LsmAD domain-containing protein

Overview
NameLsmAD domain-containing protein
Smed IDSMED30019396
Length (bp)2596
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of LsmAD domain-containing protein (SMED30019396) t-SNE clustered cells

Violin plots show distribution of expression levels for LsmAD domain-containing protein (SMED30019396) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of LsmAD domain-containing protein (SMED30019396) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for LsmAD domain-containing protein (SMED30019396) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019396

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30019396h1SMcG0014083 dd_Smed_v4_11128_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30019396h1SMcG0014083 dd_Smed_v4_11128_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of LsmAD domain-containing protein vs. Ensembl Fly
Match: Atx2 (gene:FBgn0041188 transcript:FBtr0083100)

HSP 1 Score: 52.7582 bits (125), Expect = 1.357e-6
Identity = 45/170 (26.47%), Postives = 71/170 (41.76%), Query Frame = 1
Query:  367 LGNFVTIKTETEE-YNGVLKAVSPNGDFCLT-EATVFVNNNELSSRYEKFKMIPIKSIKIVEAKNVESNYNPGSSDQNKILTDEEIVKQRRSNTVTDHSQYNANGSSDIELTPFYDSSVPLEDNCLNASKIGAHWFPPEEMFEKNKISFNVKSTYNENLEGYTTQLNKND 870
            +G+ V ++  +   Y GV +  S N D  L   A +   N     +  K  + P  ++  + AK+ +S Y    + Q      ++    R      +     ANG  DIEL           D+  N       W P  EMF KN+ +F V ST++++L  YT  L+K D
Sbjct:    8 VGSVVEVRLRSGNIYEGVFRTFSGNFDIALELPACIKSKNLPEEGKVPKHIIFPADTVVTIVAKDFDSQYATAGAFQTDGAISDKCNGARPDEKELEPWDSGANGDIDIEL-----------DSAANG------WDP-NEMFRKNENTFGVTSTFDDSLASYTVPLDKGD 159          
BLAST of LsmAD domain-containing protein vs. Ensembl Fly
Match: Atx2 (gene:FBgn0041188 transcript:FBtr0344377)

HSP 1 Score: 52.7582 bits (125), Expect = 1.357e-6
Identity = 45/170 (26.47%), Postives = 71/170 (41.76%), Query Frame = 1
Query:  367 LGNFVTIKTETEE-YNGVLKAVSPNGDFCLT-EATVFVNNNELSSRYEKFKMIPIKSIKIVEAKNVESNYNPGSSDQNKILTDEEIVKQRRSNTVTDHSQYNANGSSDIELTPFYDSSVPLEDNCLNASKIGAHWFPPEEMFEKNKISFNVKSTYNENLEGYTTQLNKND 870
            +G+ V ++  +   Y GV +  S N D  L   A +   N     +  K  + P  ++  + AK+ +S Y    + Q      ++    R      +     ANG  DIEL           D+  N       W P  EMF KN+ +F V ST++++L  YT  L+K D
Sbjct:    8 VGSVVEVRLRSGNIYEGVFRTFSGNFDIALELPACIKSKNLPEEGKVPKHIIFPADTVVTIVAKDFDSQYATAGAFQTDGAISDKCNGARPDEKELEPWDSGANGDIDIEL-----------DSAANG------WDP-NEMFRKNENTFGVTSTFDDSLASYTVPLDKGD 159          
BLAST of LsmAD domain-containing protein vs. Ensembl Fly
Match: Atx2 (gene:FBgn0041188 transcript:FBtr0083099)

HSP 1 Score: 52.7582 bits (125), Expect = 1.524e-6
Identity = 45/170 (26.47%), Postives = 71/170 (41.76%), Query Frame = 1
Query:  367 LGNFVTIKTETEE-YNGVLKAVSPNGDFCLT-EATVFVNNNELSSRYEKFKMIPIKSIKIVEAKNVESNYNPGSSDQNKILTDEEIVKQRRSNTVTDHSQYNANGSSDIELTPFYDSSVPLEDNCLNASKIGAHWFPPEEMFEKNKISFNVKSTYNENLEGYTTQLNKND 870
            +G+ V ++  +   Y GV +  S N D  L   A +   N     +  K  + P  ++  + AK+ +S Y    + Q      ++    R      +     ANG  DIEL           D+  N       W P  EMF KN+ +F V ST++++L  YT  L+K D
