GTPase-activating Rap/Ran-GAP domain protein 3

Overview
NameGTPase-activating Rap/Ran-GAP domain protein 3
Smed IDSMED30019399
Length (bp)3156
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of GTPase-activating Rap/Ran-GAP domain protein 3 (SMED30019399) t-SNE clustered cells

Violin plots show distribution of expression levels for GTPase-activating Rap/Ran-GAP domain protein 3 (SMED30019399) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of GTPase-activating Rap/Ran-GAP domain protein 3 (SMED30019399) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for GTPase-activating Rap/Ran-GAP domain protein 3 (SMED30019399) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019399

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30019399h1SMcG0013195 SmedASXL_011502SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30019399h1SMcG0013195 dd_Smed_v4_7514_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30019399h1SMcG0013195 dd_Smed_v4_7514_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30019399h1SMcG0013195 dd_Smed_v4_7514_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30019399h1SMcG0013195 dd_Smed_v4_7514_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30019399h1SMcG0013195 dd_Smed_v6_7514_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30019399h1SMcG0013195 OX_Smed_1.0.15207ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of GTPase-activating Rap/Ran-GAP domain protein 3 vs. Ensembl Human
Match: GARNL3 (GTPase activating Rap/RanGAP domain like 3 [Source:HGNC Symbol;Acc:HGNC:25425])

HSP 1 Score: 672.929 bits (1735), Expect = 0.000e+0
Identity = 358/809 (44.25%), Postives = 526/809 (65.02%), Query Frame = 1
Query:  319 LENSTSND-GCQDLGFLSLYPRGSFSRKNYGSVEMLINRHMEGYTNNAGRFRVELGSSSSQSDLRGDPFVPSKWSNMQKENPLHLENPEQETRWYFKYFLGKLHQVYMGLISERDPXXXXXXXXXXXXXXXXQYRAIFWRKIGSQKLCIPYNTNSPMNIKKMLSLFDQQKFERFPKEIFNYEVQKDVLILEEQEGSVNFKFGVIYCEKGQNSDEEMYNNVKGSEDFDKFLNLLGDKVVLLNWDRFRGGLDVKNNTTGKYSYYTIYEGHEIMFHVSTALPLSSDNRQQIERKRHXXXXXXXXXXXXXXXXEPFEKYWTPSMMKTHFTHIFAIVSYIHSRKVYRLSVYSEESVPLFGPPLPSPAEFVNFFEFREFLIVKLINGEKSAFNTPVFSEKRERTMEMLLNNILETYTSD-NINMLNRRAFSDIVLDQTNGISTTKEMNRNDAFIKFGQMLKVNIIIKGDAPTSNITTRVLKRVPWQPRIFANDLQFQIHCGDSWGEKLILGTDRGTFIVEENAAPAILIEKSCETKQIEIVENLGLMVFRCDKGRDSKIAIIQLSEL-KNID--ILPMTKADVKKLSLDKTRGCHLFGLSKPHIQPMRLVVVVNRRLQIYVWK-----CVTCCXXXXXXXXXXXXXIDASFQYIRELPTFEIPQVLTILESQRHVQ---IIIGYKNQFDLIDEKTGDTTHLFKTDIIKSAMIAALDLYSEDEPELLLCYNRTCHFQKLK--HDGHPSEQSSNYEFDFSWNFEPKNIVLVLPYILAFTQNAVEIRLVVNGSLVHTMSVPDCKLITSKIDLFFSTTA 2700
            +++S S D GC+         RG FSRK+YGSVE+LI+   +G    AGRFRVE GSS   +       +P  W    +   +HLENPE  TRWYFKYFLG++HQ Y+G  +E+ P  +S  ++D NN  V QYRAI WRK G+QK+C+PY+    +++K +LS  +  KFE+ P+EIF+ E+QKD+L+LEEQEGSVNFKFGV++ + GQ +D+EM++N  GSE F KFLNLLGD + L  W  +RGGLD KN+TTG +S YT+Y+GHEIMFHVST LP S +N+QQ+ERKRHIGNDIV I+F       P    + PSM+++HFTHIFA+V Y      YRL ++SEESVPLFGPPLP+P  F +  EFR+FL+VKLINGEK+   TP F++KR RT++ML+ ++ +    D + NMLNRR+FSD VL ++   +  KE  R   F++ GQ LK+  I++GDAP+S   + + K+ PW+P+ F ++   +  C D WG+ L++ TD G  +V+++     + +++   KQ+ ++E L L+V R DKG+D+++ + +LS L K ++      +++D ++  L+KT+GCHL+ ++  H + +R+VV +  +L +   K      VT  S LS  ++         FQYIRE+   + P V+T+++         I + Y++QFD+++E TG+   L   +  +   +AA+D+Y + E  LLLCYN +C ++K+   + G    Q S  +F F WN  P  IV   PY+LAFT +++EIRLVVNG+LVHT  VP  +L+ S+ D++F+ TA
Sbjct:    1 MKSSVSEDLGCR---------RGDFSRKHYGSVELLISSDADGAIQRAGRFRVENGSSDENATA-----LPGTW----RRTDVHLENPEYHTRWYFKYFLGQVHQNYIGNDAEKSPFFLSVTLSDQNNQRVPQYRAILWRKTGTQKICLPYSPTKTLSVKSILSAMNLDKFEKGPREIFHPEIQKDLLVLEEQEGSVNFKFGVLFAKDGQLTDDEMFSNEIGSEPFQKFLNLLGDTITLKGWTGYRGGLDTKNDTTGIHSVYTVYQGHEIMFHVSTMLPYSKENKQQVERKRHIGNDIVTIVFQEGEESSP---AFKPSMIRSHFTHIFALVRYNQQNDNYRLKIFSEESVPLFGPPLPTPPVFTDHQEFRDFLLVKLINGEKATLETPTFAQKRRRTLDMLIRSLHQDLMPDLHKNMLNRRSFSD-VLPESPKSARKKEEARQAEFVRIGQALKLKSIVRGDAPSSLAASGICKKEPWEPQCFCSNFPHEAVCADPWGQALLVSTDAGVLLVDDDLPSVPVFDRTLPVKQMHVLETLDLLVLRADKGKDARLFVFRLSALQKGLEGKQAGKSRSDCRENKLEKTKGCHLYAINTHHSRELRIVVAIRNKLLLITRKHNKPSGVTSTSLLSPLSESPVE----EFQYIREICLSDSPMVMTLVDGPAEESDNLICVAYRHQFDVVNESTGEAFRLHHVEANRVNFVAAIDVYEDGEAGLLLCYNYSCIYKKVCPFNGGSFLVQPSASDFQFCWNQAPYAIVCAFPYLLAFTTDSMEIRLVVNGNLVHTAVVPQLQLVASRSDIYFTATA 783          
BLAST of GTPase-activating Rap/Ran-GAP domain protein 3 vs. Ensembl Human
Match: GARNL3 (GTPase activating Rap/RanGAP domain like 3 [Source:HGNC Symbol;Acc:HGNC:25425])

HSP 1 Score: 671.389 bits (1731), Expect = 0.000e+0
Identity = 353/788 (44.80%), Postives = 517/788 (65.61%), Query Frame = 1
Query:  379 RGSFSRKNYGSVEMLINRHMEGYTNNAGRFRVELGSSSSQSDLRGDPFVPSKWSNMQKENPLHLENPEQETRWYFKYFLGKLHQVYMGLISERDPXXXXXXXXXXXXXXXXQYRAIFWRKIGSQKLCIPYNTNSPMNIKKMLSLFDQQKFERFPKEIFNYEVQKDVLILEEQEGSVNFKFGVIYCEKGQNSDEEMYNNVKGSEDFDKFLNLLGDKVVLLNWDRFRGGLDVKNNTTGKYSYYTIYEGHEIMFHVSTALPLSSDNRQQIERKRHXXXXXXXXXXXXXXXXEPFEKYWTPSMMKTHFTHIFAIVSYIHSRKVYRLSVYSEESVPLFGPPLPSPAEFVNFFEFREFLIVKLINGEKSAFNTPVFSEKRERTMEMLLNNILETYTSD-NINMLNRRAFSDIVLDQTNGISTTKEMNRNDAFIKFGQMLKVNIIIKGDAPTSNITTRVLKRVPWQPRIFANDLQFQIHCGDSWGEKLILGTDRGTFIVEENAAPAILIEKSCETKQIEIVENLGLMVFRCDKGRDSKIAIIQLSEL-KNID--ILPMTKADVKKLSLDKTRGCHLFGLSKPHIQPMRLVVVVNRRLQIYVWK-----CVTCCXXXXXXXXXXXXXIDASFQYIRELPTFEIPQVLTILESQRHVQ---IIIGYKNQFDLIDEKTGDTTHLFKTDIIKSAMIAALDLYSEDEPELLLCYNRTCHFQKLK--HDGHPSEQSSNYEFDFSWNFEPKNIVLVLPYILAFTQNAVEIRLVVNGSLVHTMSVPDCKLITSKIDLFFSTTA 2700
            RG FSRK+YGSVE+LI+   +G    AGRFRVE GSS   +       +P  W    +   +HLENPE  TRWYFKYFLG++HQ Y+G  +E+ P  +S  ++D NN  V QYRAI WRK G+QK+C+PY+    +++K +LS  +  KFE+ P+EIF+ E+QKD+L+LEEQEGSVNFKFGV++ + GQ +D+EM++N  GSE F KFLNLLGD + L  W  +RGGLD KN+TTG +S YT+Y+GHEIMFHVST LP S +N+QQ+ERKRHIGNDIV I+F       P    + PSM+++HFTHIFA+V Y      YRL ++SEESVPLFGPPLP+P  F +  EFR+FL+VKLINGEK+   TP F++KR RT++ML+ ++ +    D + NMLNRR+FSD VL ++   +  KE  R   F++ GQ LK+  I++GDAP+S   + + K+ PW+P+ F ++   +  C D WG+ L++ TD G  +V+++     + +++   KQ+ ++E L L+V R DKG+D+++ + +LS L K ++      +++D ++  L+KT+GCHL+ ++  H + +R+VV +  +L +   K      VT  S LS  ++         FQYIRE+   + P V+T+++         I + Y++QFD+++E TG+   L   +  +   +AA+D+Y + E  LLLCYN +C ++K+   + G    Q S  +F F WN  P  IV   PY+LAFT +++EIRLVVNG+LVHT  VP  +L+ S+ D++F+ TA
Sbjct:   35 RGDFSRKHYGSVELLISSDADGAIQRAGRFRVENGSSDENATA-----LPGTW----RRTDVHLENPEYHTRWYFKYFLGQVHQNYIGNDAEKSPFFLSVTLSDQNNQRVPQYRAILWRKTGTQKICLPYSPTKTLSVKSILSAMNLDKFEKGPREIFHPEIQKDLLVLEEQEGSVNFKFGVLFAKDGQLTDDEMFSNEIGSEPFQKFLNLLGDTITLKGWTGYRGGLDTKNDTTGIHSVYTVYQGHEIMFHVSTMLPYSKENKQQVERKRHIGNDIVTIVFQEGEESSP---AFKPSMIRSHFTHIFALVRYNQQNDNYRLKIFSEESVPLFGPPLPTPPVFTDHQEFRDFLLVKLINGEKATLETPTFAQKRRRTLDMLIRSLHQDLMPDLHKNMLNRRSFSD-VLPESPKSARKKEEARQAEFVRIGQALKLKSIVRGDAPSSLAASGICKKEPWEPQCFCSNFPHEAVCADPWGQALLVSTDAGVLLVDDDLPSVPVFDRTLPVKQMHVLETLDLLVLRADKGKDARLFVFRLSALQKGLEGKQAGKSRSDCRENKLEKTKGCHLYAINTHHSRELRIVVAIRNKLLLITRKHNKPSGVTSTSLLSPLSESPVE----EFQYIREICLSDSPMVMTLVDGPAEESDNLICVAYRHQFDVVNESTGEAFRLHHVEANRVNFVAAIDVYEDGEAGLLLCYNYSCIYKKVCPFNGGSFLVQPSASDFQFCWNQAPYAIVCAFPYLLAFTTDSMEIRLVVNGNLVHTAVVPQLQLVASRSDIYFTATA 805          
BLAST of GTPase-activating Rap/Ran-GAP domain protein 3 vs. Ensembl Human
Match: GARNL3 (GTPase activating Rap/RanGAP domain like 3 [Source:HGNC Symbol;Acc:HGNC:25425])

HSP 1 Score: 659.833 bits (1701), Expect = 0.000e+0
Identity = 349/780 (44.74%), Postives = 511/780 (65.51%), Query Frame = 1
Query:  379 RGSFSRKNYGSVEMLINRHMEGYTNNAGRFRVELGSSSSQSDLRGDPFVPSKWSNMQKENPLHLENPEQETRWYFKYFLGKLHQVYMGLISERDPXXXXXXXXXXXXXXXXQYRAIFWRKIGSQKLCIPYNTNSPMNIKKMLSLFDQQKFERFPKEIFNYEVQKDVLILEEQEGSVNFKFGVIYCEKGQNSDEEMYNNVKGSEDFDKFLNLLGDKVVLLNWDRFRGGLDVKNNTTGKYSYYTIYEGHEIMFHVSTALPLSSDNRQQIERKRHXXXXXXXXXXXXXXXXEPFEKYWTPSMMKTHFTHIFAIVSYIHSRKVYRLSVYSEESVPLFGPPLPSPAEFVNFFEFREFLIVKLINGEKSAFNTPVFSEKRERTMEMLLNNILETYTSD-NINMLNRRAFSDIVLDQTNGISTTKEMNRNDAFIKFGQMLKVNIIIKGDAPTSNITTRVLKRVPWQPRIFANDLQFQIHCGDSWGEKLILGTDRGTFIVEENAAPAILIEKSCETKQIEIVENLGLMVFRCDKGRDSKIAIIQLSEL-KNID--ILPMTKADVKKLSLDKTRGCHLFGLSKPHIQPMRLVVVVNRRLQIYVWK-----CVTCCXXXXXXXXXXXXXIDASFQYIRELPTFEIPQVLTILESQRHVQ---IIIGYKNQFDLIDEKTGDTTHLFKTDIIKSAMIAALDLYSEDEPELLLCYNRTCHFQKLK--HDGHPSEQSSNYEFDFSWNFEPKNIVLVLPYILAFTQNAVEIRLVVNGSLVHTMSVPDCKLITSKI 2676
            RG FSRK+YGSVE+LI+   +G    AGRFRVE GSS   +       +P  W    +   +HLENPE  TRWYFKYFLG++HQ Y+G  +E+ P  +S  ++D NN  V QYRAI WRK G+QK+C+PY+    +++K +LS  +  KFE+ P+EIF+ E+QKD+L+LEEQEGSVNFKFGV++ + GQ +D+EM++N  GSE F KFLNLLGD + L  W  +RGGLD KN+TTG +S YT+Y+GHEIMFHVST LP S +N+QQ+ERKRHIGNDIV I+F       P    + PSM+++HFTHIFA+V Y      YRL ++SEESVPLFGPPLP+P  F +  EFR+FL+VKLINGEK+   TP F++KR RT++ML+ ++ +    D + NMLNRR+FSD VL ++   +  KE  R   F++ GQ LK+  I++GDAP+S   + + K+ PW+P+ F ++   +  C D WG+ L++ TD G  +V+++     + +++   KQ+ ++E L L+V R DKG+D+++ + +LS L K ++      +++D ++  L+KT+GCHL+ ++  H + +R+VV +  +L +   K      VT  S LS  ++         FQYIRE+   + P V+T+++         I + Y++QFD+++E TG+   L   +  +   +AA+D+Y + E  LLLCYN +C ++K+   + G    Q S  +F F WN  P  IV   PY+LAFT +++EIRLVVNG+LVHT  VP  +L+ S++
Sbjct:   17 RGDFSRKHYGSVELLISSDADGAIQRAGRFRVENGSSDENATA-----LPGTW----RRTDVHLENPEYHTRWYFKYFLGQVHQNYIGNDAEKSPFFLSVTLSDQNNQRVPQYRAILWRKTGTQKICLPYSPTKTLSVKSILSAMNLDKFEKGPREIFHPEIQKDLLVLEEQEGSVNFKFGVLFAKDGQLTDDEMFSNEIGSEPFQKFLNLLGDTITLKGWTGYRGGLDTKNDTTGIHSVYTVYQGHEIMFHVSTMLPYSKENKQQVERKRHIGNDIVTIVFQEGEESSP---AFKPSMIRSHFTHIFALVRYNQQNDNYRLKIFSEESVPLFGPPLPTPPVFTDHQEFRDFLLVKLINGEKATLETPTFAQKRRRTLDMLIRSLHQDLMPDLHKNMLNRRSFSD-VLPESPKSARKKEEARQAEFVRIGQALKLKSIVRGDAPSSLAASGICKKEPWEPQCFCSNFPHEAVCADPWGQALLVSTDAGVLLVDDDLPSVPVFDRTLPVKQMHVLETLDLLVLRADKGKDARLFVFRLSALQKGLEGKQAGKSRSDCRENKLEKTKGCHLYAINTHHSRELRIVVAIRNKLLLITRKHNKPSGVTSTSLLSPLSESPVE----EFQYIREICLSDSPMVMTLVDGPAEESDNLICVAYRHQFDVVNESTGEAFRLHHVEANRVNFVAAIDVYEDGEAGLLLCYNYSCIYKKVCPFNGGSFLVQPSASDFQFCWNQAPYAIVCAFPYLLAFTTDSMEIRLVVNGNLVHTAVVPQLQLVASRV 779          
BLAST of GTPase-activating Rap/Ran-GAP domain protein 3 vs. Ensembl Human
Match: GARNL3 (GTPase activating Rap/RanGAP domain like 3 [Source:HGNC Symbol;Acc:HGNC:25425])

HSP 1 Score: 226.098 bits (575), Expect = 2.032e-66
Identity = 120/238 (50.42%), Postives = 162/238 (68.07%), Query Frame = 1
Query:  319 LENSTSNDGCQDLGFLSLYPRGSFSRKNYGSVEMLINRHMEGYTNNAGRFRVELGSSSSQSDLRGDPFVPSKWSNMQKENPLHLENPEQETRWYFKYFLGKLHQVYMGLISERDPXXXXXXXXXXXXXXXXQYRAIFWRKIGSQKLCIPYNTNSPMNIKKMLSLFDQQKFERFPKEIFNYEVQKDVLILEEQEGSVNFKFGVIYCEKGQNSDEEMYNNVKGSEDFDKFLNLLGDKVVL 1032
            LE+  +    +DLG      RG FSRK+YGSVE+LI+   +G    AGRFRVE GSS   +       +P  W    +   +HLENPE  TRWYFKYFLG++HQ Y+G  +E+ P  +S  ++D NN  V QYRAI WRK G+QK+C+PY+    +++K +LS  +  KFE+ P+EIF+ E+QKD+L+LEEQEGSVNFKFGV++ + GQ +D+EM++N  GSE F KFLNLLGD + L
Sbjct:   42 LESQVNLSVSEDLGCR----RGDFSRKHYGSVELLISSDADGAIQRAGRFRVENGSSDENATA-----LPGTW----RRTDVHLENPEYHTRWYFKYFLGQVHQNYIGNDAEKSPFFLSVTLSDQNNQRVPQYRAILWRKTGTQKICLPYSPTKTLSVKSILSAMNLDKFEKGPREIFHPEIQKDLLVLEEQEGSVNFKFGVLFAKDGQLTDDEMFSNEIGSEPFQKFLNLLGDTITL 266          
BLAST of GTPase-activating Rap/Ran-GAP domain protein 3 vs. Ensembl Human
Match: SIPA1 (signal-induced proliferation-associated 1 [Source:HGNC Symbol;Acc:HGNC:10885])

HSP 1 Score: 170.244 bits (430), Expect = 1.990e-42
Identity = 111/337 (32.94%), Postives = 171/337 (50.74%), Query Frame = 1
Query:  568 LENPEQETRWYFKYFLGKLHQVYMGLISERDPXXXX---XXXXXXXXXXXXQYRAIF-------WRKIGSQKLCIPYNTNSPMNIKKMLSLFDQQKFERFPK-EIFNYEVQKDVLILEEQEGSVNFKFGVIYCEKGQNSDEEMYNNVKGSEDFDKFLNLLGDKVVLLNWDRFRGGLDVKNNTTGKYSYYTIYEGHEIMFHVSTALPLSSDNRQQIERKRHXXXXXXXXXXXXXXXXEPFEKYWTPSMMKTHFTHIFAIV---SYIHSRKVYRLSVYSEESVPLFGPPLPS-PAEFVNFFEFREFLIVKLINGEKSAFNTPVFSEKRERTMEMLLNNI 1533
            LE+ +    +Y KYF GK HQ + G+     PV +S             ++ YR I         R   S+   +P      ++ +K+L     Q      +    + +V + +L L+EQ  S   K G++YC  GQ S+EEMYNN +    F +FL LLGD V L  ++ +R  LD K ++TG +S YT Y+ HEIMFHVST LP + +N+QQ+ RKRH     +    +  +  EP  K + P+ +++HF H+F +V   +       YR++V   +  P FGP LP+    F    +FR FL+ K +NGE++A +   F     RT +  L ++
Sbjct:  209 LEHADLGAGYYRKYFYGKEHQNFFGMDESLGPVAVSLRREEKEGSGGGTLHSYRVIVRTTQLRTLRGTISED-ALPPGPPRGLSPRKLLEHVAPQLSPSCLRLGSASPKVPRTLLTLDEQVLSFQRKVGILYCRAGQGSEEEMYNNQEAGPAFMQFLTLLGDVVRLKGFESYRAQLDTKTDSTGTHSLYTTYQDHEIMFHVSTMLPYTPNNQQQLLRKRH-----IGNDIVTIVFQEPGSKPFCPTTIRSHFQHVFLVVRAHTPCTPHTTYRVAVSRTQDTPAFGPALPAGGGPFAANADFRAFLLAKALNGEQAAGHARQFHAMATRTRQQYLQDL 539          
BLAST of GTPase-activating Rap/Ran-GAP domain protein 3 vs. Ensembl Celegans
Match: sipa-1 (SIPA (Vertebrate Signal-Induced Proliferation-Associated) homolog [Source:UniProtKB/TrEMBL;Acc:G5EBQ9])

HSP 1 Score: 166.392 bits (420), Expect = 1.006e-41
Identity = 84/238 (35.29%), Postives = 139/238 (58.40%), Query Frame = 1
Query:  862 VQKDVLILEEQEGSVNFKFGVIYCEKGQNSDEEMYNNVKGSEDFDKFLNLLGDKVVLLNWDRFRGGLDVKNNTTGKYSYYTIYEGHEIMFHVSTALPLSSDNRQQIERKRHXXXXXXXXXXXXXXXXEPFEKYWTPSMMKTHFTHIFAIVSYIHSR----KVYRLSVYSEESVPLFGPPLPSPAEFVNFFEFREFLIVKLINGEKSAFNTPVFSEKRERTMEMLLNNILETYTSDNIN 1563
            V++ ++ ++EQ     +K G++ C+  Q+++E+MYNN   +  FD+FL+ LG +V L  ++ ++GGLD + +TTG +S Y+ Y+ HEIMFHVST LP +  NRQQ+ RKRH     +    +  +  EP    ++P  +++HF H+F IV  +H+       Y ++V   + VP FGPP+P  A F    EF ++L+ K+IN E +   +  F+    RT    L +++E Y   + N
Sbjct:  359 VEELIMKIDEQPIYTRYKVGIMLCKNEQSTEEQMYNNEFSTPSFDEFLDFLGQRVTLKGFEAYKGGLDTRGDTTGTHSIYSEYQAHEIMFHVSTLLPFTPSNRQQLSRKRH-----IGNDMVTIVFQEPGALPFSPITVRSHFQHVFIIV-RVHNECSENVTYSVAVSRSKDVPAFGPPVPKGACFSKCAEFHDWLLTKIINAENAVHRSKKFATMAARTRREALRDLVENYVGPHQN 590          
BLAST of GTPase-activating Rap/Ran-GAP domain protein 3 vs. Ensembl Celegans
Match: sipa-1 (SIPA (Vertebrate Signal-Induced Proliferation-Associated) homolog [Source:UniProtKB/TrEMBL;Acc:G5EBQ9])

HSP 1 Score: 166.392 bits (420), Expect = 1.070e-41
Identity = 84/238 (35.29%), Postives = 139/238 (58.40%), Query Frame = 1
Query:  862 VQKDVLILEEQEGSVNFKFGVIYCEKGQNSDEEMYNNVKGSEDFDKFLNLLGDKVVLLNWDRFRGGLDVKNNTTGKYSYYTIYEGHEIMFHVSTALPLSSDNRQQIERKRHXXXXXXXXXXXXXXXXEPFEKYWTPSMMKTHFTHIFAIVSYIHSR----KVYRLSVYSEESVPLFGPPLPSPAEFVNFFEFREFLIVKLINGEKSAFNTPVFSEKRERTMEMLLNNILETYTSDNIN 1563
            V++ ++ ++EQ     +K G++ C+  Q+++E+MYNN   +  FD+FL+ LG +V L  ++ ++GGLD + +TTG +S Y+ Y+ HEIMFHVST LP +  NRQQ+ RKRH     +    +  +  EP    ++P  +++HF H+F IV  +H+       Y ++V   + VP FGPP+P  A F    EF ++L+ K+IN E +   +  F+    RT    L +++E Y   + N
Sbjct:  359 VEELIMKIDEQPIYTRYKVGIMLCKNEQSTEEQMYNNEFSTPSFDEFLDFLGQRVTLKGFEAYKGGLDTRGDTTGTHSIYSEYQAHEIMFHVSTLLPFTPSNRQQLSRKRH-----IGNDMVTIVFQEPGALPFSPITVRSHFQHVFIIV-RVHNECSENVTYSVAVSRSKDVPAFGPPVPKGACFSKCAEFHDWLLTKIINAENAVHRSKKFATMAARTRREALRDLVENYVGPHQN 590          
BLAST of GTPase-activating Rap/Ran-GAP domain protein 3 vs. Ensembl Celegans
Match: sipa-1 (SIPA (Vertebrate Signal-Induced Proliferation-Associated) homolog [Source:UniProtKB/TrEMBL;Acc:G5EBQ9])

HSP 1 Score: 166.392 bits (420), Expect = 1.236e-41
Identity = 84/238 (35.29%), Postives = 139/238 (58.40%), Query Frame = 1
Query:  862 VQKDVLILEEQEGSVNFKFGVIYCEKGQNSDEEMYNNVKGSEDFDKFLNLLGDKVVLLNWDRFRGGLDVKNNTTGKYSYYTIYEGHEIMFHVSTALPLSSDNRQQIERKRHXXXXXXXXXXXXXXXXEPFEKYWTPSMMKTHFTHIFAIVSYIHSR----KVYRLSVYSEESVPLFGPPLPSPAEFVNFFEFREFLIVKLINGEKSAFNTPVFSEKRERTMEMLLNNILETYTSDNIN 1563
            V++ ++ ++EQ     +K G++ C+  Q+++E+MYNN   +  FD+FL+ LG +V L  ++ ++GGLD + +TTG +S Y+ Y+ HEIMFHVST LP +  NRQQ+ RKRH     +    +  +  EP    ++P  +++HF H+F IV  +H+       Y ++V   + VP FGPP+P  A F    EF ++L+ K+IN E +   +  F+    RT    L +++E Y   + N
Sbjct:  359 VEELIMKIDEQPIYTRYKVGIMLCKNEQSTEEQMYNNEFSTPSFDEFLDFLGQRVTLKGFEAYKGGLDTRGDTTGTHSIYSEYQAHEIMFHVSTLLPFTPSNRQQLSRKRH-----IGNDMVTIVFQEPGALPFSPITVRSHFQHVFIIVR-VHNECSENVTYSVAVSRSKDVPAFGPPVPKGACFSKCAEFHDWLLTKIINAENAVHRSKKFATMAARTRREALRDLVENYVGPHQN 590          
BLAST of GTPase-activating Rap/Ran-GAP domain protein 3 vs. Ensembl Celegans
Match: sipa-1 (SIPA (Vertebrate Signal-Induced Proliferation-Associated) homolog [Source:UniProtKB/TrEMBL;Acc:G5EBQ9])

HSP 1 Score: 166.392 bits (420), Expect = 1.248e-41
Identity = 84/238 (35.29%), Postives = 139/238 (58.40%), Query Frame = 1
Query:  862 VQKDVLILEEQEGSVNFKFGVIYCEKGQNSDEEMYNNVKGSEDFDKFLNLLGDKVVLLNWDRFRGGLDVKNNTTGKYSYYTIYEGHEIMFHVSTALPLSSDNRQQIERKRHXXXXXXXXXXXXXXXXEPFEKYWTPSMMKTHFTHIFAIVSYIHSR----KVYRLSVYSEESVPLFGPPLPSPAEFVNFFEFREFLIVKLINGEKSAFNTPVFSEKRERTMEMLLNNILETYTSDNIN 1563
            V++ ++ ++EQ     +K G++ C+  Q+++E+MYNN   +  FD+FL+ LG +V L  ++ ++GGLD + +TTG +S Y+ Y+ HEIMFHVST LP +  NRQQ+ RKRH     +    +  +  EP    ++P  +++HF H+F IV  +H+       Y ++V   + VP FGPP+P  A F    EF ++L+ K+IN E +   +  F+    RT    L +++E Y   + N
Sbjct:  359 VEELIMKIDEQPIYTRYKVGIMLCKNEQSTEEQMYNNEFSTPSFDEFLDFLGQRVTLKGFEAYKGGLDTRGDTTGTHSIYSEYQAHEIMFHVSTLLPFTPSNRQQLSRKRH-----IGNDMVTIVFQEPGALPFSPITVRSHFQHVFIIVR-VHNECSENVTYSVAVSRSKDVPAFGPPVPKGACFSKCAEFHDWLLTKIINAENAVHRSKKFATMAARTRREALRDLVENYVGPHQN 590          
BLAST of GTPase-activating Rap/Ran-GAP domain protein 3 vs. Ensembl Celegans
Match: sipa-1 (SIPA (Vertebrate Signal-Induced Proliferation-Associated) homolog [Source:UniProtKB/TrEMBL;Acc:G5EBQ9])

HSP 1 Score: 166.392 bits (420), Expect = 1.251e-41
Identity = 84/238 (35.29%), Postives = 139/238 (58.40%), Query Frame = 1
Query:  862 VQKDVLILEEQEGSVNFKFGVIYCEKGQNSDEEMYNNVKGSEDFDKFLNLLGDKVVLLNWDRFRGGLDVKNNTTGKYSYYTIYEGHEIMFHVSTALPLSSDNRQQIERKRHXXXXXXXXXXXXXXXXEPFEKYWTPSMMKTHFTHIFAIVSYIHSR----KVYRLSVYSEESVPLFGPPLPSPAEFVNFFEFREFLIVKLINGEKSAFNTPVFSEKRERTMEMLLNNILETYTSDNIN 1563
            V++ ++ ++EQ     +K G++ C+  Q+++E+MYNN   +  FD+FL+ LG +V L  ++ ++GGLD + +TTG +S Y+ Y+ HEIMFHVST LP +  NRQQ+ RKRH     +    +  +  EP    ++P  +++HF H+F IV  +H+       Y ++V   + VP FGPP+P  A F    EF ++L+ K+IN E +   +  F+    RT    L +++E Y   + N
Sbjct:  359 VEELIMKIDEQPIYTRYKVGIMLCKNEQSTEEQMYNNEFSTPSFDEFLDFLGQRVTLKGFEAYKGGLDTRGDTTGTHSIYSEYQAHEIMFHVSTLLPFTPSNRQQLSRKRH-----IGNDMVTIVFQEPGALPFSPITVRSHFQHVFIIVR-VHNECSENVTYSVAVSRSKDVPAFGPPVPKGACFSKCAEFHDWLLTKIINAENAVHRSKKFATMAARTRREALRDLVENYVGPHQN 590          
BLAST of GTPase-activating Rap/Ran-GAP domain protein 3 vs. Ensembl Fly
Match: RapGAP1 (gene:FBgn0264895 transcript:FBtr0334847)

HSP 1 Score: 169.088 bits (427), Expect = 1.108e-42
Identity = 128/391 (32.74%), Postives = 203/391 (51.92%), Query Frame = 1
Query:  502 DLRGDPFVP-SKWSNMQKENPLHLENPEQETRWYFKYFLGKLHQVYMGLISERDPXXXXXXXXXXXXXXXXQYRAIFWRKIGSQKLCIPYNT--NSPMNIKKMLSLFDQQKFERFPKEIFNYEVQKDVLILEEQEGSVNFKFGVIYCEKGQNSDEEMYNNVKGSEDFDKFLNLLGDKVVLLNWDRFRGGLDVKNNTTGKYSYYTIYEGHEIMFHVSTALPLSSDNRQQIERKRHXXXXXXXXXXXXXXXXEPFEKYWTPSMMKTHFTHIFAIVSYI-----HSRKVYRLSVYSEESVPLFGPPLPSPAEFVNFFEFREFLIVKLINGEKSAFNTPVFSEKRERTMEMLLNNILETYTSDNINMLNRRAFSDIVLDQTNGISTTKEMNRNDA 1650
            D RG+P +P + W  M K      E  +   + Y +++  + H   +GL  +  P+++S    +V N      R +   + G+    +P +     P   K   +L +    E F   I   +  + + + +E     +FKFGV+Y   GQ ++EE++ N + S  FD+FL++LG ++ L +   +RGGLD++N  TG  + Y +++  EIMFHVST LP +  + QQ++RKRHIGNDIV I+F       PF    +P M+ +HF H F +V  I     H+R  Y++SV + + VP FGP LP+PA F    EF+EF++ KLIN E + +    F++  +RT   LL N+ E            R F    L QT+  S T E  + ++
Sbjct:  205 DARGNPLLPQTTW--MAK-----FET-DDTAKCYRRFYAAREHSNLIGLDEQLGPILLSIKTENVANQE--HMRILMRLRTGTMHELLPVSCLLPQPSPAKMAHTLNENITVEHF-MPILCPKASQLISVYDEHVLVSHFKFGVLYQRYGQTTEEELFGNQQTSPAFDEFLDVLGQRIRLKDHKGYRGGLDIQNGHTGDTAVYEVFKEREIMFHVSTLLPHTEGDPQQLQRKRHIGNDIVAIVFQETNT--PF----SPDMIASHFLHAFIVVQPIEPNTPHTR--YKVSVTARDDVPFFGPTLPNPAVFRKGQEFKEFILTKLINAENACYKAEKFAKLEQRTRTSLLQNLCEELREKT------RDFLGTDLSQTSAGSPTPETPKAES 570          
BLAST of GTPase-activating Rap/Ran-GAP domain protein 3 vs. Ensembl Fly
Match: RapGAP1 (gene:FBgn0264895 transcript:FBtr0334848)

