protocadherin-1

Overview
Nameprotocadherin-1
Smed IDSMED30019393
Length (bp)3254
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of protocadherin-1 (SMED30019393) t-SNE clustered cells

Violin plots show distribution of expression levels for protocadherin-1 (SMED30019393) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of protocadherin-1 (SMED30019393) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for protocadherin-1 (SMED30019393) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019393

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30019393SMESG000033799.1 SmedASXL_014402SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30019393SMESG000033799.1 SmedASXL_014403SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
gutSMED30019393SMESG000033799.1 dd_Smed_v4_16629_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30019393SMESG000033799.1 dd_Smed_v4_16629_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30019393SMESG000033799.1 dd_Smed_v4_16629_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30019393SMESG000033799.1 dd_Smed_v6_16629_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of protocadherin-1 vs. Ensembl Human
Match: PCDH11X (protocadherin 11 X-linked [Source:HGNC Symbol;Acc:HGNC:8656])

HSP 1 Score: 216.468 bits (550), Expect = 1.022e-56
Identity = 198/686 (28.86%), Postives = 319/686 (46.50%), Query Frame = 2
Query:  395 DSDYGINSEIIYSIEGKDKGFFKLLQMK----NNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKD--DETLITVLINSNSDPEVKRHFQVSAISGLTLISR-LDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQI----VIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGY--SGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNK---YFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPSXXXXXXXXXXXXNEDEDKQTSVINEKVDQEKTYQEARRKNNIDNYDGFKWNSKEVLISLTVGSVMLII 2404
            D D GIN    Y +  K +  F L  ++    +  P     K  DREE+D Y +     D G P+++    + + + D ND+ P F    +  + + E+A  G+ +  +  TD D  +   I    ++      +R F ++A +GL  I   LD E +     + V+A D G+  +     + VNV D+NDN P I    +++ ++D+     L EN P  + +A++TVTD D++ NG V C     +++  F L   + N F        + T    D E+   Y + +   D G PPL+    + I ++DENDN P F++ F    I EN  PG  +  + A D D G NAKI Y +        S+ +  TG++T +   DRE      F   A D   P L S+V V + I D+ND  P+F  + Y+F + E     G VG +   D D   NS +  S      N  + + S   +     I  DRE Q +Y   V+A+D G  SRSSS  V I + D+NDN P F  P  +   + +  +  PGT++ +V+A D+D   N +V Y +        F ID+++G + +    D  +L   R+L+ A D G P    +  +  LF NE     T +INE V ++ T         I +      +  ++L++   G++ +++
Sbjct:  165 DPDVGINGVQNYELI-KSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKE-TEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLL-VLASDGGL--MPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDT---VVLSENIPLNTKIALITVTDKDADHNGRVTCFT---DHEIPFRLRPVFSNQF-------LLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAKINYLLGPDAPPEFSL-DCRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSI--LDENDDFTIDSQTGVI-RPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNCSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFVNESVTNAT-LINELV-RKSTEAPVTPNTEIADVSSPTSDYVKILVAAVAGTITVVV 826          

HSP 2 Score: 117.857 bits (294), Expect = 5.111e-26
Identity = 162/602 (26.91%), Postives = 252/602 (41.86%), Query Frame = 2
Query:  491 IFKTMKLFDREER----DRYELVFIATDKGI-PKKTGE-IKIYIKIRDLNDHAPEFDMPKDYV-IGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRH---FQVSAISG--------LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFE---LISRYFNNFPNSKRNYRIVTLRE-FDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRI------KENIMPGSPIFTLIATDPDIGKNAKII----YQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGWV--GKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTY-LLANNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNG 2191
            IF T    DRE+      R E  F   +  I P +    +KI   I D+ND+AP F  P   + I + E++   SK       D D      V IN   + E+ +    F +  I          L +   LD E     + + V   D G P  +++  + V+V D NDN P        ++     + EN P  + V  +  TDAD           I  N K +F    L+S       +      ++T++E  DRE   ++++ V   D GL P  ++  + + + D NDN PS    +  + +       ENI   + I  +  TD D   N ++     ++IP + + + S    +  ++      D E       K  A D   P LN S  + ++++DEND  P+F  S     I E  S  +   KV A D DS  N+ I +           +    G +   K  +LDRE +  Y  T+ AKDNGVP  +S+V V + + D NDNSP F+    + Y   + E L     +  +  TD D  +N  VT  +L  N  F ID ++G +  N + DR +       + A+D G
Sbjct:   84 IFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLF--PATVINISIPENSAINSKYTLPAAVDPD------VGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEK-DTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHP-----VFKETEIEVSIPENAPVGTSVTQLHATDAD-----------IGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMP--ARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFS----NQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAKINYLLGPDAPPEFSLDCRTGMLTVVK--KLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTH---NEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGG 649          

HSP 3 Score: 68.9366 bits (167), Expect = 4.773e-11
Identity = 90/327 (27.52%), Postives = 138/327 (42.20%), Query Frame = 2
Query: 1277 ITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIIS---IPNPSTGIVTNLV---SFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEG--YSGWVGKVEAYXXXXXXXXXIIFSFTGFLHN---HLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGV-PSRSSSVIVQIQLEDINDNSPKFS-----QPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNKYFIIDEKSGEVFINRTLDRLELVPRR---LLIMAKDNGTP 2197
            I   IED NDN P F        I EN    S      A DPD+G N    Y++  K QNI     I  P    +  L+     DRE   +   K    D   P  +S+  + + + D ND  P+F  +     I E       V ++ A D D   N+ I FSF+  + N    L+ L +   + + K   LDRE    ++L V A D G+ P+R+   +V + + D+NDN P         P++   +  ++E +   T I  +  TD D + NG+VT    +   F +       F+  T   L+    +   + ++A D G P
Sbjct:  125 IRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYEL-IKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKE-PLDREETPNHKLLVLASDGGLMPARA---MVLVNVTDVNDNVPSIDIRYIVNPVNDTVV--LSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQFLLETAAYLDYESTKEYAIKLLAADAGKP 444          
BLAST of protocadherin-1 vs. Ensembl Human
Match: PCDH11X (protocadherin 11 X-linked [Source:HGNC Symbol;Acc:HGNC:8656])

HSP 1 Score: 216.468 bits (550), Expect = 1.094e-56
Identity = 198/686 (28.86%), Postives = 319/686 (46.50%), Query Frame = 2
Query:  395 DSDYGINSEIIYSIEGKDKGFFKLLQMK----NNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKD--DETLITVLINSNSDPEVKRHFQVSAISGLTLISR-LDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQI----VIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGY--SGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNK---YFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPSXXXXXXXXXXXXNEDEDKQTSVINEKVDQEKTYQEARRKNNIDNYDGFKWNSKEVLISLTVGSVMLII 2404
            D D GIN    Y +  K +  F L  ++    +  P     K  DREE+D Y +     D G P+++    + + + D ND+ P F    +  + + E+A  G+ +  +  TD D  +   I    ++      +R F ++A +GL  I   LD E +     + V+A D G+  +     + VNV D+NDN P I    +++ ++D+     L EN P  + +A++TVTD D++ NG V C     +++  F L   + N F        + T    D E+   Y + +   D G PPL+    + I ++DENDN P F++ F    I EN  PG  +  + A D D G NAKI Y +        S+ +  TG++T +   DRE      F   A D   P L S+V V + I D+ND  P+F  + Y+F + E     G VG +   D D   NS +  S      N  + + S   +     I  DRE Q +Y   V+A+D G  SRSSS  V I + D+NDN P F  P  +   + +  +  PGT++ +V+A D+D   N +V Y +        F ID+++G + +    D  +L   R+L+ A D G P    +  +  LF NE     T +INE V ++ T         I +      +  ++L++   G++ +++
Sbjct:  165 DPDVGINGVQNYELI-KSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKE-TEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLL-VLASDGGL--MPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDT---VVLSENIPLNTKIALITVTDKDADHNGRVTCFT---DHEIPFRLRPVFSNQF-------LLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAKINYLLGPDAPPEFSL-DCRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSI--LDENDDFTIDSQTGVI-RPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNCSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFVNESVTNAT-LINELV-RKSTEAPVTPNTEIADVSSPTSDYVKILVAAVAGTITVVV 826          

HSP 2 Score: 117.857 bits (294), Expect = 5.224e-26
Identity = 162/602 (26.91%), Postives = 252/602 (41.86%), Query Frame = 2
Query:  491 IFKTMKLFDREER----DRYELVFIATDKGI-PKKTGE-IKIYIKIRDLNDHAPEFDMPKDYV-IGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRH---FQVSAISG--------LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFE---LISRYFNNFPNSKRNYRIVTLRE-FDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRI------KENIMPGSPIFTLIATDPDIGKNAKII----YQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGWV--GKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTY-LLANNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNG 2191
            IF T    DRE+      R E  F   +  I P +    +KI   I D+ND+AP F  P   + I + E++   SK       D D      V IN   + E+ +    F +  I          L +   LD E     + + V   D G P  +++  + V+V D NDN P        ++     + EN P  + V  +  TDAD           I  N K +F    L+S       +      ++T++E  DRE   ++++ V   D GL P  ++  + + + D NDN PS    +  + +       ENI   + I  +  TD D   N ++     ++IP + + + S    +  ++      D E       K  A D   P LN S  + ++++DEND  P+F  S     I E  S  +   KV A D DS  N+ I +           +    G +   K  +LDRE +  Y  T+ AKDNGVP  +S+V V + + D NDNSP F+    + Y   + E L     +  +  TD D  +N  VT  +L  N  F ID ++G +  N + DR +       + A+D G
Sbjct:   84 IFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLF--PATVINISIPENSAINSKYTLPAAVDPD------VGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEK-DTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHP-----VFKETEIEVSIPENAPVGTSVTQLHATDAD-----------IGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMP--ARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFS----NQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAKINYLLGPDAPPEFSLDCRTGMLTVVK--KLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTH---NEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGG 649          

HSP 3 Score: 69.3218 bits (168), Expect = 4.453e-11
Identity = 90/327 (27.52%), Postives = 138/327 (42.20%), Query Frame = 2
Query: 1277 ITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIIS---IPNPSTGIVTNLV---SFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEG--YSGWVGKVEAYXXXXXXXXXIIFSFTGFLHN---HLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGV-PSRSSSVIVQIQLEDINDNSPKFS-----QPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNKYFIIDEKSGEVFINRTLDRLELVPRR---LLIMAKDNGTP 2197
            I   IED NDN P F        I EN    S      A DPD+G N    Y++  K QNI     I  P    +  L+     DRE   +   K    D   P  +S+  + + + D ND  P+F  +     I E       V ++ A D D   N+ I FSF+  + N    L+ L +   + + K   LDRE    ++L V A D G+ P+R+   +V + + D+NDN P         P++   +  ++E +   T I  +  TD D + NG+VT    +   F +       F+  T   L+    +   + ++A D G P
Sbjct:  125 IRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYEL-IKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKE-PLDREETPNHKLLVLASDGGLMPARA---MVLVNVTDVNDNVPSIDIRYIVNPVNDTVV--LSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQFLLETAAYLDYESTKEYAIKLLAADAGKP 444          
BLAST of protocadherin-1 vs. Ensembl Human
Match: PCDH11X (protocadherin 11 X-linked [Source:HGNC Symbol;Acc:HGNC:8656])

HSP 1 Score: 215.312 bits (547), Expect = 1.250e-56
Identity = 198/686 (28.86%), Postives = 319/686 (46.50%), Query Frame = 2
Query:  395 DSDYGINSEIIYSIEGKDKGFFKLLQMK----NNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKD--DETLITVLINSNSDPEVKRHFQVSAISGLTLISR-LDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQI----VIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGY--SGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNK---YFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPSXXXXXXXXXXXXNEDEDKQTSVINEKVDQEKTYQEARRKNNIDNYDGFKWNSKEVLISLTVGSVMLII 2404
            D D GIN    Y +  K +  F L  ++    +  P     K  DREE+D Y +     D G P+++    + + + D ND+ P F    +  + + E+A  G+ +  +  TD D  +   I    ++      +R F ++A +GL  I   LD E +     + V+A D G+  +     + VNV D+NDN P I    +++ ++D+     L EN P  + +A++TVTD D++ NG V C     +++  F L   + N F        + T    D E+   Y + +   D G PPL+    + I ++DENDN P F++ F    I EN  PG  +  + A D D G NAKI Y +        S+ +  TG++T +   DRE      F   A D   P L S+V V + I D+ND  P+F  + Y+F + E     G VG +   D D   NS +  S      N  + + S   +     I  DRE Q +Y   V+A+D G  SRSSS  V I + D+NDN P F  P  +   + +  +  PGT++ +V+A D+D   N +V Y +        F ID+++G + +    D  +L   R+L+ A D G P    +  +  LF NE     T +INE V ++ T         I +      +  ++L++   G++ +++
Sbjct:  165 DPDVGINGVQNYELI-KSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKE-TEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLL-VLASDGGL--MPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDT---VVLSENIPLNTKIALITVTDKDADHNGRVTCFT---DHEIPFRLRPVFSNQF-------LLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAKINYLLGPDAPPEFSL-DCRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILD--ENDDFTIDSQTGVI-RPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNCSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFVNESVTNAT-LINELV-RKSTEAPVTPNTEIADVSSPTSDYVKILVAAVAGTITVVV 826          

HSP 2 Score: 117.857 bits (294), Expect = 4.748e-26
Identity = 162/602 (26.91%), Postives = 252/602 (41.86%), Query Frame = 2
Query:  491 IFKTMKLFDREER----DRYELVFIATDKGI-PKKTGE-IKIYIKIRDLNDHAPEFDMPKDYV-IGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRH---FQVSAISG--------LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFE---LISRYFNNFPNSKRNYRIVTLRE-FDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRI------KENIMPGSPIFTLIATDPDIGKNAKII----YQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGWV--GKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTY-LLANNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNG 2191
            IF T    DRE+      R E  F   +  I P +    +KI   I D+ND+AP F  P   + I + E++   SK       D D      V IN   + E+ +    F +  I          L +   LD E     + + V   D G P  +++  + V+V D NDN P        ++     + EN P  + V  +  TDAD           I  N K +F    L+S       +      ++T++E  DRE   ++++ V   D GL P  ++  + + + D NDN PS    +  + +       ENI   + I  +  TD D   N ++     ++IP + + + S    +  ++      D E       K  A D   P LN S  + ++++DEND  P+F  S     I E  S  +   KV A D DS  N+ I +           +    G +   K  +LDRE +  Y  T+ AKDNGVP  +S+V V + + D NDNSP F+    + Y   + E L     +  +  TD D  +N  VT  +L  N  F ID ++G +  N + DR +       + A+D G
Sbjct:   84 IFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLF--PATVINISIPENSAINSKYTLPAAVDPD------VGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEK-DTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHP-----VFKETEIEVSIPENAPVGTSVTQLHATDAD-----------IGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMP--ARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFS----NQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAKINYLLGPDAPPEFSLDCRTGMLTVVK--KLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTH---NEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGG 649          
BLAST of protocadherin-1 vs. Ensembl Human
Match: PCDH11X (protocadherin 11 X-linked [Source:HGNC Symbol;Acc:HGNC:8656])

