N-acetyltransferase domain-containing protein

Overview
NameN-acetyltransferase domain-containing protein
Smed IDSMED30019398
Length (bp)2186
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of N-acetyltransferase domain-containing protein (SMED30019398) t-SNE clustered cells

Violin plots show distribution of expression levels for N-acetyltransferase domain-containing protein (SMED30019398) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of N-acetyltransferase domain-containing protein (SMED30019398) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for N-acetyltransferase domain-containing protein (SMED30019398) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019398

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30019398SMESG000023874.1 SmedASXL_015306SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30019398SMESG000023874.1 dd_Smed_v6_13214_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Category 4 cellSMED30019398SMESG000023874.1 dd_Smed_v4_13214_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30019398SMESG000023874.1 dd_Smed_v4_13214_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of N-acetyltransferase domain-containing protein vs. Ensembl Human
Match: NAA50 (N(alpha)-acetyltransferase 50, NatE catalytic subunit [Source:HGNC Symbol;Acc:HGNC:29533])

HSP 1 Score: 48.1358 bits (113), Expect = 8.767e-6
Identity = 28/90 (31.11%), Postives = 51/90 (56.67%), Query Frame = 1
Query:  766 VEPESISEVGFENQI-IAAISFKLRHIDVRKIVHVTMLGVLKEYRSKGIGKHLINLVLD-QKIVGKYDAVVVHADFS---ACDFFKKFGF 1020
            +E   ++++ + N I + A+  ++ H   +K +++  LG L  YR  GIG  ++N VL+  +  G +D + +H   S   A DF++KFGF
Sbjct:   40 LEVGELAKLAYFNDIAVGAVCCRVDHSQNQKRLYIMTLGCLAPYRRLGIGTKMLNHVLNICEKDGTFDNIYLHVQISNESAIDFYRKFGF 129          
BLAST of N-acetyltransferase domain-containing protein vs. Ensembl Human
Match: NAA50 (N(alpha)-acetyltransferase 50, NatE catalytic subunit [Source:HGNC Symbol;Acc:HGNC:29533])

HSP 1 Score: 48.1358 bits (113), Expect = 8.792e-6
Identity = 28/90 (31.11%), Postives = 51/90 (56.67%), Query Frame = 1
Query:  766 VEPESISEVGFENQI-IAAISFKLRHIDVRKIVHVTMLGVLKEYRSKGIGKHLINLVLD-QKIVGKYDAVVVHADFS---ACDFFKKFGF 1020
            +E   ++++ + N I + A+  ++ H   +K +++  LG L  YR  GIG  ++N VL+  +  G +D + +H   S   A DF++KFGF
Sbjct:   39 LEVGELAKLAYFNDIAVGAVCCRVDHSQNQKRLYIMTLGCLAPYRRLGIGTKMLNHVLNICEKDGTFDNIYLHVQISNESAIDFYRKFGF 128          
BLAST of N-acetyltransferase domain-containing protein vs. Ensembl Zebrafish
Match: si:dkeyp-50b9.1 (si:dkeyp-50b9.1 [Source:ZFIN;Acc:ZDB-GENE-131127-254])

HSP 1 Score: 96.6709 bits (239), Expect = 8.799e-21
Identity = 54/166 (32.53%), Postives = 97/166 (58.43%), Query Frame = 1
Query:  784 SEVGFENQIIAAISFKLRHI-DVRKIVHVTMLGVLKEYRSKGIGKHLINLVLDQKIVGKYDAVVVHADFSACDFFKKFGFSDDPILNIQWHTLEPEYTNCSLLTYLPSYSNQDRENKLLAEEFSTAEMEVDIKLWQKKMTEVHCFQFQ--TFQRMKMEIQHLKETI 1272
            S VG E+ I+AA  ++L+ +    K++ +++L V K YR +GIG +++ L+  Q +VG+YD +V HAD     FF   GFSDD +LN  +  L+ E+TN  +++YLP ++    +  +   +FS +  EV+I+L   +   +  +Q Q     R+  E++ L++ +
Sbjct:  184 SAVGVESLIVAAACYELKTLFTGNKVLQLSLLAVRKNYRHQGIGSYIVQLLKSQSVVGQYDTLVAHADTDTTAFFNSNGFSDDLMLNDMFKELKDEWTNSIIMSYLPPFTT---DLTMRDPDFSLSLQEVEIELKTARSQALCAYQQQMVCVTRLLKEVKILRQQL 346          
BLAST of N-acetyltransferase domain-containing protein vs. Ensembl Zebrafish
Match: si:dkeyp-50b9.1 (si:dkeyp-50b9.1 [Source:ZFIN;Acc:ZDB-GENE-131127-254])

HSP 1 Score: 96.6709 bits (239), Expect = 8.799e-21
Identity = 54/166 (32.53%), Postives = 97/166 (58.43%), Query Frame = 1
Query:  784 SEVGFENQIIAAISFKLRHI-DVRKIVHVTMLGVLKEYRSKGIGKHLINLVLDQKIVGKYDAVVVHADFSACDFFKKFGFSDDPILNIQWHTLEPEYTNCSLLTYLPSYSNQDRENKLLAEEFSTAEMEVDIKLWQKKMTEVHCFQFQ--TFQRMKMEIQHLKETI 1272
            S VG E+ I+AA  ++L+ +    K++ +++L V K YR +GIG +++ L+  Q +VG+YD +V HAD     FF   GFSDD +LN  +  L+ E+TN  +++YLP ++    +  +   +FS +  EV+I+L   +   +  +Q Q     R+  E++ L++ +
Sbjct:  184 SAVGVESLIVAAACYELKTLFTGNKVLQLSLLAVRKNYRHQGIGSYIVQLLKSQSVVGQYDTLVAHADTDTTAFFNSNGFSDDLMLNDMFKELKDEWTNSIIMSYLPPFTT---DLTMRDPDFSLSLQEVEIELKTARSQALCAYQQQMVCVTRLLKEVKILRQQL 346          
BLAST of N-acetyltransferase domain-containing protein vs. Ensembl Zebrafish
Match: naa50 (N(alpha)-acetyltransferase 50, NatE catalytic subunit [Source:NCBI gene;Acc:445229])