HSP 1 Score: 169.088 bits (427), Expect = 1.554e-42
Identity = 128/391 (32.74%), Postives = 203/391 (51.92%), Query Frame = 1
Query:  502 DLRGDPFVP-SKWSNMQKENPLHLENPEQETRWYFKYFLGKLHQVYMGLISERDPXXXXXXXXXXXXXXXXQYRAIFWRKIGSQKLCIPYNT--NSPMNIKKMLSLFDQQKFERFPKEIFNYEVQKDVLILEEQEGSVNFKFGVIYCEKGQNSDEEMYNNVKGSEDFDKFLNLLGDKVVLLNWDRFRGGLDVKNNTTGKYSYYTIYEGHEIMFHVSTALPLSSDNRQQIERKRHXXXXXXXXXXXXXXXXEPFEKYWTPSMMKTHFTHIFAIVSYI-----HSRKVYRLSVYSEESVPLFGPPLPSPAEFVNFFEFREFLIVKLINGEKSAFNTPVFSEKRERTMEMLLNNILETYTSDNINMLNRRAFSDIVLDQTNGISTTKEMNRNDA 1650
            D RG+P +P + W  M K      E  +   + Y +++  + H   +GL  +  P+++S    +V N      R +   + G+    +P +     P   K   +L +    E F   I   +  + + + +E     +FKFGV+Y   GQ ++EE++ N + S  FD+FL++LG ++ L +   +RGGLD++N  TG  + Y +++  EIMFHVST LP +  + QQ++RKRHIGNDIV I+F       PF    +P M+ +HF H F +V  I     H+R  Y++SV + + VP FGP LP+PA F    EF+EF++ KLIN E + +    F++  +RT   LL N+ E            R F    L QT+  S T E  + ++
Sbjct:  231 DARGNPLLPQTTW--MAK-----FET-DDTAKCYRRFYAAREHSNLIGLDEQLGPILLSIKTENVANQE--HMRILMRLRTGTMHELLPVSCLLPQPSPAKMAHTLNENITVEHF-MPILCPKASQLISVYDEHVLVSHFKFGVLYQRYGQTTEEELFGNQQTSPAFDEFLDVLGQRIRLKDHKGYRGGLDIQNGHTGDTAVYEVFKEREIMFHVSTLLPHTEGDPQQLQRKRHIGNDIVAIVFQETNT--PF----SPDMIASHFLHAFIVVQPIEPNTPHTR--YKVSVTARDDVPFFGPTLPNPAVFRKGQEFKEFILTKLINAENACYKAEKFAKLEQRTRTSLLQNLCEELREKT------RDFLGTDLSQTSAGSPTPETPKAES 596          
BLAST of GTPase-activating Rap/Ran-GAP domain protein 3 vs. Ensembl Fly
Match: RapGAP1 (gene:FBgn0264895 transcript:FBtr0334850)

HSP 1 Score: 169.088 bits (427), Expect = 1.712e-42
Identity = 128/391 (32.74%), Postives = 203/391 (51.92%), Query Frame = 1
Query:  502 DLRGDPFVP-SKWSNMQKENPLHLENPEQETRWYFKYFLGKLHQVYMGLISERDPXXXXXXXXXXXXXXXXQYRAIFWRKIGSQKLCIPYNT--NSPMNIKKMLSLFDQQKFERFPKEIFNYEVQKDVLILEEQEGSVNFKFGVIYCEKGQNSDEEMYNNVKGSEDFDKFLNLLGDKVVLLNWDRFRGGLDVKNNTTGKYSYYTIYEGHEIMFHVSTALPLSSDNRQQIERKRHXXXXXXXXXXXXXXXXEPFEKYWTPSMMKTHFTHIFAIVSYI-----HSRKVYRLSVYSEESVPLFGPPLPSPAEFVNFFEFREFLIVKLINGEKSAFNTPVFSEKRERTMEMLLNNILETYTSDNINMLNRRAFSDIVLDQTNGISTTKEMNRNDA 1650
            D RG+P +P + W  M K      E  +   + Y +++  + H   +GL  +  P+++S    +V N      R +   + G+    +P +     P   K   +L +    E F   I   +  + + + +E     +FKFGV+Y   GQ ++EE++ N + S  FD+FL++LG ++ L +   +RGGLD++N  TG  + Y +++  EIMFHVST LP +  + QQ++RKRHIGNDIV I+F       PF    +P M+ +HF H F +V  I     H+R  Y++SV + + VP FGP LP+PA F    EF+EF++ KLIN E + +    F++  +RT   LL N+ E            R F    L QT+  S T E  + ++
Sbjct:  288 DARGNPLLPQTTW--MAK-----FET-DDTAKCYRRFYAAREHSNLIGLDEQLGPILLSIKTENVANQE--HMRILMRLRTGTMHELLPVSCLLPQPSPAKMAHTLNENITVEHF-MPILCPKASQLISVYDEHVLVSHFKFGVLYQRYGQTTEEELFGNQQTSPAFDEFLDVLGQRIRLKDHKGYRGGLDIQNGHTGDTAVYEVFKEREIMFHVSTLLPHTEGDPQQLQRKRHIGNDIVAIVFQETNT--PF----SPDMIASHFLHAFIVVQPIEPNTPHTR--YKVSVTARDDVPFFGPTLPNPAVFRKGQEFKEFILTKLINAENACYKAEKFAKLEQRTRTSLLQNLCEELREKT------RDFLGTDLSQTSAGSPTPETPKAES 653          
BLAST of GTPase-activating Rap/Ran-GAP domain protein 3 vs. Ensembl Fly
Match: RapGAP1 (gene:FBgn0264895 transcript:FBtr0334846)

HSP 1 Score: 169.088 bits (427), Expect = 1.712e-42
Identity = 128/391 (32.74%), Postives = 203/391 (51.92%), Query Frame = 1
Query:  502 DLRGDPFVP-SKWSNMQKENPLHLENPEQETRWYFKYFLGKLHQVYMGLISERDPXXXXXXXXXXXXXXXXQYRAIFWRKIGSQKLCIPYNT--NSPMNIKKMLSLFDQQKFERFPKEIFNYEVQKDVLILEEQEGSVNFKFGVIYCEKGQNSDEEMYNNVKGSEDFDKFLNLLGDKVVLLNWDRFRGGLDVKNNTTGKYSYYTIYEGHEIMFHVSTALPLSSDNRQQIERKRHXXXXXXXXXXXXXXXXEPFEKYWTPSMMKTHFTHIFAIVSYI-----HSRKVYRLSVYSEESVPLFGPPLPSPAEFVNFFEFREFLIVKLINGEKSAFNTPVFSEKRERTMEMLLNNILETYTSDNINMLNRRAFSDIVLDQTNGISTTKEMNRNDA 1650
            D RG+P +P + W  M K      E  +   + Y +++  + H   +GL  +  P+++S    +V N      R +   + G+    +P +     P   K   +L +    E F   I   +  + + + +E     +FKFGV+Y   GQ ++EE++ N + S  FD+FL++LG ++ L +   +RGGLD++N  TG  + Y +++  EIMFHVST LP +  + QQ++RKRHIGNDIV I+F       PF    +P M+ +HF H F +V  I     H+R  Y++SV + + VP FGP LP+PA F    EF+EF++ KLIN E + +    F++  +RT   LL N+ E            R F    L QT+  S T E  + ++
Sbjct:  288 DARGNPLLPQTTW--MAK-----FET-DDTAKCYRRFYAAREHSNLIGLDEQLGPILLSIKTENVANQE--HMRILMRLRTGTMHELLPVSCLLPQPSPAKMAHTLNENITVEHF-MPILCPKASQLISVYDEHVLVSHFKFGVLYQRYGQTTEEELFGNQQTSPAFDEFLDVLGQRIRLKDHKGYRGGLDIQNGHTGDTAVYEVFKEREIMFHVSTLLPHTEGDPQQLQRKRHIGNDIVAIVFQETNT--PF----SPDMIASHFLHAFIVVQPIEPNTPHTR--YKVSVTARDDVPFFGPTLPNPAVFRKGQEFKEFILTKLINAENACYKAEKFAKLEQRTRTSLLQNLCEELREKT------RDFLGTDLSQTSAGSPTPETPKAES 653          
BLAST of GTPase-activating Rap/Ran-GAP domain protein 3 vs. Ensembl Fly
Match: RapGAP1 (gene:FBgn0264895 transcript:FBtr0334849)

HSP 1 Score: 169.088 bits (427), Expect = 2.108e-42
Identity = 128/391 (32.74%), Postives = 203/391 (51.92%), Query Frame = 1
Query:  502 DLRGDPFVP-SKWSNMQKENPLHLENPEQETRWYFKYFLGKLHQVYMGLISERDPXXXXXXXXXXXXXXXXQYRAIFWRKIGSQKLCIPYNT--NSPMNIKKMLSLFDQQKFERFPKEIFNYEVQKDVLILEEQEGSVNFKFGVIYCEKGQNSDEEMYNNVKGSEDFDKFLNLLGDKVVLLNWDRFRGGLDVKNNTTGKYSYYTIYEGHEIMFHVSTALPLSSDNRQQIERKRHXXXXXXXXXXXXXXXXEPFEKYWTPSMMKTHFTHIFAIVSYI-----HSRKVYRLSVYSEESVPLFGPPLPSPAEFVNFFEFREFLIVKLINGEKSAFNTPVFSEKRERTMEMLLNNILETYTSDNINMLNRRAFSDIVLDQTNGISTTKEMNRNDA 1650
            D RG+P +P + W  M K      E  +   + Y +++  + H   +GL  +  P+++S    +V N      R +   + G+    +P +     P   K   +L +    E F   I   +  + + + +E     +FKFGV+Y   GQ ++EE++ N + S  FD+FL++LG ++ L +   +RGGLD++N  TG  + Y +++  EIMFHVST LP +  + QQ++RKRHIGNDIV I+F       PF    +P M+ +HF H F +V  I     H+R  Y++SV + + VP FGP LP+PA F    EF+EF++ KLIN E + +    F++  +RT   LL N+ E            R F    L QT+  S T E  + ++
Sbjct:  314 DARGNPLLPQTTW--MAK-----FET-DDTAKCYRRFYAAREHSNLIGLDEQLGPILLSIKTENVANQE--HMRILMRLRTGTMHELLPVSCLLPQPSPAKMAHTLNENITVEHF-MPILCPKASQLISVYDEHVLVSHFKFGVLYQRYGQTTEEELFGNQQTSPAFDEFLDVLGQRIRLKDHKGYRGGLDIQNGHTGDTAVYEVFKEREIMFHVSTLLPHTEGDPQQLQRKRHIGNDIVAIVFQETNT--PF----SPDMIASHFLHAFIVVQPIEPNTPHTR--YKVSVTARDDVPFFGPTLPNPAVFRKGQEFKEFILTKLINAENACYKAEKFAKLEQRTRTSLLQNLCEELREKT------RDFLGTDLSQTSAGSPTPETPKAES 679          
BLAST of GTPase-activating Rap/Ran-GAP domain protein 3 vs. Ensembl Zebrafish
Match: GARNL3 (si:ch211-182d3.1 [Source:NCBI gene;Acc:560594])

HSP 1 Score: 677.167 bits (1746), Expect = 0.000e+0
Identity = 381/873 (43.64%), Postives = 553/873 (63.34%), Query Frame = 1
Query:  334 SNDGCQDLGFLSLYPRGSFSRKNYGSVEMLINRHMEGYTNNAGRFRVELGSSSSQSDLRGDPFVPSKWSNMQKENPLHLENPEQETRWYFKYFLGKLHQVYMGLISERDPXXXXXXXXXXXXXXXXQYRAIFWRKIGSQKLCIPYNTNSPMNIKKMLSLFDQQKFERFPKEIFNYEVQKDVLILEEQEGSVNFKFGVIYCEKGQNSDEEMYNNVKGSEDFDKFLNLLGDKVVLLNWDRFRGGLDVKNNTTGKYSYYTIYEGHEIMFHVSTALPLSSDNRQQIERKRHXXXXXXXXXXXXXXXXEPFEKYWTPSMMKTHFTHIFAIVSYIHSRKVYRLSVYSEESVPLFGPPLPSPAEFVNFFEFREFLIVKLINGEKSAFNTPVFSEKRERTMEMLLNNILETYTSD-NINMLNRRAFSDIVLDQTNGISTTKEMNRNDAFIKFGQMLKVNIIIKGDAPTSNITTRVLKRVPWQPRIFANDLQFQIHCGDSWGEKLILGTDRGTFIVEENA---APAILIEKSCETKQIEIVENLGLMVFRCDKGRDSKIAIIQLSELK-NID--ILPMTKADVKKLSLDKTRGCHLFGLSKPHIQPMRLVVVVNRRLQIYVWKC--VTCCXXXXXXXXXXXXXIDASFQYIRELPTFEIPQVLTILE---SQRHVQIIIGYKNQFDLIDEKTGDTTHLFKTDIIKSAMIAALDLYSEDEPELLLCYNRTCHFQKLK--HDGHPSEQSSNYEFDFSWNFEPKNIVLVLPYILAFTQNAVEIRLVVNGSLVHTMSVPDCKLITSKIDLFFSTTADNLCKELIEKQKSGTSSFDRLYRVSNPLSSIEYQELSQSPTMKRSMIFQRLHIYKISLSSMSGCSYQVPL 2910
            ++   +DLG      RG FSRK+YGSVE+LI+   +G    AGRFRVE GS    SD     + P  W    +   +HLENPE  TRWYFKYFLGK+HQ Y+G  +E++P  +S V++D NN  V QYRAI WRK G+ K+ +PY+    +++K +LS  +  +FE+ P+EI N E+QKD+L+LEEQEGSVNFKFGV+Y + GQ +D+EM++N  GSE F+KFLNLLGD + L  W  +RGGLD KN+TTG  S YT+Y+GHE+MFHVST LP S +N+QQ+ERKRHIGNDIV I+F       P    + PSM+++HFTHIFA+V Y      YRL ++SEESVPLFGPPLPSP  F +  EFR+FL+VKLINGEK+   TP F++KR+RT++ML+ ++ +    D + NMLNRR+FSD VL ++   +  KE  R   F++ GQ LK+  I++GDAPTS +TT + ++ PW+ + F +   + I CGDSWG+ L++ TD    ++ E++    P  + +K+   KQ+ ++E   L++ R DKG+D+++ + +LS LK  I+   L  TK D ++  L+KT+GCHL+ ++  H   +R+V  +  +L +   K   + C SS+++    ++S ++  FQYIRE+   + P V+ +++    +    I + Y++QFDLI+E TGD   L   D  +   +AA+D+Y + E  LLLCYN  C ++K+   +   P  Q +  +F FSWN  P   V   PYILAFT +++EIRLVVNG+LV+T  VP+ +L  S+ D++F ++A            +   S       S+P +   Y E+   P+       Q  HIYKI LS++ G S + PL
Sbjct:   33 TSSASEDLGCR----RGEFSRKHYGSVELLISSDADGAIQRAGRFRVENGSIDEISD-----YTPGTW----RRTDVHLENPEYHTRWYFKYFLGKVHQNYVGTDAEKNPFFLSVVLSDQNNQRVPQYRAILWRKTGTLKISLPYSPTKTLSVKSILSAMNVDRFEKGPREILNPEIQKDLLVLEEQEGSVNFKFGVLYAKDGQLTDDEMFSNEMGSETFEKFLNLLGDTICLQGWAGYRGGLDTKNDTTGINSIYTVYQGHELMFHVSTMLPYSKENKQQVERKRHIGNDIVTIVFQEGDDASP---SFKPSMIRSHFTHIFALVRYNSQNDSYRLKIFSEESVPLFGPPLPSPPVFTDHQEFRDFLLVKLINGEKATLETPTFAQKRQRTLDMLIRSLYQDLMPDMHKNMLNRRSFSD-VLPESPKSARKKEEARQAEFVRVGQALKLKTIVRGDAPTSLVTTGLCRKEPWESQSFCSSFPYDIVCGDSWGQSLLVATDSAGVMLLEDSPTLPPVQVFDKTLTVKQMHVLEPQDLLIARADKGKDARLYVYRLSTLKQGIEERQLVRTKCDSRENKLEKTKGCHLYSINTHHGVELRIVAAIRNKLLLITRKQSRLECVSSIATVTGSTDSPVE-EFQYIREICLCDSPVVMALVDGPTGENDHMICVAYRHQFDLINESTGDAYRLHHVDSNRVNFVAAIDVYEDGEAGLLLCYNNICVYKKVCPFNGATPMIQPNTSDFHFSWNQMPNATVCAFPYILAFTTDSIEIRLVVNGNLVYTAVVPELQLTASRSDIYFISSA--------PINSASNCSSRDTSSQSSPQTPTGY-EMPVFPSPLGDGETQSKHIYKIPLSNLVGRSIERPL 878          
BLAST of GTPase-activating Rap/Ran-GAP domain protein 3 vs. Ensembl Zebrafish
Match: si:ch211-182d3.1 (si:ch211-182d3.1 [Source:NCBI gene;Acc:560594])

HSP 1 Score: 676.781 bits (1745), Expect = 0.000e+0
Identity = 389/909 (42.79%), Postives = 564/909 (62.05%), Query Frame = 1
Query:  250 KKTINNSKPSNYLIPPAQLS--------VRSLENSTSNDGCQDLGFLSLYPRGSFSRKNYGSVEMLINRHMEGYTNNAGRFRVELGSSSSQSDLRGDPFVPSKWSNMQKENPLHLENPEQETRWYFKYFLGKLHQVYMGLISERDPXXXXXXXXXXXXXXXXQYRAIFWRKIGSQKLCIPYNTNSPMNIKKMLSLFDQQKFERFPKEIFNYEVQKDVLILEEQEGSVNFKFGVIYCEKGQNSDEEMYNNVKGSEDFDKFLNLLGDKVVLLNWDRFRGGLDVKNNTTGKYSYYTIYEGHEIMFHVSTALPLSSDNRQQIERKRHXXXXXXXXXXXXXXXXEPFEKYWTPSMMKTHFTHIFAIVSYIHSRKVYRLSVYSEESVPLFGPPLPSPAEFVNFFEFREFLIVKLINGEKSAFNTPVFSEKRERTMEMLLNNILETYTSD-NINMLNRRAFSDIVLDQTNGISTTKEMNRNDAFIKFGQMLKVNIIIKGDAPTSNITTRVLKRVPWQPRIFANDLQFQIHCGDSWGEKLILGTDRGTFIVEENA---APAILIEKSCETKQIEIVENLGLMVFRCDKGRDSKIAIIQLSELK-NID--ILPMTKADVKKLSLDKTRGCHLFGLSKPHIQPMRLVVVVNRRLQIYVWKC--VTCCXXXXXXXXXXXXXIDASFQYIRELPTFEIPQVLTILE---SQRHVQIIIGYKNQFDLIDEKTGDTTHLFKTDIIKSAMIAALDLYSEDEPELLLCYNRTCHFQKLK--HDGHPSEQSSNYEFDFSWNFEPKNIVLVLPYILAFTQNAVEIRLVVNGSLVHTMSVPDCKLITSKIDLFFSTTADNLCKELIEKQKSGTSSFDRLYRVSNPLSSIEYQELSQSPTMKRSMIFQRLHIYKISLSSMSGCSYQVPL 2910
            +KT  ++ P  Y IP A           + +     S    +DLG      RG FSRK+YGSVE+LI+   +G    AGRFRVE GS    SD     + P  W    +   +HLENPE  TRWYFKYFLGK+HQ Y+G  +E++P  +S V++D NN  V QYRAI WRK G+ K+ +PY+    +++K +LS  +  +FE+ P+EI N E+QKD+L+LEEQEGSVNFKFGV+Y + GQ +D+EM++N  GSE F+KFLNLLGD + L  W  +RGGLD KN+TTG  S YT+Y+GHE+MFHVST LP S +N+QQ+ERKRHIGNDIV I+F       P    + PSM+++HFTHIFA+V Y      YRL ++SEESVPLFGPPLPSP  F +  EFR+FL+VKLINGEK+   TP F++KR+RT++ML+ ++ +    D + NMLNRR+FSD VL ++   +  KE  R   F++ GQ LK+  I++GDAPTS +TT + ++ PW+ + F +   + I CGDSWG+ L++ TD    ++ E++    P  + +K+   KQ+ ++E   L++ R DKG+D+++ + +LS LK  I+   L  TK D ++  L+KT+GCHL+ ++  H   +R+V  +  +L +   K   + C SS+++    ++S ++  FQYIRE+   + P V+ +++    +    I + Y++QFDLI+E TGD   L   D  +   +AA+D+Y + E  LLLCYN  C ++K+   +   P  Q +  +F FSWN  P   V   PYILAFT +++EIRLVVNG+LV+T  VP+ +L  S+ D++F ++A            +   S       S+P +   Y E+   P+       Q  HIYKI LS++ G S + PL
Sbjct:   18 EKTKGSNSPRAYSIPCAAKGCGQWLCNVIAAKAKMPSKCSSEDLGCR----RGEFSRKHYGSVELLISSDADGAIQRAGRFRVENGSIDEISD-----YTPGTW----RRTDVHLENPEYHTRWYFKYFLGKVHQNYVGTDAEKNPFFLSVVLSDQNNQRVPQYRAILWRKTGTLKISLPYSPTKTLSVKSILSAMNVDRFEKGPREILNPEIQKDLLVLEEQEGSVNFKFGVLYAKDGQLTDDEMFSNEMGSETFEKFLNLLGDTICLQGWAGYRGGLDTKNDTTGINSIYTVYQGHELMFHVSTMLPYSKENKQQVERKRHIGNDIVTIVFQEGDDASP---SFKPSMIRSHFTHIFALVRYNSQNDSYRLKIFSEESVPLFGPPLPSPPVFTDHQEFRDFLLVKLINGEKATLETPTFAQKRQRTLDMLIRSLYQDLMPDMHKNMLNRRSFSD-VLPESPKSARKKEEARQAEFVRVGQALKLKTIVRGDAPTSLVTTGLCRKEPWESQSFCSSFPYDIVCGDSWGQSLLVATDSAGVMLLEDSPTLPPVQVFDKTLTVKQMHVLEPQDLLIARADKGKDARLYVYRLSTLKQGIEERQLVRTKCDSRENKLEKTKGCHLYSINTHHGVELRIVAAIRNKLLLITRKQSRLECVSSIATVTGSTDSPVE-EFQYIREICLCDSPVVMALVDGPTGENDHMICVAYRHQFDLINESTGDAYRLHHVDSNRVNFVAAIDVYEDGEAGLLLCYNNICVYKKVCPFNGATPMIQPNTSDFHFSWNQMPNATVCAFPYILAFTTDSIEIRLVVNGNLVYTAVVPELQLTASRSDIYFISSA--------PINSASNCSSRDTSSQSSPQTPTGY-EMPVFPSPLGDGETQSKHIYKIPLSNLVGRSIERPL 899          
BLAST of GTPase-activating Rap/Ran-GAP domain protein 3 vs. Ensembl Zebrafish
Match: si:ch211-182d3.1 (si:ch211-182d3.1 [Source:NCBI gene;Acc:560594])

HSP 1 Score: 676.011 bits (1743), Expect = 0.000e+0
Identity = 378/858 (44.06%), Postives = 547/858 (63.75%), Query Frame = 1
Query:  379 RGSFSRKNYGSVEMLINRHMEGYTNNAGRFRVELGSSSSQSDLRGDPFVPSKWSNMQKENPLHLENPEQETRWYFKYFLGKLHQVYMGLISERDPXXXXXXXXXXXXXXXXQYRAIFWRKIGSQKLCIPYNTNSPMNIKKMLSLFDQQKFERFPKEIFNYEVQKDVLILEEQEGSVNFKFGVIYCEKGQNSDEEMYNNVKGSEDFDKFLNLLGDKVVLLNWDRFRGGLDVKNNTTGKYSYYTIYEGHEIMFHVSTALPLSSDNRQQIERKRHXXXXXXXXXXXXXXXXEPFEKYWTPSMMKTHFTHIFAIVSYIHSRKVYRLSVYSEESVPLFGPPLPSPAEFVNFFEFREFLIVKLINGEKSAFNTPVFSEKRERTMEMLLNNILETYTSD-NINMLNRRAFSDIVLDQTNGISTTKEMNRNDAFIKFGQMLKVNIIIKGDAPTSNITTRVLKRVPWQPRIFANDLQFQIHCGDSWGEKLILGTDRGTFIVEENA---APAILIEKSCETKQIEIVENLGLMVFRCDKGRDSKIAIIQLSELK-NID--ILPMTKADVKKLSLDKTRGCHLFGLSKPHIQPMRLVVVVNRRLQIYVWKC--VTCCXXXXXXXXXXXXXIDASFQYIRELPTFEIPQVLTILE---SQRHVQIIIGYKNQFDLIDEKTGDTTHLFKTDIIKSAMIAALDLYSEDEPELLLCYNRTCHFQKLK--HDGHPSEQSSNYEFDFSWNFEPKNIVLVLPYILAFTQNAVEIRLVVNGSLVHTMSVPDCKLITSKIDLFFSTTADNLCKELIEKQKSGTSSFDRLYRVSNPLSSIEYQELSQSPTMKRSMIFQRLHIYKISLSSMSGCSYQVPL 2910
            RG FSRK+YGSVE+LI+   +G    AGRFRVE GS    SD     + P  W    +   +HLENPE  TRWYFKYFLGK+HQ Y+G  +E++P  +S V++D NN  V QYRAI WRK G+ K+ +PY+    +++K +LS  +  +FE+ P+EI N E+QKD+L+LEEQEGSVNFKFGV+Y + GQ +D+EM++N  GSE F+KFLNLLGD + L  W  +RGGLD KN+TTG  S YT+Y+GHE+MFHVST LP S +N+QQ+ERKRHIGNDIV I+F       P    + PSM+++HFTHIFA+V Y      YRL ++SEESVPLFGPPLPSP  F +  EFR+FL+VKLINGEK+   TP F++KR+RT++ML+ ++ +    D + NMLNRR+FSD VL ++   +  KE  R   F++ GQ LK+  I++GDAPTS +TT + ++ PW+ + F +   + I CGDSWG+ L++ TD    ++ E++    P  + +K+   KQ+ ++E   L++ R DKG+D+++ + +LS LK  I+   L  TK D ++  L+KT+GCHL+ ++  H   +R+V  +  +L +   K   + C SS+++    ++S ++  FQYIRE+   + P V+ +++    +    I + Y++QFDLI+E TGD   L   D  +   +AA+D+Y + E  LLLCYN  C ++K+   +   P  Q +  +F FSWN  P   V   PYILAFT +++EIRLVVNG+LV+T  VP+ +L  S+ D++F ++A            +   S       S+P +   Y E+   P+       Q  HIYKI LS++ G S + PL
Sbjct:   27 RGEFSRKHYGSVELLISSDADGAIQRAGRFRVENGSIDEISD-----YTPGTW----RRTDVHLENPEYHTRWYFKYFLGKVHQNYVGTDAEKNPFFLSVVLSDQNNQRVPQYRAILWRKTGTLKISLPYSPTKTLSVKSILSAMNVDRFEKGPREILNPEIQKDLLVLEEQEGSVNFKFGVLYAKDGQLTDDEMFSNEMGSETFEKFLNLLGDTICLQGWAGYRGGLDTKNDTTGINSIYTVYQGHELMFHVSTMLPYSKENKQQVERKRHIGNDIVTIVFQEGDDASP---SFKPSMIRSHFTHIFALVRYNSQNDSYRLKIFSEESVPLFGPPLPSPPVFTDHQEFRDFLLVKLINGEKATLETPTFAQKRQRTLDMLIRSLYQDLMPDMHKNMLNRRSFSD-VLPESPKSARKKEEARQAEFVRVGQALKLKTIVRGDAPTSLVTTGLCRKEPWESQSFCSSFPYDIVCGDSWGQSLLVATDSAGVMLLEDSPTLPPVQVFDKTLTVKQMHVLEPQDLLIARADKGKDARLYVYRLSTLKQGIEERQLVRTKCDSRENKLEKTKGCHLYSINTHHGVELRIVAAIRNKLLLITRKQSRLECVSSIATVTGSTDSPVE-EFQYIREICLCDSPVVMALVDGPTGENDHMICVAYRHQFDLINESTGDAYRLHHVDSNRVNFVAAIDVYEDGEAGLLLCYNNICVYKKVCPFNGATPMIQPNTSDFHFSWNQMPNATVCAFPYILAFTTDSIEIRLVVNGNLVYTAVVPELQLTASRSDIYFISSA--------PINSASNCSSRDTSSQSSPQTPTGY-EMPVFPSPLGDGETQSKHIYKIPLSNLVGRSIERPL 861          
BLAST of GTPase-activating Rap/Ran-GAP domain protein 3 vs. Ensembl Zebrafish
Match: si:ch211-182d3.1 (si:ch211-182d3.1 [Source:NCBI gene;Acc:560594])

HSP 1 Score: 675.626 bits (1742), Expect = 0.000e+0
Identity = 378/858 (44.06%), Postives = 547/858 (63.75%), Query Frame = 1
Query:  379 RGSFSRKNYGSVEMLINRHMEGYTNNAGRFRVELGSSSSQSDLRGDPFVPSKWSNMQKENPLHLENPEQETRWYFKYFLGKLHQVYMGLISERDPXXXXXXXXXXXXXXXXQYRAIFWRKIGSQKLCIPYNTNSPMNIKKMLSLFDQQKFERFPKEIFNYEVQKDVLILEEQEGSVNFKFGVIYCEKGQNSDEEMYNNVKGSEDFDKFLNLLGDKVVLLNWDRFRGGLDVKNNTTGKYSYYTIYEGHEIMFHVSTALPLSSDNRQQIERKRHXXXXXXXXXXXXXXXXEPFEKYWTPSMMKTHFTHIFAIVSYIHSRKVYRLSVYSEESVPLFGPPLPSPAEFVNFFEFREFLIVKLINGEKSAFNTPVFSEKRERTMEMLLNNILETYTSD-NINMLNRRAFSDIVLDQTNGISTTKEMNRNDAFIKFGQMLKVNIIIKGDAPTSNITTRVLKRVPWQPRIFANDLQFQIHCGDSWGEKLILGTDRGTFIVEENA---APAILIEKSCETKQIEIVENLGLMVFRCDKGRDSKIAIIQLSELK-NID--ILPMTKADVKKLSLDKTRGCHLFGLSKPHIQPMRLVVVVNRRLQIYVWKC--VTCCXXXXXXXXXXXXXIDASFQYIRELPTFEIPQVLTILE---SQRHVQIIIGYKNQFDLIDEKTGDTTHLFKTDIIKSAMIAALDLYSEDEPELLLCYNRTCHFQKLK--HDGHPSEQSSNYEFDFSWNFEPKNIVLVLPYILAFTQNAVEIRLVVNGSLVHTMSVPDCKLITSKIDLFFSTTADNLCKELIEKQKSGTSSFDRLYRVSNPLSSIEYQELSQSPTMKRSMIFQRLHIYKISLSSMSGCSYQVPL 2910
            RG FSRK+YGSVE+LI+   +G    AGRFRVE GS    SD     + P  W    +   +HLENPE  TRWYFKYFLGK+HQ Y+G  +E++P  +S V++D NN  V QYRAI WRK G+ K+ +PY+    +++K +LS  +  +FE+ P+EI N E+QKD+L+LEEQEGSVNFKFGV+Y + GQ +D+EM++N  GSE F+KFLNLLGD + L  W  +RGGLD KN+TTG  S YT+Y+GHE+MFHVST LP S +N+QQ+ERKRHIGNDIV I+F       P    + PSM+++HFTHIFA+V Y      YRL ++SEESVPLFGPPLPSP  F +  EFR+FL+VKLINGEK+   TP F++KR+RT++ML+ ++ +    D + NMLNRR+FSD VL ++   +  KE  R   F++ GQ LK+  I++GDAPTS +TT + ++ PW+ + F +   + I CGDSWG+ L++ TD    ++ E++    P  + +K+   KQ+ ++E   L++ R DKG+D+++ + +LS LK  I+   L  TK D ++  L+KT+GCHL+ ++  H   +R+V  +  +L +   K   + C SS+++    ++S ++  FQYIRE+   + P V+ +++    +    I + Y++QFDLI+E TGD   L   D  +   +AA+D+Y + E  LLLCYN  C ++K+   +   P  Q +  +F FSWN  P   V   PYILAFT +++EIRLVVNG+LV+T  VP+ +L  S+ D++F ++A            +   S       S+P +   Y E+   P+       Q  HIYKI LS++ G S + PL
Sbjct:   11 RGEFSRKHYGSVELLISSDADGAIQRAGRFRVENGSIDEISD-----YTPGTW----RRTDVHLENPEYHTRWYFKYFLGKVHQNYVGTDAEKNPFFLSVVLSDQNNQRVPQYRAILWRKTGTLKISLPYSPTKTLSVKSILSAMNVDRFEKGPREILNPEIQKDLLVLEEQEGSVNFKFGVLYAKDGQLTDDEMFSNEMGSETFEKFLNLLGDTICLQGWAGYRGGLDTKNDTTGINSIYTVYQGHELMFHVSTMLPYSKENKQQVERKRHIGNDIVTIVFQEGDDASP---SFKPSMIRSHFTHIFALVRYNSQNDSYRLKIFSEESVPLFGPPLPSPPVFTDHQEFRDFLLVKLINGEKATLETPTFAQKRQRTLDMLIRSLYQDLMPDMHKNMLNRRSFSD-VLPESPKSARKKEEARQAEFVRVGQALKLKTIVRGDAPTSLVTTGLCRKEPWESQSFCSSFPYDIVCGDSWGQSLLVATDSAGVMLLEDSPTLPPVQVFDKTLTVKQMHVLEPQDLLIARADKGKDARLYVYRLSTLKQGIEERQLVRTKCDSRENKLEKTKGCHLYSINTHHGVELRIVAAIRNKLLLITRKQSRLECVSSIATVTGSTDSPVE-EFQYIREICLCDSPVVMALVDGPTGENDHMICVAYRHQFDLINESTGDAYRLHHVDSNRVNFVAAIDVYEDGEAGLLLCYNNICVYKKVCPFNGATPMIQPNTSDFHFSWNQMPNATVCAFPYILAFTTDSIEIRLVVNGNLVYTAVVPELQLTASRSDIYFISSA--------PINSASNCSSRDTSSQSSPQTPTGY-EMPVFPSPLGDGETQSKHIYKIPLSNLVGRSIERPL 845          
BLAST of GTPase-activating Rap/Ran-GAP domain protein 3 vs. Ensembl Zebrafish
Match: si:ch211-182d3.1 (si:ch211-182d3.1 [Source:NCBI gene;Acc:560594])