Sbjct:   69 VGSVVEVRLRSGNIYEGVFRTFSGNFDIALELPACIKSKNLPEEGKVPKHIIFPADTVVTIVAKDFDSQYATAGAFQTDGAISDKCNGARPDEKELEPWDSGANGDIDIEL-----------DSAANG------WDP-NEMFRKNENTFGVTSTFDDSLASYTVPLDKGD 220          
BLAST of LsmAD domain-containing protein vs. Ensembl Fly
Match: Atx2 (gene:FBgn0041188 transcript:FBtr0083101)

HSP 1 Score: 52.373 bits (124), Expect = 1.932e-6
Identity = 45/170 (26.47%), Postives = 71/170 (41.76%), Query Frame = 1
Query:  367 LGNFVTIKTETEE-YNGVLKAVSPNGDFCL-TEATVFVNNNELSSRYEKFKMIPIKSIKIVEAKNVESNYNPGSSDQNKILTDEEIVKQRRSNTVTDHSQYNANGSSDIELTPFYDSSVPLEDNCLNASKIGAHWFPPEEMFEKNKISFNVKSTYNENLEGYTTQLNKND 870
            +G+ V ++  +   Y GV +  S N D  L   A +   N     +  K  + P  ++  + AK+ +S Y    + Q      ++    R      +     ANG  DIEL           D+  N       W P  EMF KN+ +F V ST++++L  YT  L+K D
Sbjct:    8 VGSVVEVRLRSGNIYEGVFRTFSGNFDIALELPACIKSKNLPEEGKVPKHIIFPADTVVTIVAKDFDSQYATAGAFQTDGAISDKCNGARPDEKELEPWDSGANGDIDIEL-----------DSAANG------WDP-NEMFRKNENTFGVTSTFDDSLASYTVPLDKGD 159          
BLAST of LsmAD domain-containing protein vs. TrEMBL
Match: A0A0R3TKA7 (LsmAD domain-containing protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS7592 PE=4 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 1.406e-16
Identity = 73/199 (36.68%), Postives = 102/199 (51.26%), Query Frame = 1
Query:  346 YILCKYYLGNFVTIKTETEEYNGVLKAVSPNGDFCLTEA-TVFVNNNELSSRYEKFKMIPIKSIKIVEAKNVESNYNPGSSDQNKILTDEEIVKQRRSNTVTDHSQYNANGSSDIELTPFYDSSVPLE-DNCLNASKIGAHWFPPEEMFEKNKISFNVKSTYNENLEGYTTQLNKNDPNFERDLLIAQKKALEIEKDRN 936
            Y L +Y +GN   + T T    GV+KA+SP GD  L    T  + + +     EK K IP+  IK + A++++    P S  ++ I             T  D S  N    SD EL  FY+S  P E D C   S+ G   FP ++MF+ N+  +NV STY ENLEGYT  L+K+DP+F++      K A EIE  +N
Sbjct:   49 YTLMRYLVGNVAEVHTSTHVSIGVIKAISPTGDVGLMSVRTAPIESEDGPYTIEKHKCIPLSEIKHLVARDIK----PASVLKDNI-------------TAEDSSHLN---DSDGELQKFYES--PGEGDACSLNSEEG---FPVDQMFKINREKYNVVSTYKENLEGYTCPLDKSDPDFKKKEQYYSKIAKEIEDGKN 222          
BLAST of LsmAD domain-containing protein vs. TrEMBL
Match: C1LGI0 (Ataxin-2 OS=Schistosoma japonicum OX=6182 GN=EWB00_004042 PE=2 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 2.467e-16
Identity = 81/238 (34.03%), Postives = 119/238 (50.00%), Query Frame = 1
Query:  307 QNAAD----FYDDHKTLYILCKYYLGNFV-TIKTETEEYNGVLKAVSPNGDFCLTEATVFVNNNELSSRYEKFKMIPIKSIKIVEAKNVESNYNPGSSDQNKILTDEEIVKQRRSNTVTDHSQYNANGSSDIELTPFYDSSVPLEDNCLNASKIGAHWFPPEEMFEKNKISFNVKSTYNENLEGYTTQLNKNDPNFERDLLIAQKKALEIEKDRNNGXXXXXXXXXXXXXXXFCSIVR 1005
            QNA D     Y +    YIL ++ +GN    I TE +   GV+KA+SP+ D  LT A V   N++ S +    K +P   IK+V   N++ +        + I TD EI K   +N          N ++D EL PF+ SS  ++D  L+     A      EMFE N+  F+V STYNE+L  YTT ++++ PNF        K A +I ++   GL   E+   ENEE  + ++VR
Sbjct:   35 QNAPDDNLGIYANPSLTYILGRHVIGNVGEIITTENDRVLGVIKAISPSADMGLTYAQVAQKNDKGSRKNVTDKTVPWTDIKMVRILNIKRS----DCLIDDIKTDSEIAKDCANN----------NHAADKELVPFFASSDGVKDCLLDQGSFSA-----VEMFETNEKMFSVFSTYNEDLREYTTPVDRSAPNFPETEARCAKLAQDIAENSGMGLMGDEDIGMENEEEKYSAVVR 253          