HSP 1 Score: 216.083 bits (549), Expect = 1.260e-56
Identity = 198/686 (28.86%), Postives = 319/686 (46.50%), Query Frame = 2
Query:  395 DSDYGINSEIIYSIEGKDKGFFKLLQMK----NNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKD--DETLITVLINSNSDPEVKRHFQVSAISGLTLISR-LDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQI----VIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGY--SGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNK---YFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPSXXXXXXXXXXXXNEDEDKQTSVINEKVDQEKTYQEARRKNNIDNYDGFKWNSKEVLISLTVGSVMLII 2404
            D D GIN    Y +  K +  F L  ++    +  P     K  DREE+D Y +     D G P+++    + + + D ND+ P F    +  + + E+A  G+ +  +  TD D  +   I    ++      +R F ++A +GL  I   LD E +     + V+A D G+  +     + VNV D+NDN P I    +++ ++D+     L EN P  + +A++TVTD D++ NG V C     +++  F L   + N F        + T    D E+   Y + +   D G PPL+    + I ++DENDN P F++ F    I EN  PG  +  + A D D G NAKI Y +        S+ +  TG++T +   DRE      F   A D   P L S+V V + I D+ND  P+F  + Y+F + E     G VG +   D D   NS +  S      N  + + S   +     I  DRE Q +Y   V+A+D G  SRSSS  V I + D+NDN P F  P  +   + +  +  PGT++ +V+A D+D   N +V Y +        F ID+++G + +    D  +L   R+L+ A D G P    +  +  LF NE     T +INE V ++ T         I +      +  ++L++   G++ +++
Sbjct:  165 DPDVGINGVQNYELI-KSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKE-TEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLL-VLASDGGL--MPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDT---VVLSENIPLNTKIALITVTDKDADHNGRVTCFT---DHEIPFRLRPVFSNQF-------LLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAKINYLLGPDAPPEFSL-DCRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSI--LDENDDFTIDSQTGVI-RPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNCSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFVNESVTNAT-LINELV-RKSTEAPVTPNTEIADVSSPTSDYVKILVAAVAGTITVVV 826          

HSP 2 Score: 117.472 bits (293), Expect = 6.597e-26
Identity = 162/602 (26.91%), Postives = 252/602 (41.86%), Query Frame = 2
Query:  491 IFKTMKLFDREER----DRYELVFIATDKGI-PKKTGE-IKIYIKIRDLNDHAPEFDMPKDYV-IGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRH---FQVSAISG--------LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFE---LISRYFNNFPNSKRNYRIVTLRE-FDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRI------KENIMPGSPIFTLIATDPDIGKNAKII----YQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGWV--GKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTY-LLANNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNG 2191
            IF T    DRE+      R E  F   +  I P +    +KI   I D+ND+AP F  P   + I + E++   SK       D D      V IN   + E+ +    F +  I          L +   LD E     + + V   D G P  +++  + V+V D NDN P        ++     + EN P  + V  +  TDAD           I  N K +F    L+S       +      ++T++E  DRE   ++++ V   D GL P  ++  + + + D NDN PS    +  + +       ENI   + I  +  TD D   N ++     ++IP + + + S    +  ++      D E       K  A D   P LN S  + ++++DEND  P+F  S     I E  S  +   KV A D DS  N+ I +           +    G +   K  +LDRE +  Y  T+ AKDNGVP  +S+V V + + D NDNSP F+    + Y   + E L     +  +  TD D  +N  VT  +L  N  F ID ++G +  N + DR +       + A+D G
Sbjct:   84 IFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLF--PATVINISIPENSAINSKYTLPAAVDPD------VGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEK-DTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHP-----VFKETEIEVSIPENAPVGTSVTQLHATDAD-----------IGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMP--ARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFS----NQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAKINYLLGPDAPPEFSLDCRTGMLTVVK--KLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTH---NEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGG 649          

HSP 3 Score: 68.9366 bits (167), Expect = 5.112e-11
Identity = 90/327 (27.52%), Postives = 138/327 (42.20%), Query Frame = 2
Query: 1277 ITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIIS---IPNPSTGIVTNLV---SFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEG--YSGWVGKVEAYXXXXXXXXXIIFSFTGFLHN---HLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGV-PSRSSSVIVQIQLEDINDNSPKFS-----QPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNKYFIIDEKSGEVFINRTLDRLELVPRR---LLIMAKDNGTP 2197
            I   IED NDN P F        I EN    S      A DPD+G N    Y++  K QNI     I  P    +  L+     DRE   +   K    D   P  +S+  + + + D ND  P+F  +     I E       V ++ A D D   N+ I FSF+  + N    L+ L +   + + K   LDRE    ++L V A D G+ P+R+   +V + + D+NDN P         P++   +  ++E +   T I  +  TD D + NG+VT    +   F +       F+  T   L+    +   + ++A D G P
Sbjct:  125 IRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYEL-IKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKE-PLDREETPNHKLLVLASDGGLMPARA---MVLVNVTDVNDNVPSIDIRYIVNPVNDTVV--LSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQFLLETAAYLDYESTKEYAIKLLAADAGKP 444          
BLAST of protocadherin-1 vs. Ensembl Human
Match: PCDH11X (protocadherin 11 X-linked [Source:HGNC Symbol;Acc:HGNC:8656])

HSP 1 Score: 216.083 bits (549), Expect = 1.506e-56
Identity = 198/686 (28.86%), Postives = 319/686 (46.50%), Query Frame = 2
Query:  395 DSDYGINSEIIYSIEGKDKGFFKLLQMK----NNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKD--DETLITVLINSNSDPEVKRHFQVSAISGLTLISR-LDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQI----VIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGY--SGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNK---YFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPSXXXXXXXXXXXXNEDEDKQTSVINEKVDQEKTYQEARRKNNIDNYDGFKWNSKEVLISLTVGSVMLII 2404
            D D GIN    Y +  K +  F L  ++    +  P     K  DREE+D Y +     D G P+++    + + + D ND+ P F    +  + + E+A  G+ +  +  TD D  +   I    ++      +R F ++A +GL  I   LD E +     + V+A D G+  +     + VNV D+NDN P I    +++ ++D+     L EN P  + +A++TVTD D++ NG V C     +++  F L   + N F        + T    D E+   Y + +   D G PPL+    + I ++DENDN P F++ F    I EN  PG  +  + A D D G NAKI Y +        S+ +  TG++T +   DRE      F   A D   P L S+V V + I D+ND  P+F  + Y+F + E     G VG +   D D   NS +  S      N  + + S   +     I  DRE Q +Y   V+A+D G  SRSSS  V I + D+NDN P F  P  +   + +  +  PGT++ +V+A D+D   N +V Y +        F ID+++G + +    D  +L   R+L+ A D G P    +  +  LF NE     T +INE V ++ T         I +      +  ++L++   G++ +++
Sbjct:  165 DPDVGINGVQNYELI-KSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKE-TEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLL-VLASDGGL--MPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDT---VVLSENIPLNTKIALITVTDKDADHNGRVTCFT---DHEIPFRLRPVFSNQF-------LLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAKINYLLGPDAPPEFSL-DCRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSI--LDENDDFTIDSQTGVI-RPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNCSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFVNESVTNAT-LINELV-RKSTEAPVTPNTEIADVSSPTSDYVKILVAAVAGTITVVV 826          

HSP 2 Score: 117.472 bits (293), Expect = 6.888e-26
Identity = 162/602 (26.91%), Postives = 252/602 (41.86%), Query Frame = 2
Query:  491 IFKTMKLFDREER----DRYELVFIATDKGI-PKKTGE-IKIYIKIRDLNDHAPEFDMPKDYV-IGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRH---FQVSAISG--------LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFE---LISRYFNNFPNSKRNYRIVTLRE-FDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRI------KENIMPGSPIFTLIATDPDIGKNAKII----YQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGWV--GKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTY-LLANNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNG 2191
            IF T    DRE+      R E  F   +  I P +    +KI   I D+ND+AP F  P   + I + E++   SK       D D      V IN   + E+ +    F +  I          L +   LD E     + + V   D G P  +++  + V+V D NDN P        ++     + EN P  + V  +  TDAD           I  N K +F    L+S       +      ++T++E  DRE   ++++ V   D GL P  ++  + + + D NDN PS    +  + +       ENI   + I  +  TD D   N ++     ++IP + + + S    +  ++      D E       K  A D   P LN S  + ++++DEND  P+F  S     I E  S  +   KV A D DS  N+ I +           +    G +   K  +LDRE +  Y  T+ AKDNGVP  +S+V V + + D NDNSP F+    + Y   + E L     +  +  TD D  +N  VT  +L  N  F ID ++G +  N + DR +       + A+D G
Sbjct:   84 IFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLF--PATVINISIPENSAINSKYTLPAAVDPD------VGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEK-DTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHP-----VFKETEIEVSIPENAPVGTSVTQLHATDAD-----------IGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMP--ARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFS----NQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAKINYLLGPDAPPEFSLDCRTGMLTVVK--KLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTH---NEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGG 649          

HSP 3 Score: 68.9366 bits (167), Expect = 5.309e-11
Identity = 90/327 (27.52%), Postives = 138/327 (42.20%), Query Frame = 2
Query: 1277 ITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIIS---IPNPSTGIVTNLV---SFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEG--YSGWVGKVEAYXXXXXXXXXIIFSFTGFLHN---HLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGV-PSRSSSVIVQIQLEDINDNSPKFS-----QPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNKYFIIDEKSGEVFINRTLDRLELVPRR---LLIMAKDNGTP 2197
            I   IED NDN P F        I EN    S      A DPD+G N    Y++  K QNI     I  P    +  L+     DRE   +   K    D   P  +S+  + + + D ND  P+F  +     I E       V ++ A D D   N+ I FSF+  + N    L+ L +   + + K   LDRE    ++L V A D G+ P+R+   +V + + D+NDN P         P++   +  ++E +   T I  +  TD D + NG+VT    +   F +       F+  T   L+    +   + ++A D G P
Sbjct:  125 IRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYEL-IKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKE-PLDREETPNHKLLVLASDGGLMPARA---MVLVNVTDVNDNVPSIDIRYIVNPVNDTVV--LSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQFLLETAAYLDYESTKEYAIKLLAADAGKP 444          
BLAST of protocadherin-1 vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 190.66 bits (483), Expect = 1.023e-48
Identity = 190/627 (30.30%), Postives = 292/627 (46.57%), Query Frame = 2
Query:  392 RDSDYGINSEIIYSI-EGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISGL------------TLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPN-PSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKE----GYSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANN------KYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPS 2200
            RD D G N EI YS+ EG  K    LL +     + +T    DRE      L  IA+DKG PK+     + I + D+ND+AP F     Y + + E+    + I  +K TD+D          +N     K H+ +++ SG+            TL  R+D ++S    T  + A D   P L+++  +T+NV+DIND+ P     TL  +     L EN      V  V   D DS  NGI+  ++      ++F +           + +  I T +  DRET + Y + V  +D G P L++  TI + ++D NDN P+F K  +   I E +  GS I TL A D D  ++ KI Y+I E  + + SI +    G + ++    +  +  +  +  A D+    L     V + I+D N   P F    +  KI E    GY   V  ++A D+D   N+ I++S          I  S G+I       LDRE ++T+ + V A D+  P  ++S  +++ L+DINDNSP+F+    S Y   I+E +  GT   +V A D D   NG V Y L  +      + F +D  SG + ++  LDR +     L I A+D GTPS
Sbjct:  295 RDLDSGENGEIEYSLGEGNGK---NLLAINAKSGVIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVF-ASDSYNVTILENITIPAVIATVKATDED--------FGTNG----KVHYSMASSSGIGGLTIDYSTGEVTLRERIDAKNS--PITAVIRAKDGAQPALSSTVPLTINVIDINDHAP-----TLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSM---EGSEDFII----------DEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDND--EDQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQDHKVRVEISATDQGG--LQGRCVVNVFIDDVNS-APYFNDHPFSVKIPEHSPIGYP--VITLKAEDHDRGDNARIVYSIDS--SQFFRIDPSSGDISVSS--DLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTS---SSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPS 871          

HSP 2 Score: 147.517 bits (371), Expect = 2.226e-35
Identity = 151/493 (30.63%), Postives = 232/493 (47.06%), Query Frame = 2
Query:  656 YVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISG-LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNF-KLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKE--GYSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNKYFIIDEKSGEVF 2122
            YV  + ED    + I  +K +    + L   ++ +  D   +  F +  +SG + L   +D E  + K  + V A +   P ++ STT+ V+VLD+ DN P      + +  S F ++ E+ P  + V  V   D DS  NG ++ +L E N K    +         N+K    I T    DRET+S  R+ V   D+G P   S   + I + D NDN P F+   +   I ENI   + I T+ ATD D G N K+ Y +           + STG VT     D + N+ IT    A D   P L+S+V +T+ + D ND  P  +++     ++E       VG+V A D DS  N  I +S  G   +  +I+  D  +     + LDRE  + Y L V A+D G PS ++S  + + L+DINDN+P F +     Y   I+E +  G+ I  + A D+DE++  K+TY         I+E   EVF
Sbjct:  170 YVKELPEDTPIETIIASVKASHASSQPLYYSMV-APQDSRSQNLFTLDTMSGEIRLAKSMDREV-LDKHILKVTAYERVDPTISASTTVVVHVLDVQDNSP------IFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEGNGKNLLAI---------NAKSGV-IQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGEVTLRERIDAK-NSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEG---SEDFIIDEDSGLIKTTKL-LDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDK---KEYNVTISEEMPRGSQIITLKAVDNDEDQ--KITYR--------IEEADREVF 626          