HSP 1 Score: 646.351 bits (1666), Expect = 0.000e+0
Identity = 367/856 (42.87%), Postives = 528/856 (61.68%), Query Frame = 1
Query:  379 RGSFSRKNYGSVEMLINRHMEGYTNNAGRFRVELGSSSSQSDLRGDPFVPSKWSNMQKENPLHLENPEQETRWYFKYFLGKLHQVYMGLISERDPXXXXXXXXXXXXXXXXQYRAIFWRKIGSQKLCIPYNTNSPMNIKKMLSLFDQQKFERFPKEIFNYEVQKDVLILEEQEGSVNFKFGVIYCEKGQNSDEEMYNNVKGSEDFDKFLNLLGDKVVLLNWDRFRGGLDVKNNTTGKYSYYTIYEGHEIMFHVSTALPLSSDNRQQIERKRHXXXXXXXXXXXXXXXXEPFEKYWTPSMMKTHFTHIFAIVSYIHSRKVYRLSVYSEESVPLFGPPLPSPAEFVNFFEFREFLIVKLINGEKSAFNTPVFSEKRERTMEMLLNNILETYTSD-NINMLNRRAFSDIVLDQTNGISTTKEMNRNDAFIKFGQMLKVNIIIKGDAPTSNITTRVLKRVPWQPRIFANDLQFQIHCGDSWGEKLILGTDRGTFIVEENA---APAILIEKSCETKQIEIVENLGLMVFRCDKGRDSKIAIIQLSELK-NID--ILPMTKADVKKLSLDKTRGCHLFGLSKPHIQPMRLVVVVNRRLQIYVWKCVTCCXXXXXXXXXXXXXIDASFQYIRELPTFEIPQVLTILE---SQRHVQIIIGYKNQFDLIDEKTGDTTHLFKTDIIKSAMIAALDLYSEDEPELLLCYNRTCHFQKLK--HDGHPSEQSSNYEFDFSWNFEPKNIVLVLPYILAFTQNAVEIRLVVNGSLVHTMSVPDCKLITSKIDLFFSTTADNLCKELIEKQKSGTSSFDRLYRVSNPLSSIEYQELSQSPTMKRSMIFQRLHIYKISLSSMSGCSYQVPL 2910
            RG FSRK+YGSVE+LI+   +G    AGRFRVE GS    SD     + P  W    +   +HLENPE  TRWYFKYFLGK+HQ Y+G  +E++P  +S V++D NN  V QYRAI WRK G+ K+ +PY+    +++K +LS  +  +FE+ P+EI N E+QKD+L+LEEQEGSVNFKFGV+Y + GQ +D+EM++N  GSE F+KFLNLLGD + L  W  +RGGLD KN+TTG  S YT+Y+GHE+MFHVST LP S +N+QQ+ERKRHIGNDIV I+F       P    + PSM+++HFTHIFA+V Y      YRL ++SEESVPLFGPPLPSP  F +  EFR+FL+VKLINGEK+   TP F++KR+RT++ML+ ++ +    D + NMLNRR+FSD VL ++   +  KE  R   F++ GQ LK+  I++GDAPTS +TT + ++ PW+ + F +   + I CGDSWG+ L++ TD    ++ E++    P  + +K+   KQ+ ++E   L++ R DKG+D+++ + +LS LK  I+   L  TK D ++  L+KT+G       + HI P+      N+ + I                      + ++F+   E+   + P V+ +++    +    I + Y++QFDLI+E TGD   L   D  +   +AA+D+Y + E  LLLCYN  C ++K+   +   P  Q +  +F FSWN  P   V   PYILAFT +++EIRLVVNG+LV+T  VP+ +L  S+ D++F ++A            +   S       S+P +   Y E+   P+       Q  HIYKI LS++ G S + PL
Sbjct:   27 RGEFSRKHYGSVELLISSDADGAIQRAGRFRVENGSIDEISD-----YTPGTW----RRTDVHLENPEYHTRWYFKYFLGKVHQNYVGTDAEKNPFFLSVVLSDQNNQRVPQYRAILWRKTGTLKISLPYSPTKTLSVKSILSAMNVDRFEKGPREILNPEIQKDLLVLEEQEGSVNFKFGVLYAKDGQLTDDEMFSNEMGSETFEKFLNLLGDTICLQGWAGYRGGLDTKNDTTGINSIYTVYQGHELMFHVSTMLPYSKENKQQVERKRHIGNDIVTIVFQEGDDASP---SFKPSMIRSHFTHIFALVRYNSQNDSYRLKIFSEESVPLFGPPLPSPPVFTDHQEFRDFLLVKLINGEKATLETPTFAQKRQRTLDMLIRSLYQDLMPDMHKNMLNRRSFSD-VLPESPKSARKKEEARQAEFVRVGQALKLKTIVRGDAPTSLVTTGLCRKEPWESQSFCSSFPYDIVCGDSWGQSLLVATDSAGVMLLEDSPTLPPVQVFDKTLTVKQMHVLEPQDLLIARADKGKDARLYVYRLSTLKQGIEERQLVRTKCDSRENKLEKTKG-------RKHIIPVHTGRTHNKHIIILT-------------------DLFSAFEIFAEICLCDSPVVMALVDGPTGENDHMICVAYRHQFDLINESTGDAYRLHHVDSNRVNFVAAIDVYEDGEAGLLLCYNNICVYKKVCPFNGATPMIQPNTSDFHFSWNQMPNATVCAFPYILAFTTDSIEIRLVVNGNLVYTAVVPELQLTASRSDIYFISSA--------PINSASNCSSRDTSSQSSPQTPTGY-EMPVFPSPLGDGETQSKHIYKIPLSNLVGRSIERPL 834          
BLAST of GTPase-activating Rap/Ran-GAP domain protein 3 vs. Ensembl Xenopus
Match: nhs (NHS actin remodeling regulator [Source:Xenbase;Acc:XB-GENE-5872334])

HSP 1 Score: 556.984 bits (1434), Expect = 0.000e+0
Identity = 307/728 (42.17%), Postives = 459/728 (63.05%), Query Frame = 1
Query:  802 LSLFDQQKFERFPKEIFNYEVQKDVLILEEQEGSVNFKFGVIYCEKGQNSDEEMYNNVKGSEDFDKFLNLLGDKVVLLNWDRFRGGLDVKNNTTGKYSYYTIYEGHEIMFHVSTALPLSSDNRQQIERKRHXXXXXXXXXXXXXXXXEPFEKYWTPSMMKTHFTHIFAIVSYIHSRKVYRLSVYSEESVPLFGPPLPSPAEFVNFFEFREFLIVKLINGEKSAFNTPVFSEKRERTMEMLLNNILETYTSD-NINMLNRRAFSDIVLDQTNGISTTKEMNRNDAFIKFGQMLKVNIIIKGDAPTSNITTRVLKRVPWQPRIFANDLQFQIHCGDSWGEKLILGTDRGTFIVEENAAPAILIEKSCETKQIEIVENLGLMVFRCDKGRDSKIAIIQLSELKNI--DILPM-TKADVKKLSLDKTRGCHLFGLSKPHIQPMRLVVVVNRRLQIYV--WKCVTCCXXXXXXXXXXXXXIDASFQYIRELPTFEIPQVLTILE---SQRHVQIIIGYKNQFDLIDEKTGDTTHLFKTDIIKSAMIAALDLYSEDEPELLLCYNRTCHFQKLK--HDGHPSEQSSNYEFDFSWNFEPKNIVLVLPYILAFTQNAVEIRLVVNGSLVHTMSVPDCKLITSKIDLFFSTTADNLCKELIEKQKSGTSSFDRLYRVSNPLSSIEYQELSQSPTMKRSMIFQRLHIYKISLSSMSGCSYQVPLNPKFRPNLLNSSKS 2952
             S  +  +FE+ P+EI N E+QKD+L+LEEQEGSVNFKFGV+Y + GQ +D+EM++N  GSE F K LNLLGD + L +W  +RGGLD KN+TTG +S YT+Y+GHEIMFHVST LP S +N+QQ+ERKRHIGNDIV I+F      +     + PSM+++HFTHIFA+V Y      YRL ++SEESVPLFGPPLPSP  F +  EFR+FL+VKLINGEK+   TP F++KR+RT++ML+ ++ +    D + NMLNRR+FSD VL ++   +  KE  R   F++ GQ LK+  I++GDAPTS  TT + ++ PW+ + F N    +   GDSWG+ L++ TD G  ++++      + +K+ + KQ+ ++ENL L++ R DKG+++++ + +LS +K    D   M +K + ++  L+KT+GCHL+ ++  H   +R+V  +  +L +     K +   +  +  +  + S ++  FQYIRE+   + P V+T+++         I + Y++QFDL++E TG++  L   D  +   +AA+D+Y + E  LLLCYN  C+++K+   + G P  Q S  +F FSWN  P  +V   PYILAFT +++EIRLVVNG+LVHT  VP+ +L+ S+ D++F  TA            S  SS       S+P++   Y EL   P+       Q  +IYKI LS++ G S + PL     P ++ +  S
Sbjct:   60 FSAMNLDRFEKSPREILNPEIQKDLLVLEEQEGSVNFKFGVLYAKDGQLTDDEMFSNEAGSESFQKMLNLLGDTITLKSWVGYRGGLDTKNDTTGIHSVYTVYQGHEIMFHVSTMLPYSKENKQQVERKRHIGNDIVTIVFQEG---DEASSAFKPSMIRSHFTHIFALVRYNKQNDSYRLKIFSEESVPLFGPPLPSPPVFTDHQEFRDFLLVKLINGEKATLETPTFAQKRQRTLDMLIRSLYQDLMPDLHKNMLNRRSFSD-VLPESPKSARKKEEARQAEFVRIGQALKLKTIVRGDAPTSLATTGLCRKEPWESQCFCNSFTHEALGGDSWGQSLLVSTDAGVLLIDDGQPLVTVFDKTFQIKQMHVLENLDLLITRVDKGKEARLYVFRLSSIKKGLEDKQVMKSKYECRENKLEKTKGCHLYAINTHHSNELRIVAAIRNKLLLITRKHKQLNSFTGFNVTSPSTESPVE-EFQYIREICLSDPPVVMTLVDGPTGDNDNMICVAYRHQFDLVNESTGESCRLHHVDASRVNFVAAIDVYEDGEAGLLLCYNYMCYYKKVCPFNGGSPLIQPSASDFHFSWNQVPNAVVCAFPYILAFTTDSIEIRLVVNGNLVHTAVVPELQLVASRSDIYFKATA--------AVGSSSNSSSKDTSSHSSPMTPTGY-ELPVFPSSPGEAEVQCRNIYKIPLSNLVGRSIERPLKSPLVPKVITTPTS 773          
BLAST of GTPase-activating Rap/Ran-GAP domain protein 3 vs. Ensembl Xenopus
Match: nhs (NHS actin remodeling regulator [Source:Xenbase;Acc:XB-GENE-5872334])

HSP 1 Score: 542.732 bits (1397), Expect = 2.864e-177
Identity = 296/731 (40.49%), Postives = 450/731 (61.56%), Query Frame = 1
Query:  802 LSLFDQQKFERFPKEIFNYEVQKDVLILEEQEGSVNFKFGVIYCEKGQNSDEEMYNNVKGSEDFDKFLNLLGDKVVLLNWDRFRGGLDVKNNTTGKYSYYTIYEGHEIMFHVSTALPLSSDNRQQIERKRHXXXXXXXXXXXXXXXXEPFEKYWTPSMMKTHFTHIFAIVSYIHSRKVYRLSVYSEESVPLFGPPLPSPAEFVNFFEFREFLIVKLINGEKSAFNTPVFSEKRERTMEMLLNNILETYTSDNINML----NRRAFSDIVLDQTNGISTTKEMNRNDAFIKFGQMLKVNIIIKGDAPTSNITTRVLKRVPWQPRIFANDLQFQIHCGDSWGEKLILGTDRGTFIVEENAAPAILIEKSCETKQIEIVENLGLMVFRCDKGRDSKIAIIQLSELKNI--DILPM-TKADVKKLSLDKTRGCHLFGLSKPHIQPMRLVVVVNRRLQIYV--WKCVTCCXXXXXXXXXXXXXIDASFQYIRELPTFEIPQVLTILE---SQRHVQIIIGYKNQFDLIDEKTGDTTHLFKTDIIKSAMIAALDLYSEDEPELLLCYNRTCHFQKLK--HDGHPSEQSSNYEFDFSWNFEPKNIVLVLPYILAFTQNAVEIRLVVNGSLVHTMSVPDCKLITSKIDLFFSTTADNLCKELIEKQKSGTSSFDRLYRVSNPLSSIEYQELSQSPTMKRSMIFQRLHIYKISLSSMSGCSYQVPLNPKFRPNLLNSSKS 2952
             S  +  +FE+ P+EI N E+QKD+L+LEEQEGSVNFKFGV+Y + GQ +D+EM++N  GSE F K LNLLGD + L +W  +RGGLD KN+TTG +S YT+Y+GHEIMFHVST LP S +N+QQ+ERKRH      +I+ I     +     + PSM+++HFTHIFA+V Y      YRL ++SEESVPLFGPPLPSP  F +  EFR+FL+VKLINGEK+   TP F++KR+RT++ML+ ++ +    D   ++      R+FSD VL ++   +  KE  R   F++ GQ LK+  I++GDAPTS  TT + ++ PW+ + F N    +   GDSWG+ L++ TD G  ++++      + +K+ + KQ+ ++ENL L++ R DKG+++++ + +LS +K    D   M +K + ++  L+KT+GCHL+ ++  H   +R+V  +  +L +     K +   +  +  +  + S ++  FQYIRE+   + P V+T+++         I + Y++QFDL++E TG++  L   D  +   +AA+D+Y + E  LLLCYN  C+++K+   + G P  Q S  +F FSWN  P  +V   PYILAFT +++EIRLVVNG+LVHT  VP+ +L+ S+ D++F  TA            S  SS       S+P++   Y EL   P+       Q  +IYKI LS++ G S + PL     P ++ +  S
Sbjct:   74 FSAMNLDRFEKSPREILNPEIQKDLLVLEEQEGSVNFKFGVLYAKDGQLTDDEMFSNEAGSESFQKMLNLLGDTITLKSWVGYRGGLDTKNDTTGIHSVYTVYQGHEIMFHVSTMLPYSKENKQQVERKRH---IGNDIVTIVFQEGDEASSAFKPSMIRSHFTHIFALVRYNKQNDSYRLKIFSEESVPLFGPPLPSPPVFTDHQEFRDFLLVKLINGEKATLETPTFAQKRQRTLDMLIRSLYQDLMPDLHKVILIYCVSRSFSD-VLPESPKSARKKEEARQAEFVRIGQALKLKTIVRGDAPTSLATTGLCRKEPWESQCFCNSFTHEALGGDSWGQSLLVSTDAGVLLIDDGQPLVTVFDKTFQIKQMHVLENLDLLITRVDKGKEARLYVFRLSSIKKGLEDKQVMKSKYECRENKLEKTKGCHLYAINTHHSNELRIVAAIRNKLLLITRKHKQLNSFTGFNVTSPSTESPVE-EFQYIREICLSDPPVVMTLVDGPTGDNDNMICVAYRHQFDLVNESTGESCRLHHVDASRVNFVAAIDVYEDGEAGLLLCYNYMCYYKKVCPFNGGSPLIQPSASDFHFSWNQVPNAVVCAFPYILAFTTDSIEIRLVVNGNLVHTAVVPELQLVASRSDIYFKATA--------AVGSSSNSSSKDTSSHSSPMTPTGY-ELPVFPSSPGEAEVQCRNIYKIPLSNLVGRSIERPLKSPLVPKVITTPTS 790          
BLAST of GTPase-activating Rap/Ran-GAP domain protein 3 vs. Ensembl Xenopus
Match: nhs (NHS actin remodeling regulator [Source:Xenbase;Acc:XB-GENE-5872334])

HSP 1 Score: 514.998 bits (1325), Expect = 8.563e-169
Identity = 274/636 (43.08%), Postives = 415/636 (65.25%), Query Frame = 1
Query:  802 LSLFDQQKFERFPKEIFNYEVQKDVLILEEQEGSVNFKFGVIYCEKGQNSDEEMYNNVKGSEDFDKFLNLLGDKVVLLNWDRFRGGLDVKNNTTGKYSYYTIYEGHEIMFHVSTALPLSSDNRQQIERKRHXXXXXXXXXXXXXXXXEPFEKYWTPSMMKTHFTHIFAIVSYIHSRKVYRLSVYSEESVPLFGPPLPSPAEFVNFFEFREFLIVKLINGEKSAFNTPVFSEKRERTMEMLLNNILETYTSD-NINMLNRRAFSDIVLDQTNGISTTKEMNRNDAFIKFGQMLKVNIIIKGDAPTSNITTRVLKRVPWQPRIFANDLQFQIHCGDSWGEKLILGTDRGTFIVEENAAPAILIEKSCETKQIEIVENLGLMVFRCDKGRDSKIAIIQLSELKNI--DILPM-TKADVKKLSLDKTRGCHLFGLSKPHIQPMRLVVVVNRRLQIYV--WKCVTCCXXXXXXXXXXXXXIDASFQYIRELPTFEIPQVLTILE---SQRHVQIIIGYKNQFDLIDEKTGDTTHLFKTDIIKSAMIAALDLYSEDEPELLLCYNRTCHFQKLK--HDGHPSEQSSNYEFDFSWNFEPKNIVLVLPYILAFTQNAVEIRLVVNGSLVHTMSVPDCKLITSKI 2676
             S  +  +FE+ P+EI N E+QKD+L+LEEQEGSVNFKFGV+Y + GQ +D+EM++N  GSE F K LNLLGD + L +W  +RGGLD KN+TTG +S YT+Y+GHEIMFHVST LP S +N+QQ+ERKRHIGNDIV I+F      +     + PSM+++HFT I      + +     L ++SEESVPLFGPPLPSP  F +  EFR+FL+VKLINGEK+   TP F++KR+RT++ML+ ++ +    D + NMLNRR+FSD VL ++   +  KE  R   F++ GQ LK+  I++GDAPTS  TT + ++ PW+ + F N    +   GDSWG+ L++ TD G  ++++      + +K+ + KQ+ ++ENL L++ R DKG+++++ + +LS +K    D   M +K + ++  L+KT+GCHL+ ++  H   +R+V  +  +L +     K +   +  +  +  + S ++  FQYIRE+   + P V+T+++         I + Y++QFDL++E TG++  L   D  +   +AA+D+Y + E  LLLCYN  C+++K+   + G P  Q S  +F FSWN  P  +V   PYILAFT +++EIRLVVNG+LVHT  VP+ +L+ S++
Sbjct:   74 FSAMNLDRFEKSPREILNPEIQKDLLVLEEQEGSVNFKFGVLYAKDGQLTDDEMFSNEAGSESFQKMLNLLGDTITLKSWVGYRGGLDTKNDTTGIHSVYTVYQGHEIMFHVSTMLPYSKENKQQVERKRHIGNDIVTIVFQEG---DEASSAFKPSMIRSHFTRILFNQECLANLG-GGLKIFSEESVPLFGPPLPSPPVFTDHQEFRDFLLVKLINGEKATLETPTFAQKRQRTLDMLIRSLYQDLMPDLHKNMLNRRSFSD-VLPESPKSARKKEEARQAEFVRIGQALKLKTIVRGDAPTSLATTGLCRKEPWESQCFCNSFTHEALGGDSWGQSLLVSTDAGVLLIDDGQPLVTVFDKTFQIKQMHVLENLDLLITRVDKGKEARLYVFRLSSIKKGLEDKQVMKSKYECRENKLEKTKGCHLYAINTHHSNELRIVAAIRNKLLLITRKHKQLNSFTGFNVTSPSTESPVE-EFQYIREICLSDPPVVMTLVDGPTGDNDNMICVAYRHQFDLVNESTGESCRLHHVDASRVNFVAAIDVYEDGEAGLLLCYNYMCYYKKVCPFNGGSPLIQPSASDFHFSWNQVPNAVVCAFPYILAFTTDSIEIRLVVNGNLVHTAVVPELQLVASRV 703          
BLAST of GTPase-activating Rap/Ran-GAP domain protein 3 vs. Ensembl Xenopus
Match: nhs (NHS actin remodeling regulator [Source:Xenbase;Acc:XB-GENE-5872334])

HSP 1 Score: 363.999 bits (933), Expect = 2.854e-115
Identity = 191/412 (46.36%), Postives = 278/412 (67.48%), Query Frame = 1
Query:  841 KEIFNYEVQKDVLILEEQEGSVNFKFGVIYCEKGQNSDEEMYNNVKGSEDFDKFLNLLGDKVVLLNWDRFRGGLDVKNNTTGKYSYYTIYEGHEIMFHVSTALPLSSDNRQQIERKRHXXXXXXXXXXXXXXXXEPFEKYWTPSMMKTHFTHIFAIVSYIHSRKVYRLSVYSEESVPLFGPPLPSPAEFVNFFEFREFLIVKLINGEKSAFNTPVFSEKRERTMEMLLNNILETYTSD-NINMLNRRAFSDIVLDQTNGISTTKEMNRNDAFIKFGQMLKVNIIIKGDAPTSNITTRVLKRVPWQPRIFANDLQFQIHCGDSWGEKLILGTDRGTFIVEENAAPAILIEKSCETKQIEIVENLGLMVFRCDKGRDSKIAIIQLSELKNI--DILPM-TKADVKKLSLDKTRG 2064
            +E FN+E+    L L       NFKFGV+Y + GQ +D+EM++N  GSE F K LNLLGD + L +W  +RGGLD KN+TTG +S YT+Y+GHEIMFHVST LP S +N+QQ+ERKRHIGNDIV I+F      +     + PSM+++HFTHIFA+V Y      YRL ++SEESVPLFGPPLPSP  F +  EFR+FL+VKLINGEK+   TP F++KR+RT++ML+ ++ +    D + NMLNRR+FSD VL ++   +  KE  R   F++ GQ LK+  I++GDAPTS  TT + ++ PW+ + F N    +   GDSWG+ L++ TD G  ++++      + +K+ + KQ+ ++ENL L++ R DKG+++++ + +LS +K    D   M +K + ++  L+KT+G
Sbjct:   11 RESFNHEINPIGLFL-------NFKFGVLYAKDGQLTDDEMFSNEAGSESFQKMLNLLGDTITLKSWVGYRGGLDTKNDTTGIHSVYTVYQGHEIMFHVSTMLPYSKENKQQVERKRHIGNDIVTIVFQEG---DEASSAFKPSMIRSHFTHIFALVRYNKQNDSYRLKIFSEESVPLFGPPLPSPPVFTDHQEFRDFLLVKLINGEKATLETPTFAQKRQRTLDMLIRSLYQDLMPDLHKNMLNRRSFSD-VLPESPKSARKKEEARQAEFVRIGQALKLKTIVRGDAPTSLATTGLCRKEPWESQCFCNSFTHEALGGDSWGQSLLVSTDAGVLLIDDGQPLVTVFDKTFQIKQMHVLENLDLLITRVDKGKEARLYVFRLSSIKKGLEDKQVMKSKYECRENKLEKTKG 411          
BLAST of GTPase-activating Rap/Ran-GAP domain protein 3 vs. Ensembl Xenopus
Match: chrna9 (cholinergic receptor, nicotinic alpha 9 [Source:Xenbase;Acc:XB-GENE-983401])

HSP 1 Score: 162.155 bits (409), Expect = 1.483e-42
Identity = 98/223 (43.95%), Postives = 140/223 (62.78%), Query Frame = 1
Query:  874 VLILEEQEGSVNFKFGVIYCEKGQNSDEEMYNNVKGSEDFDKFLNLLGDKVVLLNWDRFRGGLDVKNNTTGKYSYYTIYEGHEIMFHVSTALPLSSDNRQQIERKRHXXXXXXXXXXXXXXXXEPFEKYWTPSMMKTHFTHIFAIVSYIHSRK---VYRLSVYSEESVPLFGPPLPSPAEFVNFFEFREFLIVKLINGEKSAFNTPVFSEKRERTMEMLLNNI 1533
            ++  +E E +  FKFGVIY +  Q S+EE++ N + S  F +F++LLGD V+L ++  FRGGLDV +  TG  S YT++   EIMFHVST LP +  + QQ++RKRHIGNDIV IIF  +    PF     P M+ ++F H + +V   +      +Y++SV + E VP FGPPLP+P  F    EFREFL+ KLIN E +   +  F++  +RT   LL+N+
Sbjct:  139 IVAYDEHEINNTFKFGVIYQKYKQTSEEELFGNSEESPAFKEFMDLLGDAVLLQDFKGFRGGLDVAHGQTGTESIYTVFREKEIMFHVSTKLPFTEGDTQQLQRKRHIGNDIVAIIFQEENT--PF----VPDMIASNFLHAYIVVQVENPEADITMYKVSVTAREDVPSFGPPLPNPPVFHKNSEFREFLLTKLINAEHACCKSDKFAKLEDRTRAALLDNL 355          
BLAST of GTPase-activating Rap/Ran-GAP domain protein 3 vs. Ensembl Mouse
Match: Garnl3 (GTPase activating RANGAP domain-like 3 [Source:MGI Symbol;Acc:MGI:2139309])

HSP 1 Score: 667.537 bits (1721), Expect = 0.000e+0
Identity = 356/806 (44.17%), Postives = 522/806 (64.76%), Query Frame = 1
Query:  319 LENSTSND-GCQDLGFLSLYPRGSFSRKNYGSVEMLINRHMEGYTNNAGRFRVELGSSSSQSDLRGDPFVPSKWSNMQKENPLHLENPEQETRWYFKYFLGKLHQVYMGLISERDPXXXXXXXXXXXXXXXXQYRAIFWRKIGSQKLCIPYNTNSPMNIKKMLSLFDQQKFERFPKEIFNYEVQKDVLILEEQEGSVNFKFGVIYCEKGQNSDEEMYNNVKGSEDFDKFLNLLGDKVVLLNWDRFRGGLDVKNNTTGKYSYYTIYEGHEIMFHVSTALPLSSDNRQQIERKRHXXXXXXXXXXXXXXXXEPFEKYWTPSMMKTHFTHIFAIVSYIHSRKVYRLSVYSEESVPLFGPPLPSPAEFVNFFEFREFLIVKLINGEKSAFNTPVFSEKRERTMEMLLNNILETYTSD-NINMLNRRAFSDIVLDQTNGISTTKEMNRNDAFIKFGQMLKVNIIIKGDAPTSNITTRVLKRVPWQPRIFANDLQFQIHCGDSWGEKLILGTDRGTFIVEENAAPAILIEKSCETKQIEIVENLGLMVFRCDKGRDSKIAIIQLSEL-KNID--ILPMTKADVKKLSLDKTRGCHLFGLSKPHIQPMRLVVVVNRRLQIYVWKC---VTCCXXXXXXXXXXXXXIDASFQYIRELPTFEIPQVLTILESQRHVQ---IIIGYKNQFDLIDEKTGDTTHLFKTDIIKSAMIAALDLYSEDEPELLLCYNRTCHFQKLK--HDGHPSEQSSNYEFDFSWNFEPKNIVLVLPYILAFTQNAVEIRLVVNGSLVHTMSVPDCKLITSKIDLFFSTT 2697
            +++S S D GC+         RG FSRK+YGSVE+LI+   +G    AGRFRVE GS+   +       +P  W    +   +HLENPE  TRWYFKYFLG++HQ Y+G  +E+ P  +S  ++D NN  V QYRAI WRK G+QK+C+PY+    +++K +LS  +  KFE+ P+EIF+ E+QKD+L+LEEQEGSVNFKFGV++ + GQ +D+EM++N  GSE F KFLNLLGD + L  W  +RGGLD KNNTTG  S YT+Y+GHE+MFHVST LP S +NRQQ+ERKRHIGNDIV I+F       P    + PSM+++HFTHIFA+V Y      YRL ++SEESVPLFGPPLPSP  F +  EFR+FL+VKLINGEK+   TP F++KR RT++ML+ ++ +    D + NMLNRR+FSD VL ++   +  KE  R   F++ GQ LK+  I++GDAP+S   + + K+ PW+P+ F  +   +  C D WG+ L++ TD G  +V+++     + +++   KQI ++E L L+V R DKG+D+++ + +LS + K +D      +++D ++  L+KT+GCHL+ ++  H + +R+VV +  +L +   K     +    +S  +  S S ++  FQYIRE+   + P V+ +++         I + Y++QFD+++E TG+   L   +  K   +AA+D+Y + E  LLLCYN +C ++K+   + G    Q S  +F F WN  P  IV   PY+LAFT +++EIRLVVNG+LVHT  VP  +L+ S+ D++F+  
Sbjct:    1 MKSSVSEDLGCR---------RGDFSRKHYGSVELLISSDADGAIQRAGRFRVENGSTDESAAA-----LPGTW----RRTDVHLENPEYHTRWYFKYFLGQVHQNYIGNDAEKSPFFLSVTLSDQNNQRVPQYRAILWRKTGTQKICLPYSPTKTLSVKSILSAMNLDKFEKGPREIFHPEIQKDLLVLEEQEGSVNFKFGVLFAKDGQLTDDEMFSNEIGSEAFQKFLNLLGDTITLKGWTGYRGGLDTKNNTTGINSVYTVYQGHEVMFHVSTMLPYSKENRQQVERKRHIGNDIVTIVFQEGEESSP---AFKPSMIRSHFTHIFALVRYDQQNDNYRLKIFSEESVPLFGPPLPSPPVFTDHQEFRDFLLVKLINGEKATLETPTFAQKRRRTLDMLIRSLYQDLMPDLHKNMLNRRSFSD-VLPESPKSARKKEEARQAEFVRIGQALKLKSIVRGDAPSSLAASGMCKKEPWEPQCFCCNFPHEAVCADPWGQALLVSTDAGVLLVDDDLPSVPVFDRTLPVKQIHVLETLDLLVLRADKGKDARLFVFRLSAVQKGLDGRQTGRSRSDCRENKLEKTKGCHLYAINTHHSRELRIVVAIRNKLLLITRKPHNKPSGVPGVSLLSPLSESPVE-EFQYIREICLCDSPAVMALVDGPTEESDNLICVAYRHQFDVVNESTGEAFRLHHVEANKVNFVAAIDVYEDGEAGLLLCYNYSCIYKKVCPFNGGSFLLQPSASDFQFCWNQAPYAIVCAFPYLLAFTTDSMEIRLVVNGNLVHTAVVPQLQLVASRSDIYFTAA 783          
BLAST of GTPase-activating Rap/Ran-GAP domain protein 3 vs. Ensembl Mouse
Match: Garnl3 (GTPase activating RANGAP domain-like 3 [Source:MGI Symbol;Acc:MGI:2139309])