HSP 1 Score: 47.7506 bits (112), Expect = 7.764e-6
Identity = 28/90 (31.11%), Postives = 51/90 (56.67%), Query Frame = 1
Query:  766 VEPESISEVGFENQI-IAAISFKLRHIDVRKIVHVTMLGVLKEYRSKGIGKHLINLVLD-QKIVGKYDAVVVHADFS---ACDFFKKFGF 1020
            +E   ++++ + N I + A+  ++ H   +K +++  LG L  YR  GIG  ++N VL+  +  G +D + +H   S   A DF++KFGF
Sbjct:   37 LEVGELAKLAYFNDIAVGAVCCRVDHSQNQKRLYIMTLGCLAPYRRLGIGTKMLNHVLNICEKDGTFDNIYLHVQISNESAIDFYQKFGF 126          
BLAST of N-acetyltransferase domain-containing protein vs. Ensembl Zebrafish
Match: naa50 (N(alpha)-acetyltransferase 50, NatE catalytic subunit [Source:NCBI gene;Acc:445229])

HSP 1 Score: 47.7506 bits (112), Expect = 8.815e-6
Identity = 28/90 (31.11%), Postives = 51/90 (56.67%), Query Frame = 1
Query:  766 VEPESISEVGFENQI-IAAISFKLRHIDVRKIVHVTMLGVLKEYRSKGIGKHLINLVLD-QKIVGKYDAVVVHADFS---ACDFFKKFGF 1020
            +E   ++++ + N I + A+  ++ H   +K +++  LG L  YR  GIG  ++N VL+  +  G +D + +H   S   A DF++KFGF
Sbjct:   39 LEVGELAKLAYFNDIAVGAVCCRVDHSQNQKRLYIMTLGCLAPYRRLGIGTKMLNHVLNICEKDGTFDNIYLHVQISNESAIDFYQKFGF 128          
BLAST of N-acetyltransferase domain-containing protein vs. Ensembl Zebrafish
Match: naa50 (N(alpha)-acetyltransferase 50, NatE catalytic subunit [Source:NCBI gene;Acc:445229])

HSP 1 Score: 47.7506 bits (112), Expect = 8.872e-6
Identity = 28/90 (31.11%), Postives = 51/90 (56.67%), Query Frame = 1
Query:  766 VEPESISEVGFENQI-IAAISFKLRHIDVRKIVHVTMLGVLKEYRSKGIGKHLINLVLD-QKIVGKYDAVVVHADFS---ACDFFKKFGF 1020
            +E   ++++ + N I + A+  ++ H   +K +++  LG L  YR  GIG  ++N VL+  +  G +D + +H   S   A DF++KFGF
Sbjct:   40 LEVGELAKLAYFNDIAVGAVCCRVDHSQNQKRLYIMTLGCLAPYRRLGIGTKMLNHVLNICEKDGTFDNIYLHVQISNESAIDFYQKFGF 129          
BLAST of N-acetyltransferase domain-containing protein vs. Ensembl Xenopus
Match: cdk1 (cyclin-dependent kinase 1 [Source:Xenbase;Acc:XB-GENE-482750])

HSP 1 Score: 48.521 bits (114), Expect = 6.836e-6
Identity = 28/90 (31.11%), Postives = 51/90 (56.67%), Query Frame = 1
Query:  766 VEPESISEVGFENQI-IAAISFKLRHIDVRKIVHVTMLGVLKEYRSKGIGKHLINLVLD-QKIVGKYDAVVVHADFS---ACDFFKKFGF 1020
            +E   ++++ + N I + A+  ++ H   +K +++  LG L  YR  GIG  ++N VL+  +  G +D + +H   S   A DF++KFGF
Sbjct:   35 LEVGELAKLAYFNDIAVGAVCCRVDHSQNQKRLYIMTLGCLAPYRRLGIGTKMLNHVLNICEKDGTFDNIYLHVQISNESAIDFYRKFGF 124          
BLAST of N-acetyltransferase domain-containing protein vs. Ensembl Xenopus
Match: cdk1 (cyclin-dependent kinase 1 [Source:Xenbase;Acc:XB-GENE-482750])

HSP 1 Score: 48.521 bits (114), Expect = 7.161e-6
Identity = 28/90 (31.11%), Postives = 51/90 (56.67%), Query Frame = 1
Query:  766 VEPESISEVGFENQI-IAAISFKLRHIDVRKIVHVTMLGVLKEYRSKGIGKHLINLVLD-QKIVGKYDAVVVHADFS---ACDFFKKFGF 1020
            +E   ++++ + N I + A+  ++ H   +K +++  LG L  YR  GIG  ++N VL+  +  G +D + +H   S   A DF++KFGF
Sbjct:   39 LEVGELAKLAYFNDIAVGAVCCRVDHSQNQKRLYIMTLGCLAPYRRLGIGTKMLNHVLNICEKDGTFDNIYLHVQISNESAIDFYRKFGF 128          
BLAST of N-acetyltransferase domain-containing protein vs. Ensembl Mouse
Match: Naa50 (N(alpha)-acetyltransferase 50, NatE catalytic subunit [Source:MGI Symbol;Acc:MGI:1919367])

HSP 1 Score: 48.521 bits (114), Expect = 5.138e-6
Identity = 28/90 (31.11%), Postives = 51/90 (56.67%), Query Frame = 1
Query:  766 VEPESISEVGFENQI-IAAISFKLRHIDVRKIVHVTMLGVLKEYRSKGIGKHLINLVLD-QKIVGKYDAVVVHADFS---ACDFFKKFGF 1020
            +E   ++++ + N I + A+  ++ H   +K +++  LG L  YR  GIG  ++N VL+  +  G +D + +H   S   A DF++KFGF
Sbjct:   39 LEVGELAKLAYFNDIAVGAVCCRVDHSQNQKRLYIMTLGCLAPYRRLGIGTKMLNHVLNICEKDGTFDNIYLHVQISNESAIDFYRKFGF 128          
BLAST of N-acetyltransferase domain-containing protein vs. Ensembl Mouse
Match: Naa50 (N(alpha)-acetyltransferase 50, NatE catalytic subunit [Source:MGI Symbol;Acc:MGI:1919367])