BLAST of LsmAD domain-containing protein vs. TrEMBL
Match: C1LGI1 (Ataxin-2, N-terminal,domain-containing protein OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 2.905e-16
Identity = 81/238 (34.03%), Postives = 119/238 (50.00%), Query Frame = 1
Query:  307 QNAAD----FYDDHKTLYILCKYYLGNFV-TIKTETEEYNGVLKAVSPNGDFCLTEATVFVNNNELSSRYEKFKMIPIKSIKIVEAKNVESNYNPGSSDQNKILTDEEIVKQRRSNTVTDHSQYNANGSSDIELTPFYDSSVPLEDNCLNASKIGAHWFPPEEMFEKNKISFNVKSTYNENLEGYTTQLNKNDPNFERDLLIAQKKALEIEKDRNNGXXXXXXXXXXXXXXXFCSIVR 1005
            QNA D     Y +    YIL ++ +GN    I TE +   GV+KA+SP+ D  LT A V   N++ S +    K +P   IK+V   N++ +        + I TD EI K   +N          N ++D EL PF+ SS  ++D  L+     A      EMFE N+  F+V STYNE+L  YTT ++++ PNF        K A +I ++   GL   E+   ENEE  + ++VR
Sbjct:   13 QNAPDDNLGIYANPSLTYILGRHVIGNVGEIITTENDRVLGVIKAISPSADMGLTYAQVAQKNDKGSRKNVTDKTVPWTDIKMVRILNIKRS----DCLIDDIKTDSEIAKDCANN----------NHAADKELVPFFASSDGVKDCLLDQGSFSA-----VEMFETNEKMFSVFSTYNEDLREYTTPVDRSAPNFPETEARCAKLAQDIAENSGMGLMGDEDIGMENEEEKYSAVVR 231          
BLAST of LsmAD domain-containing protein vs. TrEMBL
Match: A0A0X3PBJ6 (LsmAD domain-containing protein OS=Schistocephalus solidus OX=70667 GN=TR142668 PE=4 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 7.941e-16
Identity = 81/243 (33.33%), Postives = 120/243 (49.38%), Query Frame = 1
Query:  310 NAADFYDDHKTLYILCKYYLGNFVTIKTETEEYNGVLKAVSPNGDFCLTEA-TVFVNNNELSSRYEKFKMIPIKSIKIVEAKNVESNYNPGSSDQNKILTDEEIVKQRRSNTVTDHSQYNANGSSDIELTPFYDSSVPLEDNCLNASKIGAHWFPPEEMFEKNKISFNVKSTYNENLEGYTTQLNKNDPNFERDLLIAQKKALEIEK--DRNNGXXXXXXXXXXXXXXXFCSIVRTSESHRNI 1029
            N    Y + +  Y L +Y +GN   I T      GV+KA+SPNG+F LT   TV  ++   +   ++ KM+P+  IK V  +NV+    P    + +  T E        N   D S + +    D  L  ++ S    E   LN+ +     FPPE+MFE N+  FNV S+Y  +LEGYT  L+K+DP+F+       K A EIE   D N     ++   E NEEL F ++++  E  R+I
Sbjct:   40 NEVGLYANQQLTYYLARYMMGNVGEIYTNNCMCVGVIKAISPNGNFGLTCVRTVRYDSTPETYEIDEEKMVPLSEIKKVILRNVD----PSECQKAEYRTQE--------NPSAD-SHFTSPDDPDTCLEQYFHSVDEAEACSLNSEE----NFPPEDMFEINEKRFNVTSSYQASLEGYTMPLDKSDPDFKAKEEYCAKIAQEIEAGGDANAWDTMIDEDVECNEELQFSAVLKEGEPGRDI 265          
BLAST of LsmAD domain-containing protein vs. TrEMBL
Match: A0A0R3SB66 (LsmAD domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS1677 PE=4 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 3.865e-15
Identity = 68/198 (34.34%), Postives = 101/198 (51.01%), Query Frame = 1
Query:  346 YILCKYYLGNFVTIKTETEEYNGVLKAVSPNGDFCLTEA-TVFVNNNELSSRYEKFKMIPIKSIKIVEAKNVESNYNPGSSDQNKILTDEEIVKQRRSNTVTDHSQYNANGSSDIELTPFYDSSVPLEDNCLNASKIGAHWFPPEEMFEKNKISFNVKSTYNENLEGYTTQLNKNDPNFERDLLIAQKKALEIEKDRN 936
            Y L +Y++GN   + T T    GV+KA+SP GD  L    T  +         +K+K IP+  IK V A++++S           +L D   V    S  + D         SD +L  FY+S    ED C   S+ G   FP ++MF+ N+  +NV ST+ +NLEGYT  L+K+DP+F++      K A EIE D++