HSP 1 Score: 666.766 bits (1719), Expect = 0.000e+0
Identity = 356/805 (44.22%), Postives = 521/805 (64.72%), Query Frame = 1
Query:  319 LENSTSNDGCQDLGFLSLYPRGSFSRKNYGSVEMLINRHMEGYTNNAGRFRVELGSSSSQSDLRGDPFVPSKWSNMQKENPLHLENPEQETRWYFKYFLGKLHQVYMGLISERDPXXXXXXXXXXXXXXXXQYRAIFWRKIGSQKLCIPYNTNSPMNIKKMLSLFDQQKFERFPKEIFNYEVQKDVLILEEQEGSVNFKFGVIYCEKGQNSDEEMYNNVKGSEDFDKFLNLLGDKVVLLNWDRFRGGLDVKNNTTGKYSYYTIYEGHEIMFHVSTALPLSSDNRQQIERKRHXXXXXXXXXXXXXXXXEPFEKYWTPSMMKTHFTHIFAIVSYIHSRKVYRLSVYSEESVPLFGPPLPSPAEFVNFFEFREFLIVKLINGEKSAFNTPVFSEKRERTMEMLLNNILETYTSD-NINMLNRRAFSDIVLDQTNGISTTKEMNRNDAFIKFGQMLKVNIIIKGDAPTSNITTRVLKRVPWQPRIFANDLQFQIHCGDSWGEKLILGTDRGTFIVEENAAPAILIEKSCETKQIEIVENLGLMVFRCDKGRDSKIAIIQLSEL-KNID--ILPMTKADVKKLSLDKTRGCHLFGLSKPHIQPMRLVVVVNRRLQIYVWKC---VTCCXXXXXXXXXXXXXIDASFQYIRELPTFEIPQVLTILESQRHVQ---IIIGYKNQFDLIDEKTGDTTHLFKTDIIKSAMIAALDLYSEDEPELLLCYNRTCHFQKLK--HDGHPSEQSSNYEFDFSWNFEPKNIVLVLPYILAFTQNAVEIRLVVNGSLVHTMSVPDCKLITSKIDLFFSTT 2697
            LE+  +    +DLG      RG FSRK+YGSVE+LI+   +G    AGRFRVE GS+   +       +P  W    +   +HLENPE  TRWYFKYFLG++HQ Y+G  +E+ P  +S  ++D NN  V QYRAI WRK G+QK+C+PY+    +++K +LS  +  KFE+ P+EIF+ E+QKD+L+LEEQEGSVNFKFGV++ + GQ +D+EM++N  GSE F KFLNLLGD + L  W  +RGGLD KNNTTG  S YT+Y+GHE+MFHVST LP S +NRQQ+ERKRHIGNDIV I+F       P    + PSM+++HFTHIFA+V Y      YRL ++SEESVPLFGPPLPSP  F +  EFR+FL+VKLINGEK+   TP F++KR RT++ML+ ++ +    D + NMLNRR+FSD VL ++   +  KE  R   F++ GQ LK+  I++GDAP+S   + + K+ PW+P+ F  +   +  C D WG+ L++ TD G  +V+++     + +++   KQI ++E L L+V R DKG+D+++ + +LS + K +D      +++D ++  L+KT+GCHL+ ++  H + +R+VV +  +L +   K     +    +S  +  S S ++  FQYIRE+   + P V+ +++         I + Y++QFD+++E TG+   L   +  K   +AA+D+Y + E  LLLCYN +C ++K+   + G    Q S  +F F WN  P  IV   PY+LAFT +++EIRLVVNG+LVHT  VP  +L+ S+ D++F+  
Sbjct:   42 LESQVNLSVSEDLGCR----RGDFSRKHYGSVELLISSDADGAIQRAGRFRVENGSTDESAAA-----LPGTW----RRTDVHLENPEYHTRWYFKYFLGQVHQNYIGNDAEKSPFFLSVTLSDQNNQRVPQYRAILWRKTGTQKICLPYSPTKTLSVKSILSAMNLDKFEKGPREIFHPEIQKDLLVLEEQEGSVNFKFGVLFAKDGQLTDDEMFSNEIGSEAFQKFLNLLGDTITLKGWTGYRGGLDTKNNTTGINSVYTVYQGHEVMFHVSTMLPYSKENRQQVERKRHIGNDIVTIVFQEGEESSP---AFKPSMIRSHFTHIFALVRYDQQNDNYRLKIFSEESVPLFGPPLPSPPVFTDHQEFRDFLLVKLINGEKATLETPTFAQKRRRTLDMLIRSLYQDLMPDLHKNMLNRRSFSD-VLPESPKSARKKEEARQAEFVRIGQALKLKSIVRGDAPSSLAASGMCKKEPWEPQCFCCNFPHEAVCADPWGQALLVSTDAGVLLVDDDLPSVPVFDRTLPVKQIHVLETLDLLVLRADKGKDARLFVFRLSAVQKGLDGRQTGRSRSDCRENKLEKTKGCHLYAINTHHSRELRIVVAIRNKLLLITRKPHNKPSGVPGVSLLSPLSESPVE-EFQYIREICLCDSPAVMALVDGPTEESDNLICVAYRHQFDVVNESTGEAFRLHHVEANKVNFVAAIDVYEDGEAGLLLCYNYSCIYKKVCPFNGGSFLLQPSASDFQFCWNQAPYAIVCAFPYLLAFTTDSMEIRLVVNGNLVHTAVVPQLQLVASRSDIYFTAA 828          
BLAST of GTPase-activating Rap/Ran-GAP domain protein 3 vs. Ensembl Mouse
Match: Garnl3 (GTPase activating RANGAP domain-like 3 [Source:MGI Symbol;Acc:MGI:2139309])

HSP 1 Score: 666.381 bits (1718), Expect = 0.000e+0
Identity = 351/785 (44.71%), Postives = 513/785 (65.35%), Query Frame = 1
Query:  379 RGSFSRKNYGSVEMLINRHMEGYTNNAGRFRVELGSSSSQSDLRGDPFVPSKWSNMQKENPLHLENPEQETRWYFKYFLGKLHQVYMGLISERDPXXXXXXXXXXXXXXXXQYRAIFWRKIGSQKLCIPYNTNSPMNIKKMLSLFDQQKFERFPKEIFNYEVQKDVLILEEQEGSVNFKFGVIYCEKGQNSDEEMYNNVKGSEDFDKFLNLLGDKVVLLNWDRFRGGLDVKNNTTGKYSYYTIYEGHEIMFHVSTALPLSSDNRQQIERKRHXXXXXXXXXXXXXXXXEPFEKYWTPSMMKTHFTHIFAIVSYIHSRKVYRLSVYSEESVPLFGPPLPSPAEFVNFFEFREFLIVKLINGEKSAFNTPVFSEKRERTMEMLLNNILETYTSD-NINMLNRRAFSDIVLDQTNGISTTKEMNRNDAFIKFGQMLKVNIIIKGDAPTSNITTRVLKRVPWQPRIFANDLQFQIHCGDSWGEKLILGTDRGTFIVEENAAPAILIEKSCETKQIEIVENLGLMVFRCDKGRDSKIAIIQLSEL-KNID--ILPMTKADVKKLSLDKTRGCHLFGLSKPHIQPMRLVVVVNRRLQIYVWKC---VTCCXXXXXXXXXXXXXIDASFQYIRELPTFEIPQVLTILESQRHVQ---IIIGYKNQFDLIDEKTGDTTHLFKTDIIKSAMIAALDLYSEDEPELLLCYNRTCHFQKLK--HDGHPSEQSSNYEFDFSWNFEPKNIVLVLPYILAFTQNAVEIRLVVNGSLVHTMSVPDCKLITSKIDLFFSTT 2697
            RG FSRK+YGSVE+LI+   +G    AGRFRVE GS+   +       +P  W    +   +HLENPE  TRWYFKYFLG++HQ Y+G  +E+ P  +S  ++D NN  V QYRAI WRK G+QK+C+PY+    +++K +LS  +  KFE+ P+EIF+ E+QKD+L+LEEQEGSVNFKFGV++ + GQ +D+EM++N  GSE F KFLNLLGD + L  W  +RGGLD KNNTTG  S YT+Y+GHE+MFHVST LP S +NRQQ+ERKRHIGNDIV I+F       P    + PSM+++HFTHIFA+V Y      YRL ++SEESVPLFGPPLPSP  F +  EFR+FL+VKLINGEK+   TP F++KR RT++ML+ ++ +    D + NMLNRR+FSD VL ++   +  KE  R   F++ GQ LK+  I++GDAP+S   + + K+ PW+P+ F  +   +  C D WG+ L++ TD G  +V+++     + +++   KQI ++E L L+V R DKG+D+++ + +LS + K +D      +++D ++  L+KT+GCHL+ ++  H + +R+VV +  +L +   K     +    +S  +  S S ++  FQYIRE+   + P V+ +++         I + Y++QFD+++E TG+   L   +  K   +AA+D+Y + E  LLLCYN +C ++K+   + G    Q S  +F F WN  P  IV   PY+LAFT +++EIRLVVNG+LVHT  VP  +L+ S+ D++F+  
Sbjct:   17 RGDFSRKHYGSVELLISSDADGAIQRAGRFRVENGSTDESAAA-----LPGTW----RRTDVHLENPEYHTRWYFKYFLGQVHQNYIGNDAEKSPFFLSVTLSDQNNQRVPQYRAILWRKTGTQKICLPYSPTKTLSVKSILSAMNLDKFEKGPREIFHPEIQKDLLVLEEQEGSVNFKFGVLFAKDGQLTDDEMFSNEIGSEAFQKFLNLLGDTITLKGWTGYRGGLDTKNNTTGINSVYTVYQGHEVMFHVSTMLPYSKENRQQVERKRHIGNDIVTIVFQEGEESSP---AFKPSMIRSHFTHIFALVRYDQQNDNYRLKIFSEESVPLFGPPLPSPPVFTDHQEFRDFLLVKLINGEKATLETPTFAQKRRRTLDMLIRSLYQDLMPDLHKNMLNRRSFSD-VLPESPKSARKKEEARQAEFVRIGQALKLKSIVRGDAPSSLAASGMCKKEPWEPQCFCCNFPHEAVCADPWGQALLVSTDAGVLLVDDDLPSVPVFDRTLPVKQIHVLETLDLLVLRADKGKDARLFVFRLSAVQKGLDGRQTGRSRSDCRENKLEKTKGCHLYAINTHHSRELRIVVAIRNKLLLITRKPHNKPSGVPGVSLLSPLSESPVE-EFQYIREICLCDSPAVMALVDGPTEESDNLICVAYRHQFDVVNESTGEAFRLHHVEANKVNFVAAIDVYEDGEAGLLLCYNYSCIYKKVCPFNGGSFLLQPSASDFQFCWNQAPYAIVCAFPYLLAFTTDSMEIRLVVNGNLVHTAVVPQLQLVASRSDIYFTAA 787          
BLAST of GTPase-activating Rap/Ran-GAP domain protein 3 vs. Ensembl Mouse
Match: Garnl3 (GTPase activating RANGAP domain-like 3 [Source:MGI Symbol;Acc:MGI:2139309])

HSP 1 Score: 213.772 bits (543), Expect = 1.901e-63
Identity = 111/182 (60.99%), Postives = 136/182 (74.73%), Query Frame = 1
Query:  901 SVNFKFGVIYCEKGQNSDEEMYNNVKGSEDFDKFLNLLGDKVVLLNWDRFRGGLDVKNNTTGKYSYYTIYEGHEIMFHVSTALPLSSDNRQQIERKRHXXXXXXXXXXXXXXXXEPFEKYWTPSMMKTHFTHIFAIVSYIHSRKVYRLSVYSEESVPLFGPPLPSPAEFVNFFEFREFLIVK 1446
            SVNFKFGV++ + GQ +D+EM++N  GSE F KFLNLLGD + L  W  +RGGLD KNNTTG  S YT+Y+GHE+MFHVST LP S +NRQQ+ERKRHIGNDIV I+F       P    + PSM+++HFTHIFA+V Y      YRL ++SEESVPLFGPPLPSP  F +  EFR+FL+VK
Sbjct:    2 SVNFKFGVLFAKDGQLTDDEMFSNEIGSEAFQKFLNLLGDTITLKGWTGYRGGLDTKNNTTGINSVYTVYQGHEVMFHVSTMLPYSKENRQQVERKRHIGNDIVTIVFQEGEESSP---AFKPSMIRSHFTHIFALVRYDQQNDNYRLKIFSEESVPLFGPPLPSPPVFTDHQEFRDFLLVK 180          
BLAST of GTPase-activating Rap/Ran-GAP domain protein 3 vs. Ensembl Mouse
Match: Sipa1l3 (signal-induced proliferation-associated 1 like 3 [Source:MGI Symbol;Acc:MGI:1921456])

HSP 1 Score: 171.014 bits (432), Expect = 1.613e-42
Identity = 129/411 (31.39%), Postives = 203/411 (49.39%), Query Frame = 1
Query:  385 SFSRKNYGSVEMLINRHMEGYTNNAGRFRVELGSSSSQSDLRGDPFVPSKWSNMQ-KENPLHLENPEQETRWYFKYFLGKLHQVYMGLISERDPXXXXXXXXXXXXXXXX----QYRAIFWRKI----------GSQKLCIPYNTNSPMNIKKMLS-LFDQQKFERFPKEIFNYEVQKDVLILEEQEGSVNFKFGVIYCEKGQNSDEEMYNNVKGSEDFDKFLNLLGDKVVLLNWDRFRGGLDVKNNTTGKYSYYTIYEGHEIMFHVSTALPLSSDNRQQIERKRHXXXXXXXXXXXXXXXXEPFEKYWTPSMMKTHFTHIFAIVSYIHS----RKVYRLSVYSEESVPLFGPPLPSPAEFVNFFEFREFLIVKLINGEKSAFNTPVFSEKRERTMEMLLNNILETYTSDN 1557
            SFSR + GS       HM   T +  R      +++S S L     VP +    Q +     +E+ +   R+Y  YF+GK H  Y G+  +  PV +S     + ++  +    QYR IF  +            +      + T   + +K  L  +  +         +   +V + +L L+EQ      K G++YC+ GQ+S+EEMYNN +    F++FL+LLGDKV L  + ++   LDVK ++TG +S YT Y+ +EIMFHVST LP + +NRQQ+ RKRH     +    +  I  EP    +TP  +++HF H+F IV  +H+       Y ++V   +  P FGPP+P+   F     FR+FL+ K+IN E +A  +  F     RT +  L ++ E   S+ 
Sbjct:  436 SFSRASVGSPGGSSEAHMAEPTLSTHR------TNASISVLE----VPKEQQRTQSRPRQYSIEHVDLGARYYQDYFVGKEHANYFGVDEKLGPVAVSIKREKLEDHKDHGPQYQYRIIFRTRELITLRGSILEDATPTATKHGTGRGLPLKDALEYVIPELNIHCLRLALNTPKVTEQLLKLDEQGLCRKHKVGILYCKAGQSSEEEMYNNEEAGPAFEEFLDLLGDKVCLKGFTKYAAQLDVKTDSTGTHSLYTTYQDYEIMFHVSTLLPYTPNNRQQLLRKRH-----IGNDIVTIIFQEPGALPFTPKNIRSHFQHVFIIV-RVHNPCTENVCYSMAVTRSKDAPPFGPPIPNGTTFRKSDVFRDFLLAKVINAENAAHKSDKFHTMATRTRQEYLKDLAENCVSNT 830          
BLAST of GTPase-activating Rap/Ran-GAP domain protein 3 vs. UniProt/SwissProt
Match: sp|Q5ZJY3|GARL3_CHICK (GTPase-activating Rap/Ran-GAP domain-like protein 3 OS=Gallus gallus OX=9031 GN=GARNL3 PE=2 SV=1)

HSP 1 Score: 692.575 bits (1786), Expect = 0.000e+0
Identity = 379/867 (43.71%), Postives = 552/867 (63.67%), Query Frame = 1
Query:  379 RGSFSRKNYGSVEMLINRHMEGYTNNAGRFRVELGSSSSQSDLRGDPFVPSKWSNMQKENPLHLENPEQETRWYFKYFLGKLHQVYMGLISERDPXXXXXXXXXXXXXXXXQYRAIFWRKIGSQKLCIPYNTNSPMNIKKMLSLFDQQKFERFPKEIFNYEVQKDVLILEEQEGSVNFKFGVIYCEKGQNSDEEMYNNVKGSEDFDKFLNLLGDKVVLLNWDRFRGGLDVKNNTTGKYSYYTIYEGHEIMFHVSTALPLSSDNRQQIERKRHXXXXXXXXXXXXXXXXEPFEKYWTPSMMKTHFTHIFAIVSYIHSRKVYRLSVYSEESVPLFGPPLPSPAEFVNFFEFREFLIVKLINGEKSAFNTPVFSEKRERTMEMLLNNILETYTSD-NINMLNRRAFSDIVLDQTNGISTTKEMNRNDAFIKFGQMLKVNIIIKGDAPTSNITTRVLKRVPWQPRIFANDLQFQIHCGDSWGEKLILGTDRGTFIVEENAAPAILIEKSCETKQIEIVENLGLMVFRCDKGRDSKIAIIQLSEL-KNIDI--LPMTKADVKKLSLDKTRGCHLFGLSKPHIQPMRLVVVVNRRLQIYVWKCVTCCXXXXXXXXXXXXXIDASFQYIRELPTFEIPQVLTILE---SQRHVQIIIGYKNQFDLIDEKTGDTTHLFKTDIIKSAMIAALDLYSEDEPELLLCYNRTCHFQKLK--HDGHPSEQSSNYEFDFSWNFEPKNIVLVLPYILAFTQNAVEIRLVVNGSLVHTMSVPDCKLITSKIDLFFSTTADNLCKELIEKQKSGTSSFDRLYRVSNPLSSIEYQELSQSPTMKRSMIFQRLHIYKISLSSMSGCSYQVPLNPKFRPNLLNSSKS 2952
            RG FSRK+YGSVE+LI+   +G    AGRFRVE GSS   +      + P  W        +HLENPE  TRWYFKYFLGK+HQ Y+G  SE++P  +S V++D NN  V QY +I WRK G+QK+C+PY+    +++K +LS    +KFE+ P+EIF+ ++QKD+L+LEEQEGSVNFKFGV+Y + GQ +D+EM++N  GSE F +FL+LLGD + L  W  +RGGLD KN+TTG +S YT+Y+GHEIMFHVST LP S +N+QQ+ERKRHIGNDIV I+F       P  K   PSM+++HFTHIFA+V Y      YRL ++SEESVPLFGPPLPSP  F N  EFR+F++VKLINGEK+   TP FS+KR+RT++ML+ ++ +    D + NMLNRR+FSD++ D     +  KE  R   F++ GQ LK+   +KGDAPT+  TT   K+ PW+ + F ++   ++ C DSWG+ L++ TD G  ++++      + +K+ + KQ+ ++E L  ++ R DKG+DS++ + +LS + K+I+   +  +K D ++  L++T+GCHL+ ++  H   +R+VV +  +L +   K   C S   S    S S ++  FQYIRE+   + P V+T+++         I + Y++QFDL++E TG++  L   +  K   +AA+D+Y + E  LLLCYN  C ++K+   + G P  Q S Y+F FSWN  P  +V   PYILAFT +++EIRLVVNG+LVHT  VP+ +L+ S+ D++F  TA            S  SS   +   S+P +   Y  L  S +     +  + ++YKI LS++ G S + PL     P ++ +  S
Sbjct:   29 RGEFSRKHYGSVELLISSDADGAIQRAGRFRVENGSSDENTG-----YTPGTWHRTD----VHLENPEYYTRWYFKYFLGKVHQNYIGTDSEKNPFFLSVVLSDQNNQRVPQYHSILWRKTGTQKICLPYSPTKTLSVKSILSAMSLEKFEKGPREIFHPDIQKDLLVLEEQEGSVNFKFGVLYAKDGQLTDDEMFSNETGSESFQRFLHLLGDTITLKGWTGYRGGLDTKNDTTGTFSIYTVYQGHEIMFHVSTMLPYSRENKQQVERKRHIGNDIVTIVFQEGEETAPAFK---PSMIRSHFTHIFALVRYNKQNDSYRLKIFSEESVPLFGPPLPSPPVFTNHQEFRDFVLVKLINGEKATLETPTFSQKRQRTLDMLIRSLYQDLMPDLHKNMLNRRSFSDVLPDSPKS-TRKKEEARQAEFVRLGQALKLKTGVKGDAPTTLATTSFCKKEPWESQSFCSNFPHEVVCADSWGQSLLVSTDAGILLIDDGQTTVQVFDKTLQIKQMHVLEALDYLIARTDKGKDSRLLVFRLSSVQKDIETKQVIRSKYDCRENKLERTKGCHLYAINTHHSSELRIVVAIRNKLLLITKKYNPCNSLTGSSLSLSESPVE-EFQYIREICLSDPPVVMTLVDGPTGDSDNMICVAYRHQFDLVNESTGESYRLHHIEANKVNFVAAIDVYEDGEAGLLLCYNYVCQYRKVYPFNGGSPLIQPSAYDFHFSWNQVPYAVVCAFPYILAFTTDSIEIRLVVNGNLVHTAVVPELQLVASRSDIYFKATA--------AVSGSSHSSSKEMSSRSSPQTPTAYDMLECSLSSSEGEVACK-NLYKIPLSNLVGRSIERPLKSPLTPKVVTTPTS 872          
BLAST of GTPase-activating Rap/Ran-GAP domain protein 3 vs. UniProt/SwissProt
Match: sp|A5PF44|GARL3_DANRE (GTPase-activating Rap/Ran-GAP domain-like protein 3 OS=Danio rerio OX=7955 GN=garnl3 PE=3 SV=1)

HSP 1 Score: 677.167 bits (1746), Expect = 0.000e+0
Identity = 381/873 (43.64%), Postives = 553/873 (63.34%), Query Frame = 1
Query:  334 SNDGCQDLGFLSLYPRGSFSRKNYGSVEMLINRHMEGYTNNAGRFRVELGSSSSQSDLRGDPFVPSKWSNMQKENPLHLENPEQETRWYFKYFLGKLHQVYMGLISERDPXXXXXXXXXXXXXXXXQYRAIFWRKIGSQKLCIPYNTNSPMNIKKMLSLFDQQKFERFPKEIFNYEVQKDVLILEEQEGSVNFKFGVIYCEKGQNSDEEMYNNVKGSEDFDKFLNLLGDKVVLLNWDRFRGGLDVKNNTTGKYSYYTIYEGHEIMFHVSTALPLSSDNRQQIERKRHXXXXXXXXXXXXXXXXEPFEKYWTPSMMKTHFTHIFAIVSYIHSRKVYRLSVYSEESVPLFGPPLPSPAEFVNFFEFREFLIVKLINGEKSAFNTPVFSEKRERTMEMLLNNILETYTSD-NINMLNRRAFSDIVLDQTNGISTTKEMNRNDAFIKFGQMLKVNIIIKGDAPTSNITTRVLKRVPWQPRIFANDLQFQIHCGDSWGEKLILGTDRGTFIVEENA---APAILIEKSCETKQIEIVENLGLMVFRCDKGRDSKIAIIQLSELK-NID--ILPMTKADVKKLSLDKTRGCHLFGLSKPHIQPMRLVVVVNRRLQIYVWKC--VTCCXXXXXXXXXXXXXIDASFQYIRELPTFEIPQVLTILE---SQRHVQIIIGYKNQFDLIDEKTGDTTHLFKTDIIKSAMIAALDLYSEDEPELLLCYNRTCHFQKLK--HDGHPSEQSSNYEFDFSWNFEPKNIVLVLPYILAFTQNAVEIRLVVNGSLVHTMSVPDCKLITSKIDLFFSTTADNLCKELIEKQKSGTSSFDRLYRVSNPLSSIEYQELSQSPTMKRSMIFQRLHIYKISLSSMSGCSYQVPL 2910
            ++   +DLG      RG FSRK+YGSVE+LI+   +G    AGRFRVE GS    SD     + P  W    +   +HLENPE  TRWYFKYFLGK+HQ Y+G  +E++P  +S V++D NN  V QYRAI WRK G+ K+ +PY+    +++K +LS  +  +FE+ P+EI N E+QKD+L+LEEQEGSVNFKFGV+Y + GQ +D+EM++N  GSE F+KFLNLLGD + L  W  +RGGLD KN+TTG  S YT+Y+GHE+MFHVST LP S +N+QQ+ERKRHIGNDIV I+F       P    + PSM+++HFTHIFA+V Y      YRL ++SEESVPLFGPPLPSP  F +  EFR+FL+VKLINGEK+   TP F++KR+RT++ML+ ++ +    D + NMLNRR+FSD VL ++   +  KE  R   F++ GQ LK+  I++GDAPTS +TT + ++ PW+ + F +   + I CGDSWG+ L++ TD    ++ E++    P  + +K+   KQ+ ++E   L++ R DKG+D+++ + +LS LK  I+   L  TK D ++  L+KT+GCHL+ ++  H   +R+V  +  +L +   K   + C SS+++    ++S ++  FQYIRE+   + P V+ +++    +    I + Y++QFDLI+E TGD   L   D  +   +AA+D+Y + E  LLLCYN  C ++K+   +   P  Q +  +F FSWN  P   V   PYILAFT +++EIRLVVNG+LV+T  VP+ +L  S+ D++F ++A            +   S       S+P +   Y E+   P+       Q  HIYKI LS++ G S + PL
Sbjct:   33 TSSASEDLGCR----RGEFSRKHYGSVELLISSDADGAIQRAGRFRVENGSIDEISD-----YTPGTW----RRTDVHLENPEYHTRWYFKYFLGKVHQNYVGTDAEKNPFFLSVVLSDQNNQRVPQYRAILWRKTGTLKISLPYSPTKTLSVKSILSAMNVDRFEKGPREILNPEIQKDLLVLEEQEGSVNFKFGVLYAKDGQLTDDEMFSNEMGSETFEKFLNLLGDTICLQGWAGYRGGLDTKNDTTGINSIYTVYQGHELMFHVSTMLPYSKENKQQVERKRHIGNDIVTIVFQEGDDASP---SFKPSMIRSHFTHIFALVRYNSQNDSYRLKIFSEESVPLFGPPLPSPPVFTDHQEFRDFLLVKLINGEKATLETPTFAQKRQRTLDMLIRSLYQDLMPDMHKNMLNRRSFSD-VLPESPKSARKKEEARQAEFVRVGQALKLKTIVRGDAPTSLVTTGLCRKEPWESQSFCSSFPYDIVCGDSWGQSLLVATDSAGVMLLEDSPTLPPVQVFDKTLTVKQMHVLEPQDLLIARADKGKDARLYVYRLSTLKQGIEERQLVRTKCDSRENKLEKTKGCHLYSINTHHGVELRIVAAIRNKLLLITRKQSRLECVSSIATVTGSTDSPVE-EFQYIREICLCDSPVVMALVDGPTGENDHMICVAYRHQFDLINESTGDAYRLHHVDSNRVNFVAAIDVYEDGEAGLLLCYNNICVYKKVCPFNGATPMIQPNTSDFHFSWNQMPNATVCAFPYILAFTTDSIEIRLVVNGNLVYTAVVPELQLTASRSDIYFISSA--------PINSASNCSSRDTSSQSSPQTPTGY-EMPVFPSPLGDGETQSKHIYKIPLSNLVGRSIERPL 878          
BLAST of GTPase-activating Rap/Ran-GAP domain protein 3 vs. UniProt/SwissProt
Match: sp|Q5VVW2|GARL3_HUMAN (GTPase-activating Rap/Ran-GAP domain-like protein 3 OS=Homo sapiens OX=9606 GN=GARNL3 PE=2 SV=2)

HSP 1 Score: 671.389 bits (1731), Expect = 0.000e+0
Identity = 353/788 (44.80%), Postives = 517/788 (65.61%), Query Frame = 1
Query:  379 RGSFSRKNYGSVEMLINRHMEGYTNNAGRFRVELGSSSSQSDLRGDPFVPSKWSNMQKENPLHLENPEQETRWYFKYFLGKLHQVYMGLISERDPXXXXXXXXXXXXXXXXQYRAIFWRKIGSQKLCIPYNTNSPMNIKKMLSLFDQQKFERFPKEIFNYEVQKDVLILEEQEGSVNFKFGVIYCEKGQNSDEEMYNNVKGSEDFDKFLNLLGDKVVLLNWDRFRGGLDVKNNTTGKYSYYTIYEGHEIMFHVSTALPLSSDNRQQIERKRHXXXXXXXXXXXXXXXXEPFEKYWTPSMMKTHFTHIFAIVSYIHSRKVYRLSVYSEESVPLFGPPLPSPAEFVNFFEFREFLIVKLINGEKSAFNTPVFSEKRERTMEMLLNNILETYTSD-NINMLNRRAFSDIVLDQTNGISTTKEMNRNDAFIKFGQMLKVNIIIKGDAPTSNITTRVLKRVPWQPRIFANDLQFQIHCGDSWGEKLILGTDRGTFIVEENAAPAILIEKSCETKQIEIVENLGLMVFRCDKGRDSKIAIIQLSEL-KNID--ILPMTKADVKKLSLDKTRGCHLFGLSKPHIQPMRLVVVVNRRLQIYVWK-----CVTCCXXXXXXXXXXXXXIDASFQYIRELPTFEIPQVLTILESQRHVQ---IIIGYKNQFDLIDEKTGDTTHLFKTDIIKSAMIAALDLYSEDEPELLLCYNRTCHFQKLK--HDGHPSEQSSNYEFDFSWNFEPKNIVLVLPYILAFTQNAVEIRLVVNGSLVHTMSVPDCKLITSKIDLFFSTTA 2700
            RG FSRK+YGSVE+LI+   +G    AGRFRVE GSS   +       +P  W    +   +HLENPE  TRWYFKYFLG++HQ Y+G  +E+ P  +S  ++D NN  V QYRAI WRK G+QK+C+PY+    +++K +LS  +  KFE+ P+EIF+ E+QKD+L+LEEQEGSVNFKFGV++ + GQ +D+EM++N  GSE F KFLNLLGD + L  W  +RGGLD KN+TTG +S YT+Y+GHEIMFHVST LP S +N+QQ+ERKRHIGNDIV I+F       P    + PSM+++HFTHIFA+V Y      YRL ++SEESVPLFGPPLP+P  F +  EFR+FL+VKLINGEK+   TP F++KR RT++ML+ ++ +    D + NMLNRR+FSD VL ++   +  KE  R   F++ GQ LK+  I++GDAP+S   + + K+ PW+P+ F ++   +  C D WG+ L++ TD G  +V+++     + +++   KQ+ ++E L L+V R DKG+D+++ + +LS L K ++      +++D ++  L+KT+GCHL+ ++  H + +R+VV +  +L +   K      VT  S LS  ++         FQYIRE+   + P V+T+++         I + Y++QFD+++E TG+   L   +  +   +AA+D+Y + E  LLLCYN +C ++K+   + G    Q S  +F F WN  P  IV   PY+LAFT +++EIRLVVNG+LVHT  VP  +L+ S+ D++F+ TA
Sbjct:   35 RGDFSRKHYGSVELLISSDADGAIQRAGRFRVENGSSDENATA-----LPGTW----RRTDVHLENPEYHTRWYFKYFLGQVHQNYIGNDAEKSPFFLSVTLSDQNNQRVPQYRAILWRKTGTQKICLPYSPTKTLSVKSILSAMNLDKFEKGPREIFHPEIQKDLLVLEEQEGSVNFKFGVLFAKDGQLTDDEMFSNEIGSEPFQKFLNLLGDTITLKGWTGYRGGLDTKNDTTGIHSVYTVYQGHEIMFHVSTMLPYSKENKQQVERKRHIGNDIVTIVFQEGEESSP---AFKPSMIRSHFTHIFALVRYNQQNDNYRLKIFSEESVPLFGPPLPTPPVFTDHQEFRDFLLVKLINGEKATLETPTFAQKRRRTLDMLIRSLHQDLMPDLHKNMLNRRSFSD-VLPESPKSARKKEEARQAEFVRIGQALKLKSIVRGDAPSSLAASGICKKEPWEPQCFCSNFPHEAVCADPWGQALLVSTDAGVLLVDDDLPSVPVFDRTLPVKQMHVLETLDLLVLRADKGKDARLFVFRLSALQKGLEGKQAGKSRSDCRENKLEKTKGCHLYAINTHHSRELRIVVAIRNKLLLITRKHNKPSGVTSTSLLSPLSESPVE----EFQYIREICLSDSPMVMTLVDGPAEESDNLICVAYRHQFDVVNESTGEAFRLHHVEANRVNFVAAIDVYEDGEAGLLLCYNYSCIYKKVCPFNGGSFLVQPSASDFQFCWNQAPYAIVCAFPYLLAFTTDSMEIRLVVNGNLVHTAVVPQLQLVASRSDIYFTATA 805          
BLAST of GTPase-activating Rap/Ran-GAP domain protein 3 vs. UniProt/SwissProt
Match: sp|Q3V0G7|GARL3_MOUSE (GTPase-activating Rap/Ran-GAP domain-like protein 3 OS=Mus musculus OX=10090 GN=Garnl3 PE=1 SV=1)