HSP 3 Score: 145.591 bits (366), Expect = 8.767e-35
Identity = 159/604 (26.32%), Postives = 270/604 (44.70%), Query Frame = 2
Query:  395 DSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDR----YELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDD--ETLITVLINSNSDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQI-PEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGWVGKVEAYXXXXXXXXXIIFSFTGFLHN-------HLWIL-KSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLL---ANNKYFIIDEKSGEVFINRTLDRLEL 2152
            D D+G N ++ YS+     G   L         + T ++  RE  D        V  A D   P  +  + + I + D+NDHAP   +    +I ++E+   G ++  +   D+D     +I   +  + D      F +   SGL   ++L    +  ++++ V A D G P+L TSTTI V + DINDN P     T      N  + E  P+ S +  +   D D +         IE  +++ F ++           +   +    E  R+     RV +   DQG   L  +  + ++I+D N + P F+   F  +I E+   G P+ TL A D D G NA+I+Y I   ++  I    +PS+G ++     DRE   + +    A D  +P LN+S ++ + ++D ND  P F SS+Y   I E        ++    D++   + I  +  FL+         L+ L ++ G +      +LDRE  +   L + A+D G PS S++  + + L D+NDN+P F Q     Y   I E    G+ +  ++A D DE +N  +++ +   A+ K F I+E + +  + R L R E 
Sbjct:  401 DEDFGTNGKVHYSM-ASSSGIGGL------TIDYSTGEVTLRERIDAKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTL-IAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSED------FIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAP-----TFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYR---IEEADREVFSILDI-------GDQGAILSVSGELKRQD-HKVRVEISATDQG--GLQGRCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQFFRI----DPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDY--FLNESSSSPSIQLFRLDRTSGTLRVSS--KLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQ---LSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEF 960          

HSP 4 Score: 136.346 bits (342), Expect = 5.771e-32
Identity = 161/604 (26.66%), Postives = 250/604 (41.39%), Query Frame = 2
Query:  395 DSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAIS--GLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPS---------TGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEG--YSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDN--------GVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNKYFIIDEKSGEVFINRTLDR 2143
            D D G N  I YS+EG +        +  +  + KT KL DRE   RY L   A D G P       I + ++D+ND+AP FD  K+Y + + E+   GS+I  +K  D D++  IT  I   +D EV   F +  I   G  L    + +    K  + + A D G   L     + V + D+N           +D   + K+ E+ P    V  +   D D   N  +  ++            S++F   P+S     I    + DRE  + + V V   D   PPL++   I + ++D NDN P F+   +   I E+I  G+    + A D DIG N  + Y + E      S  +PS         +G +      DRE    I    FA D   P L+++ E+TL + D ND  P F   +Y   I E       VG + A D D   N+DI F   G     L+ ++ D     + G+     + +  +   EAK N             SS+V V+I + D+NDN P      D   +    + +     I  + A D D  +N  + Y L  N     ++ +G++ + +   R
Sbjct:  505 DEDSGPNGIIKYSMEGSED-----FIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDK-KEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIE-EADREV---FSILDIGDQGAILSVSGELKRQDHKVRVEISATDQG--GLQGRCVVNVFIDDVNS------APYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDS----------SQFFRIDPSSGD---ISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNE------SSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAE---QNGVV---RILTRAEFDYEAKANKFFFELQASSGQLSSTVPVRIHVSDVNDNKPALK---DFVILMNRFDNVQMARQIGFIPAFDPD--QNATLEYFLEENDLIEAEKYTGKILVKQEWKR 1060          

HSP 5 Score: 128.257 bits (321), Expect = 1.768e-29
Identity = 111/410 (27.07%), Postives = 190/410 (46.34%), Query Frame = 2
Query:  998 KLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPE-KYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYS--GWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNI---FSEKGIQLDREV---QSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPS 2200
            +L E+ P E+ +A V  + A S+    +  +++ P +       SR  N F     +  I   +  DRE +  + + V   ++  P +S+  T+ + + D  DN P F K  +   I+E+   G+ + ++ A D D G+N +I Y + E   +N+++I N  +G++      DRE  + I     A D+  P   S+  V + + D ND  P+F S +Y+  I E  +    +  V+A D D        F   G +H  +      G +   +S   + L   +    S     + AKD   P+ SS+V + I + DIND++P     + +  M  + E +  G  + +V A D+D   NG + Y +  ++ FIIDE SG +   + LDR       L + A+D GTPS
Sbjct:  173 ELPEDTPIETIIASVKASHASSQP---LYYSMVAPQD-------SRSQNLFTLDTMSGEIRLAKSMDREVLDKHILKVTAYERVDPTISASTTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEGNGKNLLAI-NAKSGVIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDED--------FGTNGKVHYSMASSSGIGGLTIDYSTGEVTLRERIDAKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTL---IAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPS 560          
BLAST of protocadherin-1 vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 157.918 bits (398), Expect = 1.168e-38
Identity = 164/558 (29.39%), Postives = 260/558 (46.59%), Query Frame = 2
Query:  596 IYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISGL------------TLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPN-PSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKE----GYSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANN------KYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPS 2200
            + I + D+ND+AP F     Y + + E+    + I  +K TD+D          +N     K H+ +++ SG+            TL  R+D ++S    T  + A D   P L+++  +T+NV+DIND+ P     TL  +     L EN      V  V   D DS  NGI+  ++      ++F +           + +  I T +  DRET + Y + V  +D G P L++  TI + ++D NDN P+F K  +   I E +  GS I TL A D D  ++ KI Y+I E  + + SI +    G + ++    +  +  +  +  A D+    L     V + I+D N   P F    +  KI E    GY   V  ++A D+D   N+ I++S          I  S G+I       LDRE ++T+ + V A D+  P  ++S  +++ L+DINDNSP+F+    S Y   I+E +  GT   +V A D D   NG V Y L  +      + F +D  SG + ++  LDR +     L I A+D GTPS
Sbjct:    2 VEITVVDVNDNAPVF-ASDSYNVTILENITIPAVIATVKATDED--------FGTNG----KVHYSMASSSGIGGLTIDYSTGEVTLRERIDAKNS--PITAVIRAKDGAQPALSSTVPLTINVIDINDHAP-----TLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSM---EGSEDFII----------DEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDND--EDQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQDHKVRVEISATDQGG--LQGRCVVNVFIDDVNS-APYFNDHPFSVKIPEHSPIGYP--VITLKAEDHDRGDNARIVYSIDS--SQFFRIDPSSGDISVSS--DLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTS---SSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPS 512          

HSP 2 Score: 145.976 bits (367), Expect = 6.439e-35
Identity = 159/604 (26.32%), Postives = 270/604 (44.70%), Query Frame = 2
Query:  395 DSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDR----YELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDD--ETLITVLINSNSDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQI-PEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGWVGKVEAYXXXXXXXXXIIFSFTGFLHN-------HLWIL-KSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLL---ANNKYFIIDEKSGEVFINRTLDRLEL 2152
            D D+G N ++ YS+     G   L         + T ++  RE  D        V  A D   P  +  + + I + D+NDHAP   +    +I ++E+   G ++  +   D+D     +I   +  + D      F +   SGL   ++L    +  ++++ V A D G P+L TSTTI V + DINDN P     T      N  + E  P+ S +  +   D D +         IE  +++ F ++           +   +    E  R+     RV +   DQG   L  +  + ++I+D N + P F+   F  +I E+   G P+ TL A D D G NA+I+Y I   ++  I    +PS+G ++     DRE   + +    A D  +P LN+S ++ + ++D ND  P F SS+Y   I E        ++    D++   + I  +  FL+         L+ L ++ G +      +LDRE  +   L + A+D G PS S++  + + L D+NDN+P F Q     Y   I E    G+ +  ++A D DE +N  +++ +   A+ K F I+E + +  + R L R E 
Sbjct:   42 DEDFGTNGKVHYSM-ASSSGIGGL------TIDYSTGEVTLRERIDAKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTL-IAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSED------FIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAP-----TFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYR---IEEADREVFSILDI-------GDQGAILSVSGELKRQD-HKVRVEISATDQG--GLQGRCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQFFRI----DPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDY--FLNESSSSPSIQLFRLDRTSGTLRVSS--KLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQ---LSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEF 601          

HSP 3 Score: 136.732 bits (343), Expect = 3.979e-32
Identity = 161/604 (26.66%), Postives = 250/604 (41.39%), Query Frame = 2
Query:  395 DSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAIS--GLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPS---------TGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEG--YSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDN--------GVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNKYFIIDEKSGEVFINRTLDR 2143
            D D G N  I YS+EG +        +  +  + KT KL DRE   RY L   A D G P       I + ++D+ND+AP FD  K+Y + + E+   GS+I  +K  D D++  IT  I   +D EV   F +  I   G  L    + +    K  + + A D G   L     + V + D+N           +D   + K+ E+ P    V  +   D D   N  +  ++            S++F   P+S     I    + DRE  + + V V   D   PPL++   I + ++D NDN P F+   +   I E+I  G+    + A D DIG N  + Y + E      S  +PS         +G +      DRE    I    FA D   P L+++ E+TL + D ND  P F   +Y   I E       VG + A D D   N+DI F   G     L+ ++ D     + G+     + +  +   EAK N             SS+V V+I + D+NDN P      D   +    + +     I  + A D D  +N  + Y L  N     ++ +G++ + +   R
Sbjct:  146 DEDSGPNGIIKYSMEGSED-----FIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFD-KKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIE-EADREV---FSILDIGDQGAILSVSGELKRQDHKVRVEISATDQG--GLQGRCVVNVFIDDVNS------APYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDS----------SQFFRIDPSSG---DISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNE------SSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAE---QNGVV---RILTRAEFDYEAKANKFFFELQASSGQLSSTVPVRIHVSDVNDNKPALK---DFVILMNRFDNVQMARQIGFIPAFDPD--QNATLEYFLEENDLIEAEKYTGKILVKQEWKR 701          

HSP 4 Score: 51.2174 bits (121), Expect = 5.748e-6
Identity = 35/103 (33.98%), Postives = 53/103 (51.46%), Query Frame = 2
Query: 1901 IVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNK---YFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPS 2200
            +V+I + D+NDN+P F+      Y   I E +    +I  V ATD+D   NGKV Y +A++       ID  +GEV +   +D  +  P   +I AKD   P+
Sbjct:    1 MVEITVVDVNDNAPVFAS---DSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGEVTLRERID-AKNSPITAVIRAKDGAQPA 99          
BLAST of protocadherin-1 vs. Ensembl Celegans
Match: cdh-1 (CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4W0])

HSP 1 Score: 152.14 bits (383), Expect = 8.711e-37
Identity = 169/599 (28.21%), Postives = 274/599 (45.74%), Query Frame = 2
Query:  434 IEGKDKGFFKLLQMKNNKPIFKTMKL---FDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKD--DETLITVLINSNSDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDA--DSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEG--YSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTY-LLANNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPS 2200
            ++G     FKL   K N+ +   + +    DRE RD+YEL+  A D G P K G+++  I+I D ND+AP F   + Y   V  +   GS +  ++ TD D  + + I+  I   S P    +F +S    +T  + L   S+     + V+A D+G P+L++S  +T+ VL    + P + I  L +S+S   LMEN    S VA V++     D+++  I    L      Q                  Y ++     DRET S + +    +  G   +   Q +TI   D NDN P +     Q  I  N   G    TL A DPD+G+N  I Y + +    ++SI +  TG +    + D  + + I F+  A D  +P L++ ++V  ++ D     P F  + +  +I E       + KV A ++   ++  I +S       HL +    G +  +K    D E Q +YQ TV A +    S +S+ ++ I+L+D+NDN P F     + Y   + E   P   +  V A+D D    G+V+Y +L+ +  F I+  +GEVF  + L R       L++ AKD G  S
Sbjct:  162 LQGNVNNVFKLASRKVNEQLQADLVVNGQLDREFRDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVFSRSR-YTASVSANISIGSHLITVQATDADIGENSRISYDIKKTSAPS-NSNFAISQSGVITTTASLLPAST---HDVIVVASDHGSPSLSSSAVVTITVLGSTLSSPPLDIIWLVESNSA-HLMENSTLGSIVARVSIAQQYRDTKLRLIGSSALCPQQTDQ---------------AHVYLLLLCGILDRETASEHHLKFLLEKDGQIIIEHPQLLTIG--DINDNAPQWHS--SQIHISLNRTQGGS-RTLTAKDPDLGQNGWIRYSVLDT--ELVSI-DKETGRIFVPNTIDCNIGSEIKFRVRAEDGGSPALSTDLQVVADLLDTESKPPQFEKALWQVEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSLQN-QDEHLTVDTMSGTVCIQK--TFDFEKQKSYQTTVIATNAN--SETSTSLISIRLKDVNDNWPIF---YPNEYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHILSESSSFSINPVTGEVFAQKPLARGRF---HLVVSAKDGGGQS 720          

HSP 2 Score: 139.428 bits (350), Expect = 6.402e-33
Identity = 161/621 (25.93%), Postives = 271/621 (43.64%), Query Frame = 2
Query:  377 IKLSPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQT-ITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPS------TGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGY--SGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPG-----TLITKVMATDDDENENGKVTYLLANNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTP 2197
            +K+   +S  G +  I YS++ +D+    +  M     I KT   FD E++  Y+   IAT+     +T    I I+++D+ND+ P F  P +Y + V+E       +  +  +D D  T   V  +  S+      F ++ ++G     +     +  +F + V A D G  +   S  I + V+D +   PQ        S S +++   +     +A+ +V          V  ++   +   NF +           +   +I   R  D +      + +Q     LP   S QT + I+IED NDNPP FS    +  I+E++    P + + A+D D  KN ++ Y I      I S P  S      TG ++     D E   +   +  A D   P  +S++ + + + D ND  P F  S Y  ++ E       VGKV A D DS  N  I++  T     +  I +  GN+++++ I  DREV S   +++ A+D GVP RSS+   +I + D+NDN P             IT  +VP      T I  ++A D D+  NG V Y         + + +G+V++ R L+  +   +RL ++  D G P
Sbjct:  560 VKVVANNSQCGNSKRIRYSLQNQDE-HLTVDTMSGTVCIQKT---FDFEKQKSYQTTVIATNAN--SETSTSLISIRLKDVNDNWPIF-YPNEYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHILSE---SSSFSINPVTGEVFAQK---PLARGRFHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQF-------SRSKYEIRTTEDILPGIAIGSVGAMSK-----VKYSIYSGDQDHNFSI----------DEDTGKIYVTRYLDADVHDTVLLNIQAT---LPSGESNQTQVVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSI------ISSHPGSSIEIDQFTGQLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRITNG-SEYFGIDEKLGNVYTKRSI--DREVISHVDISIVAEDKGVPPRSSTASARISVLDVNDNPPS---------CLSITPIVVPAGSPLSTAIGTIVAMDPDKGLNGSVLYRAQLQSSLFVVKSNGDVYLRRQLNASDERHQRLSVIVSDQGVP 1124          