Sbjct:   49 YTLVRYFVGNVAEVHTSTHVSIGVVKAISPLGDVGLMSVRTAPIGEEGGPYTIDKYKCIPLSEIKHVIARDIKSV---------GVLKDN--VPAEDSCHLND---------SDGDLQKFYESPG-EEDACSLNSEEG---FPVDQMFKINREKYNVVSTFKDNLEGYTCPLDKSDPDFKKKEQYYAKVAKEIEDDKS 222          
BLAST of LsmAD domain-containing protein vs. Ensembl Yeast
Match: PBP1 (Component of glucose deprivation induced stress granules; involved in P-body-dependent granule assembly; similar to human ataxin-2; interacts with Pab1p to regulate mRNA polyadenylation; interacts with Mkt1p to regulate HO translation; protein increases in abundance and relative distribution to the nucleus increases upon DNA replication stress [Source:SGD;Acc:S000003410])

HSP 1 Score: 48.1358 bits (113), Expect = 5.577e-6
Identity = 29/74 (39.19%), Postives = 43/74 (58.11%), Query Frame = 1
Query:  721 LEDNCLNASKIGAHWFPPEEMFEKNKISFNVKSTYNENLEGYTTQLNKNDPNFERDLLIAQKKALEIEKDRNNG 942
            LED+        A W    + F  N+  F VKST++E+L  YTT++NK+DPN+ + L  A++ A EIE    +G
Sbjct:  209 LEDDS-------ASW----DQFAVNEKKFGVKSTFDEHL--YTTKINKDDPNYSKRLQEAERIAKEIESQGTSG 269          
BLAST of LsmAD domain-containing protein vs. Planmine SMEST
Match: SMESG000036673.1 (SMESG000036673.1)

HSP 1 Score: 1363.98 bits (3529), Expect = 0.000e+0
Identity = 715/718 (99.58%), Postives = 717/718 (99.86%), Query Frame = 1
Query:  145 MSYNRRPMQKRGGRIKNNFIENITVRRSNPVHNTSYAAQLRPNINNCYNADNNMQNAADFYDDHKTLYILCKYYLGNFVTIKTETEEYNGVLKAVSPNGDFCLTEATVFVNNNELSSRYEKFKMIPIKSIKIVEAKNVESNYNPGSSDQNKILTDEEIVKQRRSNTVTDHSQYNANGSSDIELTPFYDSSVPLEDNCLNASKIGAHWFPPEEMFEKNKISFNVKSTYNENLEGYTTQLNKNDPNFERDLLIAQKKALEIEKDRNNGXXXXXXXXXXXXXXXFCSIVRTSESHRNIGTESKSSISQGNNLPQQTKNFNEHNTMSLSPELADQKHNLNPNAREFTPISSSAPYCDVNNITMHINSMNIQNPNNFPNIAHSQNFIPYSIPIMFPHQMSNSVPIIQNTNGMEQFIFSRPNIVPNYSMSPFIVPNHCQLAFDPNLMNQAPNSRFDNSFQNSIQSELNYDRDTTLQNDFVNQNESSEIENIQAQEEMKRGAEDHQKRHSNSNDEYEKDFKDSNSSVPDNQYNNGSNHGYEMNEAMSSYQKMNLAMSSHNQRMINQVVAGNSQAYILPANIVHGIRQVGNYPQMMPNQISYIPNYFQRQXXXXXXXXXXXXNMIHNPAQMHQGVQLQMKSIAPQNTNFQPGFPPNQSFVPVINSQMPGQNFHTILPTYPHPMAGPINSHLQIPIQSNMXXXXXXXXXXXXCNYFTPMQLPPSQQN 2298
            MSYNRRPMQKRGGRIKNNFIENITVRRSNPVHNTSYAAQLRPNINNCYNADNNMQNAADFYDDHKTLYILCKYYLGNFVTIKTETEEYNGVLKAVSPNGDFCLTEATVFVNNNELSSRYEKFKMIPIKSIKIVEAKNVESNYNPGSSDQNKILTDEEIVKQRRSNTVTDHSQYNANGSSDIELTPFYDSSVPLEDNCLNASKIGAHWFPPEEMFEKNKISFNVKSTYNENLEGYTTQLNKNDPNFERDLLIAQKKALEIEKDRNNGLDHLENGDEENEELLFCSIVRTSESHRNI TESKSSISQGNNLPQQTKNFNEHNTMSLSPELADQKHNLNPNAREFTPISSSAPYCDVNNITMHINSMNIQNPNNFPNIAHSQNFIPYSIPIMFPHQMSNSVPIIQNTNGMEQFIFSRPNIVPNYSMSPFIVPNHCQLAFDPNLMNQAPNSRFDNSFQNSIQSELNYDRDTTLQNDFVNQNESSEIENIQAQEEMKRGAEDHQKRHSNSNDEYEKDFKDSNSSVPDNQYNNGSNHGYEMNEAMSSYQKMNLAMSSH+QRMINQVVAGNSQAYILPANIVHGIRQVGNYPQMMPNQISYIPNYFQRQPPIVTPIHPVIPNMIHNPAQMHQGVQLQMKSIAPQNTNFQPGFPPNQSFVPVINSQMPGQNFHTILPTYPHPMAGPIN+HLQIPIQSNMPQFPQFISPIQPCNYFTPMQLPPSQQN