HSP 1 Score: 666.766 bits (1719), Expect = 0.000e+0
Identity = 356/805 (44.22%), Postives = 521/805 (64.72%), Query Frame = 1
Query:  319 LENSTSNDGCQDLGFLSLYPRGSFSRKNYGSVEMLINRHMEGYTNNAGRFRVELGSSSSQSDLRGDPFVPSKWSNMQKENPLHLENPEQETRWYFKYFLGKLHQVYMGLISERDPXXXXXXXXXXXXXXXXQYRAIFWRKIGSQKLCIPYNTNSPMNIKKMLSLFDQQKFERFPKEIFNYEVQKDVLILEEQEGSVNFKFGVIYCEKGQNSDEEMYNNVKGSEDFDKFLNLLGDKVVLLNWDRFRGGLDVKNNTTGKYSYYTIYEGHEIMFHVSTALPLSSDNRQQIERKRHXXXXXXXXXXXXXXXXEPFEKYWTPSMMKTHFTHIFAIVSYIHSRKVYRLSVYSEESVPLFGPPLPSPAEFVNFFEFREFLIVKLINGEKSAFNTPVFSEKRERTMEMLLNNILETYTSD-NINMLNRRAFSDIVLDQTNGISTTKEMNRNDAFIKFGQMLKVNIIIKGDAPTSNITTRVLKRVPWQPRIFANDLQFQIHCGDSWGEKLILGTDRGTFIVEENAAPAILIEKSCETKQIEIVENLGLMVFRCDKGRDSKIAIIQLSEL-KNID--ILPMTKADVKKLSLDKTRGCHLFGLSKPHIQPMRLVVVVNRRLQIYVWKC---VTCCXXXXXXXXXXXXXIDASFQYIRELPTFEIPQVLTILESQRHVQ---IIIGYKNQFDLIDEKTGDTTHLFKTDIIKSAMIAALDLYSEDEPELLLCYNRTCHFQKLK--HDGHPSEQSSNYEFDFSWNFEPKNIVLVLPYILAFTQNAVEIRLVVNGSLVHTMSVPDCKLITSKIDLFFSTT 2697
            LE+  +    +DLG      RG FSRK+YGSVE+LI+   +G    AGRFRVE GS+   +       +P  W    +   +HLENPE  TRWYFKYFLG++HQ Y+G  +E+ P  +S  ++D NN  V QYRAI WRK G+QK+C+PY+    +++K +LS  +  KFE+ P+EIF+ E+QKD+L+LEEQEGSVNFKFGV++ + GQ +D+EM++N  GSE F KFLNLLGD + L  W  +RGGLD KNNTTG  S YT+Y+GHE+MFHVST LP S +NRQQ+ERKRHIGNDIV I+F       P    + PSM+++HFTHIFA+V Y      YRL ++SEESVPLFGPPLPSP  F +  EFR+FL+VKLINGEK+   TP F++KR RT++ML+ ++ +    D + NMLNRR+FSD VL ++   +  KE  R   F++ GQ LK+  I++GDAP+S   + + K+ PW+P+ F  +   +  C D WG+ L++ TD G  +V+++     + +++   KQI ++E L L+V R DKG+D+++ + +LS + K +D      +++D ++  L+KT+GCHL+ ++  H + +R+VV +  +L +   K     +    +S  +  S S ++  FQYIRE+   + P V+ +++         I + Y++QFD+++E TG+   L   +  K   +AA+D+Y + E  LLLCYN +C ++K+   + G    Q S  +F F WN  P  IV   PY+LAFT +++EIRLVVNG+LVHT  VP  +L+ S+ D++F+  
Sbjct:   42 LESQVNLSVSEDLGCR----RGDFSRKHYGSVELLISSDADGAIQRAGRFRVENGSTDESAAA-----LPGTW----RRTDVHLENPEYHTRWYFKYFLGQVHQNYIGNDAEKSPFFLSVTLSDQNNQRVPQYRAILWRKTGTQKICLPYSPTKTLSVKSILSAMNLDKFEKGPREIFHPEIQKDLLVLEEQEGSVNFKFGVLFAKDGQLTDDEMFSNEIGSEAFQKFLNLLGDTITLKGWTGYRGGLDTKNNTTGINSVYTVYQGHEVMFHVSTMLPYSKENRQQVERKRHIGNDIVTIVFQEGEESSP---AFKPSMIRSHFTHIFALVRYDQQNDNYRLKIFSEESVPLFGPPLPSPPVFTDHQEFRDFLLVKLINGEKATLETPTFAQKRRRTLDMLIRSLYQDLMPDLHKNMLNRRSFSD-VLPESPKSARKKEEARQAEFVRIGQALKLKSIVRGDAPSSLAASGMCKKEPWEPQCFCCNFPHEAVCADPWGQALLVSTDAGVLLVDDDLPSVPVFDRTLPVKQIHVLETLDLLVLRADKGKDARLFVFRLSAVQKGLDGRQTGRSRSDCRENKLEKTKGCHLYAINTHHSRELRIVVAIRNKLLLITRKPHNKPSGVPGVSLLSPLSESPVE-EFQYIREICLCDSPAVMALVDGPTEESDNLICVAYRHQFDVVNESTGEAFRLHHVEANKVNFVAAIDVYEDGEAGLLLCYNYSCIYKKVCPFNGGSFLLQPSASDFQFCWNQAPYAIVCAFPYLLAFTTDSMEIRLVVNGNLVHTAVVPQLQLVASRSDIYFTAA 828          
BLAST of GTPase-activating Rap/Ran-GAP domain protein 3 vs. UniProt/SwissProt
Match: sp|Q54EH3|Y1510_DICDI (GTPase-activating protein DDB_G0291510 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0291510 PE=4 SV=1)

HSP 1 Score: 204.527 bits (519), Expect = 1.178e-52
Identity = 130/333 (39.04%), Postives = 194/333 (58.26%), Query Frame = 1
Query:  562 LHLENPEQETRWYFKYFLGKLHQVYMGLISERDPXXXXXXXXXXXXXXXXQYRAIFWRKIGSQKLCI---PYNTNSPMNI-KKMLSLFDQQKFERFPKEIFNYEVQKDVLILEEQEGSVNFKFGVIYCEKGQNSDEEMYNNVKGSEDFDKFLNLLGDKVVLLNWDRFRGGLDVKNNTTGKYSYYTIYEGHEIMFHVSTALPLSSDNRQQIERKRHXXXXXXXXXXXXXXXXEPFEKYWTPSMMKTHFTHIFAIVSYIHSRKVYRLSVYSEESVPLFGPPLPSPAEFVNFFEFREFLIVKLINGEKSAFNT-PVFSEKRERTMEMLLNNILETY 1545
            + +ENPE+   WY+ YFLGK HQ Y+G +   D    S    +        Y+ I W   G ++       + + +P +I KK L     +K     KEI + ++ KD   LE+ +  +N+KFG++     Q+S+++ YNNV+ S  + +FLNLLGD VVL ++  +RGGLDV NNTTG +S YT  +G+E+MFHVST LP S  + QQIERKRH+GNDIV IIF +    +P    W PS + ++F HIFA+V        Y + +  +  +  FGP LP+ + F     F+EFLI KL+N +++A N+ P F+ K +RT +  L +I + +
Sbjct:   82 IAVENPEECILWYYNYFLGKSHQNYLGTLDNGDVFGASIKKEEYAIEGEYSYKTIIWTLEGIERQWFQLKKHASTTPTDIIKKALPRLQIKKI----KEIDSPDLLKDFKDLEQTQTEINYKFGLLLARPNQSSEDDFYNNVEHSPKWTEFLNLLGDTVVLNSFKGYRGGLDVNNNTTGTHSLYTSLKGYEVMFHVSTMLPHSKADSQQIERKRHLGNDIVIIIFYDCDPSDPIIP-WDPSTVNSNFNHIFAVVRPADENN-YHVEIVIKHGIAKFGPVLPTHSIFPKNSTFKEFLITKLVNAQRAALNSAPSFATKLKRTFKDQLESIYKKH 408          

HSP 2 Score: 54.6842 bits (130), Expect = 4.503e-6
Identity = 52/213 (24.41%), Postives = 88/213 (41.31%), Query Frame = 1
Query: 2056 TRGCHLFGLSKPHIQPMR-----LVVVVNRRLQIYVWKCVTCCXXXXXXXXXXXXXIDASFQYIRELPTFEIPQVLTILESQRHVQIIIGYKNQFDLIDEKTGDTTHLFKTDIIKSAMIAALDLYSEDEPELLLCYNRTCHFQKLKHDGHPSEQSSNYEFDFSWNFEPKNIVLVLPYILAFTQNAVEIRLVVNGSLVH------TMSVPDCKL 2661
            T+GC ++G +K   +        L V + + L +Y W                       F   RELP  +  + L  +       I +G + +F LID  T     L+K     S  + AL L    + E+LLC+N    F  +   G+ + Q     F+  W   P ++ LV  Y+L  +   +E+R ++NG+++       ++S  DC L
Sbjct:  702 TKGCTVYGYTKGDNEGQEEDITLLYVGLKKTLLLYEWN-------------------KGEFVKSRELPLMDNIKTLCAIAPG---MICVGIQKEFLLIDIFTQTIKELYKKS--DSEPVKALSL----DNEILLCFNNIGIF--VDESGNKTRQ-----FELKWGSTPSSLALVPSYVLGISGPLIEVRTLLNGNIIQSLPANISLSNDDCNL 879          
BLAST of GTPase-activating Rap/Ran-GAP domain protein 3 vs. TrEMBL
Match: A0A1S3K598 (GTPase-activating Rap/Ran-GAP domain-like protein 3 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106178946 PE=4 SV=1)

HSP 1 Score: 777.319 bits (2006), Expect = 0.000e+0
Identity = 428/874 (48.97%), Postives = 594/874 (67.96%), Query Frame = 1
Query:  160 SMNHLDIVGTKESNEP---KLGLLRRAFSS-KKRKK-----TINNSKPSNYL-IPPAQLSVRSL-ENSTSNDGCQDLGFLSLYPRGSFSRKNYGSVEMLINRHMEGYTNNA-GRFRVELGSSSSQSDLRGDPFVPSKWSNMQKENPLHLENPEQETRWYFKYFLGKLHQVYMGLISERDPXXXXXXXXXXXXXXXXQYRAIFWRKIGSQKLCIPYNTNSPMNIKKMLSLFDQQKFERFPKEIFNYEVQKDVLILEEQEGSVNFKFGVIYCEKGQNSDEEMYNNVKGSEDFDKFLNLLGDKVVLLNWDRFRGGLDVKNNTTGKYSYYTIYEGHEIMFHVSTALPLSSDNRQQIERKRHXXXXXXXXXXXXXXXXEPFEKYWTPSMMKTHFTHIFAIVSYIHSRKVYRLSVYSEESVPLFGPPLPSPAEFVNFFEFREFLIVKLINGEKSAFNTPVFSEKRERTMEMLLNNILETYTSD-NIN-MLNRRAFSDIVLDQTNGISTTKEMNRNDAFIKFGQMLKVNIIIKGDAPTSNITTRVLKRVPWQPRIFANDLQFQIHCGDSWGEKLILGTDRGTFIVEENAAPAILIEKSCETKQIEIVENLGLMVFRCDKGRDSKIAIIQLSELKN-IDILPMTKADVKKLSLDKTRGCHLFGLSKPHIQPMRLVVVVNRRLQIYVWKCVTCCXXXXXXXXXXXXXIDASFQYIRELPTFEIPQVLTILESQR-HVQIIIGYKNQFDLIDEKTGDTTHLFKTDIIKSAMIAALDLYSEDEPELLLCYNRTCHFQKLKHDGHPSEQSSNYEFDFSWNFEPKNIVLVLPYILAFTQNAVEIRLVVNGSLVHTMSVPDCKLITSKIDLFFSTTA-----DNLCKE 2718
            SM  + ++      +P   K GLLRRAFSS KKR++     ++N      +L +PP Q       E         DL       RG FSRK+YGSVE+L +   EG  + A GRFR+E G      +   D F PS   +     P+H+ENPE +TRWYFKYFLGK+HQ Y+GL ++++P ++S V+TD NN+NV QYRAI WRK G++K+C+PY+   P  +K +L  FD  K E+ P+EI+N EVQK++L+LEEQEGSVNFKFGV YC +GQ SD+EMY N KGS  FDKF++LLGD++ L  WDRF+GGLDVK+N+TG  S YT+YEGHEIMFHVS+ LP S+DN+QQ+ERKRHIGNDIVNII++    D+  +  + PSMMKTHFTHI+A+V Y      YRL+VYS ESVPLFGPPLP+PA F +  EFR+FL+VK INGEK+A  TPVF++KR RT++ML+ N  + +  + N N MLNRRAFSD++ D  +G S  KE  R   F++ GQ LK+NII+KGDAPTS ITT +LKR PW+P+ F +    +I CGDSWG+KLI+ T+ GT ++EE   P ++ +++   KQI++VE  GL++FR +KG+DSKI + +L++ +   + +  TK D +   +++++GCHL+ LS+P    +R+V+ + +RL +  WK     +  +        ++D  FQ++REL ++E P+++T+++  R   QI +GYK+Q+DLI+EK GDT HL   D  K  +++A+D+Y + E ELLLCYN  CHFQKL      +E +SN EFDF WN +P +IV   PYILA T + +EIRL++NGSLV T++ P   LITSK D++F++TA      + CKE
Sbjct:   21 SMVEIQLIEESNDTDPFVEKPGLLRRAFSSIKKRRRREATRSVNIGADGKWLQVPPGQQRCTCFFEGGDEGSPASDLAAR----RGMFSRKHYGSVELLTSSESEGTIHTAAGRFRIETG------EFEHDEF-PSPLGS-----PVHVENPEYQTRWYFKYFLGKMHQNYVGLDADKEPFILSVVVTDANNHNVPQYRAILWRKQGARKICLPYDPTKPKTVKGILGHFDMPKVEKGPREIYNAEVQKELLVLEEQEGSVNFKFGVTYCIEGQISDDEMYGNEKGSSSFDKFIHLLGDRIKLKGWDRFKGGLDVKSNSTGDDSVYTVYEGHEIMFHVSSLLPYSTDNKQQVERKRHIGNDIVNIIYVEMNSDQ--QPSFRPSMMKTHFTHIYALVVYEKDTDKYRLNVYSAESVPLFGPPLPTPAVFADHAEFRDFLLVKCINGEKAALCTPVFAQKRVRTLDMLIRNTYDNHMVEVNKNTMLNRRAFSDVIPDYQHG-SRRKEEARKLEFVRVGQALKLNIILKGDAPTSLITTGMLKREPWEPQCFYHSFPNEIICGDSWGDKLIIVTEVGTMVIEEGCIPRLIFDRTVSIKQIDVVEPHGLIIFRPEKGKDSKIHVFRLADFEGRTNSIVRTKLDSRDHKIERSKGCHLYALSRPGGSHLRMVIAIGKRLLVMSWK--HSAAWSAWCVSNDTETVDG-FQFLRELQSYETPELITLIDGPRGDNQICVGYKHQYDLINEKNGDTLHLHHVDASKVKLVSAIDIYEDSEAELLLCYNHVCHFQKL------TEDNSN-EFDFLWNSQPCSIVCAFPYILALTPDTMEIRLIINGSLVQTVTYPRLGLITSKCDIYFASTAMGYHSSDKCKE 865          
BLAST of GTPase-activating Rap/Ran-GAP domain protein 3 vs. TrEMBL
Match: A0A5K3EXR4 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 770.385 bits (1988), Expect = 0.000e+0
Identity = 403/770 (52.34%), Postives = 545/770 (70.78%), Query Frame = 1
Query:  541 NMQKENPLHLENPEQETRWYFKYFLGKLHQVYMGLISERDPXXXXXXXXXXXXXXXXQYRAIFWRKIGSQKLCIPYNTNSPMNIKKMLSLFDQQKFERFPKEIFNYEVQKDVLILEEQEGSVNFKFGVIYCEKGQNSDEEMYNNVKGSEDFDKFLNLLGDKVVLLNWDRFRGGLDVKNNTTGKYSYYTIYEGHEIMFHVSTALPLSSDNRQQIERKRHXXXXXXXXXXXXXXXXE-PFEKYWTPSMMKTHFTHIFAIVSYIHSRKVYRLSVYSEESVPLFGPPLPSPAEFVNFFEFREFLIVKLINGEKSAFNTPVFSEKRERTMEMLLNNILETYTSD-NINMLNRRAFSDIVLDQTNGISTTKEMNRNDAFIKFGQMLKVNIIIKGDAPTSNITTRVLKRVPWQPRIFANDLQFQIHCGDSWGEKLILGTDRGTFIVEENAAPAILIEKSCETKQIEIVENLGLMVFRCDKGRDSKIAIIQLSELKNIDILPMTKADVKKLSLDKTRGCHLFGLSKPHIQPMRLVVVVNRRLQIYVWKCVTCCXXXXXXXXXXXXXIDASFQYIRELPTFEIPQVLTILESQRHVQIIIGYKNQFDLIDEKTGDTTHLFKTDIIKSAMIAALDLYSEDEPELLLCYNRTCHFQK-----------------------LKH---DGHPS--------------EQSSNYEFDFSWNFEPKNIVLVLPYILAFTQNAVEIRLVVNGSLVHTMSVPDCKLITSKIDLFFSTTADNLCKELI 2724
            ++    P+HLENPE+ETRWYFKYFLGK H+++ G ISE+DP++++ V ++     + QYRAI W K GSQKLCI  +  + ++ KK+L LFD  + E+  KEI +YE Q++ L LEEQEGSVNFKFGV+YC  GQ SDEEMYNN  GS  +  FL LLGD++ L NWDRF+GGLD K  TTG  S YTIYEGHEIMFHVST LP+S+DNRQQIERKRHIGNDIVNIIF N    + P    W PSMMKTHFTHIFA+V+Y      YR SV+SEESVP FGP +P+  EF +  E R FL+VKLINGEK+AF++PVF++KR RT EMLLNNILE Y S+ + N   RRAFS+IV D   G  +TK+ NRNDAFI+FGQMLK+N II+GDAPTS ITT + K++PWQPR     +   I CGD+WG+ L+   D G + +EE+  P +LI+KS + KQ+++ E+ G+M+ R DKGR+S+I+++QLS+L   ++  + +  VK+ +LD++RGCHLF  S    +P+RLV+ V RRL IY W+      SLSSWNQF+ S + A F ++RE+PT E+ QVL+IL+S    +I  GY+NQFDL+DE+TG+T HL+KT+  KS  +A +++ S+D+ ELLLC+NR C+ Q+                       L+H   DG+ S              + ++  +++FSWNFEPK+IVL  PYILAFT++A+E RL++NGSLVHTM+VP+C L++SK D++F+++++ L + ++
Sbjct:  138 SLSGGGPVHLENPERETRWYFKYFLGKAHRIFCGNISEKDPLLLAIVKSEFEAEGLRQYRAILWTKFGSQKLCISNSFTNSVSPKKILCLFDIHRLEKGLKEIIHYEAQREALTLEEQEGSVNFKFGVLYCMDGQTSDEEMYNNENGSPQYQAFLRLLGDRITLKNWDRFKGGLDTKTETTGIESVYTIYEGHEIMFHVSTLLPISTDNRQQIERKRHIGNDIVNIIFFNTDDADKPLS--WKPSMMKTHFTHIFAVVTYNQVTNAYRFSVFSEESVPYFGPTIPTTREFTDHEELRHFLLVKLINGEKAAFHSPVFAQKRIRTSEMLLNNILEKYGSECSANGPYRRAFSEIVQDSAEGSPSTKDQNRNDAFIRFGQMLKLNTIIRGDAPTSCITTGISKQIPWQPRRLHMKMHGDISCGDAWGKVLLTCVDGGVYALEEHQQPLLLIDKSVDVKQLKVAESFGIMILRHDKGRESRISVLQLSDLPLAEV--VDRGLVKRHTLDRSRGCHLFSTSTSATRPLRLVLAVGRRLLIYQWQVEITGRSLSSWNQFTYSELTARFVFVREVPTSEVVQVLSILDSNMGGRICAGYRNQFDLLDERTGETLHLYKTENGKSQAVAVVEMRSDDDLELLLCFNRNCYLQRITKRNLPFHAHSDLFNVCSSLEVLEHQIVDGNSSTSPLIKPCLTSNRIQTTATTDYNFSWNFEPKHIVLAHPYILAFTESAIEFRLLLNGSLVHTMTVPNCILLSSKHDIYFASSSEALHQSVL 903          
BLAST of GTPase-activating Rap/Ran-GAP domain protein 3 vs. TrEMBL
Match: A0A068W7D8 (GTPase activating Rap:RanGAP domain 3 OS=Echinococcus granulosus OX=6210 GN=EgrG_000797600 PE=4 SV=1)

HSP 1 Score: 764.992 bits (1974), Expect = 0.000e+0
Identity = 404/793 (50.95%), Postives = 545/793 (68.73%), Query Frame = 1
Query:  532 KWSNMQKENPLHLENPEQETRWYFKYFLGKLHQVYMGLISERDPXXXXXXXXXXXXXXXXQYRAIFWRKIGSQKLCIPYNTNSPMNIKKMLSLFDQQKFERFPKEIFNYEVQKDVLILEEQEGSVNFKFGVIYCEKGQNSDEEMYNNVKGSEDFDKFLNLLGDKVVLLNWDRFRGGLDVKNNTTGKYSYYTIYEGHEIMFHVSTALPLSSDNRQQIERKRHXXXXXXXXXXXXXXXXE-PFEKYWTPSMMKTHFTHIFAIVSYIHSRKVYRLSVYSEESVPLFGPPLPSPAEFVNFFEFREFLIVKLINGEKSAFNTPVFSEKRERTMEMLLNNILETYT-SDNINMLNRRAFSDIVLDQTNGISTTKEMNRNDAFIKFGQMLKVNIIIKGDAPTSNITTRVLKRVPWQPRIFANDLQFQIHCGDSWGEKLILGTDRGTFIVEENAAPAILIEKSCETKQIEIVENLGLMVFRCDKGRDSKIAIIQLSELKNIDILPMTKADVKKLSLDKTRGCHLFGLSKPHIQPMRLVVVVNRRLQIYVWKCVTCCXXXXXXXXXXXXXIDASFQYIRELPTFEIPQVLTILESQRHVQIIIGYKNQFDLIDEKTGDTTHLFKTDIIKSAMIAALDLYSEDEPELLLCYNRTCHFQKLKH--------------------------DGHPSEQS--------------SNYEFDFSWNFEPKNIVLVLPYILAFTQNAVEIRLVVNGSLVHTMSVPDCKLITSKIDLFFSTTADNLCKELIEKQKSGTSSFDRLYRVSNPL 2784
            K + +    P+HLENPE+ETRWYFKYFLGK H +Y G ISE+DP++++ V ++     + QYRAI W K GSQKLCI  +  S ++ KK+L LFD  + E+  KEI ++EVQK+VL LEEQEGSVNFKFGV+YC++GQ  DEEMYNN +GS  +  FL LLGD++ L NWDRF+GGLD K  TTG  S YTIYEGHEIMFHVST LP+S+DNRQQIERKRHIGNDIVNIIF +    E P    W PSMMKTHFTHIFAI++Y      YRLSV+SEESVP FGP +P+  EF +  E R FL+VKLINGEK+AF++PVF++KR RT EMLLNNILE Y   +N N   RRAFS+IV D T G  + K+ NRNDAFI+FGQMLK+N II+GDAPTS ITT + K +PWQPR         I  GD+WG+ L+   D G + +EE+  P +LI+KS + KQI++ E+ G+M+ R DKGR+S+I+++QLS+L   +++   +  VKK  LD++RGCH+F  S    +P+RLV  V +RL IY W+      SLSSWNQF+ S + A F ++RE+PT E  QVL++L+S    +I  GY+NQFDL+DE+TG+T HL++T+ +K+  +A +++ S+D+ ELLLC+NR C+ Q++                            +G  +  S              +  +++FSWNFEPK+IVL  PYIL FT++AVE RL++NGSLVHTM+VP+C L++SK D++F+++++ L + ++      +     L  + +PL
Sbjct:  127 KKNTLASGGPVHLENPERETRWYFKYFLGKAHHIYCGNISEKDPLLLAIVKSEFEAQGLRQYRAILWTKFGSQKLCISNSFASSVSPKKILCLFDIYRLEKGLKEILHHEVQKEVLTLEEQEGSVNFKFGVLYCKEGQTLDEEMYNNEEGSPQYQAFLRLLGDRIALKNWDRFKGGLDAKTETTGTESIYTIYEGHEIMFHVSTLLPISTDNRQQIERKRHIGNDIVNIIFYDASDVEKPL--LWKPSMMKTHFTHIFAIITYNKRTNAYRLSVFSEESVPYFGPTIPTSREFTDHEELRHFLLVKLINGEKAAFHSPVFAQKRIRTSEMLLNNILEKYGFENNTNGPYRRAFSEIVQDSTEGSPSAKDHNRNDAFIRFGQMLKLNTIIRGDAPTSCITTGISKHIPWQPRRLHIKAHADIASGDTWGKVLLACVDGGVYALEEHQQPLLLIDKSVDVKQIKVAESFGVMIIRYDKGRESRISVLQLSDLPLAEVI--DRVLVKKHMLDRSRGCHIFSTSTSATRPLRLVFAVGKRLLIYQWQVEITGRSLSSWNQFTYSELSARFVFVREIPTSEAVQVLSMLDSNMGGRICAGYRNQFDLLDERTGETLHLYRTENVKNQAVAVVEIRSDDDLELLLCFNRNCYLQRITKRSLLFHNHSDIFNTCSSLEGMEHQFAEGFSTTSSAIKSPVTSSRVQTAATTDYNFSWNFEPKHIVLAPPYILGFTESAVEFRLLMNGSLVHTMTVPNCLLLSSKQDIYFASSSEALHQSILSGDLCQSPHLHSLQTLESPL 915          
BLAST of GTPase-activating Rap/Ran-GAP domain protein 3 vs. TrEMBL
Match: A0A564ZFS7 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS15018 PE=4 SV=1)

HSP 1 Score: 763.837 bits (1971), Expect = 0.000e+0
Identity = 414/846 (48.94%), Postives = 561/846 (66.31%), Query Frame = 1
Query:  319 LENSTSNDGCQDLGFLSLYPRGSFSRKNYGSVEMLINRHMEGYTNNAGRFRVE--LGSSSSQSDLRGDPFVPSKWSNMQKENPLHLENPEQETRWYFKYFLGKLHQVYMGLISERDPXXXXXXXXXXXXXXXXQYRAIFWRKIGSQKLCIPYNTNSPMNIKKMLSLFDQQKFERFPKEIFNYEVQKDVLILEEQEGSVNFKFGVIYCEKGQNSDEEMYNNVKGSEDFDKFLNLLGDKVVLLNWDRFRGGLDVKNNTTGKYSYYTIYEGHEIMFHVSTALPLSSDNRQQIERKRHXXXXXXXXXXXXXXXXE-PFEKYWTPSMMKTHFTHIFAIVSYIHSRKVYRLSVYSEESVPLFGPPLPSPAEFVNFFEFREFLIVKLINGEKSAFNTPVFSEKRERTMEMLLNNILETY-TSDNINMLNRRAFSDIVLDQTNGISTTKEMNRNDAFIKFGQMLKVNIIIKGDAPTSNITTRVLKRVPWQPRIFANDLQFQIHCGDSWGEKLILGTDRGTFIVEENAAPAILIEKSCETKQIEIVENLGLMVFRCDKGRDSKIAIIQLSELKNIDILPMTKADVKKLSLDKTRGCHLFGLSKPHIQPMRLVVVVNRRLQIYVWKCVTCCXXXXXXXXXXXXXIDASFQYIRELPTFEIPQVLTILESQRHVQIIIGYKNQFDLIDEKTGDTTHLFKTDIIKSAMIAALDLYSEDEPELLLCYNRTCHFQKLKH--------------------------DGHPS--------------EQSSNYEFDFSWNFEPKNIVLVLPYILAFTQNAVEIRLVVNGSLVHTMSVPDCKLITSKIDLFFSTTADNLCKELI 2724
            L+ S   + C  +  LS    G  SR   G+   L  +       N G   VE           L  +  V  +  +     P+HLENPE+ETRWYFKYFLGK HQ+Y G ISE+DP++++ V ++     + QYRAI W K GSQKLCI  +  S ++ KK+L LFD  + E+  +EI  +E QK+ L LEEQEGSVNFKFGV+YC+ GQ SDEEMYNN  GS  +  FL LLGD++ L NWDRF+GGLD K  TTG  S YTIYEGHEIMFHVST LP+S+DNRQQIERKRHIGNDIVNIIF +    E P    W PSMMKTHFTHIFA+V+Y +    YRLSV+SEESVP FGP +P+  EF +  E R FL+VKLINGEK+AF++PVF++KR RT EMLLNNILE Y T +N N   RRAFS+IV D      ++K+ NR DAFI+FGQMLK+N II+GDAPTS ITT + K++PWQPR     +   I  GD+WG+ L+  TD G + +EE+  P +LI+KS + KQI++ E+ G+M+ R DKGR+S+I+++QLS+L   +++  T   VKK ++D+++GCH+F  S    +P+RLV  + +RL IY W+      SLSSWNQF+ S + A F Y+RE+PT E  QVL+IL+S    +I  GY+NQFDL+DE+TG+T HL++T+ +KS  +A +++ S+D+ ELLLC+NR C+ Q++                            +G  S              + ++  +++FSWNFEPK IVL  PYILAFT++A+E RL++NGSLVHTM+VP+C L++ K D++F+++++ L + ++
Sbjct:   74 LKTSALQESCPSIHLLS---GGGGSRNTAGTSTALQKKPQSSSAPNEGITGVEPIYSPPGHIVGLLKNRNVTKRSPSFSGGGPVHLENPERETRWYFKYFLGKAHQLYCGNISEKDPLLLAIVRSEFEAEGLRQYRAILWTKFGSQKLCISNSFTSSVSAKKILCLFDIYRLEKGLREILQFEAQKEALTLEEQEGSVNFKFGVLYCKDGQVSDEEMYNNETGSPQYQAFLRLLGDRIALKNWDRFKGGLDAKTETTGTESIYTIYEGHEIMFHVSTLLPISTDNRQQIERKRHIGNDIVNIIFFDTNDVEKPLS--WKPSMMKTHFTHIFAVVAYNNITNAYRLSVFSEESVPYFGPTIPTSREFTDHEELRHFLLVKLINGEKAAFHSPVFAQKRIRTSEMLLNNILEKYGTENNANGPYRRAFSEIVQDTAESSPSSKDQNRYDAFIRFGQMLKLNTIIRGDAPTSCITTGISKQIPWQPRRLHMKMHGDIISGDTWGKVLLTCTDGGVYALEEHQQPLLLIDKSVDVKQIKVAESFGVMIIRYDKGRESRISVLQLSDLPLTEVIDRTL--VKKHTIDRSKGCHIFSTSTSSTRPLRLVFAIGKRLLIYQWQVEITGRSLSSWNQFTYSELTARFVYVREVPTSEPVQVLSILDSNMGGRICAGYRNQFDLLDERTGETLHLYRTENVKSQAVAVVEIRSDDDLELLLCFNRNCYLQRITKRTMLFHNHSDIFNMCTSIEGMEHQYPEGFSSPGPTIKSSLTNSRVQTAATTDYNFSWNFEPKQIVLAPPYILAFTESAIEFRLIINGSLVHTMTVPNCLLLSYKYDIYFASSSEALHQSVL 912          
BLAST of GTPase-activating Rap/Ran-GAP domain protein 3 vs. TrEMBL
Match: A0A1S3K6C4 (GTPase-activating Rap/Ran-GAP domain-like protein 3 isoform X2 OS=Lingula unguis OX=7574 GN=LOC106178946 PE=4 SV=1)

HSP 1 Score: 763.451 bits (1970), Expect = 0.000e+0
Identity = 404/790 (51.14%), Postives = 560/790 (70.89%), Query Frame = 1
Query:  379 RGSFSRKNYGSVEMLINRHMEGYTNNA-GRFRVELGSSSSQSDLRGDPFVPSKWSNMQKENPLHLENPEQETRWYFKYFLGKLHQVYMGLISERDPXXXXXXXXXXXXXXXXQYRAIFWRKIGSQKLCIPYNTNSPMNIKKMLSLFDQQKFERFPKEIFNYEVQKDVLILEEQEGSVNFKFGVIYCEKGQNSDEEMYNNVKGSEDFDKFLNLLGDKVVLLNWDRFRGGLDVKNNTTGKYSYYTIYEGHEIMFHVSTALPLSSDNRQQIERKRHXXXXXXXXXXXXXXXXEPFEKYWTPSMMKTHFTHIFAIVSYIHSRKVYRLSVYSEESVPLFGPPLPSPAEFVNFFEFREFLIVKLINGEKSAFNTPVFSEKRERTMEMLLNNILETYTSD-NIN-MLNRRAFSDIVLDQTNGISTTKEMNRNDAFIKFGQMLKVNIIIKGDAPTSNITTRVLKRVPWQPRIFANDLQFQIHCGDSWGEKLILGTDRGTFIVEENAAPAILIEKSCETKQIEIVENLGLMVFRCDKGRDSKIAIIQLSELKN-IDILPMTKADVKKLSLDKTRGCHLFGLSKPHIQPMRLVVVVNRRLQIYVWKCVTCCXXXXXXXXXXXXXIDASFQYIRELPTFEIPQVLTILESQR-HVQIIIGYKNQFDLIDEKTGDTTHLFKTDIIKSAMIAALDLYSEDEPELLLCYNRTCHFQKLKHDGHPSEQSSNYEFDFSWNFEPKNIVLVLPYILAFTQNAVEIRLVVNGSLVHTMSVPDCKLITSKIDLFFSTTA-----DNLCKE 2718
            RG FSRK+YGSVE+L +   EG  + A GRFR+E G      +   D F PS   +     P+H+ENPE +TRWYFKYFLGK+HQ Y+GL ++++P ++S V+TD NN+NV QYRAI WRK G++K+C+PY+   P  +K +L  FD  K E+ P+EI+N EVQK++L+LEEQEGSVNFKFGV YC +GQ SD+EMY N KGS  FDKF++LLGD++ L  WDRF+GGLDVK+N+TG  S YT+YEGHEIMFHVS+ LP S+DN+QQ+ERKRHIGNDIVNII++    D+  +  + PSMMKTHFTHI+A+V Y      YRL+VYS ESVPLFGPPLP+PA F +  EFR+FL+VK INGEK+A  TPVF++KR RT++ML+ N  + +  + N N MLNRRAFSD++ D  +G S  KE  R   F++ GQ LK+NII+KGDAPTS ITT +LKR PW+P+ F +    +I CGDSWG+KLI+ T+ GT ++EE   P ++ +++   KQI++VE  GL++FR +KG+DSKI + +L++ +   + +  TK D +   +++++GCHL+ LS+P    +R+V+ + +RL +  WK     +  +        ++D  FQ++REL ++E P+++T+++  R   QI +GYK+Q+DLI+EK GDT HL   D  K  +++A+D+Y + E ELLLCYN  CHFQKL      +E +SN EFDF WN +P +IV   PYILA T + +EIRL++NGSLV T++ P   LITSK D++F++TA      + CKE
Sbjct:   77 RGMFSRKHYGSVELLTSSESEGTIHTAAGRFRIETG------EFEHDEF-PSPLGS-----PVHVENPEYQTRWYFKYFLGKMHQNYVGLDADKEPFILSVVVTDANNHNVPQYRAILWRKQGARKICLPYDPTKPKTVKGILGHFDMPKVEKGPREIYNAEVQKELLVLEEQEGSVNFKFGVTYCIEGQISDDEMYGNEKGSSSFDKFIHLLGDRIKLKGWDRFKGGLDVKSNSTGDDSVYTVYEGHEIMFHVSSLLPYSTDNKQQVERKRHIGNDIVNIIYVEMNSDQ--QPSFRPSMMKTHFTHIYALVVYEKDTDKYRLNVYSAESVPLFGPPLPTPAVFADHAEFRDFLLVKCINGEKAALCTPVFAQKRVRTLDMLIRNTYDNHMVEVNKNTMLNRRAFSDVIPDYQHG-SRRKEEARKLEFVRVGQALKLNIILKGDAPTSLITTGMLKREPWEPQCFYHSFPNEIICGDSWGDKLIIVTEVGTMVIEEGCIPRLIFDRTVSIKQIDVVEPHGLIIFRPEKGKDSKIHVFRLADFEGRTNSIVRTKLDSRDHKIERSKGCHLYALSRPGGSHLRMVIAIGKRLLVMSWK--HSAAWSAWCVSNDTETVDG-FQFLRELQSYETPELITLIDGPRGDNQICVGYKHQYDLINEKNGDTLHLHHVDASKVKLVSAIDIYEDSEAELLLCYNHVCHFQKL------TEDNSN-EFDFLWNSQPCSIVCAFPYILALTPDTMEIRLIINGSLVQTVTYPRLGLITSKCDIYFASTAMGYHSSDKCKE 841          
BLAST of GTPase-activating Rap/Ran-GAP domain protein 3 vs. Ensembl Cavefish
Match: si:ch211-182d3.1 (GTPase activating Rap/RanGAP domain like 3 [Source:NCBI gene;Acc:103036318])