HSP 3 Score: 104.375 bits (259), Expect = 3.456e-22
Identity = 129/501 (25.75%), Postives = 213/501 (42.51%), Query Frame = 2
Query:  767 DPEVKRHFQVSAISG-LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPS------TGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDEN------DCIPMFLSSAYHFKIKEGYSGWVGKVEAYXXXXXXXXXIIFSF------TGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQ----IQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPS 2200
            D +  +  +V   SG ++ I+ LDYE    KF I  + V+        +  I V V D NDN P     + +D     ++ E     +  A+ TVTD D     +    +++ N    F+L SR  N     +    +V   + DRE    Y + ++ +D G P    Q   +I I D NDN P FS+  +   +  NI  GS + T+ ATD DIG+N++I Y I +      S P+ S      +G++T   S        +     A D  +P L+SS  VT+ +          D I +  S++ H          V +V       ++   +I S       T   H +L +L          GI LDRE  S + L    + +G       +I++    + + DINDN+P++     S     +  T      +T   A D D  +NG + Y + + +   ID+++G +F+  T+D       +  + A+D G+P+
Sbjct:   62 DEQTSKFLKVDERSGEISTIAHLDYEK-RSKFDIVAVKVEES----GETIDILVEVDDENDNAP-----SFADQVVKLEISEFAQLGTSFALPTVTDGDGPKFDVHRFVILQGNVNNVFKLASRKVNE----QLQADLVVNGQLDREFRDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVFSRSRYTASVSANISIGSHLITVQATDADIGENSRISYDIKKT-----SAPSNSNFAISQSGVITTTASLLPASTHDVI--VVASDHGSPSLSSSAVVTITVLGSTLSSPPLDIIWLVESNSAHLMENSTLGSIVARVSIAQQYRDTKLRLIGSSALCPQQTDQAHVYLLLL---------CGI-LDRETASEHHLKFLLEKDG------QIIIEHPQLLTIGDINDNAPQWHS---SQIHISLNRTQGGSRTLT---AKDPDLGQNGWIRYSVLDTELVSIDKETGRIFVPNTIDCNIGSEIKFRVRAEDGGSPA 519          

HSP 4 Score: 100.138 bits (248), Expect = 6.969e-21
Identity = 164/689 (23.80%), Postives = 289/689 (41.94%), Query Frame = 2
Query:  422 IIYSI-EGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISG-LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFP-------QIVIDTLS---------------------------DSSSNFKL--------MENKPKESFVAMVTVTDADSEMNGI------VDCNLI----EPNNKQNFELISRYFNNFPNSKRNYRIVTL-----REF---------------------------DRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQ-NIISIPNPSTGIVT----NLVSFDREMNTSITFKAFALDEFNPLLNS--SVEVTLEIEDENDCIPMFLSSAYHFKIKEGYS-GWV-GKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKD-NGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNKYFI-IDEKSGEVFINRTL-DRLELVPRRLLIMAKDNGT 2194
            + YSI EG     F +    +++ + +T    DRE  +RY L  I T  G  ++ G  ++ +++ +LND+ P F M K     V E+   GS +  +   D D+   +   + S+S  +   HF +   +G + L + LD+E  + + T+ + A D    +  T T +T+ V DINDN P       Q  +   +                            SSS F++        M+  P      +VTVT  D   NG+      V  ++I    EP +K  FE     F    NSK   +I  L     REF                           DRE  + +   V+  ++ +     Q    + + DENDN P F+   +   +K+++  G  I  ++A+D D G+N ++ Y+I      NI+++ NP TG +     N    D   N +      A D  +P   +   V+V+L++   +   P F+   Y   + E  S G V  K+ A +     N  +++S        L I    G +  +    LD E +    + +   D NG   RS+ V ++I +E +++ +P F++   S Y  +I  +   G  + ++ A D+D   +G V Y +++ +  + I+E +G + + + L  R  L   ++ ++A  + T
Sbjct: 1861 LTYSIVEGNIDSAFSV----DSEGVIRTNLELDREILERYSLKVIGTGSG--QQIG-TRVDVRVNNLNDNVPSFPMSKPR--RVPENLRVGSYVATVGAKDVDNLAPLRYFLVSDSSGQTPTHFNIDQFTGTIHLTAPLDFEV-LPEHTLTIKATDG---SFDTFTNLTIFVSDINDNAPTFSKPLYQTTVSPATFSPGQPFAKIEAHDLDARGALTYSLGQGSSSIFRVAPESGALFMKVLPPAGERYLVTVTATD---NGVPSFSTSVPVSVIIGEAEPTDKPGFEKAEFRFEVMENSKIGLQIGNLSGEESREFHYRIQDPEASKIFSIDKFGRLFVAGPIDREQRATHEFQVEIDNEMMTSQKVQCKCHVIVLDENDNLPVFTSVAYYLSLKDSMAHGQKIGQIMASDQDSGENGRVSYRILSGNDLNIVTL-NPDTGSIQLNEWNDAQLDEFPNATWQILVEARDHGHPARAAVGKVQVSLKMSSWSGSAPFFVLPVYEVHVLEDTSVGTVLQKIRASNRLGMRNDGLLYSLKEH-QGKLGIDVKTGELTLKT--HLDWESEPIISMYLSVSDGNG---RSAVVPLKIVVEPVDEFAPVFTK---SSYTLQIPISTPAGESVGQMQAIDEDGGVHGVVKYSISDRQSTVKIEEHTGIIRLQKPLVSRRNLTIEQITVVAYSSPT 2523          

HSP 5 Score: 99.3673 bits (246), Expect = 1.249e-20
Identity = 129/519 (24.86%), Postives = 228/519 (43.93%), Query Frame = 2
Query:  383 LSPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDRE--ERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNL-TTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMEN-KPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIP--EKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLS-SAYHFKIKEGYSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQL 1918
            +S  D D G   E+ Y I  +   F       +  P+  T ++F ++   R R+ LV  A D G         I+I + D +   P+F   K Y I   ED + G  I  +    K   ++ +   + N        F +   +G   ++R  Y  +    T+ ++ +   +P+  +  T + + + D NDN PQ      S S     + E+ K  E F  +V  +D D + NG V  ++I  +   + E+     + F       ++ T    D E   +Y++ V+  D G+PP SS  T+ I + D NDN P F K ++   + EN  P + +  ++A D D  +N +I+Y+I    +Y  I    +   G V    S DRE+ + +     A D+  P  +S+    + + D ND  P  LS +          S  +G + A D D   N  +++     L + L+++KS+G+++  +  QL+   +   +L+V   D GVP +S    V +++
Sbjct:  663 VSASDMDSGTFGEVSYHILSESSSF-------SINPV--TGEVFAQKPLARGRFHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSK-YEIRTTEDILPGIAIGSVGAMSKVKYSIYSGDQDHN--------FSIDEDTGKIYVTR--YLDADVHDTV-LLNIQATLPSGESNQTQVVIFIEDHNDNPPQ-----FSSSLVEISIREDLKLHEPFY-VVQASDKDKKKNGEVRYSIISSHPGSSIEI-----DQFTG-----QLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRITNGSEYFGI----DEKLGNVYTKRSIDREVISHVDISIVAEDKGVPPRSSTASARISVLDVNDNPPSCLSITPIVVPAGSPLSTAIGTIVAMDPDKGLNGSVLYR--AQLQSSLFVVKSNGDVYLRR--QLNASDERHQRLSVIVSDQGVPRKSVVCHVPVRI 1136          

HSP 6 Score: 75.485 bits (184), Expect = 2.498e-13
Identity = 142/582 (24.40%), Postives = 233/582 (40.03%), Query Frame = 2
Query:  461 KLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGE-IKIYIKIRDLNDHAPEFDMPKDYVIG--VKEDAIEGSKICDIKVTDKDDETLIT---VLINSNSDPEVK---RHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIA--------TDPD---IGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLW-ILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLAN-NKYFIIDEKSGEVFINRTLD 2140
            K L++        T+   D E+R ++++V +  ++     +GE I I +++ D ND+AP F    D V+   + E A  G+      VTD D         V++  N +   K   R       + L +  +LD E    K+ + + A D G P        ++ ++D NDN P       S S     +  N    S +  V  TDAD   N  +  ++ + +   N        +NF  S+      T       T   + V V   D G P LSS   +TI +     + P     +  +    ++M  S + +++A         D     IG +A    Q  + +  ++ +     GI       DRE  +    K F L++   ++    ++ L I D ND  P + SS  H  +     G    + A D D   N  I +S    L   L  I K  G IF    I  D  + S  +  V A+D G P+ S+ + V   L D     P+F + L   +  +I E    GT + KV+A +     + ++ Y L N +++  +D  SG V I +T D
Sbjct:   67 KFLKVDERSGEISTIAHLDYEKRSKFDIVAVKVEE-----SGETIDILVEVDDENDNAPSF---ADQVVKLEISEFAQLGTSFALPTVTDGDGPKFDVHRFVILQGNVNNVFKLASRKVNEQLQADLVVNGQLDRE-FRDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAP-----VFSRSRYTASVSANISIGSHLITVQATDADIGENSRISYDIKKTSAPSN--------SNFAISQSGVITTTASLLPAST---HDVIVVASDHGSPSLSSSAVVTITVLGSTLSSPPLDIIWLVESNSAHLMENSTLGSIVARVSIAQQYRDTKLRLIGSSALCPQQTDQAHVYLLLL----CGI------LDRETASEHHLK-FLLEKDGQIIIEHPQL-LTIGDINDNAPQWHSSQIHISLNR-TQGGSRTLTAKDPDLGQNGWIRYS---VLDTELVSIDKETGRIFVPNTI--DCNIGSEIKFRVRAEDGGSPALSTDLQVVADLLDTESKPPQFEKAL---WQVEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSLQNQDEHLTVDTMSGTVCIQKTFD 602          

HSP 7 Score: 70.0922 bits (170), Expect = 1.034e-11
Identity = 122/484 (25.21%), Postives = 201/484 (41.53%), Query Frame = 2
Query:  788 FQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKF---FFQDRIKENIMPGSPIFTLIAT-DPDIGKNAKIIYQIPEKYQNIIS-IPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMF-LSSAYHFKIKEGYSGWVGKVEAYXXXXXXXXX--IIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKIT-ETLVPGTLITKVMATDDDENENGKVTYLL--ANNKYFIIDEKSGEVFINRTLDRLELVPRRLL--IMAKDNGTPS 2200
            F +++ +G   +  LD E+S     I +I  D G  N   S T+ V V D NDN PQ+   T S+     ++ E+      +     +D D   NG     L+E ++  + +L+    +           + LR     ++  +++ ++  D G+P L  ++ + I     N NP + +K    F +      I  G P    IA   P++   A + Y I E   NI S     S G++   +  DRE+    + K         +      V + + + ND +P F +S             +V  V A D D+ +     ++   +G    H  I +  G I       LD EV   + LT++A D    + ++   + I + DINDN+P FS+PL   Y   ++  T  PG    K+ A D D    G +TY L   ++  F +  +SG +F    +  L     R L  + A DNG PS
Sbjct: 1673 FSINSTTGSISVLPLDREASQEHLLI-IILTDGGSRN--DSCTVRVTVADQNDNKPQLDASTPSE----LEIAESSRVGDVLHRFRASDMDIGQNGKFSFELLE-DSSGSLDLVPETGD-----------LVLRRL--SSLQSWKIKLRVVDHGVPGLYVEKNLEI----SNRNPQTEAKAPLEFLKQTYLSTIDEGLPRGQFIAKLQPEL---AGLTYSIVEG--NIDSAFSVDSEGVIRTNLELDREILERYSLKVIGTGSGQQI---GTRVDVRVNNLNDNVPSFPMSKPRRVPENLRVGSYVATVGAKDVDNLAPLRYFLVSDSSGQTPTHFNIDQFTGTIHLTA--PLDFEVLPEHTLTIKATDGSFDTFTN---LTIFVSDINDNAPTFSKPL---YQTTVSPATFSPGQPFAKIEAHDLD--ARGALTYSLGQGSSSIFRVAPESGALF----MKVLPPAGERYLVTVTATDNGVPS 2109          
BLAST of protocadherin-1 vs. Ensembl Celegans
Match: hmr-1 (Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q967F4])

HSP 1 Score: 122.094 bits (305), Expect = 1.276e-27
Identity = 169/635 (26.61%), Postives = 269/635 (42.36%), Query Frame = 2
Query:  377 IKLSPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIF--KTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDD----ETLITVLINSNSDPEVKRHFQ----VSAISG-LTLISRLDYESSMRKFTIPVIAVDNGIPN-LTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIE---PNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMP--------GSPIFTLIATDPDI-GKNAKIIYQI-------PEKYQNIISIPNPSTGIVTNLVSFDRE------MNTSITFKAF-ALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKE--GYSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLV--PGTLITKVMATDDDENE-NGKVTYLL---ANNKYFIIDEKSGEVFINRTLDR 2143
            +K+   D D   N +I+YS+        K   +     +       +FDRE R R ++   ATD+G     G  +  +++ D+ND++P+F+ P  Y   V      G+ +  +   D D     E   ++ I++ +  E +        V+  SG +TLI  +  ++  +KF   VIA DNGIP  L +S  +T+NVLD     P+    T  D      + EN      +       +    N  V   L     P NK   +   R FN F N      +V +   D E +++Y +T+   D     ++S +T  + + D ND  P F+   F   I E + P        G PI T+ A D D  G   ++ Y+I         K+  I  +    TG +     FDRE      +    + ++  AL   N     +V+V + I D ND  P F    Y  ++KE  G    V  ++A+D D +SN        G       +    G IF ++   LD E    Y L + A D      +++  V I +ED+NDN+P+F Q     Y   + E  V  P  L   V ATD D++E + ++ Y L     ++ F I + SG + + + LDR
Sbjct:  890 VKVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPS-YETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKT--QKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKW--QTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKF--RQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDM-TSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDEL----TGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDKHSNLRYHLIGAGGGRIPFGVRTDSGTIFVKE--PLDFEASDQYHLVLIASDG---RHNATTNVYIHIEDVNDNAPQFEQ---QKYATTVIEEDVDIPKVLF-NVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYSGTIELVKALDR 1503          