Sbjct:    1 MSYNRRPMQKRGGRIKNNFIENITVRRSNPVHNTSYAAQLRPNINNCYNADNNMQNAADFYDDHKTLYILCKYYLGNFVTIKTETEEYNGVLKAVSPNGDFCLTEATVFVNNNELSSRYEKFKMIPIKSIKIVEAKNVESNYNPGSSDQNKILTDEEIVKQRRSNTVTDHSQYNANGSSDIELTPFYDSSVPLEDNCLNASKIGAHWFPPEEMFEKNKISFNVKSTYNENLEGYTTQLNKNDPNFERDLLIAQKKALEIEKDRNNGLDHLENGDEENEELLFCSIVRTSESHRNIDTESKSSISQGNNLPQQTKNFNEHNTMSLSPELADQKHNLNPNAREFTPISSSAPYCDVNNITMHINSMNIQNPNNFPNIAHSQNFIPYSIPIMFPHQMSNSVPIIQNTNGMEQFIFSRPNIVPNYSMSPFIVPNHCQLAFDPNLMNQAPNSRFDNSFQNSIQSELNYDRDTTLQNDFVNQNESSEIENIQAQEEMKRGAEDHQKRHSNSNDEYEKDFKDSNSSVPDNQYNNGSNHGYEMNEAMSSYQKMNLAMSSHSQRMINQVVAGNSQAYILPANIVHGIRQVGNYPQMMPNQISYIPNYFQRQPPIVTPIHPVIPNMIHNPAQMHQGVQLQMKSIAPQNTNFQPGFPPNQSFVPVINSQMPGQNFHTILPTYPHPMAGPINAHLQIPIQSNMPQFPQFISPIQPCNYFTPMQLPPSQQN 718          
BLAST of LsmAD domain-containing protein vs. Planmine SMEST
Match: SMESG000036673.1 (SMESG000036673.1)

HSP 1 Score: 1350.11 bits (3493), Expect = 0.000e+0
Identity = 708/711 (99.58%), Postives = 710/711 (99.86%), Query Frame = 1
Query:  166 MQKRGGRIKNNFIENITVRRSNPVHNTSYAAQLRPNINNCYNADNNMQNAADFYDDHKTLYILCKYYLGNFVTIKTETEEYNGVLKAVSPNGDFCLTEATVFVNNNELSSRYEKFKMIPIKSIKIVEAKNVESNYNPGSSDQNKILTDEEIVKQRRSNTVTDHSQYNANGSSDIELTPFYDSSVPLEDNCLNASKIGAHWFPPEEMFEKNKISFNVKSTYNENLEGYTTQLNKNDPNFERDLLIAQKKALEIEKDRNNGXXXXXXXXXXXXXXXFCSIVRTSESHRNIGTESKSSISQGNNLPQQTKNFNEHNTMSLSPELADQKHNLNPNAREFTPISSSAPYCDVNNITMHINSMNIQNPNNFPNIAHSQNFIPYSIPIMFPHQMSNSVPIIQNTNGMEQFIFSRPNIVPNYSMSPFIVPNHCQLAFDPNLMNQAPNSRFDNSFQNSIQSELNYDRDTTLQNDFVNQNESSEIENIQAQEEMKRGAEDHQKRHSNSNDEYEKDFKDSNSSVPDNQYNNGSNHGYEMNEAMSSYQKMNLAMSSHNQRMINQVVAGNSQAYILPANIVHGIRQVGNYPQMMPNQISYIPNYFQRQXXXXXXXXXXXXNMIHNPAQMHQGVQLQMKSIAPQNTNFQPGFPPNQSFVPVINSQMPGQNFHTILPTYPHPMAGPINSHLQIPIQSNMXXXXXXXXXXXXCNYFTPMQLPPSQQN 2298
            MQKRGGRIKNNFIENITVRRSNPVHNTSYAAQLRPNINNCYNADNNMQNAADFYDDHKTLYILCKYYLGNFVTIKTETEEYNGVLKAVSPNGDFCLTEATVFVNNNELSSRYEKFKMIPIKSIKIVEAKNVESNYNPGSSDQNKILTDEEIVKQRRSNTVTDHSQYNANGSSDIELTPFYDSSVPLEDNCLNASKIGAHWFPPEEMFEKNKISFNVKSTYNENLEGYTTQLNKNDPNFERDLLIAQKKALEIEKDRNNGLDHLENGDEENEELLFCSIVRTSESHRNI TESKSSISQGNNLPQQTKNFNEHNTMSLSPELADQKHNLNPNAREFTPISSSAPYCDVNNITMHINSMNIQNPNNFPNIAHSQNFIPYSIPIMFPHQMSNSVPIIQNTNGMEQFIFSRPNIVPNYSMSPFIVPNHCQLAFDPNLMNQAPNSRFDNSFQNSIQSELNYDRDTTLQNDFVNQNESSEIENIQAQEEMKRGAEDHQKRHSNSNDEYEKDFKDSNSSVPDNQYNNGSNHGYEMNEAMSSYQKMNLAMSSH+QRMINQVVAGNSQAYILPANIVHGIRQVGNYPQMMPNQISYIPNYFQRQPPIVTPIHPVIPNMIHNPAQMHQGVQLQMKSIAPQNTNFQPGFPPNQSFVPVINSQMPGQNFHTILPTYPHPMAGPIN+HLQIPIQSNMPQFPQFISPIQPCNYFTPMQLPPSQQN
Sbjct:    1 MQKRGGRIKNNFIENITVRRSNPVHNTSYAAQLRPNINNCYNADNNMQNAADFYDDHKTLYILCKYYLGNFVTIKTETEEYNGVLKAVSPNGDFCLTEATVFVNNNELSSRYEKFKMIPIKSIKIVEAKNVESNYNPGSSDQNKILTDEEIVKQRRSNTVTDHSQYNANGSSDIELTPFYDSSVPLEDNCLNASKIGAHWFPPEEMFEKNKISFNVKSTYNENLEGYTTQLNKNDPNFERDLLIAQKKALEIEKDRNNGLDHLENGDEENEELLFCSIVRTSESHRNIDTESKSSISQGNNLPQQTKNFNEHNTMSLSPELADQKHNLNPNAREFTPISSSAPYCDVNNITMHINSMNIQNPNNFPNIAHSQNFIPYSIPIMFPHQMSNSVPIIQNTNGMEQFIFSRPNIVPNYSMSPFIVPNHCQLAFDPNLMNQAPNSRFDNSFQNSIQSELNYDRDTTLQNDFVNQNESSEIENIQAQEEMKRGAEDHQKRHSNSNDEYEKDFKDSNSSVPDNQYNNGSNHGYEMNEAMSSYQKMNLAMSSHSQRMINQVVAGNSQAYILPANIVHGIRQVGNYPQMMPNQISYIPNYFQRQPPIVTPIHPVIPNMIHNPAQMHQGVQLQMKSIAPQNTNFQPGFPPNQSFVPVINSQMPGQNFHTILPTYPHPMAGPINAHLQIPIQSNMPQFPQFISPIQPCNYFTPMQLPPSQQN 711          
BLAST of LsmAD domain-containing protein vs. Planmine SMEST