HSP 1 Score: 48.521 bits (114), Expect = 5.172e-6
Identity = 28/90 (31.11%), Postives = 51/90 (56.67%), Query Frame = 1
Query:  766 VEPESISEVGFENQI-IAAISFKLRHIDVRKIVHVTMLGVLKEYRSKGIGKHLINLVLD-QKIVGKYDAVVVHADFS---ACDFFKKFGF 1020
            +E   ++++ + N I + A+  ++ H   +K +++  LG L  YR  GIG  ++N VL+  +  G +D + +H   S   A DF++KFGF
Sbjct:   40 LEVGELAKLAYFNDIAVGAVCCRVDHSQNQKRLYIMTLGCLAPYRRLGIGTKMLNHVLNICEKDGTFDNIYLHVQISNESAIDFYRKFGF 129          
BLAST of N-acetyltransferase domain-containing protein vs. Ensembl Mouse
Match: Naa50 (N(alpha)-acetyltransferase 50, NatE catalytic subunit [Source:MGI Symbol;Acc:MGI:1919367])

HSP 1 Score: 48.1358 bits (113), Expect = 7.693e-6
Identity = 28/90 (31.11%), Postives = 51/90 (56.67%), Query Frame = 1
Query:  766 VEPESISEVGFENQI-IAAISFKLRHIDVRKIVHVTMLGVLKEYRSKGIGKHLINLVLD-QKIVGKYDAVVVHADFS---ACDFFKKFGF 1020
            +E   ++++ + N I + A+  ++ H   +K +++  LG L  YR  GIG  ++N VL+  +  G +D + +H   S   A DF++KFGF
Sbjct:   46 LEVGELAKLAYFNDIAVGAVCCRVDHSQNQKRLYIMTLGCLAPYRRLGIGTKMLNHVLNICEKDGTFDNIYLHVQISNESAIDFYRKFGF 135          
BLAST of N-acetyltransferase domain-containing protein vs. TrEMBL
Match: A0A2C9JQY1 (N-acetyltransferase domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106064321 PE=4 SV=1)

HSP 1 Score: 185.652 bits (470), Expect = 4.225e-46
Identity = 171/621 (27.54%), Postives = 301/621 (48.47%), Query Frame = 1
Query:  268 DVTNNLKLKDM---EAFVGDTKKSEIIHSTVGLFDICLPDMDINTIYGSVVDKEAYTILVFASQAHALKNIITKVKIMKNKPSKINLIKEFLERKENEQPNITENEDVYSSTEDKE-------------DAFEIIFNDNDEKEDSGAXXXXXXXXXXXXXXXXXXXXXXIKTVYKRKLNHLS----VEPESISEVGFENQIIAAISFKLRHIDVR-KIVHVTMLGVLKEYRSKGIGKHLINLVLDQKIVGKYDAVVVHADFSACDFFKKFGFSDDPILNIQWHTLEPEYTNCSLLTYLPSYSNQDRENKLLAEEFSTAEMEVDIKL--WQKKMTEVHCFQFQTFQRMKMEIQHLKETIKNQDNIMKTIMKELRESNKEKCRLERFLKNXXXXXXXXXXXXXXXXXXXXXXKEENDLLDNVEFKVKSHFFESVKMVGESDFINLLEFI-KSDPQPLLIAEFKAIKRSVNVXXXXXXXXXXXXXXXXYYCESPLMKEKEKLKILTEGFDKNHRKTGSQGLGYYFASNPATAAIYASSNNVIVADVILGNVYRNIGEIQPLKESPPDGYNSILVTS-LYSQQSNNNAAMPDIHLSKDKSSFYTQEFVIFDAAQALPLGLISFST 2055
            D    L+LK +   +  +      +++H+  GL+DI LPDM+  TIY +V  K A TI +      A  N++ ++ I K    +  L+++  E+KE        N+D + +  D+               AF  +F+D DE+E    ++ + +E+ SS+++Y+ G N +IK+ ++R+    S    + P   S +G EN+++  ++F+ + I+ + +++H+T++ +   YR   IG++L++  +   I G +DAVVVHAD SA +FF K+GFS D  LN +W  L   +TNC+L+TY P +S        +  E      ++D +L  WQ+K  E +  Q     + + EI  LK TI+ Q+ ++  ++   R  N++   +ER L+++       S    + S+     +           ++ S F + ++  G    +  +  I K+   P + A ++   R ++                LY+C S L K      ILT GF +     G  G G YF+  P+ AA ++    ++ A V LG    ++ +    ++SP +GY+SI     LY Q  N NA +              QE+V+FDA Q LPL ++S+S 
Sbjct:   82 DFNRILQLKQVHENDGIITGVSNRDLLHAVCGLYDISLPDMESETIYNTVCAKWARTIAIVQDIKDATDNMMERL-IKKRVREQKKLLEDQHEKKE-------ANKDAWKAKIDEVEDVFKEEEEEVHLSAFIDVFSDTDEEE---DEDVDEEEEDSSEENYTKGINTFIKSSFERRQQRESSDCLITP---STIGIENRLLGCVTFEKKFIEEKQRVIHITLISIRPRYRHYKIGQYLLSKCVSPVITGHFDAVVVHADNSAVNFFGKYGFSADVALNKKWGELADAFTNCTLMTYFPPFSGHSLLPTKVTREQDADMYDIDQELEKWQRKSEEAYQGQLTCILKFRNEILQLKNTIRVQNELLTKLVTTNR-VNRDALEIERDLRSTHLDQAVSSLTRGLQSLNTESKQPLQSFSSISNTEIISRFIQGMEADGSVKIVYSVTSINKAILSPDVHAMYEKTVRHLH---------DSSMITTLYFCGS-LEKPSRLQHILTHGFSEEDFSYGEFGRGLYFSKYPSKAAQFSVLGKLLEAQVALGQT-ESVLKCDRTRKSPSEGYDSIFTPGRLYRQGDNENAML-------------CQEYVLFDAHQVLPLWILSYSA 663          
BLAST of N-acetyltransferase domain-containing protein vs. TrEMBL
Match: K1R104 (N-acetyltransferase domain-containing protein OS=Crassostrea gigas OX=29159 GN=CGI_10025416 PE=4 SV=1)