HSP 2 Score: 105.916 bits (263), Expect = 1.151e-22
Identity = 177/724 (24.45%), Postives = 295/724 (40.75%), Query Frame = 2
Query:  377 IKLSPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDR---YELVFIATDKGIPKK-TGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRH-FQVSAISGLTL----ISRLDYESSMRKFTIPVIAVDNG----IPNLTTST--TITVNVLDINDNFPQIVIDTLSDSSSNFKLMEN--KPKESFVAMVTVTDADSEMNGIVDCNL--IEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQI------PEKYQN---IISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNP-LLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYS--------GWVGKVEAYXXXXXXXXXIIFSFTG-----------------FLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVP--------GTLITKVMATD-DDENENGKVTYLLAN------NKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPSXXXXXXXXXXXXNEDEDKQTSVINEKVDQEKTYQEARRKNNIDNYDG 2341
            +K++  D D G NS I YS++  +        + +N  I   ++L   +  +R   Y     A D G P   +    I+I+  + ND +  F     Y   V EDA  G+ +  I+  D D + +    ++ N     K + F +   +GL      +S  D   +     + VI  D+G     P+ T ++  T+ + + D+N+N P+      +  S   K+ME   K     +  V  TD DS  NG +  +L   +  +++ F +I R       S     +V    FDRET     VTV+  D+G  PL      ++ + D NDN P F +  ++  +      G+ + T+ A D D   NA+I Y +       E++QN      + N  +G +T +     +    I F   A D   P  L SS +VTL + D+    P + +S      K G +          + +  A  +  + NSD+I+  T                  F + + W+      +   +G  LD E  + Y LT+ A D      S+   V +++ D+ND  P+F+  L +G    I E + P        G  I  V A D D +    +V Y +         K+F IDE +GE+F N   DR ++    L + A D    +            N+D  K   VIN+  D   +++E +    +   +G
Sbjct:  662 LKVTAVDKDTGDNSRITYSVDNHN------FSINSNGEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDADRDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEF--PDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKAF-VIDRQTGVLTPSPH---VV----FDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQKFI-FNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSP---DCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWV-----EVVIMEG--LDYEQVNNYTLTLTATDMTSRVASTKTFV-VEVRDVNDVVPQFTVDLFTG---TIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSA-----LPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEG 1349          

HSP 3 Score: 104.375 bits (259), Expect = 3.098e-22
Identity = 170/666 (25.53%), Postives = 272/666 (40.84%), Query Frame = 2
Query:  395 DSDYGINSEIIYSIE---------GKDKGFFKLLQMKNN-----KPI-FKTMKLFDREERDRYELVFIATDKGIPKK-TGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDA-IEGSKI---CDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISG---------LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDS-----SSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQ--NFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQT-------ITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIP-NPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKE---GYSGWVGKVEAYXXXX-XXXXXIIFSFTGFLHNHLW-ILKSDGNIFSEKGIQLDREVQS---TYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVP-GTLITKVMATDDDE--NENGKVTYLLANNKY------FIIDEKSGEVFINRTLDRLELVPRRLLIM---AKDNGTPS 2200
            D+D   N+EI YS+E           D  FF+L+  ++      KPI  KT K              IA D GIP+      ++ + + D    AP++    D   G+  D  +E +K+   C    +     + +   + ++  P  K   +    +          + ++  LDYE  +  +T+ + A D     + ++ T  V V D+ND  PQ  +D  + +     + N  L +   K         TD+D   N +    + E N ++  +F +       FPN K          FDRE I  Y +TV+  D+ +  L            + I I D NDN PSF +  +  R+KE+   G  + T+ A D D  K++ + Y +       I       +G +      D E +        A D  +   N++  V + IED ND  P F    Y   + E        +  V A D D    +S I++   G   + ++ I K  G I   K   LDR+  +   ++   V+A D+          VQ+ + DINDNSP F + L  GY+++  E +   G     V A D D+   EN  + Y +  NK       F ID+ +G++F  R+LDR E+   R  I+   A D G PS
Sbjct: 1005 DNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQKFI---------FNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQ-VNNYTLTLTATDM-TSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEK----------FDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLD--KHSNLRYHLIGAGGGRIPFGVRTDSGTIFVKEPLDFEASDQYHLVLIASDGRH---NATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYSGTIELVKA--LDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERL-FGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDR-EISSEREFIIEVRANDRGVPS 1640          

HSP 4 Score: 94.3597 bits (233), Expect = 3.807e-19
Identity = 133/535 (24.86%), Postives = 225/535 (42.06%), Query Frame = 2
Query:  413 NSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKIC-DIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISG-LTLISRLDYE--SSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDN---FPQIVIDTLSDS-----SSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISH--YRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPD-IGKNAKIIYQIPEKYQNIISIPN-----PSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKE----GYSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPK 1945
            +S + Y + G   G        ++  IF    L D E  D+Y LV IA+D    +      +YI I D+ND+AP+F+  K Y   V E+ ++  K+  ++  TD D +   + ++           F++   SG + L+  LD +  + +  +   V A+D+    L     + VNV DINDN   FP+ +   + ++     S     M+ + ++      T  +A+ E  GIV   LI      N E + R   N        +I  +R  DRE  S   + + V+  D+G+P       +TI + D NDN P F K  ++  ++E    G+ + +  A D D   K+    YQ+ E+        +      S G++      D E  T        +   +   ++   V + + D ND  P    +  H +++E    G S  +G+  A D D+   +    +          I   DG +       LDRE  + Y L +EA DN   +     +V + L+D+NDN P+
Sbjct: 1365 HSNLRYHLIGAGGGRIPFGVRTDSGTIFVKEPL-DFEASDQYHLVLIASDG---RHNATTNVYIHIEDVNDNAPQFEQQK-YATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGYIEENREPIHSDGVYFMDVQARD--FDDPTTENANIEY-GIVRNKLI------NGESVFRIDQN------TGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHDAEAAVHVALVDRNDHAPHIHGATEH-RVREDVPRGTS--IGRYTATDRDAGDTARFRINRQSDPKRQFTI-DQDGTL--RVAHTLDREDIAVYNLIIEAYDNS--NNIGRQMVAVYLQDVNDNGPE 1871          

HSP 5 Score: 84.3445 bits (207), Expect = 4.496e-16
Identity = 131/584 (22.43%), Postives = 248/584 (42.47%), Query Frame = 2
Query:  503 MKLFDREERDRYELVFIATDKGIPKKTGEIKIYI-KIRDLNDHAPEFDMPKDYVIGVKEDAI---------EGSKICDIKVTDKDD---ETLITVLINSNSDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKR--NYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSF-SKFFFQDRIKENIMPGSPIFTLIATDPDIG-KNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSI---TFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGY------SGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHL-------WILKSDGNIFSEKGIQLDREVQSTYQLTVE--AKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKV-TYLLA-NNKYFII----DEKSGEVFINR 2131
            M+  D E+ + Y L   ATD  +  +    K ++ ++RD+ND  P+F +  D   G  ++ +          G  I  +K  D D    +  +   I   ++ E  +HF++  ++G    +       +  + + V A D  +  L  +     + + +     QIVI+ ++D++ +F+      ++ ++  V  ++ +      +  + ++ ++   + LI       P   R  +  I      D E    Y + +   D      ++   + I IED NDN P F  + +    I+E++     +F + ATD D   K+++I+Y++  +  + +      +G +  + + DR+    +    F   A+D+    L    +V + + D ND  P+F    + + I+E          +   V+A D D  +  +    + G + N L        I ++ G IF+ +   LDRE+ S  +  +E  A D GVPSR     V I++ D+NDN+P F +   + Y   + ET   G  +    A D DE     V TY L+  + YF +    D K   V + R
Sbjct: 1167 MEGLDYEQVNNYTLTLTATD--MTSRVASTKTFVVEVRDVNDVVPQFTV--DLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKV-----QIVINDVNDNAPSFE------EQKYIGRVKESEGEGHDVITIKAHDLDKHSNLRYHLIGAGGGRIPFGVRTDSGTIFVKEPLDFEASDQYHLVLIASDG---RHNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGY-IEENREPIHSDGVYFMDVQARDFDDPTTENANIEY-GIVRNKLINGESVFRIDQNTGKIFAMR--SLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEK---TRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLR 1725          

HSP 6 Score: 72.4034 bits (176), Expect = 1.922e-12
Identity = 95/355 (26.76%), Postives = 159/355 (44.79%), Query Frame = 2
Query: 1217 YRVTVQCKDQGLPPLSSQQTITIWIED--ENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATD----PDIGKNAKIIYQI----PEKYQNIISIPNPSTGIV--TNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEG--YSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDR--EVQSTYQLTVEAKDNGVP-SRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENE--------NGKVTYLLANNKYFIIDEKSGEVFINRTLDRLELV----PRRLLIMAKDNGT 2194
            YR++ Q  D      ++ Q   + I +   ++ PP F+K  ++  + E+ +    +  + A       D      I Y +    PE       I +PSTGI+  T L+ FD      +        E N    S V++T+ I+D ND +P F    Y  +++E    +  + KV A D D+  NS I +S    + NH + + S+G I ++  +  D+  E    Y+  V A+D+G P S SSS ++ I+ E+ ND S  F     S Y   + E    GT + ++ A D D +E        NG+ T  +     F IDE +G V +   +   +L     P  L ++ +D+G+
Sbjct:  494 YRISAQAMDLSPSDNTTSQLSEVAILEILADERPPQFAKQEYEVTVSEDNLVDYSVVDVKAQSFRSFEDGRSKGPITYSLEGDTPEDETKWFRI-DPSTGIIHLTRLLDFDDPALPKLHKLKVTAREDN--RESHVDLTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYS----VDNHNFSINSNGEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPT--SQYTAFVAEDAQGGTPVIQIQARDADRDEVTYSFMDKNGRSTQKM---NLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGS 836          

HSP 7 Score: 62.7734 bits (151), Expect = 1.511e-9
Identity = 89/329 (27.05%), Postives = 146/329 (44.38%), Query Frame = 2
Query: 1271 QTITIWIEDENDNPPSF--SKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIV-TNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVT-LEI-EDENDCIPMFLSSAYHFKIKEG----YSGWVGKVEAYXX--XXXXXXXIIFSFTGFL--HNHLW--ILKSDGNIFSEKGIQLDR-EVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNKYFIIDEKSGEVFINRTLDRLELVPR----RLLIMAKDNGTP 2197
            QTI I + D  D PPSF  S       +  N   G  ++  +A D     ++ ++Y+  +       I +P +G+V T    ++R     I+ +A  L   +   +   EV  LEI  DE    P F    Y   + E     YS    K +++ +  D  S   I +S  G        W  I  S G I   + +  D   +   ++L V A+++   +R S V + I+++D+NDN P F++PL   Y  ++ E +     I KV A D D  +N ++TY + N+ + I    +GE+     LD  +L  R    R  + A+D+G P
Sbjct:  407 QTIRIHVADI-DEPPSFVNSPLPMLAVVPLNPTIGRIVYQFVARDEHGDGDSNVLYKTIDVIPAGSFIVDPKSGVVRTGWSKYERGDTYRISAQAMDLSPSDNTTSQLSEVAILEILADERP--PQFAKQEYEVTVSEDNLVDYSVVDVKAQSFRSFEDGRSKGPITYSLEGDTPEDETKWFRIDPSTGIIHLTRLLDFDDPALPKLHKLKVTARED---NRESHVDLTIRIDDVNDNVPTFTRPL---YTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSVDNHNFSI--NSNGEISAKVRLDADQLNERHFVYRFNVTARDHGEP 724          

HSP 8 Score: 58.151 bits (139), Expect = 4.844e-8
Identity = 141/591 (23.86%), Postives = 239/591 (40.44%), Query Frame = 2
Query:  422 IIYSIEGKD-KGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKD--DETLITVLINSNSDPEVKRHFQVSAISGLTLISRLDYES-SMRKFT--IPVIAVDNGIP-NLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFD-----RETISHYRVTVQCKDQGLPPL------SSQQTITIWIEDENDNPPSF---SKFFFQDRIKENIMPGSP--IFTLIATDPDIGKNAKIIYQI--PEKYQNIISIPNPSTGIVT--NLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIK--EGYSGWVGKVEAYXXXXXXXXXIIFSF-----TGFLH-NHL----WILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVP-SRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLL 2074
            I YS+EG   +   K  ++  +  I    +L D ++    +L  +        +   + + I+I D+ND+ P F  P  Y   V+ED      I  +   DKD  D + IT  ++++       +F +++   ++   RLD +  + R F     V A D+G P +L++S  I +   + ND         L  S     + E+    + V  +   DAD +    V  + ++ N +   ++      N  +   +  +V LR         E  +   +TV  +D G   +      +S  T+ I IED N+N P F   +K+    +I E      P  I  + ATD D   N  I+Y +   +       + +  TG++T    V FDRE          A D  +  L    + ++E+ D ND  P F   +Y   +   E     V  V A+DND+  N++I +S       G  H N L     + +  G I   K I +  +    +   V A DNG+P +  SS  V + + D    +PK+    D      + E +    +I +  A    ++ N  V Y L
Sbjct:  569 ITYSLEGDTPEDETKWFRIDPSTGIIHLTRLLDFDDPALPKLHKLKVTAREDNRESHVDLTIRIDDVNDNVPTFTRPL-YTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSVDNH-------NFSINSNGEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVF----LPTSQYTAFVAEDAQGGTPVIQIQARDADRDE---VTYSFMDKNGRSTQKM------NLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQ---KFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKL 1135          