HSP 1 Score: 634.41 bits (1635), Expect = 0.000e+0
Identity = 385/920 (41.85%), Postives = 563/920 (61.20%), Query Frame = 1
Query:  334 SNDGCQDLGFLSLYPRGSFSRKNYGSVEMLINRHMEGYTNNAGRFRVELGSSSSQSDLRGDPFVPSKWSNMQKENPLHLENPEQETRWYFKYFLGKLHQVYMGLISERDPXXXXXXXXXXXXXXXXQYRAIFWRKIGSQKLCIPYNTNSPMNIKKMLSLFDQQKFERFPKEIFNYEVQKDVLILEEQEGSVNFKFGVIYCEKGQNSDEEMYNNVKGSEDFDKFLNLLGDKVVLLNWDRFRGGLDVKNNTTGKYSYYTIYEGHEIMFHVSTALPLSSDNRQQIERKRHXXXXXXXXXXXXXXXXEPFEKYWTPSMMKTHFTHIFAIVSYIHSRKVYRLSVYSEESVPLFGPPLPSPAEFVNFFEFREFLIVKLINGEKSAFNTPVFSEKRERTMEMLLNNILETYTSD-------NINMLNRRAFSDIVLDQTNGISTTKEMNRNDAFIKFGQMLKVNIIIKGDAPTSNITTRVLKRVPWQPRIFANDLQFQIHCGDSWGEKLILGTDRGTFIVEENAAPAI------------LIEKSCETKQIEIVENLGLMVFRCDKGRDSKIAIIQLSELK-NID--ILPMTKADVKKLSLDKTRGCHLFGLSKPHIQPMRLVVVVNRRLQIYVWKC--VTCCXXXXXXXXXXXXXIDASFQYIRELPTFEIPQVLTILE---SQRHVQIIIGYKNQFDLIDEKTGDTTHLFKTDIIKSAMIAALDLYSEDEPELLLCYNRTCHFQKLK--HDGHPSEQSSNYEFDFSWNFEPKNIVLVLPYILAFTQNAVEIRLVVNGSLVHTMSVPDCKLITSKIDLFFSTTADNLCKELIEKQKSGTSSFDRLYRVSNPLSSIEYQELSQSPTMKRSMIFQRLHIYKISLSSMSGCSYQVPLNPKFRPNLLNSSKSENEADYKACLVAQTHSFA 3006
            ++   +DLG      RG FSRK+YGSVE+LI+   +G    AGRFRVE GS     D     + P  W    +   +HLENPE  TRW+FKYFLGK+HQ Y+G+ +E++P  +S V++D NN  V QYRAI WRK G+ K+ +PY+    +++K +LS  + ++FE+ P+EI N E+QKD+L+LEEQEGSVNFKFGV++ + GQ +D+EM++N  GSE+F+KFLNLLGDK+ L  W  +RGGLD KN+TTG  S YT+Y+GHE+MFHVST LP S +N+QQ+ERKRHIGNDIV I+F       P    + PSM+++HFTHIFA+V Y      YRL ++SEESVPLFGPPLP P  F +  EFR+FL+VKLINGEK+   TP F++KR+RT++ML+ ++ +    D         NMLNRR+FSD VL ++   +  KE  R   F++ GQ LK+  I+KGDAPTS + T + ++ PW+ + F +   + I CGDSWG+ L++ TD    ++ E + P +            + +K+   KQ+ ++E   L++ R DKG+D+++ + +LS LK  I+   L  TK D ++  L+KTRGCHL+ ++  H   +R+V  +  +L +   K       SS+      S+S ++  FQYIRE+   + P ++ +++    +    I + YK+QFDLI+E TGD   L   D  +   +AA+D+Y + E  LLLCYN  C ++K+   +   P  Q ++ +F FSWN  P +IV   PYILAFT +++EIRLVVNG+LV+T  VP+ +L+ S+ D++F ++A            +   S       S+P +   Y E+   P+           IYKI LS++ G S + PL       +L +  S   A   A ++A T S +
Sbjct:   33 TSSASEDLGCR----RGDFSRKHYGSVELLISSDADGAIQRAGRFRVENGSLDETMD-----YTPGTW----RRTDVHLENPEYHTRWFFKYFLGKVHQNYVGVDAEKNPFYLSVVLSDQNNQRVPQYRAILWRKTGTLKISLPYSPTKTLSVKSILSAMNMERFEKGPREILNPEIQKDLLVLEEQEGSVNFKFGVLFAKDGQLTDDEMFSNETGSENFEKFLNLLGDKICLQGWAGYRGGLDTKNDTTGINSIYTVYQGHELMFHVSTMLPYSKENKQQVERKRHIGNDIVTIVFQEGDDASP---SFKPSMIRSHFTHIFALVRYNSQNDSYRLKIFSEESVPLFGPPLPPPPVFTDHQEFRDFLLVKLINGEKATLETPTFAQKRQRTLDMLIRSLYQDLMPDLHKVPFSPQNMLNRRSFSD-VLPESPKSARKKEEARQAEFVRIGQALKLKTIVKGDAPTSLVNTGLCRKEPWESQSFCSSFAYDIVCGDSWGQSLLVATDSAGVMLLEASDPLLSNADSPALPPVQVFDKTLTVKQMHVLEPQDLLITRADKGKDARLYVYRLSTLKRGIEERQLVRTKCDSRENKLEKTRGCHLYSINTHHGVELRIVAAIRNKLLLITRKQPRFDSISSVGISTGTSDSPVE-EFQYIREICLCDTPVIMALVDGPTGENDHMICVAYKHQFDLINESTGDAYRLHHVDSNRVNFVAAIDVYEDGEAGLLLCYNNLCAYKKVCPFNGATPMIQPNSSDFHFSWNQMPNSIVCAFPYILAFTTDSIEIRLVVNGNLVYTAVVPELQLVASRSDIYFISSA--------PVNSASNCSSRDTSSQSSPQTPTGY-EMPIFPSPLGDAEAPSKQIYKIPLSNLVGRSIERPLKSPLVNKVLTAPGSGVIA--PAPMIATTPSLS 923          
BLAST of GTPase-activating Rap/Ran-GAP domain protein 3 vs. Ensembl Cavefish
Match: si:ch211-182d3.1 (GTPase activating Rap/RanGAP domain like 3 [Source:NCBI gene;Acc:103036318])

HSP 1 Score: 634.41 bits (1635), Expect = 0.000e+0
Identity = 362/818 (44.25%), Postives = 527/818 (64.43%), Query Frame = 1
Query:  334 SNDGCQDLGFLSLYPRGSFSRKNYGSVEMLINRHMEGYTNNAGRFRVELGSSSSQSDLRGDPFVPSKWSNMQKENPLHLENPEQETRWYFKYFLGKLHQVYMGLISERDPXXXXXXXXXXXXXXXXQYRAIFWRKIGSQKLCIPYNTNSPMNIKKMLSLFDQQKFERFPKEIFNYEVQKDVLILEEQEGSVNFKFGVIYCEKGQNSDEEMYNNVKGSEDFDKFLNLLGDKVVLLNWDRFRGGLDVKNNTTGKYSYYTIYEGHEIMFHVSTALPLSSDNRQQIERKRHXXXXXXXXXXXXXXXXEPFEKYWTPSMMKTHFTHIFAIVSYIHSRKVYRLSVYSEESVPLFGPPLPSPAEFVNFFEFREFLIVKLINGEKSAFNTPVFSEKRERTMEMLLNNILETYTSD-------NINMLNRRAFSDIVLDQTNGISTTKEMNRNDAFIKFGQMLKVNIIIKGDAPTSNITTRVLKRVPWQPRIFANDLQFQIHCGDSWGEKLILGTDRGTFIVEENAAPAI------------LIEKSCETKQIEIVENLGLMVFRCDKGRDSKIAIIQLSELK-NID--ILPMTKADVKKLSLDKTRGCHLFGLSKPHIQPMRLVVVVNRRLQIYVWKC--VTCCXXXXXXXXXXXXXIDASFQYIRELPTFEIPQVLTILE---SQRHVQIIIGYKNQFDLIDEKTGDTTHLFKTDIIKSAMIAALDLYSEDEPELLLCYNRTCHFQKLK--HDGHPSEQSSNYEFDFSWNFEPKNIVLVLPYILAFTQNAVEIRLVVNGSLVHTMSVPDCKLITSKIDLFFSTTA 2700
            ++   +DLG      RG FSRK+YGSVE+LI+   +G    AGRFRVE GS     D     + P  W    +   +HLENPE  TRW+FKYFLGK+HQ Y+G+ +E++P  +S V++D NN  V QYRAI WRK G+ K+ +PY+    +++K +LS  + ++FE+ P+EI N E+QKD+L+LEEQEGSVNFKFGV++ + GQ +D+EM++N  GSE+F+KFLNLLGDK+ L  W  +RGGLD KN+TTG  S YT+Y+GHE+MFHVST LP S +N+QQ+ERKRHIGNDIV I+F       P    + PSM+++HFTHIFA+V Y      YRL ++SEESVPLFGPPLP P  F +  EFR+FL+VKLINGEK+   TP F++KR+RT++ML+ ++ +    D         NMLNRR+FSD VL ++   +  KE  R   F++ GQ LK+  I+KGDAPTS + T + ++ PW+ + F +   + I CGDSWG+ L++ TD    ++ E + P +            + +K+   KQ+ ++E   L++ R DKG+D+++ + +LS LK  I+   L  TK D ++  L+KTRGCHL+ ++  H   +R+V  +  +L +   K       SS+      S+S ++  FQYIRE+   + P ++ +++    +    I + YK+QFDLI+E TGD   L   D  +   +AA+D+Y + E  LLLCYN  C ++K+   +   P  Q ++ +F FSWN  P +IV   PYILAFT +++EIRLVVNG+LV+T  VP+ +L+ S+ D++F ++A
Sbjct:   33 TSSASEDLGCR----RGDFSRKHYGSVELLISSDADGAIQRAGRFRVENGSLDETMD-----YTPGTW----RRTDVHLENPEYHTRWFFKYFLGKVHQNYVGVDAEKNPFYLSVVLSDQNNQRVPQYRAILWRKTGTLKISLPYSPTKTLSVKSILSAMNMERFEKGPREILNPEIQKDLLVLEEQEGSVNFKFGVLFAKDGQLTDDEMFSNETGSENFEKFLNLLGDKICLQGWAGYRGGLDTKNDTTGINSIYTVYQGHELMFHVSTMLPYSKENKQQVERKRHIGNDIVTIVFQEGDDASP---SFKPSMIRSHFTHIFALVRYNSQNDSYRLKIFSEESVPLFGPPLPPPPVFTDHQEFRDFLLVKLINGEKATLETPTFAQKRQRTLDMLIRSLYQDLMPDLHKVPFSPQNMLNRRSFSD-VLPESPKSARKKEEARQAEFVRIGQALKLKTIVKGDAPTSLVNTGLCRKEPWESQSFCSSFAYDIVCGDSWGQSLLVATDSAGVMLLEASDPLLSNADSPALPPVQVFDKTLTVKQMHVLEPQDLLITRADKGKDARLYVYRLSTLKRGIEERQLVRTKCDSRENKLEKTRGCHLYSINTHHGVELRIVAAIRNKLLLITRKQPRFDSISSVGISTGTSDSPVE-EFQYIREICLCDTPVIMALVDGPTGENDHMICVAYKHQFDLINESTGDAYRLHHVDSNRVNFVAAIDVYEDGEAGLLLCYNNLCAYKKVCPFNGATPMIQPNSSDFHFSWNQMPNSIVCAFPYILAFTTDSIEIRLVVNGNLVYTAVVPELQLVASRSDIYFISSA 832          
BLAST of GTPase-activating Rap/Ran-GAP domain protein 3 vs. Ensembl Cavefish
Match: si:ch211-182d3.1 (GTPase activating Rap/RanGAP domain like 3 [Source:NCBI gene;Acc:103036318])

HSP 1 Score: 634.024 bits (1634), Expect = 0.000e+0
Identity = 359/803 (44.71%), Postives = 521/803 (64.88%), Query Frame = 1
Query:  379 RGSFSRKNYGSVEMLINRHMEGYTNNAGRFRVELGSSSSQSDLRGDPFVPSKWSNMQKENPLHLENPEQETRWYFKYFLGKLHQVYMGLISERDPXXXXXXXXXXXXXXXXQYRAIFWRKIGSQKLCIPYNTNSPMNIKKMLSLFDQQKFERFPKEIFNYEVQKDVLILEEQEGSVNFKFGVIYCEKGQNSDEEMYNNVKGSEDFDKFLNLLGDKVVLLNWDRFRGGLDVKNNTTGKYSYYTIYEGHEIMFHVSTALPLSSDNRQQIERKRHXXXXXXXXXXXXXXXXEPFEKYWTPSMMKTHFTHIFAIVSYIHSRKVYRLSVYSEESVPLFGPPLPSPAEFVNFFEFREFLIVKLINGEKSAFNTPVFSEKRERTMEMLLNNILETYTSD-------NINMLNRRAFSDIVLDQTNGISTTKEMNRNDAFIKFGQMLKVNIIIKGDAPTSNITTRVLKRVPWQPRIFANDLQFQIHCGDSWGEKLILGTDRGTFIVEENAAPAI------------LIEKSCETKQIEIVENLGLMVFRCDKGRDSKIAIIQLSELK-NID--ILPMTKADVKKLSLDKTRGCHLFGLSKPHIQPMRLVVVVNRRLQIYVWKC--VTCCXXXXXXXXXXXXXIDASFQYIRELPTFEIPQVLTILE---SQRHVQIIIGYKNQFDLIDEKTGDTTHLFKTDIIKSAMIAALDLYSEDEPELLLCYNRTCHFQKLK--HDGHPSEQSSNYEFDFSWNFEPKNIVLVLPYILAFTQNAVEIRLVVNGSLVHTMSVPDCKLITSKIDLFFSTTA 2700
            RG FSRK+YGSVE+LI+   +G    AGRFRVE GS     D     + P  W    +   +HLENPE  TRW+FKYFLGK+HQ Y+G+ +E++P  +S V++D NN  V QYRAI WRK G+ K+ +PY+    +++K +LS  + ++FE+ P+EI N E+QKD+L+LEEQEGSVNFKFGV++ + GQ +D+EM++N  GSE+F+KFLNLLGDK+ L  W  +RGGLD KN+TTG  S YT+Y+GHE+MFHVST LP S +N+QQ+ERKRHIGNDIV I+F       P    + PSM+++HFTHIFA+V Y      YRL ++SEESVPLFGPPLP P  F +  EFR+FL+VKLINGEK+   TP F++KR+RT++ML+ ++ +    D         NMLNRR+FSD VL ++   +  KE  R   F++ GQ LK+  I+KGDAPTS + T + ++ PW+ + F +   + I CGDSWG+ L++ TD    ++ E + P +            + +K+   KQ+ ++E   L++ R DKG+D+++ + +LS LK  I+   L  TK D ++  L+KTRGCHL+ ++  H   +R+V  +  +L +   K       SS+      S+S ++  FQYIRE+   + P ++ +++    +    I + YK+QFDLI+E TGD   L   D  +   +AA+D+Y + E  LLLCYN  C ++K+   +   P  Q ++ +F FSWN  P +IV   PYILAFT +++EIRLVVNG+LV+T  VP+ +L+ S+ D++F ++A
Sbjct:   27 RGDFSRKHYGSVELLISSDADGAIQRAGRFRVENGSLDETMD-----YTPGTW----RRTDVHLENPEYHTRWFFKYFLGKVHQNYVGVDAEKNPFYLSVVLSDQNNQRVPQYRAILWRKTGTLKISLPYSPTKTLSVKSILSAMNMERFEKGPREILNPEIQKDLLVLEEQEGSVNFKFGVLFAKDGQLTDDEMFSNETGSENFEKFLNLLGDKICLQGWAGYRGGLDTKNDTTGINSIYTVYQGHELMFHVSTMLPYSKENKQQVERKRHIGNDIVTIVFQEGDDASP---SFKPSMIRSHFTHIFALVRYNSQNDSYRLKIFSEESVPLFGPPLPPPPVFTDHQEFRDFLLVKLINGEKATLETPTFAQKRQRTLDMLIRSLYQDLMPDLHKVPFSPQNMLNRRSFSD-VLPESPKSARKKEEARQAEFVRIGQALKLKTIVKGDAPTSLVNTGLCRKEPWESQSFCSSFAYDIVCGDSWGQSLLVATDSAGVMLLEASDPLLSNADSPALPPVQVFDKTLTVKQMHVLEPQDLLITRADKGKDARLYVYRLSTLKRGIEERQLVRTKCDSRENKLEKTRGCHLYSINTHHGVELRIVAAIRNKLLLITRKQPRFDSISSVGISTGTSDSPVE-EFQYIREICLCDTPVIMALVDGPTGENDHMICVAYKHQFDLINESTGDAYRLHHVDSNRVNFVAAIDVYEDGEAGLLLCYNNLCAYKKVCPFNGATPMIQPNSSDFHFSWNQMPNSIVCAFPYILAFTTDSIEIRLVVNGNLVYTAVVPELQLVASRSDIYFISSA 815          
BLAST of GTPase-activating Rap/Ran-GAP domain protein 3 vs. Ensembl Cavefish
Match: si:ch211-182d3.1 (GTPase activating Rap/RanGAP domain like 3 [Source:NCBI gene;Acc:103036318])

HSP 1 Score: 534.258 bits (1375), Expect = 8.184e-177
Identity = 320/736 (43.48%), Postives = 460/736 (62.50%), Query Frame = 1
Query:  379 RGSFSRKNYGSVEMLINRHMEGYTNNAGRFRVELGSSSSQSDLRGDPFVPSKWSNMQKENPLHLENPEQETRWYFKYFLGKLHQVYMGLISERDPXXXXXXXXXXXXXXXXQYRAIFWRKIGSQKLCIPYNTNSPMNIKKMLSLFDQQKFERFPKEIFNYEVQKDVLILEEQEGSVNFKFGVIYCEKGQNSDEEMYNNVKGSEDFDKFLNLLGDKVVLLNWDRFRGGLDVKNNTTGKYSYYTIYEGHEIMFHVSTALPLSSDNRQQIERKRHXXXXXXXXXXXXXXXXEPFEKYWTPSMMKTHFTHIFAIVSYIHSRKVYRLSVYSEESVPLFGPPLPSPAEFVNFFEFREFLIVKLINGEKSAFNTPVFSEKRERTMEMLLNNILETYTSD-NINMLNRRAFSDIVLDQTNGISTTKEMNRNDAFIKFGQMLKVNIIIKGDAPTSNITTRVLKRVPWQPRIFANDLQFQIHCGDSWGEKLILGTDRGTFIVEENAAPAILIEKSCETKQIEIVENLGLMVFRCDKGRDSKIAIIQLSELK-NID--ILPMTKADVKKLSLDKTRGCHLFGLSKPHIQPMRLVVVVNRRLQIYVWKC--VTCCXXXXXXXXXXXXXIDASFQYIRELPTFEIPQVLTILE---SQRHVQIIIGYKNQFDLIDEKTGDTTHLFKTDIIKSAMIAALDLYSEDEPELLLCYNRTCHFQKLK--HDGHPSEQSSNYEFDFSWNFEPKNI 2553
            RG FSRK+YGSVE+LI+   +G    AGRFRVE GS     D     + P  W    +   +HLENPE  TRW+FKYFLGK+HQ Y+G+ +E++P  +S V++D NN  V QYRAI W                  +I  +LS  + ++FE+ P+EI N E+QK         GSVNFKFGV++ + GQ +D+EM++N  GSE+F+KFLNLLGDK+ L  W  +RGGLD KN+TTG  S YT+Y+GHE+MFHVST LP S +N+QQ+ERKRHIGNDIV I+F       P    + PSM+++HFTHIFA+V Y      YRL ++SEESVPLFGPPLP P  F +  EFR+FL+VKLINGEK+   TP F++KR+RT++ML+ ++ +    D + NMLNRR+FSD VL ++   +  KE  R   F++ GQ LK+  I+KGDAPTS + T + ++ PW+ + F +   + I CGDSWG+ L++ TD    ++ E   P  + +K+   KQ+ ++E   L++ R DKG+D+++ + +LS LK  I+   L  TK D ++  L+KTRGCHL+ ++  H   +R+V  +  +L +   K       SS+      S+S ++  FQYIRE+   + P ++ +++    +    I + YK+QFDLI+E TGD   L   D  +   +AA+D+Y + E  LLLCYN  C ++K+   +   P  Q ++ +F FSWN  P +I
Sbjct:   18 RGDFSRKHYGSVELLISSDADGAIQRAGRFRVENGSLDETMD-----YTPGTW----RRTDVHLENPEYHTRWFFKYFLGKVHQNYVGVDAEKNPFYLSVVLSDQNNQRVPQYRAILWE-----------------SITNLLSAMNMERFEKGPREILNPEIQK-------VRGSVNFKFGVLFAKDGQLTDDEMFSNETGSENFEKFLNLLGDKICLQGWAGYRGGLDTKNDTTGINSIYTVYQGHELMFHVSTMLPYSKENKQQVERKRHIGNDIVTIVFQEGDDASP---SFKPSMIRSHFTHIFALVRYNSQNDSYRLKIFSEESVPLFGPPLPPPPVFTDHQEFRDFLLVKLINGEKATLETPTFAQKRQRTLDMLIRSLYQDLMPDLHKNMLNRRSFSD-VLPESPKSARKKEEARQAEFVRIGQALKLKTIVKGDAPTSLVNTGLCRKEPWESQSFCSSFAYDIVCGDSWGQSLLVATDSAGVMLLEALPPVQVFDKTLTVKQMHVLEPQDLLITRADKGKDARLYVYRLSTLKRGIEERQLVRTKCDSRENKLEKTRGCHLYSINTHHGVELRIVAAIRNKLLLITRKQPRFDSISSVGISTGTSDSPVE-EFQYIREICLCDTPVIMALVDGPTGENDHMICVAYKHQFDLINESTGDAYRLHHVDSNRVNFVAAIDVYEDGEAGLLLCYNNLCAYKKVCPFNGATPMIQPNSSDFHFSWNQMPNSI 715          
BLAST of GTPase-activating Rap/Ran-GAP domain protein 3 vs. Ensembl Cavefish
Match: zmp:0000001168 (signal-induced proliferation-associated 1 [Source:HGNC Symbol;Acc:HGNC:10885])

HSP 1 Score: 179.489 bits (454), Expect = 1.144e-45
Identity = 115/345 (33.33%), Postives = 180/345 (52.17%), Query Frame = 1
Query:  568 LENPEQETRWYFKYFLGKLHQVYMGLISERDPXXXXXXXXXXXXXXXXQYR-AIFWRKIGSQKL-------CIP----YNTNSPMNIKKMLS-LFDQQKFERFPKEIFNYEVQKDVLILEEQEGSVNFKFGVIYCEKGQNSDEEMYNNVKGSEDFDKFLNLLGDKVVLLNWDRFRGGLDVKNNTTGKYSYYTIYEGHEIMFHVSTALPLSSDNRQQIERKRHXXXXXXXXXXXXXXXXEPFEKYWTPSMMKTHFTHIFAIVSYIH----SRKVYRLSVYSEESVPLFGPPLPSPAEFVNFFEFREFLIVKLINGEKSAFNTPVFSEKRERTMEMLLNNILETYTS 1551
            +E+ +   R+Y KYF  K HQ + G+     PV IS    +    +  QY   I +R    + L        +P    + T   ++ K++L  +              + +V+  +L L+EQ  +   K GV+YC  GQ+++E+MYNN    E FD+FL+LLG++V L  W+++R  LD K ++TG +S YT Y+ +EIMFHVST LP +++N QQ+ RKRH     +    +  +  EP    +TP  +++HF H+F IV  +H        YR++V   + +PLFGP  P  A F     FR+FL+ K IN E +A  +  F     RT +  L ++ E Y +
Sbjct:  212 IEHADLGARYYHKYFYMKDHQNFFGMDDRLGPVAISFRREEKEGTSGAQYNYRIIFRTTELKTLRGSILEESVPSAARHTTPRGLSPKRLLEFILPDLNLHCLRLASTSPKVRDTLLKLDEQGLNFQRKVGVMYCRAGQSTEEDMYNNESAGEAFDEFLDLLGERVRLKGWEKYRAQLDTKTDSTGTHSLYTRYQDYEIMFHVSTMLPYTANNTQQLLRKRH-----IGNDIVTIVFQEPGALPFTPKAIRSHFQHVFIIVR-VHEPCSENTYYRVAVTRSKDIPLFGPLFPKGARFPRTPAFRDFLLAKAINAENAAEKSEKFRSMATRTRQEYLKDLAENYVT 550          
BLAST of GTPase-activating Rap/Ran-GAP domain protein 3 vs. Ensembl Sea Lamprey
Match: rap1gap (RAP1 GTPase activating protein [Source:ZFIN;Acc:ZDB-GENE-080402-9])

HSP 1 Score: 140.198 bits (352), Expect = 4.218e-37
Identity = 85/214 (39.72%), Postives = 121/214 (56.54%), Query Frame = 1
Query:  940 GQNSDEEMYNNVKGSEDFDKFLNLLGDKVVLLNWDRFRGGLDVKNNTTGKYSYYTIYEGHEIMFHVSTALPLSSDNRQQIERKRHXXXXXXXXXXXXXXXXEPFEKYWTPSMMKTHFTHIFAIVSYIH---SRKVYRLSVYSEESVPLFGPPLPSPAEFVNFFEFREFLIVKLINGEKSAFNTPVFSEKRERTMEMLLNNILETYTSDNINMLN 1572
            GQ ++ E++ N + S   D FL +LGD V L N+  FRGGLDV +  TG  S YT +   E+MFH+ST LP +  + QQ++RKRHIGNDIV ++F  +    PF     P M+ ++F H + +V           Y+++V +   VP+FGPPLP P  F      REFL+ KLIN E +++    FS   ERT   LL+ + E   + +  ML 
Sbjct:    1 GQKTEGEVFGNRQESAALDAFLGMLGDPVQLHNFSGFRGGLDVTHGQTGSESVYTRFLDREVMFHISTKLPYTEGDAQQLQRKRHIGNDIVALVFQEEST--PF----VPDMIASNFLHAYVVVQPFRPGDGSTWYKVAVTARNDVPMFGPPLPDPPVFKKGEALREFLLTKLINAEHASYKARKFSALEERTRAALLDTLYEELHARSQCMLG 208          
BLAST of GTPase-activating Rap/Ran-GAP domain protein 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000819.1 (pep scaffold:Pmarinus_7.0:GL483423:14336:19151:-1 gene:ENSPMAG00000000748.1 transcript:ENSPMAT00000000819.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.4774 bits (171), Expect = 4.471e-13
Identity = 40/123 (32.52%), Postives = 62/123 (50.41%), Query Frame = 1
Query: 1243 EPFEKYWTPSMMKTHFTHIFAIVSYIHSRK----VYRLSVYSEESVPLFGPPLPSPAEFVNFFEFREFLIVKLINGEKSAFNTPVFSEKRERTMEMLLNNILETYTSDNINMLNRRAFSDIVL 1599
            EP    +TP  +++HF H+F IV  +H+       Y ++V   + VP FGPP+P    F     FR+FL+ K+INGE +A  +  F     RT +  L ++ E + +        R+F  I L
Sbjct:   19 EPGALPFTPKNIRSHFQHVFVIVR-VHNPGSENVCYSVAVTRSKDVPPFGPPIPKGVTFPKSAVFRDFLLAKVINGENAAHKSDKFRAMAARTRQEYLRDLAENHVTTGTVESAARSFGFIPL 140          
BLAST of GTPase-activating Rap/Ran-GAP domain protein 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003319.1 (pep scaffold:Pmarinus_7.0:GL478269:10551:16928:1 gene:ENSPMAG00000003039.1 transcript:ENSPMAT00000003319.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.1434 bits (126), Expect = 6.275e-8
Identity = 44/157 (28.03%), Postives = 78/157 (49.68%), Query Frame = 1
Query:  913 KFGVIYCEKGQNSDEEMYNNVKGSEDFDKFLNLLGDKVVLLNWDRFRGGLDVKNNTTGKYSYYTIYEGHEIMFHVSTALPLSSDNRQQIERKRHXXXXXXXXXXXXXXXXEPFEKYWTPSMMKTHFTHIFAIVSYIHSRKVYRLSVYSEESVPLFGP 1383
            K  V++  +GQ     + +N  GS+ ++ FL  LG +V L     F GGL  +N + G  + Y      E+++HVST +P  +D+    ++ RH+GND V++++          + +   ++ T F  +  IV Y      +R+ +  +  VP FGP
Sbjct:   36 KIAVLFVAEGQEDKHSILSNAGGSQSYEDFLAGLGWEVDLTRHCGFLGGLQ-RNGSNGLTAPYYATSTVEVIYHVSTRMPSDTDD-ALTKKLRHLGNDEVHVVWCEHT------REYRRDIIPTEFRDVL-IVIYPLRGHTFRICIMKKTEVPFFGP 183          
BLAST of GTPase-activating Rap/Ran-GAP domain protein 3 vs. Ensembl Sea Lamprey
Match: ralgapa1 (Ral GTPase activating protein, alpha subunit 1 (catalytic) [Source:ZFIN;Acc:ZDB-GENE-080806-1])

HSP 1 Score: 50.8322 bits (120), Expect = 2.087e-6
Identity = 46/177 (25.99%), Postives = 88/177 (49.72%), Query Frame = 1
Query:  853 NYEVQKDVLILEEQEGSVNFKFGVIYCEKGQNSDEEMYNNVKGSEDFDKFLNLLGDKVVLLNWDRFRGGLDVKNNTTGKYSYYTIYEGHEIMFHVSTALPLSSDNRQQIERKRHXXXXXXXXXXXXXXXXEPFEKYWTPSMMKTHFTHIFAIVSYIHSRKVYRLSVYSEESVPLFGP 1383
            N ++ +++  L+ ++     K  V+Y  +GQ     + +N  GS  ++ F+  LG +V L     F GGL   N + G  + Y      E++FHVST +P  SD+    ++ RHIGND V+I++          + +   ++ T F  +  +++   + +++ + +  +  VP FGP
Sbjct: 1454 NEKLLRELKNLDSRQCRETHKIAVLYVAEGQEDKLSILSNQGGSRAYEDFIAGLGWEVDLTTHCGFMGGLQ-HNRSNGFSAPYYATSTMEVIFHVSTRMPSESDD-SVTKKLRHIGNDEVHIVWSE------HSRDYRRGIIPTEFGDVLIVITPTKN-QLFSIQIIKKPEVPFFGP 1621          
BLAST of GTPase-activating Rap/Ran-GAP domain protein 3 vs. Ensembl Nematostella
Match: EDO36502 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIF7])