Match: SMESG000007883.1 (SMESG000007883.1)

HSP 1 Score: 83.9593 bits (206), Expect = 1.550e-16
Identity = 71/254 (27.95%), Postives = 122/254 (48.03%), Query Frame = 1
Query:  226 SNPVHNTSYAAQLRPNINNCYNADNNMQNAADFYDDHKTL-------YILCKYYLGNFVTIKTETEEYNGVLKAVSPNGDFCLTEATVFVNNNEL-------SSRYEKFKMIPIKSIKIVEAKNVESNYNPGSSDQNKILTDEEIVKQRRSNTVTDHSQYNANGSSDIELTPFYDSSVPL-----EDNCLNASKIGAH--WFPPEEMFEKNKISFNVKSTYNENLEGYTTQLNKNDPNFERDLLIAQKKALEIE 924
            S P    S   + R N N+  NA  N  N+ ++  + K         Y + ++ +GN V I T  E Y GVL+         L  + VFV ++ L        ++YE FK I ++ I +++  N              +++D+EI ++++ +          N + D  L P++D          +D+ LNA+  G    W+ PE+M + N+  FNVK T++E +E YTTQ++K+DP+ +  +  A++ A EIE
Sbjct:    2 SVPNRKKSRGGRNRFNCNDNKNAFRNQDNSLNYGGERKKFVMSDLSTYTIARFLMGNEVQIITNNERYEGVLRTFDST---FLGLSKVFVFDSGLNESIPMMKNQYE-FKEILLRDILLIKMLNANGKLE-------SVISDQEISQRKQIS--------KPNLNEDKNLVPYFDEEETQLHSNDDDDDLNATLKGDQSCWYHPEDMLKVNEERFNVKKTFSETMEEYTTQIDKSDPHLKEKMEYAERVAKEIE 236          
BLAST of LsmAD domain-containing protein vs. Planmine SMEST
Match: SMESG000027496.1 (SMESG000027496.1)

HSP 1 Score: 54.299 bits (129), Expect = 2.072e-7
Identity = 50/138 (36.23%), Postives = 74/138 (53.62%), Query Frame = 1
Query:  247 SYAAQLRPNINNCYNADNNMQNAADFYDDHKTLYILCKYYLGNFVTIKTETEEYNGVLKAVSPNGDFCLTEATVFVNNNELSSRYEKFKMIPIKSIKIVEAKNV-----ESNYNPGSSDQNK-ILTDEEI-VKQRRSN 639
            +YAAQ+R    N   + ++ Q   DFYD + TL I+CKY++G+ VT+KT  E   GVL  +S N   CLT  TV       +   E  K+I   S K++   +V      +NY+P  + + K I + +EI  K R+SN
Sbjct:    2 TYAAQVR----NVSKSVSSQQIDDDFYDIN-TLRIICKYFVGSIVTLKTVDEIIEGVLYTISHNK-ICLTLVTV-------AKLDEPEKIIETASNKLINLSDVMLIVTNNNYSPEVTVKGKYIKSCQEINGKDRKSN 126          
The following BLAST results are available for this feature:
BLAST of LsmAD domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of LsmAD domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of LsmAD domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Atx21.357e-626.47gene:FBgn0041188 transcript:FBtr0083100[more]
Atx21.357e-626.47gene:FBgn0041188 transcript:FBtr0344377[more]
Atx21.524e-626.47gene:FBgn0041188 transcript:FBtr0083099[more]
Atx21.932e-626.47gene:FBgn0041188 transcript:FBtr0083101[more]
back to top
BLAST of LsmAD domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of LsmAD domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of LsmAD domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of LsmAD domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of LsmAD domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3TKA71.406e-1636.68LsmAD domain-containing protein OS=Rodentolepis na... [more]
C1LGI02.467e-1634.03Ataxin-2 OS=Schistosoma japonicum OX=6182 GN=EWB00... [more]
C1LGI12.905e-1634.03Ataxin-2, N-terminal,domain-containing protein OS=... [more]
A0A0X3PBJ67.941e-1633.33LsmAD domain-containing protein OS=Schistocephalus... [more]
A0A0R3SB663.865e-1534.34LsmAD domain-containing protein OS=Hymenolepis dim... [more]
back to top