HSP 9 Score: 53.9138 bits (128), Expect = 9.352e-7
Identity = 60/232 (25.86%), Postives = 91/232 (39.22%), Query Frame = 2
Query:  515 DREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESF-VAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRET 1207
            D  +RD + L    +D    +   E  +++ + D NDHAP      ++   V+ED   G+ I     TD+D        IN  SDP  KR F +     L +   LD E  +  + + + A DN   N      + V + D+NDN P+                EN P        +  TD D+   G      + P+ K +  L   +  N      +  I  L+EFDRE 
Sbjct: 1734 DVTQRDGFHLGIRVSDG---RHDAEAAVHVALVDRNDHAPHIHGATEHR--VREDVPRGTSIGRYTATDRDAGDTARFRINRQSDP--KRQFTIDQDGTLRVAHTLDRE-DIAVYNLIIEAYDNS--NNIGRQMVAVYLQDVNDNGPEPYT-----VPRPCIFRENTPVNQLGTCEIRATDRDTAEFGPPFTMEVSPSFKYSQYLNVIFNANGDGGNGSMTITPLQEFDREA 1950          
BLAST of protocadherin-1 vs. Ensembl Celegans
Match: hmr-1 (Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q967F4])

HSP 1 Score: 122.094 bits (305), Expect = 1.276e-27
Identity = 169/635 (26.61%), Postives = 269/635 (42.36%), Query Frame = 2
Query:  377 IKLSPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIF--KTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDD----ETLITVLINSNSDPEVKRHFQ----VSAISG-LTLISRLDYESSMRKFTIPVIAVDNGIPN-LTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIE---PNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMP--------GSPIFTLIATDPDI-GKNAKIIYQI-------PEKYQNIISIPNPSTGIVTNLVSFDRE------MNTSITFKAF-ALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKE--GYSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLV--PGTLITKVMATDDDENE-NGKVTYLL---ANNKYFIIDEKSGEVFINRTLDR 2143
            +K+   D D   N +I+YS+        K   +     +       +FDRE R R ++   ATD+G     G  +  +++ D+ND++P+F+ P  Y   V      G+ +  +   D D     E   ++ I++ +  E +        V+  SG +TLI  +  ++  +KF   VIA DNGIP  L +S  +T+NVLD     P+    T  D      + EN      +       +    N  V   L     P NK   +   R FN F N      +V +   D E +++Y +T+   D     ++S +T  + + D ND  P F+   F   I E + P        G PI T+ A D D  G   ++ Y+I         K+  I  +    TG +     FDRE      +    + ++  AL   N     +V+V + I D ND  P F    Y  ++KE  G    V  ++A+D D +SN        G       +    G IF ++   LD E    Y L + A D      +++  V I +ED+NDN+P+F Q     Y   + E  V  P  L   V ATD D++E + ++ Y L     ++ F I + SG + + + LDR
Sbjct:  890 VKVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPS-YETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKT--QKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKW--QTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKF--RQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDM-TSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDEL----TGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDKHSNLRYHLIGAGGGRIPFGVRTDSGTIFVKE--PLDFEASDQYHLVLIASDG---RHNATTNVYIHIEDVNDNAPQFEQ---QKYATTVIEEDVDIPKVLF-NVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYSGTIELVKALDR 1503          

HSP 2 Score: 105.916 bits (263), Expect = 1.151e-22
Identity = 177/724 (24.45%), Postives = 295/724 (40.75%), Query Frame = 2
Query:  377 IKLSPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDR---YELVFIATDKGIPKK-TGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRH-FQVSAISGLTL----ISRLDYESSMRKFTIPVIAVDNG----IPNLTTST--TITVNVLDINDNFPQIVIDTLSDSSSNFKLMEN--KPKESFVAMVTVTDADSEMNGIVDCNL--IEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQI------PEKYQN---IISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNP-LLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYS--------GWVGKVEAYXXXXXXXXXIIFSFTG-----------------FLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVP--------GTLITKVMATD-DDENENGKVTYLLAN------NKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPSXXXXXXXXXXXXNEDEDKQTSVINEKVDQEKTYQEARRKNNIDNYDG 2341
            +K++  D D G NS I YS++  +        + +N  I   ++L   +  +R   Y     A D G P   +    I+I+  + ND +  F     Y   V EDA  G+ +  I+  D D + +    ++ N     K + F +   +GL      +S  D   +     + VI  D+G     P+ T ++  T+ + + D+N+N P+      +  S   K+ME   K     +  V  TD DS  NG +  +L   +  +++ F +I R       S     +V    FDRET     VTV+  D+G  PL      ++ + D NDN P F +  ++  +      G+ + T+ A D D   NA+I Y +       E++QN      + N  +G +T +     +    I F   A D   P  L SS +VTL + D+    P + +S      K G +          + +  A  +  + NSD+I+  T                  F + + W+      +   +G  LD E  + Y LT+ A D      S+   V +++ D+ND  P+F+  L +G    I E + P        G  I  V A D D +    +V Y +         K+F IDE +GE+F N   DR ++    L + A D    +            N+D  K   VIN+  D   +++E +    +   +G
Sbjct:  662 LKVTAVDKDTGDNSRITYSVDNHN------FSINSNGEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDADRDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEF--PDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKAF-VIDRQTGVLTPSPH---VV----FDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQKFI-FNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSP---DCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWV-----EVVIMEG--LDYEQVNNYTLTLTATDMTSRVASTKTFV-VEVRDVNDVVPQFTVDLFTG---TIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSA-----LPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEG 1349          

HSP 3 Score: 104.375 bits (259), Expect = 3.098e-22
Identity = 170/666 (25.53%), Postives = 272/666 (40.84%), Query Frame = 2
Query:  395 DSDYGINSEIIYSIE---------GKDKGFFKLLQMKNN-----KPI-FKTMKLFDREERDRYELVFIATDKGIPKK-TGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDA-IEGSKI---CDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISG---------LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDS-----SSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQ--NFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQT-------ITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIP-NPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKE---GYSGWVGKVEAYXXXX-XXXXXIIFSFTGFLHNHLW-ILKSDGNIFSEKGIQLDREVQS---TYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVP-GTLITKVMATDDDE--NENGKVTYLLANNKY------FIIDEKSGEVFINRTLDRLELVPRRLLIM---AKDNGTPS 2200
            D+D   N+EI YS+E           D  FF+L+  ++      KPI  KT K              IA D GIP+      ++ + + D    AP++    D   G+  D  +E +K+   C    +     + +   + ++  P  K   +    +          + ++  LDYE  +  +T+ + A D     + ++ T  V V D+ND  PQ  +D  + +     + N  L +   K         TD+D   N +    + E N ++  +F +       FPN K          FDRE I  Y +TV+  D+ +  L            + I I D NDN PSF +  +  R+KE+   G  + T+ A D D  K++ + Y +       I       +G +      D E +        A D  +   N++  V + IED ND  P F    Y   + E        +  V A D D    +S I++   G   + ++ I K  G I   K   LDR+  +   ++   V+A D+          VQ+ + DINDNSP F + L  GY+++  E +   G     V A D D+   EN  + Y +  NK       F ID+ +G++F  R+LDR E+   R  I+   A D G PS
Sbjct: 1005 DNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQKFI---------FNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQ-VNNYTLTLTATDM-TSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEK----------FDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLD--KHSNLRYHLIGAGGGRIPFGVRTDSGTIFVKEPLDFEASDQYHLVLIASDGRH---NATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYSGTIELVKA--LDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERL-FGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDR-EISSEREFIIEVRANDRGVPS 1640          

HSP 4 Score: 94.3597 bits (233), Expect = 3.807e-19
Identity = 133/535 (24.86%), Postives = 225/535 (42.06%), Query Frame = 2
Query:  413 NSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKIC-DIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISG-LTLISRLDYE--SSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDN---FPQIVIDTLSDS-----SSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISH--YRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPD-IGKNAKIIYQIPEKYQNIISIPN-----PSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKE----GYSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPK 1945
            +S + Y + G   G        ++  IF    L D E  D+Y LV IA+D    +      +YI I D+ND+AP+F+  K Y   V E+ ++  K+  ++  TD D +   + ++           F++   SG + L+  LD +  + +  +   V A+D+    L     + VNV DINDN   FP+ +   + ++     S     M+ + ++      T  +A+ E  GIV   LI      N E + R   N        +I  +R  DRE  S   + + V+  D+G+P       +TI + D NDN P F K  ++  ++E    G+ + +  A D D   K+    YQ+ E+        +      S G++      D E  T        +   +   ++   V + + D ND  P    +  H +++E    G S  +G+  A D D+   +    +          I   DG +       LDRE  + Y L +EA DN   +     +V + L+D+NDN P+
Sbjct: 1365 HSNLRYHLIGAGGGRIPFGVRTDSGTIFVKEPL-DFEASDQYHLVLIASDG---RHNATTNVYIHIEDVNDNAPQFEQQK-YATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGYIEENREPIHSDGVYFMDVQARD--FDDPTTENANIEY-GIVRNKLI------NGESVFRIDQN------TGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHDAEAAVHVALVDRNDHAPHIHGATEH-RVREDVPRGTS--IGRYTATDRDAGDTARFRINRQSDPKRQFTI-DQDGTL--RVAHTLDREDIAVYNLIIEAYDNS--NNIGRQMVAVYLQDVNDNGPE 1871          

HSP 5 Score: 84.3445 bits (207), Expect = 4.496e-16
Identity = 131/584 (22.43%), Postives = 248/584 (42.47%), Query Frame = 2
Query:  503 MKLFDREERDRYELVFIATDKGIPKKTGEIKIYI-KIRDLNDHAPEFDMPKDYVIGVKEDAI---------EGSKICDIKVTDKDD---ETLITVLINSNSDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKR--NYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSF-SKFFFQDRIKENIMPGSPIFTLIATDPDIG-KNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSI---TFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGY------SGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHL-------WILKSDGNIFSEKGIQLDREVQSTYQLTVE--AKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKV-TYLLA-NNKYFII----DEKSGEVFINR 2131
            M+  D E+ + Y L   ATD  +  +    K ++ ++RD+ND  P+F +  D   G  ++ +          G  I  +K  D D    +  +   I   ++ E  +HF++  ++G    +       +  + + V A D  +  L  +     + + +     QIVI+ ++D++ +F+      ++ ++  V  ++ +      +  + ++ ++   + LI       P   R  +  I      D E    Y + +   D      ++   + I IED NDN P F  + +    I+E++     +F + ATD D   K+++I+Y++  +  + +      +G +  + + DR+    +    F   A+D+    L    +V + + D ND  P+F    + + I+E          +   V+A D D  +  +    + G + N L        I ++ G IF+ +   LDRE+ S  +  +E  A D GVPSR     V I++ D+NDN+P F +   + Y   + ET   G  +    A D DE     V TY L+  + YF +    D K   V + R
Sbjct: 1167 MEGLDYEQVNNYTLTLTATD--MTSRVASTKTFVVEVRDVNDVVPQFTV--DLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKV-----QIVINDVNDNAPSFE------EQKYIGRVKESEGEGHDVITIKAHDLDKHSNLRYHLIGAGGGRIPFGVRTDSGTIFVKEPLDFEASDQYHLVLIASDG---RHNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGY-IEENREPIHSDGVYFMDVQARDFDDPTTENANIEY-GIVRNKLINGESVFRIDQNTGKIFAMR--SLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEK---TRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLR 1725          

HSP 6 Score: 72.4034 bits (176), Expect = 1.922e-12
Identity = 95/355 (26.76%), Postives = 159/355 (44.79%), Query Frame = 2
Query: 1217 YRVTVQCKDQGLPPLSSQQTITIWIED--ENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATD----PDIGKNAKIIYQI----PEKYQNIISIPNPSTGIV--TNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEG--YSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDR--EVQSTYQLTVEAKDNGVP-SRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENE--------NGKVTYLLANNKYFIIDEKSGEVFINRTLDRLELV----PRRLLIMAKDNGT 2194
            YR++ Q  D      ++ Q   + I +   ++ PP F+K  ++  + E+ +    +  + A       D      I Y +    PE       I +PSTGI+  T L+ FD      +        E N    S V++T+ I+D ND +P F    Y  +++E    +  + KV A D D+  NS I +S    + NH + + S+G I ++  +  D+  E    Y+  V A+D+G P S SSS ++ I+ E+ ND S  F     S Y   + E    GT + ++ A D D +E        NG+ T  +     F IDE +G V +   +   +L     P  L ++ +D+G+
Sbjct:  494 YRISAQAMDLSPSDNTTSQLSEVAILEILADERPPQFAKQEYEVTVSEDNLVDYSVVDVKAQSFRSFEDGRSKGPITYSLEGDTPEDETKWFRI-DPSTGIIHLTRLLDFDDPALPKLHKLKVTAREDN--RESHVDLTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYS----VDNHNFSINSNGEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPT--SQYTAFVAEDAQGGTPVIQIQARDADRDEVTYSFMDKNGRSTQKM---NLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGS 836          

HSP 7 Score: 62.7734 bits (151), Expect = 1.511e-9
Identity = 89/329 (27.05%), Postives = 146/329 (44.38%), Query Frame = 2
Query: 1271 QTITIWIEDENDNPPSF--SKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIV-TNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVT-LEI-EDENDCIPMFLSSAYHFKIKEG----YSGWVGKVEAYXX--XXXXXXXIIFSFTGFL--HNHLW--ILKSDGNIFSEKGIQLDR-EVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNKYFIIDEKSGEVFINRTLDRLELVPR----RLLIMAKDNGTP 2197
            QTI I + D  D PPSF  S       +  N   G  ++  +A D     ++ ++Y+  +       I +P +G+V T    ++R     I+ +A  L   +   +   EV  LEI  DE    P F    Y   + E     YS    K +++ +  D  S   I +S  G        W  I  S G I   + +  D   +   ++L V A+++   +R S V + I+++D+NDN P F++PL   Y  ++ E +     I KV A D D  +N ++TY + N+ + I    +GE+     LD  +L  R    R  + A+D+G P
Sbjct:  407 QTIRIHVADI-DEPPSFVNSPLPMLAVVPLNPTIGRIVYQFVARDEHGDGDSNVLYKTIDVIPAGSFIVDPKSGVVRTGWSKYERGDTYRISAQAMDLSPSDNTTSQLSEVAILEILADERP--PQFAKQEYEVTVSEDNLVDYSVVDVKAQSFRSFEDGRSKGPITYSLEGDTPEDETKWFRIDPSTGIIHLTRLLDFDDPALPKLHKLKVTARED---NRESHVDLTIRIDDVNDNVPTFTRPL---YTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSVDNHNFSI--NSNGEISAKVRLDADQLNERHFVYRFNVTARDHGEP 724          