HSP 1 Score: 177.563 bits (449), Expect = 3.072e-43
Identity = 114/349 (32.66%), Postives = 191/349 (54.73%), Query Frame = 1
Query:  304 AFVGDTKKSEIIHSTVGLFDICLPDMDINTIYGSVVDKEAYTILVFASQAHALKNIITKVKIMKNKPSKINLIKEFLERKENEQPNITENEDVYSSTEDKEDAFEIIFNDNDEKEDSGAXXXXXXXXXXXXXXXXXXXXXXIKTVYKRKLNHLSVEPESISEVGFENQIIAAISFKLRHIDVRKIVHVTMLGVLKEYRSKGIGKHLINLVLDQKIVGKYDAVVVHADFSACDFFKKFGFSDDPILNIQWHTLEPEYTNCSLLTYLPSYSNQDRENKLLAEEFSTAEMEVDIKLWQKKMTEVHCFQFQTFQRMKMEIQHLKETIKNQDNIMKTIMKELRESNKEKCRLER 1350
            A +      +++H+ VGL+D+ L DM  + +Y SV DK A TI++       ++++       K K ++ NL K+  +  + ++    +  +   ++  K   F  +++             E +E+   ++D+S G N++IK   +R+      E  S   VG EN+II AI+F+ ++I   +++H+T+L V K YR  GIGK+L+  +L+ ++VG YDA+VVHAD  A DFF+KFGFSDD +LN +W  L  ++TNC+L+ YLP++S     + L        E+E     W++K TEV+  Q     RMK EI  LK   + Q+ ++ T++ E     KEK  +E+
Sbjct:   87 AMIPGISNRDLLHAVVGLYDVSLSDMTPDVLYSSVCDKWARTIVLVRDVQETVEDLT------KRKATRRNLAKKVDDEDQAKEEGEEDKYEEEEASPSK---FATVYS---------DTESEEEEEEDDEEDFSKGINSFIKKAAERRTQQKVTETVSQDMVGIENRIIGAITFEKKYIQKDRVIHLTLLSVRKRYRKFGIGKYLLQQILEPEVVGHYDAIVVHADNGAVDFFQKFGFSDDIVLNSRWSELAEQFTNCTLMAYLPAFSGHTLLSTLKIPGLEVFELEQQFNKWKEKTTEVYQQQVSIVMRMKHEIIELKSMNEKQNELIDTLILENERLKKEKLMIEK 417          
BLAST of N-acetyltransferase domain-containing protein vs. TrEMBL
Match: A0A2C9JQZ3 (N-acetyltransferase domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106064321 PE=4 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 5.067e-41
Identity = 121/429 (28.21%), Postives = 208/429 (48.48%), Query Frame = 1
Query:  784 SEVGFENQIIAAISFKLRHIDVR-KIVHVTMLGVLKEYRSKGIGKHLINLVLDQKIVGKYDAVVVHADFSACDFFKKFGFSDDPILNIQWHTLEPEYTNCSLLTYLPSYSNQDRENKLLAEEFSTAEMEVDIKL--WQKKMTEVHCFQFQTFQRMKMEIQHLKETIKNQDNIMKTIMKELRESNKEKCRLERFLKNXXXXXXXXXXXXXXXXXXXXXXKEENDLLDNVEFKVKSHFFESVKMVGESDFINLLEFI-KSDPQPLLIAEFKAIKRSVNVXXXXXXXXXXXXXXXXYYCESPLMKEKEKLKILTEGFDKNHRKTGSQGLGYYFASNPATAAIYASSNNVIVADVILGNVYRNIGEIQPLKESPPDGYNSILVTS-LYSQQSNNNAAMPDIHLSKDKSSFYTQEFVIFDAAQALPLGLISFST 2055
            S +G EN+++  ++F+ + I+ + +++H+T++ +   YR   IG++L++  +   I G +DAVVVHAD SA +FF K+GFS D  LN +W  L   +TNC+L+TY P +S        +  E      ++D +L  WQ+K  E +  Q     + + EI  LK TI+ Q+ ++  ++   R  N++   +ER L+++       S    + S+     +           ++ S F + ++  G    +  +  I K+   P + A ++   R ++                LY+C S L K      ILT GF +     G  G G YF+  P+ AA ++    ++ A V LG    ++ +    ++SP +GY+SI     LY Q  N NA +              QE+V+FDA Q LPL ++S+S 
Sbjct:  139 STIGIENRLLGCVTFEKKFIEEKQRVIHITLISIRPRYRHYKIGQYLLSKCVSPVITGHFDAVVVHADNSAVNFFGKYGFSADVALNKKWGELADAFTNCTLMTYFPPFSGHSLLPTKVTREQDADMYDIDQELEKWQRKSEEAYQGQLTCILKFRNEILQLKNTIRVQNELLTKLVTTNR-VNRDALEIERDLRSTHLDQAVSSLTRGLQSLNTESKQPLQSFSSISNTEIISRFIQGMEADGSVKIVYSVTSINKAILSPDVHAMYEKTVRHLH---------DSSMITTLYFCGS-LEKPSRLQHILTHGFSEEDFSYGEFGRGLYFSKYPSKAAQFSVLGKLLEAQVALGQT-ESVLKCDRTRKSPSEGYDSIFTPGRLYRQGDNENAML-------------CQEYVLFDAHQVLPLWILSYSA 542          
BLAST of N-acetyltransferase domain-containing protein vs. TrEMBL
Match: A0A210R5W7 (N-acetyltransferase domain-containing protein OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT08300 PE=4 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 2.912e-40
Identity = 111/344 (32.27%), Postives = 194/344 (56.40%), Query Frame = 1
Query:  328 SEIIHSTVGLFDICLPDMDINTIYGSVVDKEAYTILVFASQAHALKNIITKVKIMKNKPSKINLIKEFLERKENEQPNITENEDVYSSTEDKEDAFEIIFNDNDEKEDSGAXXXXXXXXXXXXXXXXXXXXXXIKTVYKRKLNHLSVEPESISE--VGFENQIIAAISFKLRHIDVR-KIVHVTMLGVLKEYRSKGIGKHLINLVLDQKIVGKYDAVVVHADFSACDFFKKFGFSDDPILNIQWHTLEPEYTNCSLLTYLPSYSNQDRENKLLAEEFSTAEMEVDIKLWQKKMTEVHCFQFQTFQRMKMEIQHLKETIKNQDNIMKTIMKELRESNKEKCRLER 1350
            ++++H+ VGL+D+ L +M  + +Y +V +K A TI++       ++++  K KI K      +   E  E K  E+    EN+D+Y   E     F  +++D + +E+   D+ + ++ S   + +        KTV +RK      +P  I E  VG EN+II  ++F+ +++  + ++VH+T+L V + +R  GIGK+L+  V+D  +VG +DA+VVHAD +A +FF+ FGFSDD +LN +W  L  ++TNC+L+ YLP +S     + +    F   E+E +   W++K  EV+  Q     RMK EI  LK     Q+ +++T++K+  +  KEK  +E+
Sbjct:   95 TDLLHAVVGLYDVSLSEMTPDVLYATVCEKWARTIVLVRDLKETVRSLEEK-KIQKTSDKDDDNETESKETKTKEEKEDGENDDIYEEEEQLTSKFADVYSDTESEEEDLEDDDDEEDFSKGINTFIK------KTVERRKKRQ--CKPREIKEEQVGIENRIIGCVTFEKKYVRQKDRVVHLTLLSVRRRHRKFGIGKYLLQQVIDPAVVGHFDAIVVHADNAAVEFFQHFGFSDDVVLNSRWSELAEQFTNCTLMCYLPGFSGHSLLSTVKVPGFEVFELEQEFNKWKEKTVEVYQNQVSVVMRMKHEILQLKALTHKQNTLIETLLKDNEKLRKEKYAVEK 429          