BLAST of LsmAD domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of LsmAD domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of LsmAD domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
PBP15.577e-639.19Component of glucose deprivation induced stress gr... [more]
back to top
BLAST of LsmAD domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of LsmAD domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of LsmAD domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000036673.10.000e+099.58SMESG000036673.1[more]
SMESG000036673.10.000e+099.58SMESG000036673.1[more]
SMESG000007883.11.550e-1627.95SMESG000007883.1[more]
SMESG000027496.12.072e-736.23SMESG000027496.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019396 ID=SMED30019396|Name=LsmAD domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2596bp
AAATCTTTAAATTTTAGTGCGTGTTTTTAAATTAATTGGATATTTACGAG
TCAAATTTTGGTTTCGCGTGTAAATAAGCTATTGCAGTTTTATAGTTCTA
TTTCTTTCCACGATGAAGTTATATTGGTCTGTTTTAGACACATAATGAGT
TATAATAGAAGACCAATGCAAAAAAGAGGAGGACGTATTAAAAATAATTT
TATTGAAAATATTACAGTCAGAAGATCTAATCCAGTTCATAATACATCTT
ATGCTGCTCAATTGCGTCCAAATATTAATAACTGCTATAACGCGGATAAT
AATATGCAGAACGCTGCAGATTTTTATGATGATCATAAAACTCTGTACAT
ATTATGCAAATATTATTTGGGTAATTTTGTTACTATCAAAACCGAAACAG
AGGAATATAATGGGGTTTTGAAAGCCGTATCTCCAAATGGAGATTTTTGT
CTAACCGAAGCAACAGTATTTGTTAACAATAACGAACTATCAAGTCGTTA
CGAAAAGTTCAAAATGATTCCAATAAAAAGTATTAAAATTGTCGAAGCCA
AAAATGTGGAGTCTAATTACAACCCTGGTTCATCAGATCAGAACAAAATA
TTAACTGATGAAGAAATTGTTAAGCAAAGGCGATCTAATACTGTCACTGA
TCATAGTCAATATAATGCCAATGGTTCTTCAGATATTGAGTTAACACCAT
TTTATGATAGTTCTGTTCCTTTGGAAGATAATTGTCTTAATGCTAGTAAG
ATTGGAGCTCATTGGTTCCCTCCAGAAGAAATGTTTGAAAAAAATAAAAT
CAGTTTCAATGTCAAATCAACATATAATGAGAATTTAGAAGGATATACAA
CTCAATTAAATAAAAACGATCCGAATTTTGAACGCGATCTTCTTATTGCC
CAGAAAAAAGCTCTGGAAATTGAGAAGGATCGTAATAATGGACTTGACCA
TTTAGAAAATGGTGATGAAGAGAATGAGGAACTTTTATTTTGTTCAATAG
TCCGTACGTCAGAGTCCCACAGGAATATTGGCACCGAAAGCAAATCCTCC
ATTTCACAAGGAAATAATTTGCCCCAGCAAACCAAAAATTTCAACGAGCA
CAATACTATGTCATTATCTCCAGAATTAGCCGACCAGAAACACAATTTGA
ATCCCAACGCTCGCGAATTTACACCAATTTCTTCAAGTGCTCCTTACTGC
GATGTAAATAATATTACTATGCACATAAATTCAATGAATATTCAAAATCC
AAACAATTTTCCAAATATTGCTCATTCCCAGAATTTCATTCCTTATTCAA
TTCCAATCATGTTTCCACACCAAATGTCAAATTCCGTACCAATAATTCAA
AACACAAACGGCATGGAACAGTTCATATTTTCCCGTCCCAATATTGTTCC
AAATTATTCAATGTCACCGTTTATTGTTCCAAACCACTGCCAACTTGCTT
TTGATCCAAATCTAATGAACCAAGCTCCTAATTCAAGATTTGATAATAGT
TTTCAAAATTCCATTCAAAGTGAACTGAATTACGATCGGGACACAACTTT
ACAAAATGATTTCGTCAACCAGAATGAATCGAGTGAAATCGAAAACATCC
AAGCTCAAGAGGAAATGAAAAGAGGAGCAGAAGATCACCAGAAAAGACAT
TCGAATTCCAATGATGAATATGAAAAAGATTTCAAAGATTCTAATTCTAG
TGTGCCAGATAACCAATATAACAATGGCAGTAACCATGGTTACGAGATGA
ATGAAGCAATGTCCAGTTACCAGAAAATGAATCTGGCAATGTCGTCCCAT
AATCAGAGAATGATAAATCAAGTCGTTGCCGGAAATTCACAGGCGTACAT
ATTACCGGCAAATATCGTTCATGGAATTCGACAAGTTGGAAACTATCCAC
AGATGATGCCAAATCAAATCTCATATATTCCTAATTATTTCCAAAGACAG
CCTCCTATTGTCACCCCGATCCACCCGGTTATCCCGAATATGATTCATAA
TCCAGCGCAAATGCATCAAGGTGTTCAACTTCAAATGAAATCAATCGCTC
CTCAGAATACAAATTTTCAACCCGGATTTCCGCCCAATCAATCATTTGTG