HSP 8 Score: 58.151 bits (139), Expect = 4.844e-8
Identity = 141/591 (23.86%), Postives = 239/591 (40.44%), Query Frame = 2
Query:  422 IIYSIEGKD-KGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKD--DETLITVLINSNSDPEVKRHFQVSAISGLTLISRLDYES-SMRKFT--IPVIAVDNGIP-NLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFD-----RETISHYRVTVQCKDQGLPPL------SSQQTITIWIEDENDNPPSF---SKFFFQDRIKENIMPGSP--IFTLIATDPDIGKNAKIIYQI--PEKYQNIISIPNPSTGIVT--NLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIK--EGYSGWVGKVEAYXXXXXXXXXIIFSF-----TGFLH-NHL----WILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVP-SRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLL 2074
            I YS+EG   +   K  ++  +  I    +L D ++    +L  +        +   + + I+I D+ND+ P F  P  Y   V+ED      I  +   DKD  D + IT  ++++       +F +++   ++   RLD +  + R F     V A D+G P +L++S  I +   + ND         L  S     + E+    + V  +   DAD +    V  + ++ N +   ++      N  +   +  +V LR         E  +   +TV  +D G   +      +S  T+ I IED N+N P F   +K+    +I E      P  I  + ATD D   N  I+Y +   +       + +  TG++T    V FDRE          A D  +  L    + ++E+ D ND  P F   +Y   +   E     V  V A+DND+  N++I +S       G  H N L     + +  G I   K I +  +    +   V A DNG+P +  SS  V + + D    +PK+    D      + E +    +I +  A    ++ N  V Y L
Sbjct:  569 ITYSLEGDTPEDETKWFRIDPSTGIIHLTRLLDFDDPALPKLHKLKVTAREDNRESHVDLTIRIDDVNDNVPTFTRPL-YTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSVDNH-------NFSINSNGEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVF----LPTSQYTAFVAEDAQGGTPVIQIQARDADRDE---VTYSFMDKNGRSTQKM------NLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQ---KFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKL 1135          

HSP 9 Score: 53.9138 bits (128), Expect = 9.352e-7
Identity = 60/232 (25.86%), Postives = 91/232 (39.22%), Query Frame = 2
Query:  515 DREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESF-VAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRET 1207
            D  +RD + L    +D    +   E  +++ + D NDHAP      ++   V+ED   G+ I     TD+D        IN  SDP  KR F +     L +   LD E  +  + + + A DN   N      + V + D+NDN P+                EN P        +  TD D+   G      + P+ K +  L   +  N      +  I  L+EFDRE 
Sbjct: 1734 DVTQRDGFHLGIRVSDG---RHDAEAAVHVALVDRNDHAPHIHGATEHR--VREDVPRGTSIGRYTATDRDAGDTARFRINRQSDP--KRQFTIDQDGTLRVAHTLDRE-DIAVYNLIIEAYDNS--NNIGRQMVAVYLQDVNDNGPEPYT-----VPRPCIFRENTPVNQLGTCEIRATDRDTAEFGPPFTMEVSPSFKYSQYLNVIFNANGDGGNGSMTITPLQEFDREA 1950          
BLAST of protocadherin-1 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0304900)

HSP 1 Score: 226.483 bits (576), Expect = 7.234e-60
Identity = 192/643 (29.86%), Postives = 303/643 (47.12%), Query Frame = 2
Query:  377 IKLSPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFK---------TMKLFDREERDRYELVFIATDKGIP---KKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKED---AIEGSKICDIKVTDKD---DETLITVLINSNSDPEVKRHFQVSAISG-LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNS--KRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIP---EKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEG--YSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLW------ILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLAN----NKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTP 2197
            I L   D D G N+EI Y IE    G    L      PIF+         T    DRE  D Y L+  A D       ++T    + +K+ D ND+ P+F   + Y + V ED     E + +  I+ TD D   +  +   +I  N+    +  F + ++SG ++L+  LDYE S+R + + + A D G P+ + +T + VNV+D NDN P+       +S     ++EN P    +  V   D+D   N  +  ++ E +            +NFP +   R   + T++  DRE    +   V  KD G+PP S+  ++ I ++D NDN P+F+  +++  + E+  PG+P+ T+ ATDPD  +++++ Y+I     + +  I+  N   G++T   S D +          A D      + +  V + I D N+  P+F ++ Y   + E       V  V A D+D   N+ I +S      N L       I    G I +     LDRE  S Y LTV AKD G PS S +  V+I + D+NDN+P F  PL   Y   I E  + GT + +V A+D D   NG++ YLL++    +  F+ID  SG +  N+ LDR  +    L  +A D G+P
Sbjct:  484 ITLRATDQDIGKNAEIEYGIEAVTDG--AGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFS-ERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNT----QSQFSIDSMSGDVSLVKPLDYE-SVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQES-----VLENVPVGYNIIRVQAYDSDEGANAEITYSISERD------------DNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPD--EDSRLHYEITTGNTRGRFAITSQN-GRGLITIAQSLDYKQEKRFLLTVAATDSGGR--SDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNA--PLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPL---YQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSP 1091          

HSP 2 Score: 200.29 bits (508), Expect = 1.573e-51
Identity = 157/541 (29.02%), Postives = 268/541 (49.54%), Query Frame = 2
Query:  377 IKLSPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISG---LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEK-YQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEG--YSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIF-------SEKG-----IQLDRE-VQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSP 1942
            I++   DSD G N+EI YSI  +D  F   L +       +T+K  DREE+ R+    +A D G+P K+    + I ++D+ND+ P F+ PK Y   V ED   G+ +  +  TD D+++ +   I + +    +  F +++ +G   +T+   LDY+   ++F + V A D+G    + + T+ +N+ D N+  P  + +    S+S F   E+ P  + V +V+ TD+D  +N  +  +L    N+++   +    + F  + +   IVT    DRET S Y +TV  KD G P LS    + I + D NDN P+F    +Q  I E+ + G+ +  + A+DPD+G N +I Y + ++  ++   + +P++G +      DRE        A A+D+ +P L+S+VEV + +ED ND  P F S      + E       VG++ A+D D   N+ + +S  G           D N F       SE+       +LD E  +  ++L V A     P   +   ++I + D+NDN+P
Sbjct:  709 IRVQAYDSDEGANAEITYSISERDDNF--PLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFN-PKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGN---TRGRFAITSQNGRGLITIAQSLDYKQE-KRFLLTVAATDSG--GRSDTATVHINITDANNFAP--IFENAPYSASVF---EDAPVGTTVLVVSATDSDVGVNAQITYSL----NEESINGLGSP-DPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIG---------GDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRAAS---PPLRNDAHIEILVTDVNDNAP 1218          

HSP 3 Score: 186.037 bits (471), Expect = 4.052e-47
Identity = 165/624 (26.44%), Postives = 274/624 (43.91%), Query Frame = 2
Query:  413 NSEIIYS----IEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKD--DETLITVLINSNSD------PEVKRHFQVSAISG-LTLISRLDYESSMRKFTIPVIAVDNGIPN---LTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENK---PKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGWVGKVEAYXXXXXXXXXIIFSF-TGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNKY--------FIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPS 2200
            +S ++YS    ++ + +  FK+    +   +  T    DRE  D +    +ATD   P ++G   + + + D NDH+P F+  + +   ++E A  GS +  ++ TD+D      I   I + +D       +    F++ + SG ++  S LD E+S   + + V A D         T + ++ V VLD NDN+PQ      S+ +   ++ E++    +++ VA +  TDAD   N  +   +I  N +  F + S   +          +  ++  D E++  YR+ ++ +D G P  S+   + + + D NDN P F    FQ+ + EN+  G  I  + A D D G NA+I Y I E+  N     +P TG V  +   DRE      F+  A D   P  ++S  V + ++D ND  P F    Y   + E              D + +S + +   TG       I   +G         LD + +  + LTV A D+G   RS +  V I + D N+ +P F    ++ Y   + E    GT +  V ATD D   N ++TY L             F I+ ++G +  N  LDR       L + AKD G PS
Sbjct:  388 DSPVVYSMVSLLDSRSQSLFKV---DSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFE-AEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETS-DSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQ-----FSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGD----------VSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSG--GRSDTATVHINITDANNFAPIFE---NAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPS 986          
BLAST of protocadherin-1 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0304899)

HSP 1 Score: 226.483 bits (576), Expect = 8.250e-60
Identity = 192/643 (29.86%), Postives = 303/643 (47.12%), Query Frame = 2
Query:  377 IKLSPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFK---------TMKLFDREERDRYELVFIATDKGIP---KKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKED---AIEGSKICDIKVTDKD---DETLITVLINSNSDPEVKRHFQVSAISG-LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNS--KRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIP---EKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEG--YSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLW------ILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLAN----NKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTP 2197
            I L   D D G N+EI Y IE    G    L      PIF+         T    DRE  D Y L+  A D       ++T    + +K+ D ND+ P+F   + Y + V ED     E + +  I+ TD D   +  +   +I  N+    +  F + ++SG ++L+  LDYE S+R + + + A D G P+ + +T + VNV+D NDN P+       +S     ++EN P    +  V   D+D   N  +  ++ E +            +NFP +   R   + T++  DRE    +   V  KD G+PP S+  ++ I ++D NDN P+F+  +++  + E+  PG+P+ T+ ATDPD  +++++ Y+I     + +  I+  N   G++T   S D +          A D      + +  V + I D N+  P+F ++ Y   + E       V  V A D+D   N+ I +S      N L       I    G I +     LDRE  S Y LTV AKD G PS S +  V+I + D+NDN+P F  PL   Y   I E  + GT + +V A+D D   NG++ YLL++    +  F+ID  SG +  N+ LDR  +    L  +A D G+P
Sbjct:  484 ITLRATDQDIGKNAEIEYGIEAVTDG--AGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFS-ERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNT----QSQFSIDSMSGDVSLVKPLDYE-SVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQES-----VLENVPVGYNIIRVQAYDSDEGANAEITYSISERD------------DNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPD--EDSRLHYEITTGNTRGRFAITSQN-GRGLITIAQSLDYKQEKRFLLTVAATDSGGR--SDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNA--PLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPL---YQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSP 1091          

HSP 2 Score: 199.904 bits (507), Expect = 1.760e-51
Identity = 157/541 (29.02%), Postives = 268/541 (49.54%), Query Frame = 2
Query:  377 IKLSPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISG---LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEK-YQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEG--YSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIF-------SEKG-----IQLDRE-VQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSP 1942
            I++   DSD G N+EI YSI  +D  F   L +       +T+K  DREE+ R+    +A D G+P K+    + I ++D+ND+ P F+ PK Y   V ED   G+ +  +  TD D+++ +   I + +    +  F +++ +G   +T+   LDY+   ++F + V A D+G    + + T+ +N+ D N+  P  + +    S+S F   E+ P  + V +V+ TD+D  +N  +  +L    N+++   +    + F  + +   IVT    DRET S Y +TV  KD G P LS    + I + D NDN P+F    +Q  I E+ + G+ +  + A+DPD+G N +I Y + ++  ++   + +P++G +      DRE        A A+D+ +P L+S+VEV + +ED ND  P F S      + E       VG++ A+D D   N+ + +S  G           D N F       SE+       +LD E  +  ++L V A     P   +   ++I + D+NDN+P
Sbjct:  709 IRVQAYDSDEGANAEITYSISERDDNF--PLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFN-PKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGN---TRGRFAITSQNGRGLITIAQSLDYKQE-KRFLLTVAATDSG--GRSDTATVHINITDANNFAP--IFENAPYSASVF---EDAPVGTTVLVVSATDSDVGVNAQITYSL----NEESINGLGSP-DPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIG---------GDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRAAS---PPLRNDAHIEILVTDVNDNAP 1218          

HSP 3 Score: 186.037 bits (471), Expect = 4.340e-47
Identity = 165/624 (26.44%), Postives = 274/624 (43.91%), Query Frame = 2
Query:  413 NSEIIYS----IEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKD--DETLITVLINSNSD------PEVKRHFQVSAISG-LTLISRLDYESSMRKFTIPVIAVDNGIPN---LTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENK---PKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGWVGKVEAYXXXXXXXXXIIFSF-TGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNKY--------FIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPS 2200
            +S ++YS    ++ + +  FK+    +   +  T    DRE  D +    +ATD   P ++G   + + + D NDH+P F+  + +   ++E A  GS +  ++ TD+D      I   I + +D       +    F++ + SG ++  S LD E+S   + + V A D         T + ++ V VLD NDN+PQ      S+ +   ++ E++    +++ VA +  TDAD   N  +   +I  N +  F + S   +          +  ++  D E++  YR+ ++ +D G P  S+   + + + D NDN P F    FQ+ + EN+  G  I  + A D D G NA+I Y I E+  N     +P TG V  +   DRE      F+  A D   P  ++S  V + ++D ND  P F    Y   + E              D + +S + +   TG       I   +G         LD + +  + LTV A D+G   RS +  V I + D N+ +P F    ++ Y   + E    GT +  V ATD D   N ++TY L             F I+ ++G +  N  LDR       L + AKD G PS
Sbjct:  388 DSPVVYSMVSLLDSRSQSLFKV---DSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFE-AEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETS-DSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQ-----FSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGD----------VSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSG--GRSDTATVHINITDANNFAPIFE---NAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPS 986          
BLAST of protocadherin-1 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0300578)