HSP 2 Score: 64.6994 bits (156), Expect = 5.718e-7
Identity = 39/134 (29.10%), Postives = 70/134 (52.24%), Query Frame = 1
Query: 1651 YYCESPLMKEKEKLK-ILTEGFDKNHRKTGSQGLGYYFASNPATAAIYASSNNVIVADVILGNVYRNIGEIQPLKESPPDGYNSILVTSLYSQQSNNNAAMPDIHLSKDKSSFYTQEFVIFDAAQALPLGLISF 2049
            YYC +  ++  E++  ILT GF ++    G  G G YF+  P+ AA ++    +++ +  LG++  +I +    ++SP  G++SI+         +             + S  TQE+V+FDA Q +PLGLI++
Sbjct:  584 YYCGT--LEHPERIPDILTHGFTESDFIHGEYGRGLYFSKYPSKAAHFSGVRKILLVEAGLGHI-ESITKQDRARKSPHPGHDSIITPGRLKPSRDCGL----------EESTMTQEYVVFDAKQVMPLGLITY 704          
BLAST of N-acetyltransferase domain-containing protein vs. TrEMBL
Match: V4AGM8 (N-acetyltransferase domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_233022 PE=4 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 6.583e-40
Identity = 121/382 (31.68%), Postives = 215/382 (56.28%), Query Frame = 1
Query:  241 MVHLYSIFKDVTNNLKLKDMEAF-----VGDTKKSEIIHSTVGLFDICLPDMDINTIYGSVVDKEAYTILVFASQAHALKNIITKVKIMKNKPSKINLIKEFLER--KENEQPNITENEDVYSSTEDKEDAFEIIFNDNDEKEDSGAXXXXXXXXXXXXXXXXXXXXXXIKTVYKRKLNHLSVEPESISE--VGFENQIIAAISFKLRHIDVR-KIVHVTMLGVLKEYRSKGIGKHLINLVLDQKIVGKYDAVVVHADFSACDFFKKFGFSDDPILNIQWHTLEPEYTNCSLLTYLPSYSNQDRENKLLAEEFSTAEMEVDIKLWQKKMTEVHCFQFQTFQRMKMEIQHLKETIKNQDNIMKTIMKELRESNKEKCRLERFL 1356
            +V  Y +  D    L+L +   +     +       ++H+ VGL+DI L +M ++ +Y +V +K A TI++      A+K+   +    K K  ++N   E  +   K +E+ N+   +D Y   E     FE +F+   + ED   D+ E +ED S ++D+S G +++IK+   R+    +V+  S+ E  +G E++II  ++F+ +++  + ++VH+T++ V   YR  GIGK+L++ V+D  + G+Y+A+VVHAD  A +FF+KFGFSDD +LN +W  L  ++TNC+L+ YLP ++     + +        EM+ ++K W+ K  E +  Q     RMK EI +L++ +K QDN++K +  E  +  +EK  LE+ L
Sbjct:   59 VVSAYPVIVDFRRLLQLHNTNPYHNNDVISGISNDNLLHAVVGLYDIALSEMTLDVLYATVCEKWARTIVLVQDMKDAVKDAEFR---KKEKKEQMNGKSESDDESNKLDEKLNVDIGDDKYEEEEGSPSKFEGVFS---DVEDDEEDDDEEEEDESDEEDFSVGIHSFIKSAVTRR-KQRNVKETSLDEHDIGVESRIIGCLTFEKKYVRHKERVVHLTIVTVRPRYRKYGIGKYLLSQVIDSSVSGQYEAIVVHADNGAVEFFQKFGFSDDVVLNSRWSELAEQFTNCTLMCYLPGFTGHTVLSAINLPGLEVYEMDQELKKWKDKTLESYQAQITCVMRMKQEIFNLQKKVKCQDNMIKMLAVENEKVKQEKIILEKEL 433          
BLAST of N-acetyltransferase domain-containing protein vs. Ensembl Cavefish
Match: naa50 (N(alpha)-acetyltransferase 50, NatE catalytic subunit [Source:NCBI gene;Acc:103040640])