CCCGTTATCAATTCTCAAATGCCTGGTCAAAATTTCCATACGATACTTCC
CACTTACCCTCATCCAATGGCCGGTCCGATTAATTCTCATTTACAGATTC
CAATTCAATCTAACATGCCGCAATTTCCCCAGTTCATTTCTCCAATTCAG
CCGTGTAATTATTTCACTCCAATGCAGCTTCCACCATCACAACAAAACTG
AACAGCAAATCTATTTTTGCACTCTAGGAACAAATATCTGTAAATAATTT
CCATTTGTTTTTCGCGTTTCTTCGGATTTCAATTTCTATATTATGGTGAT
CTGTTGTTTTGATATTTTTATTTATTATAAATACCGAGTTAGCCACCGAG
TTAATTGTTACAATTTGTAAACAAAATTTTCAAAAGAAATTAATTTCAAT
TTTTTAATTTTCCAAGCATTAGTTTTTTTAATATAACATTGCATTCTATT
ATTTTTTTCATTTCCATGTACCCCATCAAATTGAGCTCAAACTTGT
back to top

protein sequence of SMED30019396-orf-1

>SMED30019396-orf-1 ID=SMED30019396-orf-1|Name=SMED30019396-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=719bp
MSYNRRPMQKRGGRIKNNFIENITVRRSNPVHNTSYAAQLRPNINNCYNA
DNNMQNAADFYDDHKTLYILCKYYLGNFVTIKTETEEYNGVLKAVSPNGD
FCLTEATVFVNNNELSSRYEKFKMIPIKSIKIVEAKNVESNYNPGSSDQN
KILTDEEIVKQRRSNTVTDHSQYNANGSSDIELTPFYDSSVPLEDNCLNA
SKIGAHWFPPEEMFEKNKISFNVKSTYNENLEGYTTQLNKNDPNFERDLL
IAQKKALEIEKDRNNGLDHLENGDEENEELLFCSIVRTSESHRNIGTESK
SSISQGNNLPQQTKNFNEHNTMSLSPELADQKHNLNPNAREFTPISSSAP
YCDVNNITMHINSMNIQNPNNFPNIAHSQNFIPYSIPIMFPHQMSNSVPI
IQNTNGMEQFIFSRPNIVPNYSMSPFIVPNHCQLAFDPNLMNQAPNSRFD
NSFQNSIQSELNYDRDTTLQNDFVNQNESSEIENIQAQEEMKRGAEDHQK
RHSNSNDEYEKDFKDSNSSVPDNQYNNGSNHGYEMNEAMSSYQKMNLAMS
SHNQRMINQVVAGNSQAYILPANIVHGIRQVGNYPQMMPNQISYIPNYFQ
RQPPIVTPIHPVIPNMIHNPAQMHQGVQLQMKSIAPQNTNFQPGFPPNQS
FVPVINSQMPGQNFHTILPTYPHPMAGPINSHLQIPIQSNMPQFPQFISP
IQPCNYFTPMQLPPSQQN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR009604LsmAD_domain
Vocabulary: molecular function
TermDefinition
GO:0003674molecular_function
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0010494cytoplasmic stress granule
Vocabulary: biological process
TermDefinition
GO:0006909phagocytosis
GO:0007275multicellular organism development
GO:0007616long-term memory
GO:0009994oocyte differentiation
GO:0010603regulation of cytoplasmic mRNA processing body assembly
GO:0022008neurogenesis
GO:0022416chaeta development
GO:0030431sleep
GO:0030833regulation of actin filament polymerization
GO:0032092positive regulation of protein binding
GO:0034063stress granule assembly
GO:0042051compound eye photoreceptor development
GO:0045475locomotor rhythm
GO:0046959habituation
GO:0048749compound eye development
GO:0051823regulation of synapse structural plasticity
GO:0060965negative regulation of gene silencing by miRNA
GO:0090328regulation of olfactory learning
GO:0097167circadian regulation of translation
GO:1901216positive regulation of neuron death
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR009604LsmAD domainSMARTSM01272LsmAD_2coord: 221..288
e-value: 1.8E-12
score: 57.4
IPR009604LsmAD domainPFAMPF06741LsmADcoord: 221..287
e-value: 2.0E-11
score: 44.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 489..524
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 489..517
NoneNo IPR availablePANTHERPTHR12854:SF7ATAXIN-2 HOMOLOGcoord: 34..302
NoneNo IPR availablePANTHERPTHR12854ATAXIN 2-RELATEDcoord: 34..302