HSP 1 Score: 578.556 bits (1490), Expect = 0.000e+0
Identity = 309/710 (43.52%), Postives = 464/710 (65.35%), Query Frame = 1
Query:  562 LHLENPEQETRWYFKYFLGKLHQVYMGLISERDPXXXXXXXXXXXXXXXXQYRAIFWRKIGSQKLCIPYNTNSPMNIKKMLSLFDQQKFERFPKEIFNYEVQKDVLILEEQEGSVNFKFGVIYCEKGQNSDEEMYNNVKGSEDFDKFLNLLGDKVVLLNWDRFRGGLDVKNNTTGKYSYYTIYEGHEIMFHVSTALPLSSDNRQQIERKRHXXXXXXXXXXXXXXXXEPFEKYWTPSMMKTHFTHIFAIVSYIHSRKVYRLSVYSEESVPLFGPPLPSPAEFVNFFEFREFLIVKLINGEKSAFNTPVFSEKRERTMEMLLNNILETYTSDNINMLNRRAFSDIVLDQTNGISTTKEMNRNDAFIKFGQMLKVNIIIKGDAPTSNITTRVLKRVPWQPRIFANDLQFQIHCGDSWGEKLILGTDRGTFIVEENAAPAILIEKSCETKQIEIVENLGLMVFRCDKGRD---SKIAIIQLSELKNIDILPMTKADVKKLSLDKTRGCHLFGLSKPHIQPMRLVVVVNRRLQIYVWKCVTCCXXXXXXXXXXXXXIDASFQYIRELPTFEIPQVLTIL--ESQRHVQIIIGYKNQFDLIDEKTGDTTHLFKTDIIKSAMIAALDLYSEDEPELLLCYNRTCHFQKLKHDGHPSEQSSNYEFDFSWNFEPKNIVLVLPYILAFTQNAVEIRLVVNGSLVHTMSVPDCKLITSKI 2676
            +HLENPE  TRWYFKYFLGK+HQ Y+ L   ++P+V+S  +TD +N  V QYRAI WRK GS+K+CI Y+ N P++ K +L  F  +K E+ P+E+ + E Q+++L LEEQEGSVN+KFGV+Y + GQ SD+EM++N  GSE+F++FL LLGD+V L  W  +RGGLDVKN+ TG  S +TIYEGHEIMFHVS+ LP + DN QQ+ERKRH       +  +    D+ ++  ++P  +K+ F HIFA+V+Y      YR++VYSE +VP+FGPPLP P  F +  EFR FL+VKLINGEK+A+ +P+FS +R+RT++ L+  + + +  + +++  R ++ + + +   G    K   R   F++FGQ LK+  I+KGDAPTS  T+      PWQP+    D   ++ CGDSWG+ ++LGT+ G ++V+E  +   L ++S   +Q+ ++E  GL++FR +K ++    ++ + +LS+L+  + +  T+ D KK  LD+T+GCHLF   +   QP+ L V   R++ +  WK        SSW   +   +   F+ IRE+   E   +LTIL  ESQ  + +  GYKN FDL+ ++TG+   +   D  K+ +++A+D+Y + EPELLL +NR C F++L       + SSN  F  +WN  P+ +V   PY+LAFT N +EIRLVVNG+LVHT+ +P+ ++ITSK+
Sbjct:    1 VHLENPEFHTRWYFKYFLGKVHQNYVALDGIKNPIVLSVCLTDADNYGVPQYRAILWRKTGSEKICIVYSPNKPISAKVILKSFGVEKLEKGPREVSSPEFQQELLTLEEQEGSVNYKFGVLYAKAGQTSDDEMFSNETGSEEFNRFLELLGDRVELQGWQGYRGGLDVKNDMTGSQSVFTIYEGHEIMFHVSSLLPYTPDNPQQVERKRH--IGNDIVTIVFQDTDDEYKPSFSPLGVKSKFIHIFALVTYNKHDDSYRVTVYSERNVPIFGPPLPCPPVFHSHLEFRNFLLVKLINGEKAAYASPIFSIRRQRTLDSLITRLWQDHMHEKLSV--RNSWGNAISESPRG-HRRKHSEREQLFLQFGQSLKLKTIVKGDAPTSLQTSTSANIKPWQPQFVYEDFPHKVLCGDSWGDSVLLGTEEGIYLVQEGKSMRQLFDRSVICQQLYVLEAYGLLLFRVEKSKEFHNPRVCVFKLSDLEEDEDVVFTREDCKKHKLDRTKGCHLFAALRSS-QPLFLAVACGRKVALLKWKHPLVW---SSWAVGNVRDMTEGFELIREVTFSEPAILLTILLTESQEPL-LCAGYKNNFDLV-QRTGEIKRVHSVDTQKTTLVSAIDVYEDHEPELLLTFNRKCLFKRLN-----GKNSSN--FYLNWNSAPQFVVCAFPYLLAFTTNTIEIRLVVNGNLVHTLVLPNLRVITSKV 692          
BLAST of GTPase-activating Rap/Ran-GAP domain protein 3 vs. Ensembl Nematostella
Match: EDO42942 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S022])

HSP 1 Score: 168.318 bits (425), Expect = 3.791e-44
Identity = 88/234 (37.61%), Postives = 138/234 (58.97%), Query Frame = 1
Query:  859 EVQKDVLILEEQEGSVNFKFGVIYCEKGQNSDEEMYNNVKGSEDFDKFLNLLGDKVVLLNWDRFRGGLDVKNNTTGKYSYYTIYEGHEIMFHVSTALPLSSDNRQQIERKRHXXXXXXXXXXXXXXXXEPFEKYWTPSMMKTHFTHIFAIVSYIH---SRKVYRLSVYSEESVPLFGPPLPSPAEFVNFFEFREFLIVKLINGEKSAFNTPVFSEKRERTMEMLLNNILETYTS 1551
            +V + ++ L+EQ  +  +K G++YC+ GQ+++EEMYNN   S  FD+FLNL+G KV L  +D +R  LD +N++TG+YS YT +   EIMFHVST LP + +N+QQ+ RKRH     +    +  +  EP    +TP  +++HF H+F ++   +       YR+++   + VP FGPP+P+  +F     F  FL+ K+IN E +A  +  FS    RT    L ++   Y S
Sbjct:  101 KVPEQLMKLDEQGMTNQYKVGILYCKAGQSTEEEMYNNQVSSPAFDEFLNLIGKKVRLKGFDGYRAQLDNRNDSTGEYSVYTKFNNREIMFHVSTLLPWTPNNKQQLLRKRH-----IGNDIVTIVFQEPGALAFTPKNIRSHFQHVFIVIRVFNPCSDNTYYRVAMSRSKDVPPFGPPIPAGPKFGKQKAFANFLLAKIINAENAAHKSEKFSAMATRTRHEYLKDLATNYIS 329          
BLAST of GTPase-activating Rap/Ran-GAP domain protein 3 vs. Ensembl Nematostella
Match: EDO39335 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAA4])

HSP 1 Score: 125.946 bits (315), Expect = 1.256e-31
Identity = 76/197 (38.58%), Postives = 118/197 (59.90%), Query Frame = 1
Query:  910 FKFGVIYCEKGQNSDEEMYNNVKGSEDFDKFLNLLGDKVVLLNWDRFRGGLDVKNNTTGKYSYYTIYEGHEIMFHVSTALPLSSDNRQQIERKRHXXXXXXXXXXXXXXXXEPFEKYWTPSMMKTHFTHIFAIVSYIHSRKVYR--LSVYSEESVPLFGPPLPSPAEFVNFFEFREFLIVKLINGEKSAFNTPVFSE 1494
            +K G++Y ++GQ ++E M+ N + S  FD FL  LGD+V +  + ++RGGLD  N+ TG +S +T Y   ++MFHVST LP   ++ Q+++RKRHIGNDIV ++F+     +     + P+ +K+ F H F +V    S   Y   +SV S   VPL+ P L     F    EFR++++ K+INGE S    P F++
Sbjct:  112 YKIGLLYVKEGQETEEAMFENQEHSPAFDAFLESLGDRVRMRGFSKYRGGLDNANDLTGLHSVHTTYRNKQVMFHVSTLLPYDKNDSQKLQRKRHIGNDIVCVVFLEAKAIK-----FNPACIKSSFLHTFVVVQVDVSSNPYEYNVSVVSRRRVPLYEPRLVERHRFEKGPEFRDWILNKVINGETSCHKAPDFAK 303          
BLAST of GTPase-activating Rap/Ran-GAP domain protein 3 vs. Ensembl Nematostella
Match: EDO37811 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEL9])

HSP 1 Score: 95.5153 bits (236), Expect = 4.536e-23
Identity = 48/107 (44.86%), Postives = 70/107 (65.42%), Query Frame = 1
Query:  874 VLILEEQEGSVNFKFGVIYCEKGQNSDEEMYNNVKGSEDFDKFLNLLGDKVVLLNWDRFRGGLDVKNNTTGKYSYYTIYEGHEIMFHVSTALPLSSDNRQQIERKRH 1194
            ++  +E   S  FKFG+IY + GQ S+EE + N   S   D+FL +LG +V L +++ + GGLDVK   TG+ S +T +   E+MFHVST LP S+ + QQ++RKRH
Sbjct:    6 IVKYDEHSASRAFKFGIIYQKFGQISEEEYFCNKHHSPAMDEFLQMLGHRVRLQDFNGYNGGLDVKYGQTGESSVHTEHNNKEVMFHVSTLLPFSNGDTQQVQRKRH 112          
BLAST of GTPase-activating Rap/Ran-GAP domain protein 3 vs. Ensembl Nematostella
Match: EDO27978 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T7S1])

HSP 1 Score: 93.5893 bits (231), Expect = 3.163e-21
Identity = 48/141 (34.04%), Postives = 85/141 (60.28%), Query Frame = 1
Query: 1672 LKVNIIIKGDAPTS--NITTRVLKRVPWQPRIFANDLQFQIHCGDSW------GEKLILGTDRGTFIVEENAAPAILIEKSCETKQIEIVENLGLMVFRCDKGRD---SKIAIIQLSELKNIDILPMTKADVKKLSLDKTR 2061
            LK+  I+KGDAPTS    T+  +K  PWQP+    D   ++ CGDSW      G+ ++LGT+ G ++V+E  +   L ++S   +Q+ ++E  GL++FR +K ++    ++ + +LS+L+  + +  T+ D KK  LD+T+
Sbjct:  103 LKLKTIVKGDAPTSLQTSTSANIKVEPWQPQFVYEDFPHKVLCGDSWELFMIAGDSVLLGTEEGIYLVQEGKSMRQLFDRSVICQQLYVLEAYGLLLFRVEKSKEFHNPRVCVFKLSDLEEDEDVVFTREDCKKHKLDRTK 243          

HSP 2 Score: 74.7146 bits (182), Expect = 9.214e-15
Identity = 62/174 (35.63%), Postives = 91/174 (52.30%), Query Frame = 1
Query:  421 LINRHMEGYTNNAGRFRVELGSSSSQSDLRGDPFVPSKWSNMQKENPL-HLENPEQETRWYFKYFLGKLHQVYMGLISERDPXXXXXXXXXXXXXXXXQYRAIFWRKIGSQKLCIPYNTNSPMNIK-------KMLSLFDQQKFERFPKEIFN------YEVQKDVLILEEQEG 900
            L+NR  E  T  A +FR+E G    Q +         + SN   +  + HLENPE  TRWYFKYFLGK+HQ Y+ L   ++P+V+S  +TD +N  V QYRAI WRK  S KL      ++P +++       K+     Q  +E FP ++        + +  D ++L  +EG
Sbjct:    3 LLNRGGEEPTGIASKFRIENGELGQQQN---------ELSNSGNQGSVVHLENPEFHTRWYFKYFLGKVHQNYVALDGIKNPIVLSVCLTDADNYGVPQYRAILWRKT-SLKLKTIVKGDAPTSLQTSTSANIKVEPWQPQFVYEDFPHKVLCGDSWELFMIAGDSVLLGTEEG 166          
BLAST of GTPase-activating Rap/Ran-GAP domain protein 3 vs. Ensembl Medaka
Match: si:ch211-182d3.1 (GTPase activating Rap/RanGAP domain like 3 [Source:NCBI gene;Acc:101157714])

HSP 1 Score: 666.381 bits (1718), Expect = 0.000e+0
Identity = 354/813 (43.54%), Postives = 508/813 (62.48%), Query Frame = 1
Query:  331 TSNDGCQDLGFLSLYPRGSFSRKNYGSVEMLINRHMEGYTNNAGRFRVELGSSSSQSDLRGDPFVPSKWSNMQKENPLHLENPEQETRWYFKYFLGKLHQVYMGLISERDPXXXXXXXXXXXXXXXXQYRAIFWRKIGSQKLCIPYNTNSPMNIKKMLSLFDQQKFERFPKEIFNYEVQKDVLILEEQEGSVNFKFGVIYCEKGQNSDEEMYNNVKGSEDFDKFLNLLGDKVVLLNWDRFRGGLDVKNNTTGKYSYYTIYEGHEIMFHVSTALPLSSDNRQQIERKRHXXXXXXXXXXXXXXXXEPFEKYWTPSMMKTHFTHIFAIVSYIHSRKVYRLSVYSEESVPLFGPPLPSPAEFVNFFEFREFLIVKLINGEKSAFNTPVFSEKRERTMEMLLNNILETYTSD-------NINMLNRRAFSDIVLDQTNGISTTKEMNRNDAFIKFGQMLKVNIIIKGDAPTSNITTRVLKRVPWQPRIFANDLQFQIHCGDSWGEKLILGTDRGTFIVEENAAPAI------------LIEKSCETKQIEIVENLGLMVFRCDKGRDSKIAIIQLSELKNI---DILPMTKADVKKLSLDKTRGCHLFGLSKPHIQPMRLVVVVNRRLQIYVWKCVTCCXXXXXXXXXXXXXIDASFQYIRELPTFEIPQVLTILE---SQRHVQIIIGYKNQFDLIDEKTGDTTHLFKTDIIKSAMIAALDLYSEDEPELLLCYNRTCHFQKLK--HDGHPSEQSSNYEFDFSWNFEPKNIVLVLPYILAFTQNAVEIRLVVNGSLVHTMSVPDCKLITSKIDLFF 2688
            T +   +DLG      RG FSRK+YGSVE+LI+   +G    AGRFRVE GSS   S     P+ P  W    +   +HLENPE  TRW+FKYFLGK+HQ Y+G  +E++P  +S V++D NN  V QYRAI WR+ G+ K+ +PY+    +++K +LS  +  +FER P+EI N E+QKD+L+LEEQEGSVNFKFGV+Y + GQ +D+EM++N  GSE+F+KFL LLGD + L  W  +RGGLD KN+TTG  S YT+Y+GHE+MFHVST LP S +N+QQ+ERKRH      +I+ I     +     + PSM+++HFTHIFA+V Y      YRL ++SEESVPLFGPPLPS   F +  EFR+FL+VKLINGEK+   TP F++KR+RT++ML+ ++ +  T D         NMLNRR+FSD VL ++   +  KE  R   F++ GQ LK+  I++GDAPTS +TT + ++ PW+ + F +   ++I C DSWG+ L++ TD    ++ E   PA+            + +K+   KQ+ ++E   L++ R DKG+D+++ + +L  +K       L   K D ++  L+KT+GCHL+ ++  H   +R+V  +  +L +   K         S       S    FQYIRE+   + P V+ +++    +    I + YK+QFDLI+E TGD   L   D  K   +AA+D+Y + E  LLLCYN  CH++K+   +   P  QS+  +F FSWN  P  IV   PYILAFT +++EIRLVVNG+LV+T  VP+ +L  S+ D++F
Sbjct:   32 TRSSASEDLGCR----RGDFSRKHYGSVELLISSDADGAIQRAGRFRVENGSSDETS-----PYTPGSW----RRTDVHLENPEYHTRWFFKYFLGKVHQNYVGTDAEKNPFFLSVVLSDQNNQRVPQYRAILWRRSGTLKISLPYSPTKTLSVKSILSAMNMDRFERGPREIMNPEIQKDLLVLEEQEGSVNFKFGVLYAKDGQLTDDEMFSNEMGSENFEKFLTLLGDTITLQGWAGYRGGLDTKNDTTGIKSIYTVYQGHELMFHVSTMLPYSKENKQQVERKRH---IGNDIVTIVFQEGDDTSSTFKPSMIRSHFTHIFALVKYNSQNDSYRLKIFSEESVPLFGPPLPSQPVFTDHQEFRDFLLVKLINGEKATLETPTFAQKRQRTLDMLIRSLYQDLTPDLHKVPFSPQNMLNRRSFSD-VLPESPKSARKKEEARQAEFVRIGQALKLKTIVRGDAPTSLVTTGLCRKEPWESQSFCSTFPYEIVCADSWGQSLLVATDTAGVVLLEGPDPALTSAETQTLPPVPVFDKTMAVKQMHVLEPQDLLITRADKGKDARLYVFKLGTIKRSLEEKQLIRGKCDCRENKLEKTKGCHLYSINTHHGSELRIVAAIRTKLLLITRK-----HPRFSAVASGADSPVEEFQYIREICLCDPPVVMALVDGPTGENDNMICVAYKHQFDLINESTGDAYRLHHVDANKVNFVAAIDVYEDGEAGLLLCYNYICHYKKVCPFNGSTPMMQSNTPDFHFSWNQMPNAIVCAFPYILAFTTDSIEIRLVVNGNLVYTAVVPELQLAASRSDIYF 822          
BLAST of GTPase-activating Rap/Ran-GAP domain protein 3 vs. Ensembl Medaka
Match: si:ch211-182d3.1 (GTPase activating Rap/RanGAP domain like 3 [Source:NCBI gene;Acc:101157714])

HSP 1 Score: 665.996 bits (1717), Expect = 0.000e+0
Identity = 354/813 (43.54%), Postives = 508/813 (62.48%), Query Frame = 1
Query:  331 TSNDGCQDLGFLSLYPRGSFSRKNYGSVEMLINRHMEGYTNNAGRFRVELGSSSSQSDLRGDPFVPSKWSNMQKENPLHLENPEQETRWYFKYFLGKLHQVYMGLISERDPXXXXXXXXXXXXXXXXQYRAIFWRKIGSQKLCIPYNTNSPMNIKKMLSLFDQQKFERFPKEIFNYEVQKDVLILEEQEGSVNFKFGVIYCEKGQNSDEEMYNNVKGSEDFDKFLNLLGDKVVLLNWDRFRGGLDVKNNTTGKYSYYTIYEGHEIMFHVSTALPLSSDNRQQIERKRHXXXXXXXXXXXXXXXXEPFEKYWTPSMMKTHFTHIFAIVSYIHSRKVYRLSVYSEESVPLFGPPLPSPAEFVNFFEFREFLIVKLINGEKSAFNTPVFSEKRERTMEMLLNNILETYTSD-------NINMLNRRAFSDIVLDQTNGISTTKEMNRNDAFIKFGQMLKVNIIIKGDAPTSNITTRVLKRVPWQPRIFANDLQFQIHCGDSWGEKLILGTDRGTFIVEENAAPAI------------LIEKSCETKQIEIVENLGLMVFRCDKGRDSKIAIIQLSELKNI---DILPMTKADVKKLSLDKTRGCHLFGLSKPHIQPMRLVVVVNRRLQIYVWKCVTCCXXXXXXXXXXXXXIDASFQYIRELPTFEIPQVLTILE---SQRHVQIIIGYKNQFDLIDEKTGDTTHLFKTDIIKSAMIAALDLYSEDEPELLLCYNRTCHFQKLK--HDGHPSEQSSNYEFDFSWNFEPKNIVLVLPYILAFTQNAVEIRLVVNGSLVHTMSVPDCKLITSKIDLFF 2688
            T +   +DLG      RG FSRK+YGSVE+LI+   +G    AGRFRVE GSS   S     P+ P  W    +   +HLENPE  TRW+FKYFLGK+HQ Y+G  +E++P  +S V++D NN  V QYRAI WR+ G+ K+ +PY+    +++K +LS  +  +FER P+EI N E+QKD+L+LEEQEGSVNFKFGV+Y + GQ +D+EM++N  GSE+F+KFL LLGD + L  W  +RGGLD KN+TTG  S YT+Y+GHE+MFHVST LP S +N+QQ+ERKRH      +I+ I     +     + PSM+++HFTHIFA+V Y      YRL ++SEESVPLFGPPLPS   F +  EFR+FL+VKLINGEK+   TP F++KR+RT++ML+ ++ +  T D         NMLNRR+FSD VL ++   +  KE  R   F++ GQ LK+  I++GDAPTS +TT + ++ PW+ + F +   ++I C DSWG+ L++ TD    ++ E   PA+            + +K+   KQ+ ++E   L++ R DKG+D+++ + +L  +K       L   K D ++  L+KT+GCHL+ ++  H   +R+V  +  +L +   K         S       S    FQYIRE+   + P V+ +++    +    I + YK+QFDLI+E TGD   L   D  K   +AA+D+Y + E  LLLCYN  CH++K+   +   P  QS+  +F FSWN  P  IV   PYILAFT +++EIRLVVNG+LV+T  VP+ +L  S+ D++F
Sbjct:   32 TRSSASEDLGCR----RGDFSRKHYGSVELLISSDADGAIQRAGRFRVENGSSDETS-----PYTPGSW----RRTDVHLENPEYHTRWFFKYFLGKVHQNYVGTDAEKNPFFLSVVLSDQNNQRVPQYRAILWRRSGTLKISLPYSPTKTLSVKSILSAMNMDRFERGPREIMNPEIQKDLLVLEEQEGSVNFKFGVLYAKDGQLTDDEMFSNEMGSENFEKFLTLLGDTITLQGWAGYRGGLDTKNDTTGIKSIYTVYQGHELMFHVSTMLPYSKENKQQVERKRH---IGNDIVTIVFQEGDDTSSTFKPSMIRSHFTHIFALVKYNSQNDSYRLKIFSEESVPLFGPPLPSQPVFTDHQEFRDFLLVKLINGEKATLETPTFAQKRQRTLDMLIRSLYQDLTPDLHKVPFSPQNMLNRRSFSD-VLPESPKSARKKEEARQAEFVRIGQALKLKTIVRGDAPTSLVTTGLCRKEPWESQSFCSTFPYEIVCADSWGQSLLVATDTAGVVLLEGPDPALTSAETQTLPPVPVFDKTMAVKQMHVLEPQDLLITRADKGKDARLYVFKLGTIKRSLEEKQLIRGKCDCRENKLEKTKGCHLYSINTHHGSELRIVAAIRTKLLLITRK-----HPRFSAVASGADSPVEEFQYIREICLCDPPVVMALVDGPTGENDNMICVAYKHQFDLINESTGDAYRLHHVDANKVNFVAAIDVYEDGEAGLLLCYNYICHYKKVCPFNGSTPMMQSNTPDFHFSWNQMPNAIVCAFPYILAFTTDSIEIRLVVNGNLVYTAVVPELQLAASRSDIYF 822          
BLAST of GTPase-activating Rap/Ran-GAP domain protein 3 vs. Ensembl Medaka
Match: si:ch211-182d3.1 (GTPase activating Rap/RanGAP domain like 3 [Source:NCBI gene;Acc:101157714])

HSP 1 Score: 664.455 bits (1713), Expect = 0.000e+0
Identity = 350/797 (43.91%), Postives = 502/797 (62.99%), Query Frame = 1
Query:  379 RGSFSRKNYGSVEMLINRHMEGYTNNAGRFRVELGSSSSQSDLRGDPFVPSKWSNMQKENPLHLENPEQETRWYFKYFLGKLHQVYMGLISERDPXXXXXXXXXXXXXXXXQYRAIFWRKIGSQKLCIPYNTNSPMNIKKMLSLFDQQKFERFPKEIFNYEVQKDVLILEEQEGSVNFKFGVIYCEKGQNSDEEMYNNVKGSEDFDKFLNLLGDKVVLLNWDRFRGGLDVKNNTTGKYSYYTIYEGHEIMFHVSTALPLSSDNRQQIERKRHXXXXXXXXXXXXXXXXEPFEKYWTPSMMKTHFTHIFAIVSYIHSRKVYRLSVYSEESVPLFGPPLPSPAEFVNFFEFREFLIVKLINGEKSAFNTPVFSEKRERTMEMLLNNILETYTSD-------NINMLNRRAFSDIVLDQTNGISTTKEMNRNDAFIKFGQMLKVNIIIKGDAPTSNITTRVLKRVPWQPRIFANDLQFQIHCGDSWGEKLILGTDRGTFIVEENAAPAI------------LIEKSCETKQIEIVENLGLMVFRCDKGRDSKIAIIQLSELKNI---DILPMTKADVKKLSLDKTRGCHLFGLSKPHIQPMRLVVVVNRRLQIYVWKCVTCCXXXXXXXXXXXXXIDASFQYIRELPTFEIPQVLTILE---SQRHVQIIIGYKNQFDLIDEKTGDTTHLFKTDIIKSAMIAALDLYSEDEPELLLCYNRTCHFQKLK--HDGHPSEQSSNYEFDFSWNFEPKNIVLVLPYILAFTQNAVEIRLVVNGSLVHTMSVPDCKLITSKIDLFF 2688
            RG FSRK+YGSVE+LI+   +G    AGRFRVE GSS   S     P+ P  W    +   +HLENPE  TRW+FKYFLGK+HQ Y+G  +E++P  +S V++D NN  V QYRAI WR+ G+ K+ +PY+    +++K +LS  +  +FER P+EI N E+QKD+L+LEEQEGSVNFKFGV+Y + GQ +D+EM++N  GSE+F+KFL LLGD + L  W  +RGGLD KN+TTG  S YT+Y+GHE+MFHVST LP S +N+QQ+ERKRH      +I+ I     +     + PSM+++HFTHIFA+V Y      YRL ++SEESVPLFGPPLPS   F +  EFR+FL+VKLINGEK+   TP F++KR+RT++ML+ ++ +  T D         NMLNRR+FSD VL ++   +  KE  R   F++ GQ LK+  I++GDAPTS +TT + ++ PW+ + F +   ++I C DSWG+ L++ TD    ++ E   PA+            + +K+   KQ+ ++E   L++ R DKG+D+++ + +L  +K       L   K D ++  L+KT+GCHL+ ++  H   +R+V  +  +L +   K         S       S    FQYIRE+   + P V+ +++    +    I + YK+QFDLI+E TGD   L   D  K   +AA+D+Y + E  LLLCYN  CH++K+   +   P  QS+  +F FSWN  P  IV   PYILAFT +++EIRLVVNG+LV+T  VP+ +L  S+ D++F
Sbjct:   27 RGDFSRKHYGSVELLISSDADGAIQRAGRFRVENGSSDETS-----PYTPGSW----RRTDVHLENPEYHTRWFFKYFLGKVHQNYVGTDAEKNPFFLSVVLSDQNNQRVPQYRAILWRRSGTLKISLPYSPTKTLSVKSILSAMNMDRFERGPREIMNPEIQKDLLVLEEQEGSVNFKFGVLYAKDGQLTDDEMFSNEMGSENFEKFLTLLGDTITLQGWAGYRGGLDTKNDTTGIKSIYTVYQGHELMFHVSTMLPYSKENKQQVERKRH---IGNDIVTIVFQEGDDTSSTFKPSMIRSHFTHIFALVKYNSQNDSYRLKIFSEESVPLFGPPLPSQPVFTDHQEFRDFLLVKLINGEKATLETPTFAQKRQRTLDMLIRSLYQDLTPDLHKVPFSPQNMLNRRSFSD-VLPESPKSARKKEEARQAEFVRIGQALKLKTIVRGDAPTSLVTTGLCRKEPWESQSFCSTFPYEIVCADSWGQSLLVATDTAGVVLLEGPDPALTSAETQTLPPVPVFDKTMAVKQMHVLEPQDLLITRADKGKDARLYVFKLGTIKRSLEEKQLIRGKCDCRENKLEKTKGCHLYSINTHHGSELRIVAAIRTKLLLITRK-----HPRFSAVASGADSPVEEFQYIREICLCDPPVVMALVDGPTGENDNMICVAYKHQFDLINESTGDAYRLHHVDANKVNFVAAIDVYEDGEAGLLLCYNYICHYKKVCPFNGSTPMMQSNTPDFHFSWNQMPNAIVCAFPYILAFTTDSIEIRLVVNGNLVYTAVVPELQLAASRSDIYF 805          
BLAST of GTPase-activating Rap/Ran-GAP domain protein 3 vs. Ensembl Medaka
Match: si:ch211-182d3.1 (GTPase activating Rap/RanGAP domain like 3 [Source:NCBI gene;Acc:101157714])

HSP 1 Score: 648.277 bits (1671), Expect = 0.000e+0
Identity = 354/783 (45.21%), Postives = 504/783 (64.37%), Query Frame = 1
Query:  379 RGSFSRKNYGSVEMLINRHMEGYTNNAGRFRVELGSSSSQSDLRGDPFVPSKWSNMQKENPLHLENPEQETRWYFKYFLGKLHQVYMGLISERDPXXXXXXXXXXXXXXXXQYRAIFWRKIG-SQKLCIPYNTNSPMNIK---KMLSLFDQQKFERFPKEIFNYEVQKDVLILEEQEGSVNFKFGVIYCEKGQNSDEEMYNNVKGSEDFDKFLNLLGDKVVLLNWDRFRGGLDVKNNTTGKYSYYTIYEGHEIMFHVSTALPLSSDNRQQIERKRHXXXXXXXXXXXXXXXXEPFEKYWTPSMMKTHFTHIFAIVSYIHSRKVYRLSVYSEESVPLFGPPLPSPAEFVNFFEFREFLIVKLINGEKSAFNTPVFSEKRERTMEMLLNNILETYTSD-NINMLNRRAFSDIVLDQTNGISTTKEMNRNDAFIKFGQMLKVNIIIKGDAPTSNITTRVLKRVPWQPRIFANDLQFQIHCGDSWGEKLILGTDRGTFIVEENAAPAILIEKSCETKQIEIVENLGLMVFRCDKGRDSKIAIIQLSELKNI---DILPMTKADVKKLSLDKTRGCHLFGLSKPHIQPMRLVVVVNRRLQIYVWKCVTCCXXXXXXXXXXXXXIDASFQYIRELPTFEIPQVLTILE---SQRHVQIIIGYKNQFDLIDEKTGDTTHLFKTDIIKSAMIAALDLYSEDEPELLLCYNRTCHFQKLK--HDGHPSEQSSNYEFDFSWNFEPKNIVLVLPYILAFTQNAVEIRLVVNGSLVHTMSVPDCKLITSKIDLFF 2688
            RG FSRK+YGSVE+LI+   +G    AGRFRVE GSS   S     P+ P  W    +   +HLENPE  TRW+FKYFLGK+HQ Y+G  +E++P  +S V++D NN  V QYRAI WR+   +  +C+  ++NSP+++       S  +  +FER P+EI N E+QKD+L+LEEQEGSVNFKFGV+Y + GQ +D+EM++N  GSE+F+KFL LLGD + L  W  +RGGLD KN+TTG  S YT+Y+GHE+MFHVST LP S +N+QQ+ERKRHIGNDIV I+F      +     + PSM+++HFTHIFA+V Y      YRL ++SEESVPLFGPPLPS   F +  EFR+FL+VKLINGEK+   TP F++KR+RT++ML+ ++ +  T D + NMLNRR+FSD VL ++   +  KE  R   F++ GQ LK+  I++GDAPTS +TT + ++ PW+ + F +   ++I C DSWG+ L++ TD  T  V +   P  + +K+   KQ+ ++E   L++ R DKG+D+++ + +L  +K       L   K D ++  L+KT+GCHL+ ++  H   +R+V  +  +L +   K         S       S    FQYIRE+   + P V+ +++    +    I + YK+QFDLI+E TGD   L   D  K   +AA+D+Y + E  LLLCYN  CH++K+   +   P  QS+  +F FSWN  P  IV   PYILAFT +++EIRLVVNG+LV+T  VP+ +L  S+ D++F
Sbjct:   26 RGDFSRKHYGSVELLISSDADGAIQRAGRFRVENGSSDETS-----PYTPGSW----RRTDVHLENPEYHTRWFFKYFLGKVHQNYVGTDAEKNPFFLSVVLSDQNNQRVPQYRAILWRRSTLTGAICL--SSNSPISLVFSCSSYSAMNMDRFERGPREIMNPEIQKDLLVLEEQEGSVNFKFGVLYAKDGQLTDDEMFSNEMGSENFEKFLTLLGDTITLQGWAGYRGGLDTKNDTTGIKSIYTVYQGHELMFHVSTMLPYSKENKQQVERKRHIGNDIVTIVFQEG---DDTSSTFKPSMIRSHFTHIFALVKYNSQNDSYRLKIFSEESVPLFGPPLPSQPVFTDHQEFRDFLLVKLINGEKATLETPTFAQKRQRTLDMLIRSLYQDLTPDLHKNMLNRRSFSD-VLPESPKSARKKEEARQAEFVRIGQALKLKTIVRGDAPTSLVTTGLCRKEPWESQSFCSTFPYEIVCADSWGQSLLVATD--TAGVTQTLPPVPVFDKTMAVKQMHVLEPQDLLITRADKGKDARLYVFKLGTIKRSLEEKQLIRGKCDCRENKLEKTKGCHLYSINTHHGSELRIVAAIRTKLLLITRK-----HPRFSAVASGADSPVEEFQYIREICLCDPPVVMALVDGPTGENDNMICVAYKHQFDLINESTGDAYRLHHVDANKVNFVAAIDVYEDGEAGLLLCYNYICHYKKVCPFNGSTPMMQSNTPDFHFSWNQMPNAIVCAFPYILAFTTDSIEIRLVVNGNLVYTAVVPELQLAASRSDIYF 786          
BLAST of GTPase-activating Rap/Ran-GAP domain protein 3 vs. Ensembl Medaka
Match: SIPA1L1 (signal-induced proliferation-associated 1-like protein 1 [Source:NCBI gene;Acc:101170559])

HSP 1 Score: 171.014 bits (432), Expect = 1.242e-42
Identity = 89/235 (37.87%), Postives = 140/235 (59.57%), Query Frame = 1
Query:  859 EVQKDVLILEEQEGSVNFKFGVIYCEKGQNSDEEMYNNVKGSEDFDKFLNLLGDKVVLLNWDRFRGGLDVKNNTTGKYSYYTIYEGHEIMFHVSTALPLSSDNRQQIERKRHXXXXXXXXXXXXXXXXEPFEKYWTPSMMKTHFTHIFAIVSYIHS----RKVYRLSVYSEESVPLFGPPLPSPAEFVNFFEFREFLIVKLINGEKSAFNTPVFSEKRERTMEMLLNNILETYTS 1551
            +V + ++ L+EQ  S   K GV+YC  GQ+++EEMYNN      F++FL LLG+KV L  + ++R  LD K ++TG +S YT ++ +EIMFHVST LP + +N+QQ+ RKRH     +    +  +  EP    +TP  +++HF H+F IV  +H+    +  Y ++V   + VP FGPP+P    F     FR+FL+ K+IN EK+A+ +  F     RT +  L ++ E + +
Sbjct:  581 KVTEQLMKLDEQGLSFQVKVGVMYCRAGQSTEEEMYNNETAGSAFEEFLELLGEKVRLKGFTKYRAQLDTKTDSTGTHSLYTSHKDYEIMFHVSTLLPYTPNNKQQLLRKRH-----IGNDIVTIVFQEPGAHPFTPRNIRSHFQHVFIIV-RVHNPCSDKTCYSIAVTRSQDVPSFGPPIPKGVTFPKSSVFRDFLLAKIINAEKAAYKSEKFGAMATRTRQEYLRDLAERHVT 809          
BLAST of GTPase-activating Rap/Ran-GAP domain protein 3 vs. Planmine SMEST
Match: SMESG000013620.1 (SMESG000013620.1)