HSP 1 Score: 47.7506 bits (112), Expect = 7.590e-6
Identity = 28/90 (31.11%), Postives = 51/90 (56.67%), Query Frame = 1
Query:  766 VEPESISEVGFENQI-IAAISFKLRHIDVRKIVHVTMLGVLKEYRSKGIGKHLINLVLD-QKIVGKYDAVVVHADFS---ACDFFKKFGF 1020
            +E   ++++ + N I + A+  ++ H   +K +++  LG L  YR  GIG  ++N VL+  +  G +D + +H   S   A DF++KFGF
Sbjct:   40 LEVGELAKLAYFNDIAVGAVCCRVDHSQNQKRLYIMTLGCLAPYRRLGIGTKMLNHVLNICEKDGTFDNIYLHVQISNESAIDFYQKFGF 129          
BLAST of N-acetyltransferase domain-containing protein vs. Ensembl Medaka
Match: naa50 (N(alpha)-acetyltransferase 50, NatE catalytic subunit [Source:NCBI gene;Acc:101162486])

HSP 1 Score: 47.7506 bits (112), Expect = 6.544e-6
Identity = 28/90 (31.11%), Postives = 51/90 (56.67%), Query Frame = 1
Query:  766 VEPESISEVGFENQI-IAAISFKLRHIDVRKIVHVTMLGVLKEYRSKGIGKHLINLVLD-QKIVGKYDAVVVHADFS---ACDFFKKFGF 1020
            +E   ++++ + N I + A+  ++ H   +K +++  LG L  YR  GIG  ++N VL+  +  G +D + +H   S   A DF++KFGF
Sbjct:   40 LEVGELAKLAYFNDIAVGAVCCRVDHSQNQKRLYIMTLGCLAPYRRLGIGTKMLNHVLNICEKDGTFDNIYLHVQISNESAIDFYQKFGF 129          
BLAST of N-acetyltransferase domain-containing protein vs. Planmine SMEST
Match: SMESG000023874.1 (SMESG000023874.1)