HSP 1 Score: 1890.55 bits (4896), Expect = 0.000e+0
Identity = 961/961 (100.00%), Postives = 961/961 (100.00%), Query Frame = 1
Query:  127 MLFIKNTTWGGSMNHLDIVGTKESNEPKLGLLRRAFSSKKRKKTINNSKPSNYLIPPAQLSVRSLENSTSNDGCQDLGFLSLYPRGSFSRKNYGSVEMLINRHMEGYTNNAGRFRVELGSSSSQSDLRGDPFVPSKWSNMQKENPLHLENPEQETRWYFKYFLGKLHQVYMGLISERDPXXXXXXXXXXXXXXXXQYRAIFWRKIGSQKLCIPYNTNSPMNIKKMLSLFDQQKFERFPKEIFNYEVQKDVLILEEQEGSVNFKFGVIYCEKGQNSDEEMYNNVKGSEDFDKFLNLLGDKVVLLNWDRFRGGLDVKNNTTGKYSYYTIYEGHEIMFHVSTALPLSSDNRQQIERKRHXXXXXXXXXXXXXXXXEPFEKYWTPSMMKTHFTHIFAIVSYIHSRKVYRLSVYSEESVPLFGPPLPSPAEFVNFFEFREFLIVKLINGEKSAFNTPVFSEKRERTMEMLLNNILETYTSDNINMLNRRAFSDIVLDQTNGISTTKEMNRNDAFIKFGQMLKVNIIIKGDAPTSNITTRVLKRVPWQPRIFANDLQFQIHCGDSWGEKLILGTDRGTFIVEENAAPAILIEKSCETKQIEIVENLGLMVFRCDKGRDSKIAIIQLSELKNIDILPMTKADVKKLSLDKTRGCHLFGLSKPHIQPMRLVVVVNRRLQIYVWKCVTCCXXXXXXXXXXXXXIDASFQYIRELPTFEIPQVLTILESQRHVQIIIGYKNQFDLIDEKTGDTTHLFKTDIIKSAMIAALDLYSEDEPELLLCYNRTCHFQKLKHDGHPSEQSSNYEFDFSWNFEPKNIVLVLPYILAFTQNAVEIRLVVNGSLVHTMSVPDCKLITSKIDLFFSTTADNLCKELIEKQKSGTSSFDRLYRVSNPLSSIEYQELSQSPTMKRSMIFQRLHIYKISLSSMSGCSYQVPLNPKFRPNLLNSSKSENEADYKACLVAQTHSFAQ 3009
            MLFIKNTTWGGSMNHLDIVGTKESNEPKLGLLRRAFSSKKRKKTINNSKPSNYLIPPAQLSVRSLENSTSNDGCQDLGFLSLYPRGSFSRKNYGSVEMLINRHMEGYTNNAGRFRVELGSSSSQSDLRGDPFVPSKWSNMQKENPLHLENPEQETRWYFKYFLGKLHQVYMGLISERDPVVISTVITDVNNNNVNQYRAIFWRKIGSQKLCIPYNTNSPMNIKKMLSLFDQQKFERFPKEIFNYEVQKDVLILEEQEGSVNFKFGVIYCEKGQNSDEEMYNNVKGSEDFDKFLNLLGDKVVLLNWDRFRGGLDVKNNTTGKYSYYTIYEGHEIMFHVSTALPLSSDNRQQIERKRHIGNDIVNIIFINDIGDEPFEKYWTPSMMKTHFTHIFAIVSYIHSRKVYRLSVYSEESVPLFGPPLPSPAEFVNFFEFREFLIVKLINGEKSAFNTPVFSEKRERTMEMLLNNILETYTSDNINMLNRRAFSDIVLDQTNGISTTKEMNRNDAFIKFGQMLKVNIIIKGDAPTSNITTRVLKRVPWQPRIFANDLQFQIHCGDSWGEKLILGTDRGTFIVEENAAPAILIEKSCETKQIEIVENLGLMVFRCDKGRDSKIAIIQLSELKNIDILPMTKADVKKLSLDKTRGCHLFGLSKPHIQPMRLVVVVNRRLQIYVWKCVTCCSSLSSWNQFSNSSIDASFQYIRELPTFEIPQVLTILESQRHVQIIIGYKNQFDLIDEKTGDTTHLFKTDIIKSAMIAALDLYSEDEPELLLCYNRTCHFQKLKHDGHPSEQSSNYEFDFSWNFEPKNIVLVLPYILAFTQNAVEIRLVVNGSLVHTMSVPDCKLITSKIDLFFSTTADNLCKELIEKQKSGTSSFDRLYRVSNPLSSIEYQELSQSPTMKRSMIFQRLHIYKISLSSMSGCSYQVPLNPKFRPNLLNSSKSENEADYKACLVAQTHSFAQ
Sbjct:    1 MLFIKNTTWGGSMNHLDIVGTKESNEPKLGLLRRAFSSKKRKKTINNSKPSNYLIPPAQLSVRSLENSTSNDGCQDLGFLSLYPRGSFSRKNYGSVEMLINRHMEGYTNNAGRFRVELGSSSSQSDLRGDPFVPSKWSNMQKENPLHLENPEQETRWYFKYFLGKLHQVYMGLISERDPVVISTVITDVNNNNVNQYRAIFWRKIGSQKLCIPYNTNSPMNIKKMLSLFDQQKFERFPKEIFNYEVQKDVLILEEQEGSVNFKFGVIYCEKGQNSDEEMYNNVKGSEDFDKFLNLLGDKVVLLNWDRFRGGLDVKNNTTGKYSYYTIYEGHEIMFHVSTALPLSSDNRQQIERKRHIGNDIVNIIFINDIGDEPFEKYWTPSMMKTHFTHIFAIVSYIHSRKVYRLSVYSEESVPLFGPPLPSPAEFVNFFEFREFLIVKLINGEKSAFNTPVFSEKRERTMEMLLNNILETYTSDNINMLNRRAFSDIVLDQTNGISTTKEMNRNDAFIKFGQMLKVNIIIKGDAPTSNITTRVLKRVPWQPRIFANDLQFQIHCGDSWGEKLILGTDRGTFIVEENAAPAILIEKSCETKQIEIVENLGLMVFRCDKGRDSKIAIIQLSELKNIDILPMTKADVKKLSLDKTRGCHLFGLSKPHIQPMRLVVVVNRRLQIYVWKCVTCCSSLSSWNQFSNSSIDASFQYIRELPTFEIPQVLTILESQRHVQIIIGYKNQFDLIDEKTGDTTHLFKTDIIKSAMIAALDLYSEDEPELLLCYNRTCHFQKLKHDGHPSEQSSNYEFDFSWNFEPKNIVLVLPYILAFTQNAVEIRLVVNGSLVHTMSVPDCKLITSKIDLFFSTTADNLCKELIEKQKSGTSSFDRLYRVSNPLSSIEYQELSQSPTMKRSMIFQRLHIYKISLSSMSGCSYQVPLNPKFRPNLLNSSKSENEADYKACLVAQTHSFAQ 961          
BLAST of GTPase-activating Rap/Ran-GAP domain protein 3 vs. Planmine SMEST
Match: SMESG000013620.1 (SMESG000013620.1)

HSP 1 Score: 1679.84 bits (4349), Expect = 0.000e+0
Identity = 858/858 (100.00%), Postives = 858/858 (100.00%), Query Frame = 1
Query:  436 MEGYTNNAGRFRVELGSSSSQSDLRGDPFVPSKWSNMQKENPLHLENPEQETRWYFKYFLGKLHQVYMGLISERDPXXXXXXXXXXXXXXXXQYRAIFWRKIGSQKLCIPYNTNSPMNIKKMLSLFDQQKFERFPKEIFNYEVQKDVLILEEQEGSVNFKFGVIYCEKGQNSDEEMYNNVKGSEDFDKFLNLLGDKVVLLNWDRFRGGLDVKNNTTGKYSYYTIYEGHEIMFHVSTALPLSSDNRQQIERKRHXXXXXXXXXXXXXXXXEPFEKYWTPSMMKTHFTHIFAIVSYIHSRKVYRLSVYSEESVPLFGPPLPSPAEFVNFFEFREFLIVKLINGEKSAFNTPVFSEKRERTMEMLLNNILETYTSDNINMLNRRAFSDIVLDQTNGISTTKEMNRNDAFIKFGQMLKVNIIIKGDAPTSNITTRVLKRVPWQPRIFANDLQFQIHCGDSWGEKLILGTDRGTFIVEENAAPAILIEKSCETKQIEIVENLGLMVFRCDKGRDSKIAIIQLSELKNIDILPMTKADVKKLSLDKTRGCHLFGLSKPHIQPMRLVVVVNRRLQIYVWKCVTCCXXXXXXXXXXXXXIDASFQYIRELPTFEIPQVLTILESQRHVQIIIGYKNQFDLIDEKTGDTTHLFKTDIIKSAMIAALDLYSEDEPELLLCYNRTCHFQKLKHDGHPSEQSSNYEFDFSWNFEPKNIVLVLPYILAFTQNAVEIRLVVNGSLVHTMSVPDCKLITSKIDLFFSTTADNLCKELIEKQKSGTSSFDRLYRVSNPLSSIEYQELSQSPTMKRSMIFQRLHIYKISLSSMSGCSYQVPLNPKFRPNLLNSSKSENEADYKACLVAQTHSFAQ 3009
            MEGYTNNAGRFRVELGSSSSQSDLRGDPFVPSKWSNMQKENPLHLENPEQETRWYFKYFLGKLHQVYMGLISERDPVVISTVITDVNNNNVNQYRAIFWRKIGSQKLCIPYNTNSPMNIKKMLSLFDQQKFERFPKEIFNYEVQKDVLILEEQEGSVNFKFGVIYCEKGQNSDEEMYNNVKGSEDFDKFLNLLGDKVVLLNWDRFRGGLDVKNNTTGKYSYYTIYEGHEIMFHVSTALPLSSDNRQQIERKRHIGNDIVNIIFINDIGDEPFEKYWTPSMMKTHFTHIFAIVSYIHSRKVYRLSVYSEESVPLFGPPLPSPAEFVNFFEFREFLIVKLINGEKSAFNTPVFSEKRERTMEMLLNNILETYTSDNINMLNRRAFSDIVLDQTNGISTTKEMNRNDAFIKFGQMLKVNIIIKGDAPTSNITTRVLKRVPWQPRIFANDLQFQIHCGDSWGEKLILGTDRGTFIVEENAAPAILIEKSCETKQIEIVENLGLMVFRCDKGRDSKIAIIQLSELKNIDILPMTKADVKKLSLDKTRGCHLFGLSKPHIQPMRLVVVVNRRLQIYVWKCVTCCSSLSSWNQFSNSSIDASFQYIRELPTFEIPQVLTILESQRHVQIIIGYKNQFDLIDEKTGDTTHLFKTDIIKSAMIAALDLYSEDEPELLLCYNRTCHFQKLKHDGHPSEQSSNYEFDFSWNFEPKNIVLVLPYILAFTQNAVEIRLVVNGSLVHTMSVPDCKLITSKIDLFFSTTADNLCKELIEKQKSGTSSFDRLYRVSNPLSSIEYQELSQSPTMKRSMIFQRLHIYKISLSSMSGCSYQVPLNPKFRPNLLNSSKSENEADYKACLVAQTHSFAQ
Sbjct:    1 MEGYTNNAGRFRVELGSSSSQSDLRGDPFVPSKWSNMQKENPLHLENPEQETRWYFKYFLGKLHQVYMGLISERDPVVISTVITDVNNNNVNQYRAIFWRKIGSQKLCIPYNTNSPMNIKKMLSLFDQQKFERFPKEIFNYEVQKDVLILEEQEGSVNFKFGVIYCEKGQNSDEEMYNNVKGSEDFDKFLNLLGDKVVLLNWDRFRGGLDVKNNTTGKYSYYTIYEGHEIMFHVSTALPLSSDNRQQIERKRHIGNDIVNIIFINDIGDEPFEKYWTPSMMKTHFTHIFAIVSYIHSRKVYRLSVYSEESVPLFGPPLPSPAEFVNFFEFREFLIVKLINGEKSAFNTPVFSEKRERTMEMLLNNILETYTSDNINMLNRRAFSDIVLDQTNGISTTKEMNRNDAFIKFGQMLKVNIIIKGDAPTSNITTRVLKRVPWQPRIFANDLQFQIHCGDSWGEKLILGTDRGTFIVEENAAPAILIEKSCETKQIEIVENLGLMVFRCDKGRDSKIAIIQLSELKNIDILPMTKADVKKLSLDKTRGCHLFGLSKPHIQPMRLVVVVNRRLQIYVWKCVTCCSSLSSWNQFSNSSIDASFQYIRELPTFEIPQVLTILESQRHVQIIIGYKNQFDLIDEKTGDTTHLFKTDIIKSAMIAALDLYSEDEPELLLCYNRTCHFQKLKHDGHPSEQSSNYEFDFSWNFEPKNIVLVLPYILAFTQNAVEIRLVVNGSLVHTMSVPDCKLITSKIDLFFSTTADNLCKELIEKQKSGTSSFDRLYRVSNPLSSIEYQELSQSPTMKRSMIFQRLHIYKISLSSMSGCSYQVPLNPKFRPNLLNSSKSENEADYKACLVAQTHSFAQ 858          
BLAST of GTPase-activating Rap/Ran-GAP domain protein 3 vs. Planmine SMEST
Match: SMESG000032884.1 (SMESG000032884.1)

HSP 1 Score: 53.9138 bits (128), Expect = 8.364e-7
Identity = 32/93 (34.41%), Postives = 50/93 (53.76%), Query Frame = 1
Query:  883 LEEQEGSVNFKFGVIYCEKGQNSDEEMYNNVKGSEDFDKFLNLLGDKVVLLNWDRFRGGLDVKNNTTGKYSYYTIYEGH---EIMFHVSTALP 1152
            ++++ G    K  V+Y   GQ   E +  N  GS +F+ F++ LG  V L N   F GGL+    ++G+  ++  Y  +   EIMFHVST +P
Sbjct: 1694 IDQRRGRETHKIAVLYVAWGQEDKESILGNTTGSLEFNTFISGLGWTVNLENHKGFMGGLE----SSGRNGFFAPYYANSTLEIMFHVSTWMP 1782          
BLAST of GTPase-activating Rap/Ran-GAP domain protein 3 vs. Planmine SMEST
Match: SMESG000032884.1 (SMESG000032884.1)

HSP 1 Score: 53.9138 bits (128), Expect = 8.367e-7
Identity = 32/93 (34.41%), Postives = 50/93 (53.76%), Query Frame = 1
Query:  883 LEEQEGSVNFKFGVIYCEKGQNSDEEMYNNVKGSEDFDKFLNLLGDKVVLLNWDRFRGGLDVKNNTTGKYSYYTIYEGH---EIMFHVSTALP 1152
            ++++ G    K  V+Y   GQ   E +  N  GS +F+ F++ LG  V L N   F GGL+    ++G+  ++  Y  +   EIMFHVST +P
Sbjct: 1708 IDQRRGRETHKIAVLYVAWGQEDKESILGNTTGSLEFNTFISGLGWTVNLENHKGFMGGLE----SSGRNGFFAPYYANSTLEIMFHVSTWMP 1796          
BLAST of GTPase-activating Rap/Ran-GAP domain protein 3 vs. Planmine SMEST
Match: SMESG000032884.1 (SMESG000032884.1)

HSP 1 Score: 53.9138 bits (128), Expect = 8.442e-7
Identity = 32/93 (34.41%), Postives = 50/93 (53.76%), Query Frame = 1
Query:  883 LEEQEGSVNFKFGVIYCEKGQNSDEEMYNNVKGSEDFDKFLNLLGDKVVLLNWDRFRGGLDVKNNTTGKYSYYTIYEGH---EIMFHVSTALP 1152
            ++++ G    K  V+Y   GQ   E +  N  GS +F+ F++ LG  V L N   F GGL+    ++G+  ++  Y  +   EIMFHVST +P
Sbjct: 1708 IDQRRGRETHKIAVLYVAWGQEDKESILGNTTGSLEFNTFISGLGWTVNLENHKGFMGGLE----SSGRNGFFAPYYANSTLEIMFHVSTWMP 1796          
The following BLAST results are available for this feature:
BLAST of GTPase-activating Rap/Ran-GAP domain protein 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GARNL30.000e+044.25GTPase activating Rap/RanGAP domain like 3 [Source... [more]
GARNL30.000e+044.80GTPase activating Rap/RanGAP domain like 3 [Source... [more]
GARNL30.000e+044.74GTPase activating Rap/RanGAP domain like 3 [Source... [more]
GARNL32.032e-6650.42GTPase activating Rap/RanGAP domain like 3 [Source... [more]
SIPA11.990e-4232.94signal-induced proliferation-associated 1 [Source:... [more]
back to top
BLAST of GTPase-activating Rap/Ran-GAP domain protein 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sipa-11.006e-4135.29SIPA (Vertebrate Signal-Induced Proliferation-Asso... [more]
sipa-11.070e-4135.29SIPA (Vertebrate Signal-Induced Proliferation-Asso... [more]
sipa-11.236e-4135.29SIPA (Vertebrate Signal-Induced Proliferation-Asso... [more]
sipa-11.248e-4135.29SIPA (Vertebrate Signal-Induced Proliferation-Asso... [more]
sipa-11.251e-4135.29SIPA (Vertebrate Signal-Induced Proliferation-Asso... [more]
back to top
BLAST of GTPase-activating Rap/Ran-GAP domain protein 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RapGAP11.108e-4232.74gene:FBgn0264895 transcript:FBtr0334847[more]
RapGAP11.554e-4232.74gene:FBgn0264895 transcript:FBtr0334848[more]
RapGAP11.712e-4232.74gene:FBgn0264895 transcript:FBtr0334850[more]
RapGAP11.712e-4232.74gene:FBgn0264895 transcript:FBtr0334846[more]
RapGAP12.108e-4232.74gene:FBgn0264895 transcript:FBtr0334849[more]
back to top
BLAST of GTPase-activating Rap/Ran-GAP domain protein 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GARNL30.000e+043.64si:ch211-182d3.1 [Source:NCBI gene;Acc:560594][more]
si:ch211-182d3.10.000e+042.79si:ch211-182d3.1 [Source:NCBI gene;Acc:560594][more]
si:ch211-182d3.10.000e+044.06si:ch211-182d3.1 [Source:NCBI gene;Acc:560594][more]
si:ch211-182d3.10.000e+044.06si:ch211-182d3.1 [Source:NCBI gene;Acc:560594][more]
si:ch211-182d3.10.000e+042.87si:ch211-182d3.1 [Source:NCBI gene;Acc:560594][more]
back to top
BLAST of GTPase-activating Rap/Ran-GAP domain protein 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nhs0.000e+042.17NHS actin remodeling regulator [Source:Xenbase;Acc... [more]
nhs2.864e-17740.49NHS actin remodeling regulator [Source:Xenbase;Acc... [more]
nhs8.563e-16943.08NHS actin remodeling regulator [Source:Xenbase;Acc... [more]
nhs2.854e-11546.36NHS actin remodeling regulator [Source:Xenbase;Acc... [more]
chrna91.483e-4243.95cholinergic receptor, nicotinic alpha 9 [Source:Xe... [more]
back to top
BLAST of GTPase-activating Rap/Ran-GAP domain protein 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Garnl30.000e+044.17GTPase activating RANGAP domain-like 3 [Source:MGI... [more]
Garnl30.000e+044.22GTPase activating RANGAP domain-like 3 [Source:MGI... [more]
Garnl30.000e+044.71GTPase activating RANGAP domain-like 3 [Source:MGI... [more]
Garnl31.901e-6360.99GTPase activating RANGAP domain-like 3 [Source:MGI... [more]
Sipa1l31.613e-4231.39signal-induced proliferation-associated 1 like 3 [... [more]
back to top
BLAST of GTPase-activating Rap/Ran-GAP domain protein 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5ZJY3|GARL3_CHICK0.000e+043.71GTPase-activating Rap/Ran-GAP domain-like protein ... [more]
sp|A5PF44|GARL3_DANRE0.000e+043.64GTPase-activating Rap/Ran-GAP domain-like protein ... [more]
sp|Q5VVW2|GARL3_HUMAN0.000e+044.80GTPase-activating Rap/Ran-GAP domain-like protein ... [more]
sp|Q3V0G7|GARL3_MOUSE0.000e+044.22GTPase-activating Rap/Ran-GAP domain-like protein ... [more]
sp|Q54EH3|Y1510_DICDI1.178e-5239.04GTPase-activating protein DDB_G0291510 OS=Dictyost... [more]
back to top
BLAST of GTPase-activating Rap/Ran-GAP domain protein 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3K5980.000e+048.97GTPase-activating Rap/Ran-GAP domain-like protein ... [more]
A0A5K3EXR40.000e+052.34Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A068W7D80.000e+050.95GTPase activating Rap:RanGAP domain 3 OS=Echinococ... [more]
A0A564ZFS70.000e+048.94Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A1S3K6C40.000e+051.14GTPase-activating Rap/Ran-GAP domain-like protein ... [more]
back to top
BLAST of GTPase-activating Rap/Ran-GAP domain protein 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-182d3.10.000e+041.85GTPase activating Rap/RanGAP domain like 3 [Source... [more]
si:ch211-182d3.10.000e+044.25GTPase activating Rap/RanGAP domain like 3 [Source... [more]
si:ch211-182d3.10.000e+044.71GTPase activating Rap/RanGAP domain like 3 [Source... [more]
si:ch211-182d3.18.184e-17743.48GTPase activating Rap/RanGAP domain like 3 [Source... [more]
zmp:00000011681.144e-4533.33signal-induced proliferation-associated 1 [Source:... [more]
back to top
BLAST of GTPase-activating Rap/Ran-GAP domain protein 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
rap1gap4.218e-3739.72RAP1 GTPase activating protein [Source:ZFIN;Acc:ZD... [more]
ENSPMAT00000000819.14.471e-1332.52pep scaffold:Pmarinus_7.0:GL483423:14336:19151:-1 ... [more]
ENSPMAT00000003319.16.275e-828.03pep scaffold:Pmarinus_7.0:GL478269:10551:16928:1 g... [more]
ralgapa12.087e-625.99Ral GTPase activating protein, alpha subunit 1 (ca... [more]
back to top
BLAST of GTPase-activating Rap/Ran-GAP domain protein 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GTPase-activating Rap/Ran-GAP domain protein 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO365020.000e+043.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO429423.791e-4437.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO393351.256e-3138.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO378114.536e-2344.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO279783.163e-2134.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of GTPase-activating Rap/Ran-GAP domain protein 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-182d3.10.000e+043.54GTPase activating Rap/RanGAP domain like 3 [Source... [more]
si:ch211-182d3.10.000e+043.54GTPase activating Rap/RanGAP domain like 3 [Source... [more]
si:ch211-182d3.10.000e+043.91GTPase activating Rap/RanGAP domain like 3 [Source... [more]
si:ch211-182d3.10.000e+045.21GTPase activating Rap/RanGAP domain like 3 [Source... [more]
SIPA1L11.242e-4237.87signal-induced proliferation-associated 1-like pro... [more]
back to top
BLAST of GTPase-activating Rap/Ran-GAP domain protein 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000013620.10.000e+0100.00SMESG000013620.1[more]
SMESG000013620.10.000e+0100.00SMESG000013620.1[more]
SMESG000032884.18.364e-734.41SMESG000032884.1[more]
SMESG000032884.18.367e-734.41SMESG000032884.1[more]
SMESG000032884.18.442e-734.41SMESG000032884.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019399 ID=SMED30019399|Name=GTPase-activating Rap/Ran-GAP domain protein 3|organism=Schmidtea mediterranea sexual|type=transcript|length=3156bp
ATCGCATGTGAAAATAATGAAGCAATTCAAACTCAATTATGATTGGTTGA
AAAAAACATTATTTCATTATAACAAATTCTGACAAAATTTTCTTTGAAAG
TTTTTTTTTGGTTAAAATATTCTGAAATGCTTTTCATCAAAAACACAACA
TGGGGTGGTTCAATGAATCATTTAGATATCGTTGGTACAAAAGAAAGTAA
TGAACCAAAATTAGGTTTATTGCGGAGAGCGTTTTCATCAAAGAAACGAA
AAAAGACAATAAATAATTCAAAGCCCTCAAACTATTTAATCCCGCCAGCT
CAGCTATCGGTCAGGTCTTTAGAAAATTCAACTTCAAATGATGGATGTCA
AGATTTGGGATTTCTTTCTTTATATCCAAGGGGATCATTCAGTAGGAAAA
ATTATGGTTCAGTTGAAATGCTCATCAATCGACACATGGAAGGCTATACA
AATAATGCCGGCCGTTTTCGAGTTGAGCTTGGTTCCAGTAGTAGTCAATC
TGATTTAAGAGGCGATCCTTTCGTTCCATCGAAATGGTCAAATATGCAGA
AAGAAAATCCTTTGCATCTCGAAAATCCCGAACAGGAAACTCGATGGTAT
TTCAAATATTTTCTCGGGAAATTGCATCAAGTTTATATGGGTCTAATAAG
TGAGCGTGATCCCGTTGTCATTTCTACTGTTATAACTGATGTCAATAATA
ACAATGTGAACCAATATCGTGCGATATTTTGGCGAAAAATAGGTAGTCAA
AAACTTTGTATTCCTTATAACACCAATAGTCCAATGAACATAAAGAAAAT
GTTAAGTTTGTTTGATCAACAAAAATTTGAAAGATTTCCAAAAGAAATTT
TCAATTATGAAGTTCAGAAAGACGTTTTAATTCTTGAAGAACAAGAGGGG
TCTGTTAATTTCAAATTTGGAGTTATTTATTGTGAAAAAGGTCAAAACAG
TGATGAAGAAATGTATAATAATGTCAAAGGTTCAGAAGACTTTGATAAAT
TTCTAAATTTGCTTGGAGACAAAGTCGTACTTTTAAACTGGGACCGATTC
AGGGGAGGATTAGATGTAAAAAACAATACTACGGGAAAGTATTCATATTA
TACAATCTATGAAGGTCATGAAATAATGTTCCATGTGTCTACAGCATTGC
CATTATCATCAGATAATCGACAACAGATCGAGCGAAAACGCCATATTGGC
AACGATATTGTCAACATTATATTCATCAATGATATTGGTGATGAACCTTT
TGAAAAGTATTGGACACCTTCAATGATGAAAACTCATTTTACGCATATAT
TCGCAATTGTGTCCTATATTCATTCGAGAAAGGTGTACCGATTAAGCGTC
TACTCAGAAGAATCAGTTCCACTTTTTGGACCGCCTTTGCCTTCGCCAGC
AGAATTCGTAAACTTCTTTGAATTCAGAGAATTTCTTATTGTTAAATTAA
TCAATGGAGAGAAGTCCGCCTTTAATACGCCAGTTTTTTCTGAGAAACGT
GAAAGGACCATGGAAATGCTTTTGAACAATATTCTAGAAACATATACATC
TGATAATATAAATATGCTTAATAGGAGAGCCTTCAGTGATATTGTTTTAG
ACCAGACTAATGGAATATCAACTACCAAAGAAATGAATAGGAATGATGCA
TTCATAAAATTTGGACAGATGTTGAAAGTAAACATCATCATTAAAGGAGA
TGCTCCAACAAGCAACATTACGACACGTGTTTTAAAAAGAGTGCCTTGGC
AACCACGGATTTTCGCCAATGATCTGCAGTTTCAAATTCACTGTGGTGAT
AGCTGGGGTGAGAAACTTATACTAGGCACAGATAGAGGTACATTTATTGT
TGAAGAAAATGCAGCTCCAGCTATTTTAATAGAAAAGTCATGTGAAACAA
AGCAAATTGAAATAGTTGAGAATTTAGGATTAATGGTTTTTCGTTGTGAT
AAAGGAAGAGATTCCAAAATTGCCATAATTCAACTTTCCGAGCTCAAAAA
CATTGATATTTTACCTATGACCAAAGCAGATGTTAAAAAACTTTCTTTAG
ACAAAACTAGAGGATGTCATTTGTTTGGATTAAGCAAGCCTCACATTCAA
CCAATGCGTTTAGTAGTAGTCGTAAATCGGCGTTTACAGATTTACGTTTG
GAAGTGCGTTACATGCTGCAGCTCCCTTTCATCCTGGAACCAATTTTCCA
ACAGTAGTATTGACGCATCTTTTCAATACATCAGAGAATTGCCGACGTTT
GAAATTCCTCAAGTTTTAACAATTCTTGAATCTCAGCGACATGTGCAAAT
CATTATCGGCTATAAGAATCAATTCGATCTGATTGATGAAAAAACGGGGG
ACACTACGCATTTATTTAAAACAGATATTATCAAATCTGCCATGATAGCA
GCACTCGATCTCTATTCAGAAGATGAGCCAGAGCTCTTACTTTGTTATAA
TAGAACTTGTCATTTTCAAAAACTGAAACACGACGGCCATCCTTCAGAAC
AGTCTTCGAATTATGAATTTGATTTCTCCTGGAATTTTGAACCAAAGAAT
ATTGTCCTGGTATTGCCATATATTTTAGCTTTCACCCAAAACGCAGTAGA
AATCAGACTTGTTGTAAATGGAAGCTTGGTTCACACAATGAGTGTTCCGG
ATTGCAAGCTTATTACATCGAAAATTGATTTGTTCTTTTCAACGACAGCA
GATAATTTATGTAAAGAACTCATTGAAAAACAGAAATCGGGAACTTCTTC
ATTCGACCGTCTTTACCGCGTGTCCAACCCGCTTTCCTCTATTGAATATC
AAGAGTTGTCACAGTCGCCAACGATGAAACGTTCAATGATATTCCAAAGA
CTTCATATATACAAAATATCTCTTAGTTCGATGTCCGGATGCAGTTATCA
GGTTCCGTTGAATCCGAAGTTCCGACCAAATTTATTGAATTCCTCAAAAT
CTGAAAATGAAGCCGATTATAAAGCTTGTTTAGTTGCCCAGACTCATAGT
TTTGCACAGTGAATAAATGAATTATTCTAAATCTATTGGAATCGGTGCTC
AACACAAAGCAAATTTATACCGATTTTCTTTGGCACTGTTTATAAAATTT
TTAGAAATATATTTCTACTCAGATGATTTTTTTTTGAAAACTTAGAAAAT
CCTGCG
back to top

protein sequence of SMED30019399-orf-1

>SMED30019399-orf-1 ID=SMED30019399-orf-1|Name=SMED30019399-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=962bp
MLFIKNTTWGGSMNHLDIVGTKESNEPKLGLLRRAFSSKKRKKTINNSKP
SNYLIPPAQLSVRSLENSTSNDGCQDLGFLSLYPRGSFSRKNYGSVEMLI
NRHMEGYTNNAGRFRVELGSSSSQSDLRGDPFVPSKWSNMQKENPLHLEN
PEQETRWYFKYFLGKLHQVYMGLISERDPVVISTVITDVNNNNVNQYRAI
FWRKIGSQKLCIPYNTNSPMNIKKMLSLFDQQKFERFPKEIFNYEVQKDV
LILEEQEGSVNFKFGVIYCEKGQNSDEEMYNNVKGSEDFDKFLNLLGDKV
VLLNWDRFRGGLDVKNNTTGKYSYYTIYEGHEIMFHVSTALPLSSDNRQQ
IERKRHIGNDIVNIIFINDIGDEPFEKYWTPSMMKTHFTHIFAIVSYIHS
RKVYRLSVYSEESVPLFGPPLPSPAEFVNFFEFREFLIVKLINGEKSAFN
TPVFSEKRERTMEMLLNNILETYTSDNINMLNRRAFSDIVLDQTNGISTT
KEMNRNDAFIKFGQMLKVNIIIKGDAPTSNITTRVLKRVPWQPRIFANDL
QFQIHCGDSWGEKLILGTDRGTFIVEENAAPAILIEKSCETKQIEIVENL
GLMVFRCDKGRDSKIAIIQLSELKNIDILPMTKADVKKLSLDKTRGCHLF
GLSKPHIQPMRLVVVVNRRLQIYVWKCVTCCSSLSSWNQFSNSSIDASFQ
YIRELPTFEIPQVLTILESQRHVQIIIGYKNQFDLIDEKTGDTTHLFKTD
IIKSAMIAALDLYSEDEPELLLCYNRTCHFQKLKHDGHPSEQSSNYEFDF
SWNFEPKNIVLVLPYILAFTQNAVEIRLVVNGSLVHTMSVPDCKLITSKI
DLFFSTTADNLCKELIEKQKSGTSSFDRLYRVSNPLSSIEYQELSQSPTM
KRSMIFQRLHIYKISLSSMSGCSYQVPLNPKFRPNLLNSSKSENEADYKA
CLVAQTHSFAQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR035974Rap/Ran-GAP_sf
IPR001180CNH_dom
IPR000331Rap_GAP_dom
Vocabulary: biological process
TermDefinition
GO:0051056regulation of small GTPase mediated signal transduction
GO:0043547positive regulation of GTPase activity
Vocabulary: molecular function
TermDefinition
GO:0005096GTPase activator activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001180Citron homology (CNH) domainSMARTSM00036nik_2coord: 547..858
e-value: 0.0013
score: -17.4
IPR001180Citron homology (CNH) domainPFAMPF00780CNHcoord: 556..848
e-value: 5.1E-40
score: 137.8
IPR001180Citron homology (CNH) domainPROSITEPS50219CNHcoord: 551..853
score: 22.463
IPR035974Rap/Ran-GAP superfamilyGENE3DG3DSA:3.40.50.11210coord: 259..450
e-value: 1.2E-70
score: 238.8
IPR035974Rap/Ran-GAP superfamilySUPERFAMILYSSF111347Rap/Ran-GAPcoord: 147..476
IPR000331Rap GTPase activating protein domainPFAMPF02145Rap_GAPcoord: 279..461
e-value: 1.7E-57
score: 194.0
IPR000331Rap GTPase activating protein domainPROSITEPS50085RAPGAPcoord: 250..469
score: 60.028
NoneNo IPR availablePANTHERPTHR15711RAP GTPASE-ACTIVATING PROTEINcoord: 37..942
NoneNo IPR availablePANTHERPTHR15711:SF22GTPASE-ACTIVATING RAP/RAN-GAP DOMAIN-LIKE PROTEIN 3coord: 37..942