HSP 1 Score: 1180.24 bits (3052), Expect = 0.000e+0
Identity = 647/651 (99.39%), Postives = 650/651 (99.85%), Query Frame = 1
Query:  115 MSYKIIDVNNPVLLLKTHEVICKNRRNKKENSSSCDEILNLWMVHLYSIFKDVTNNLKLKDMEAFVGDTKKSEIIHSTVGLFDICLPDMDINTIYGSVVDKEAYTILVFASQAHALKNIITKVKIMKNKPSKINLIKEFLERKENEQPNITENEDVYSSTEDKEDAFEIIFNDNDEKEDSGAXXXXXXXXXXXXXXXXXXXXXXIKTVYKRKLNHLSVEPESISEVGFENQIIAAISFKLRHIDVRKIVHVTMLGVLKEYRSKGIGKHLINLVLDQKIVGKYDAVVVHADFSACDFFKKFGFSDDPILNIQWHTLEPEYTNCSLLTYLPSYSNQDRENKLLAEEFSTAEMEVDIKLWQKKMTEVHCFQFQTFQRMKMEIQHLKETIKNQDNIMKTIMKELRESNKEKCRLERFLKNXXXXXXXXXXXXXXXXXXXXXXKEENDLLDNVEFKVKSHFFESVKMVGESDFINLLEFIKSDPQPLLIAEFKAIKRSVNVXXXXXXXXXXXXXXXXYYCESPLMKEKEKLKILTEGFDKNHRKTGSQGLGYYFASNPATAAIYASSNNVIVADVILGNVYRNIGEIQPLKESPPDGYNSILVTSLYSQQSNNNAAMPDIHLSKDKSSFYTQEFVIFDAAQALPLGLISFSTTDSQ 2067
            MSYKIIDVNNPVLLLKTHEVICKNRRNKKENSSSCDEILNLWMVHLYSIFKDVTNNLKLKDMEAFVGDTKKSEIIHSTVGLFDICLPDMDINTIYGSVVDKEAYTILVFASQA+ALKNIITKVKIMKNKPSKI+LIKEFLERKENE+PNITENEDVYSSTEDKEDAFEIIFNDNDEKEDSGADNKENDEDSSSDDDYSYGYNNYIKTVYKRKLNHLSVEPESISEVGFENQIIAAISFKLRHIDVRKIVHVTMLGVLKEYRSKGIGKHLINLVLDQKIVGKYDAVVVHADFSACDFFKKFGFSDDPILNIQWHTLEPEYTNCSLLTYLPSYSNQDRENKLLAEEFSTAEMEVDIKLWQKKMTEVHCFQFQTFQRMKMEIQHLKETIKNQDNIMKTIMKELRESNKEKCRLERFLKNSASSSINVSSVEPVSSIIDSISKEENDLLDNVEFKVKSHFFESVKMVGESDFINLLEFIKSDPQPLLIAEFKAIKRSVNVLSPRLSSKLLISSRILYYCESPLMKEKEKLKILTEGFDKNHRKTGSQGLGYYFASNPATAAIYASSNNVIVADVILGNVYRNIGE QPLKESPPDGYNSILVTSLYSQQSNNNAAMPDIHLSKDKSSFYTQEFVIFDAAQALPLGLISFSTTDSQ
Sbjct:    1 MSYKIIDVNNPVLLLKTHEVICKNRRNKKENSSSCDEILNLWMVHLYSIFKDVTNNLKLKDMEAFVGDTKKSEIIHSTVGLFDICLPDMDINTIYGSVVDKEAYTILVFASQANALKNIITKVKIMKNKPSKISLIKEFLERKENEEPNITENEDVYSSTEDKEDAFEIIFNDNDEKEDSGADNKENDEDSSSDDDYSYGYNNYIKTVYKRKLNHLSVEPESISEVGFENQIIAAISFKLRHIDVRKIVHVTMLGVLKEYRSKGIGKHLINLVLDQKIVGKYDAVVVHADFSACDFFKKFGFSDDPILNIQWHTLEPEYTNCSLLTYLPSYSNQDRENKLLAEEFSTAEMEVDIKLWQKKMTEVHCFQFQTFQRMKMEIQHLKETIKNQDNIMKTIMKELRESNKEKCRLERFLKNSASSSINVSSVEPVSSIIDSISKEENDLLDNVEFKVKSHFFESVKMVGESDFINLLEFIKSDPQPLLIAEFKAIKRSVNVLSPRLSSKLLISSRILYYCESPLMKEKEKLKILTEGFDKNHRKTGSQGLGYYFASNPATAAIYASSNNVIVADVILGNVYRNIGETQPLKESPPDGYNSILVTSLYSQQSNNNAAMPDIHLSKDKSSFYTQEFVIFDAAQALPLGLISFSTTDSQ 651          
The following BLAST results are available for this feature:
BLAST of N-acetyltransferase domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
NAA508.767e-631.11N(alpha)-acetyltransferase 50, NatE catalytic subu... [more]
NAA508.792e-631.11N(alpha)-acetyltransferase 50, NatE catalytic subu... [more]
back to top
BLAST of N-acetyltransferase domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of N-acetyltransferase domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of N-acetyltransferase domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkeyp-50b9.18.799e-2132.53si:dkeyp-50b9.1 [Source:ZFIN;Acc:ZDB-GENE-131127-2... [more]
si:dkeyp-50b9.18.799e-2132.53si:dkeyp-50b9.1 [Source:ZFIN;Acc:ZDB-GENE-131127-2... [more]
naa507.764e-631.11N(alpha)-acetyltransferase 50, NatE catalytic subu... [more]
naa508.815e-631.11N(alpha)-acetyltransferase 50, NatE catalytic subu... [more]
naa508.872e-631.11N(alpha)-acetyltransferase 50, NatE catalytic subu... [more]
back to top
BLAST of N-acetyltransferase domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cdk16.836e-631.11cyclin-dependent kinase 1 [Source:Xenbase;Acc:XB-G... [more]
cdk17.161e-631.11cyclin-dependent kinase 1 [Source:Xenbase;Acc:XB-G... [more]
back to top
BLAST of N-acetyltransferase domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Naa505.138e-631.11N(alpha)-acetyltransferase 50, NatE catalytic subu... [more]
Naa505.172e-631.11N(alpha)-acetyltransferase 50, NatE catalytic subu... [more]
Naa507.693e-631.11N(alpha)-acetyltransferase 50, NatE catalytic subu... [more]
back to top
BLAST of N-acetyltransferase domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of N-acetyltransferase domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2C9JQY14.225e-4627.54N-acetyltransferase domain-containing protein OS=B... [more]
K1R1043.072e-4332.66N-acetyltransferase domain-containing protein OS=C... [more]
A0A2C9JQZ35.067e-4128.21N-acetyltransferase domain-containing protein OS=B... [more]
A0A210R5W72.912e-4032.27N-acetyltransferase domain-containing protein OS=M... [more]
V4AGM86.583e-4031.68N-acetyltransferase domain-containing protein OS=L... [more]
back to top
BLAST of N-acetyltransferase domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
naa507.590e-631.11N(alpha)-acetyltransferase 50, NatE catalytic subu... [more]
back to top
BLAST of N-acetyltransferase domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of N-acetyltransferase domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of N-acetyltransferase domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of N-acetyltransferase domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
naa506.544e-631.11N(alpha)-acetyltransferase 50, NatE catalytic subu... [more]
back to top
BLAST of N-acetyltransferase domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000023874.10.000e+099.39SMESG000023874.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019398 ID=SMED30019398|Name=N-acetyltransferase domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2186bp
CGATCTATAAATTAAATTTTATTATATTATATTAAAATTTATTGAAATGG
CGTTTAAATAATCTATGACCTTCACTGAAAGTTAAGGACGCTATTATATA
ATTTTTGAAACAAAATGAGCTATAAAATTATTGATGTTAACAATCCTGTG
CTCCTACTCAAAACTCATGAAGTAATTTGCAAAAATAGGAGAAATAAAAA
AGAAAATTCTTCATCTTGTGACGAAATTCTTAATTTGTGGATGGTACATT
TGTATTCTATTTTCAAGGACGTCACTAATAATTTAAAATTAAAAGATATG
GAAGCATTTGTTGGCGATACTAAGAAATCAGAAATAATTCATTCTACTGT
TGGGTTATTTGATATTTGTTTACCAGATATGGATATAAATACGATTTATG
GAAGCGTTGTTGACAAAGAAGCCTATACTATTCTGGTATTCGCATCACAG
GCACATGCACTAAAAAATATAATTACCAAAGTTAAAATAATGAAAAATAA
ACCTTCTAAAATCAACTTGATAAAGGAATTTCTAGAAAGAAAGGAAAACG
AGCAACCAAATATTACTGAAAATGAGGACGTTTATTCATCTACTGAAGAT
AAAGAAGACGCATTTGAAATAATATTTAATGATAATGATGAGAAGGAAGA
TTCAGGGGCAGATAATAAAGAAAATGATGAAGATTCTTCCTCTGATGATG
ATTATTCTTATGGATATAATAATTATATAAAGACCGTTTATAAACGTAAA
TTAAATCATCTTTCTGTTGAACCAGAATCAATATCAGAAGTAGGATTTGA
AAATCAAATCATTGCAGCAATATCTTTTAAACTACGCCATATTGATGTAC
GTAAAATTGTTCATGTAACTATGCTCGGAGTGCTTAAAGAATACCGTAGT
AAAGGAATTGGAAAACACTTAATCAATTTAGTTCTAGATCAAAAAATTGT
CGGTAAATATGATGCAGTCGTCGTTCATGCTGACTTTAGTGCTTGTGACT
TTTTTAAAAAATTTGGATTTTCCGATGACCCAATTCTTAATATTCAATGG
CATACTTTGGAACCGGAATATACGAATTGTAGTTTGCTTACATATTTGCC
ATCATATTCCAATCAAGATCGAGAGAATAAGCTACTCGCTGAAGAGTTCA
GCACGGCTGAAATGGAGGTAGATATAAAGCTGTGGCAGAAGAAAATGACC
GAAGTCCACTGTTTTCAGTTCCAAACATTTCAAAGAATGAAAATGGAAAT
TCAACATTTAAAGGAAACGATTAAAAACCAAGATAATATCATGAAAACTA
TTATGAAAGAACTTAGAGAATCAAATAAAGAAAAATGTAGATTAGAAAGA
TTTTTAAAGAATAGTGCTTCGAGTTCTATTAATGTCAGCTCAGTTGAACC
TGTTTCATCCATAATCGATTCCATTTCTAAAGAAGAAAATGATTTGTTAG
ATAATGTGGAGTTCAAAGTTAAAAGTCATTTTTTCGAAAGTGTCAAAATG
GTTGGTGAAAGTGATTTTATAAACCTCTTGGAGTTCATCAAATCTGATCC
ACAACCACTTCTGATCGCTGAATTTAAGGCTATTAAAAGAAGTGTTAACG
TTCTCTCGCCTAGATTATCATCAAAGTTATTAATTTCCAGTCGAATACTT
TATTATTGCGAGTCCCCTTTAATGAAAGAAAAGGAAAAATTGAAAATATT
GACCGAGGGTTTTGATAAGAATCATCGAAAAACCGGAAGTCAAGGATTAG
GTTACTATTTTGCATCAAATCCAGCTACAGCAGCTATTTATGCTAGCTCA
AATAATGTGATTGTTGCTGATGTCATACTGGGTAATGTCTATCGGAATAT
TGGTGAGATTCAGCCATTGAAAGAATCCCCACCGGATGGTTACAATTCTA
TTCTGGTGACGTCCTTGTACTCGCAGCAGTCAAATAATAATGCGGCAATG
CCTGATATTCATTTATCTAAAGATAAATCTAGCTTTTACACTCAAGAATT
TGTAATATTTGATGCTGCGCAAGCTCTACCACTGGGATTGATTAGCTTTT
CCACTACAGATAGCCAGTGAATCCAATTCTTCCATTGCTTTGATTTGTAA
TTTATTTTTAGTGAGGTCTGAAATATTTGAGGTTATTTTTGGTATTTTCG
TGTTGCTAAAGAGAAAATTTAGTCTTTATGCCTGGT
back to top

protein sequence of SMED30019398-orf-1

>SMED30019398-orf-1 ID=SMED30019398-orf-1|Name=SMED30019398-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=652bp
MSYKIIDVNNPVLLLKTHEVICKNRRNKKENSSSCDEILNLWMVHLYSIF
KDVTNNLKLKDMEAFVGDTKKSEIIHSTVGLFDICLPDMDINTIYGSVVD
KEAYTILVFASQAHALKNIITKVKIMKNKPSKINLIKEFLERKENEQPNI
TENEDVYSSTEDKEDAFEIIFNDNDEKEDSGADNKENDEDSSSDDDYSYG
YNNYIKTVYKRKLNHLSVEPESISEVGFENQIIAAISFKLRHIDVRKIVH
VTMLGVLKEYRSKGIGKHLINLVLDQKIVGKYDAVVVHADFSACDFFKKF
GFSDDPILNIQWHTLEPEYTNCSLLTYLPSYSNQDRENKLLAEEFSTAEM
EVDIKLWQKKMTEVHCFQFQTFQRMKMEIQHLKETIKNQDNIMKTIMKEL
RESNKEKCRLERFLKNSASSSINVSSVEPVSSIIDSISKEENDLLDNVEF
KVKSHFFESVKMVGESDFINLLEFIKSDPQPLLIAEFKAIKRSVNVLSPR
LSSKLLISSRILYYCESPLMKEKEKLKILTEGFDKNHRKTGSQGLGYYFA
SNPATAAIYASSNNVIVADVILGNVYRNIGEIQPLKESPPDGYNSILVTS
LYSQQSNNNAAMPDIHLSKDKSSFYTQEFVIFDAAQALPLGLISFSTTDS
Q*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000018Category 4 cell
PLANA:0000034epidermis
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR012317Poly(ADP-ribose)pol_cat_dom
IPR000182GNAT_dom
IPR016181Acyl_CoA_acyltransferase
Vocabulary: molecular function
TermDefinition
GO:0003950NAD+ ADP-ribosyltransferase activity
GO:0008080N-acetyltransferase activity
GO:0016740transferase activity
GO:0016746transferase activity, transferring acyl groups
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 386..406
NoneNo IPR availableGENE3DG3DSA:3.40.630.30coord: 196..329
e-value: 4.9E-15
score: 57.6
NoneNo IPR availableGENE3DG3DSA:3.90.228.10coord: 508..650
e-value: 7.7E-14
score: 53.9
NoneNo IPR availableCDDcd04301NAT_SFcoord: 229..276
e-value: 6.12263E-7
score: 44.9593
NoneNo IPR availableSUPERFAMILYSSF56399ADP-ribosylationcoord: 527..647
IPR012317Poly(ADP-ribose) polymerase, catalytic domainPFAMPF00644PARPcoord: 526..645
e-value: 8.5E-9
score: 35.3
IPR000182GNAT domainPFAMPF13673Acetyltransf_10coord: 221..303
e-value: 1.1E-8
score: 35.1
IPR000182GNAT domainPROSITEPS51186GNATcoord: 154..322
score: 10.48
IPR016181Acyl-CoA N-acyltransferaseSUPERFAMILYSSF55729Acyl-CoA N-acyltransferases (Nat)coord: 229..307