HSP 1 Score: 226.483 bits (576), Expect = 8.250e-60
Identity = 192/643 (29.86%), Postives = 303/643 (47.12%), Query Frame = 2
Query:  377 IKLSPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFK---------TMKLFDREERDRYELVFIATDKGIP---KKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKED---AIEGSKICDIKVTDKD---DETLITVLINSNSDPEVKRHFQVSAISG-LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNS--KRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIP---EKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEG--YSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLW------ILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLAN----NKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTP 2197
            I L   D D G N+EI Y IE    G    L      PIF+         T    DRE  D Y L+  A D       ++T    + +K+ D ND+ P+F   + Y + V ED     E + +  I+ TD D   +  +   +I  N+    +  F + ++SG ++L+  LDYE S+R + + + A D G P+ + +T + VNV+D NDN P+       +S     ++EN P    +  V   D+D   N  +  ++ E +            +NFP +   R   + T++  DRE    +   V  KD G+PP S+  ++ I ++D NDN P+F+  +++  + E+  PG+P+ T+ ATDPD  +++++ Y+I     + +  I+  N   G++T   S D +          A D      + +  V + I D N+  P+F ++ Y   + E       V  V A D+D   N+ I +S      N L       I    G I +     LDRE  S Y LTV AKD G PS S +  V+I + D+NDN+P F  PL   Y   I E  + GT + +V A+D D   NG++ YLL++    +  F+ID  SG +  N+ LDR  +    L  +A D G+P
Sbjct:  484 ITLRATDQDIGKNAEIEYGIEAVTDG--AGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFS-ERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNT----QSQFSIDSMSGDVSLVKPLDYE-SVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQES-----VLENVPVGYNIIRVQAYDSDEGANAEITYSISERD------------DNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPD--EDSRLHYEITTGNTRGRFAITSQN-GRGLITIAQSLDYKQEKRFLLTVAATDSGGR--SDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNA--PLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPL---YQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSP 1091          

HSP 2 Score: 199.904 bits (507), Expect = 1.760e-51
Identity = 157/541 (29.02%), Postives = 268/541 (49.54%), Query Frame = 2
Query:  377 IKLSPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISG---LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEK-YQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEG--YSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIF-------SEKG-----IQLDRE-VQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSP 1942
            I++   DSD G N+EI YSI  +D  F   L +       +T+K  DREE+ R+    +A D G+P K+    + I ++D+ND+ P F+ PK Y   V ED   G+ +  +  TD D+++ +   I + +    +  F +++ +G   +T+   LDY+   ++F + V A D+G    + + T+ +N+ D N+  P  + +    S+S F   E+ P  + V +V+ TD+D  +N  +  +L    N+++   +    + F  + +   IVT    DRET S Y +TV  KD G P LS    + I + D NDN P+F    +Q  I E+ + G+ +  + A+DPD+G N +I Y + ++  ++   + +P++G +      DRE        A A+D+ +P L+S+VEV + +ED ND  P F S      + E       VG++ A+D D   N+ + +S  G           D N F       SE+       +LD E  +  ++L V A     P   +   ++I + D+NDN+P
Sbjct:  709 IRVQAYDSDEGANAEITYSISERDDNF--PLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFN-PKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGN---TRGRFAITSQNGRGLITIAQSLDYKQE-KRFLLTVAATDSG--GRSDTATVHINITDANNFAP--IFENAPYSASVF---EDAPVGTTVLVVSATDSDVGVNAQITYSL----NEESINGLGSP-DPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIG---------GDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRAAS---PPLRNDAHIEILVTDVNDNAP 1218          

HSP 3 Score: 186.037 bits (471), Expect = 4.340e-47
Identity = 165/624 (26.44%), Postives = 274/624 (43.91%), Query Frame = 2
Query:  413 NSEIIYS----IEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKD--DETLITVLINSNSD------PEVKRHFQVSAISG-LTLISRLDYESSMRKFTIPVIAVDNGIPN---LTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENK---PKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGWVGKVEAYXXXXXXXXXIIFSF-TGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNKY--------FIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPS 2200
            +S ++YS    ++ + +  FK+    +   +  T    DRE  D +    +ATD   P ++G   + + + D NDH+P F+  + +   ++E A  GS +  ++ TD+D      I   I + +D       +    F++ + SG ++  S LD E+S   + + V A D         T + ++ V VLD NDN+PQ      S+ +   ++ E++    +++ VA +  TDAD   N  +   +I  N +  F + S   +          +  ++  D E++  YR+ ++ +D G P  S+   + + + D NDN P F    FQ+ + EN+  G  I  + A D D G NA+I Y I E+  N     +P TG V  +   DRE      F+  A D   P  ++S  V + ++D ND  P F    Y   + E              D + +S + +   TG       I   +G         LD + +  + LTV A D+G   RS +  V I + D N+ +P F    ++ Y   + E    GT +  V ATD D   N ++TY L             F I+ ++G +  N  LDR       L + AKD G PS
Sbjct:  388 DSPVVYSMVSLLDSRSQSLFKV---DSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFE-AEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETS-DSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQ-----FSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGD----------VSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSG--GRSDTATVHINITDANNFAPIFE---NAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPS 986          
BLAST of protocadherin-1 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0303223)

HSP 1 Score: 226.483 bits (576), Expect = 8.254e-60
Identity = 192/643 (29.86%), Postives = 303/643 (47.12%), Query Frame = 2
Query:  377 IKLSPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFK---------TMKLFDREERDRYELVFIATDKGIP---KKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKED---AIEGSKICDIKVTDKD---DETLITVLINSNSDPEVKRHFQVSAISG-LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNS--KRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIP---EKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEG--YSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLW------ILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLAN----NKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTP 2197
            I L   D D G N+EI Y IE    G    L      PIF+         T    DRE  D Y L+  A D       ++T    + +K+ D ND+ P+F   + Y + V ED     E + +  I+ TD D   +  +   +I  N+    +  F + ++SG ++L+  LDYE S+R + + + A D G P+ + +T + VNV+D NDN P+       +S     ++EN P    +  V   D+D   N  +  ++ E +            +NFP +   R   + T++  DRE    +   V  KD G+PP S+  ++ I ++D NDN P+F+  +++  + E+  PG+P+ T+ ATDPD  +++++ Y+I     + +  I+  N   G++T   S D +          A D      + +  V + I D N+  P+F ++ Y   + E       V  V A D+D   N+ I +S      N L       I    G I +     LDRE  S Y LTV AKD G PS S +  V+I + D+NDN+P F  PL   Y   I E  + GT + +V A+D D   NG++ YLL++    +  F+ID  SG +  N+ LDR  +    L  +A D G+P
Sbjct:  484 ITLRATDQDIGKNAEIEYGIEAVTDG--AGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFS-ERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNT----QSQFSIDSMSGDVSLVKPLDYE-SVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQES-----VLENVPVGYNIIRVQAYDSDEGANAEITYSISERD------------DNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPD--EDSRLHYEITTGNTRGRFAITSQN-GRGLITIAQSLDYKQEKRFLLTVAATDSGGR--SDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNA--PLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPL---YQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSP 1091          

HSP 2 Score: 199.904 bits (507), Expect = 1.671e-51
Identity = 157/541 (29.02%), Postives = 268/541 (49.54%), Query Frame = 2
Query:  377 IKLSPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISG---LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEK-YQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEG--YSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIF-------SEKG-----IQLDRE-VQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSP 1942
            I++   DSD G N+EI YSI  +D  F   L +       +T+K  DREE+ R+    +A D G+P K+    + I ++D+ND+ P F+ PK Y   V ED   G+ +  +  TD D+++ +   I + +    +  F +++ +G   +T+   LDY+   ++F + V A D+G    + + T+ +N+ D N+  P  + +    S+S F   E+ P  + V +V+ TD+D  +N  +  +L    N+++   +    + F  + +   IVT    DRET S Y +TV  KD G P LS    + I + D NDN P+F    +Q  I E+ + G+ +  + A+DPD+G N +I Y + ++  ++   + +P++G +      DRE        A A+D+ +P L+S+VEV + +ED ND  P F S      + E       VG++ A+D D   N+ + +S  G           D N F       SE+       +LD E  +  ++L V A     P   +   ++I + D+NDN+P
Sbjct:  709 IRVQAYDSDEGANAEITYSISERDDNF--PLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFN-PKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGN---TRGRFAITSQNGRGLITIAQSLDYKQE-KRFLLTVAATDSG--GRSDTATVHINITDANNFAP--IFENAPYSASVF---EDAPVGTTVLVVSATDSDVGVNAQITYSL----NEESINGLGSP-DPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIG---------GDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRAAS---PPLRNDAHIEILVTDVNDNAP 1218          

HSP 3 Score: 186.037 bits (471), Expect = 4.123e-47
Identity = 165/624 (26.44%), Postives = 274/624 (43.91%), Query Frame = 2
Query:  413 NSEIIYS----IEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKD--DETLITVLINSNSD------PEVKRHFQVSAISG-LTLISRLDYESSMRKFTIPVIAVDNGIPN---LTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENK---PKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGWVGKVEAYXXXXXXXXXIIFSF-TGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNKY--------FIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPS 2200
            +S ++YS    ++ + +  FK+    +   +  T    DRE  D +    +ATD   P ++G   + + + D NDH+P F+  + +   ++E A  GS +  ++ TD+D      I   I + +D       +    F++ + SG ++  S LD E+S   + + V A D         T + ++ V VLD NDN+PQ      S+ +   ++ E++    +++ VA +  TDAD   N  +   +I  N +  F + S   +          +  ++  D E++  YR+ ++ +D G P  S+   + + + D NDN P F    FQ+ + EN+  G  I  + A D D G NA+I Y I E+  N     +P TG V  +   DRE      F+  A D   P  ++S  V + ++D ND  P F    Y   + E              D + +S + +   TG       I   +G         LD + +  + LTV A D+G   RS +  V I + D N+ +P F    ++ Y   + E    GT +  V ATD D   N ++TY L             F I+ ++G +  N  LDR       L + AKD G PS
Sbjct:  388 DSPVVYSMVSLLDSRSQSLFKV---DSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFE-AEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETS-DSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQ-----FSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGD----------VSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSG--GRSDTATVHINITDANNFAPIFE---NAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPS 986          
BLAST of protocadherin-1 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0088214)

HSP 1 Score: 226.483 bits (576), Expect = 8.254e-60
Identity = 192/643 (29.86%), Postives = 303/643 (47.12%), Query Frame = 2
Query:  377 IKLSPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFK---------TMKLFDREERDRYELVFIATDKGIP---KKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKED---AIEGSKICDIKVTDKD---DETLITVLINSNSDPEVKRHFQVSAISG-LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNS--KRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIP---EKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEG--YSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLW------ILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLAN----NKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTP 2197
            I L   D D G N+EI Y IE    G    L      PIF+         T    DRE  D Y L+  A D       ++T    + +K+ D ND+ P+F   + Y + V ED     E + +  I+ TD D   +  +   +I  N+    +  F + ++SG ++L+  LDYE S+R + + + A D G P+ + +T + VNV+D NDN P+       +S     ++EN P    +  V   D+D   N  +  ++ E +            +NFP +   R   + T++  DRE    +   V  KD G+PP S+  ++ I ++D NDN P+F+  +++  + E+  PG+P+ T+ ATDPD  +++++ Y+I     + +  I+  N   G++T   S D +          A D      + +  V + I D N+  P+F ++ Y   + E       V  V A D+D   N+ I +S      N L       I    G I +     LDRE  S Y LTV AKD G PS S +  V+I + D+NDN+P F  PL   Y   I E  + GT + +V A+D D   NG++ YLL++    +  F+ID  SG +  N+ LDR  +    L  +A D G+P
Sbjct:  484 ITLRATDQDIGKNAEIEYGIEAVTDG--AGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFS-ERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNT----QSQFSIDSMSGDVSLVKPLDYE-SVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQES-----VLENVPVGYNIIRVQAYDSDEGANAEITYSISERD------------DNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPD--EDSRLHYEITTGNTRGRFAITSQN-GRGLITIAQSLDYKQEKRFLLTVAATDSGGR--SDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNA--PLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPL---YQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSP 1091          

HSP 2 Score: 199.904 bits (507), Expect = 1.671e-51
Identity = 157/541 (29.02%), Postives = 268/541 (49.54%), Query Frame = 2
Query:  377 IKLSPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISG---LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEK-YQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEG--YSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIF-------SEKG-----IQLDRE-VQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSP 1942
            I++   DSD G N+EI YSI  +D  F   L +       +T+K  DREE+ R+    +A D G+P K+    + I ++D+ND+ P F+ PK Y   V ED   G+ +  +  TD D+++ +   I + +    +  F +++ +G   +T+   LDY+   ++F + V A D+G    + + T+ +N+ D N+  P  + +    S+S F   E+ P  + V +V+ TD+D  +N  +  +L    N+++   +    + F  + +   IVT    DRET S Y +TV  KD G P LS    + I + D NDN P+F    +Q  I E+ + G+ +  + A+DPD+G N +I Y + ++  ++   + +P++G +      DRE        A A+D+ +P L+S+VEV + +ED ND  P F S      + E       VG++ A+D D   N+ + +S  G           D N F       SE+       +LD E  +  ++L V A     P   +   ++I + D+NDN+P
Sbjct:  709 IRVQAYDSDEGANAEITYSISERDDNF--PLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFN-PKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGN---TRGRFAITSQNGRGLITIAQSLDYKQE-KRFLLTVAATDSG--GRSDTATVHINITDANNFAP--IFENAPYSASVF---EDAPVGTTVLVVSATDSDVGVNAQITYSL----NEESINGLGSP-DPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIG---------GDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRAAS---PPLRNDAHIEILVTDVNDNAP 1218          

HSP 3 Score: 186.037 bits (471), Expect = 4.123e-47
Identity = 165/624 (26.44%), Postives = 274/624 (43.91%), Query Frame = 2
Query:  413 NSEIIYS----IEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKD--DETLITVLINSNSD------PEVKRHFQVSAISG-LTLISRLDYESSMRKFTIPVIAVDNGIPN---LTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENK---PKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGWVGKVEAYXXXXXXXXXIIFSF-TGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNKY--------FIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPS 2200
            +S ++YS    ++ + +  FK+    +   +  T    DRE  D +    +ATD   P ++G   + + + D NDH+P F+  + +   ++E A  GS +  ++ TD+D      I   I + +D       +    F++ + SG ++  S LD E+S   + + V A D         T + ++ V VLD NDN+PQ      S+ +   ++ E++    +++ VA +  TDAD   N  +   +I  N +  F + S   +          +  ++  D E++  YR+ ++ +D G P  S+   + + + D NDN P F    FQ+ + EN+  G  I  + A D D G NA+I Y I E+  N     +P TG V  +   DRE      F+  A D   P  ++S  V + ++D ND  P F    Y   + E              D + +S + +   TG       I   +G         LD + +  + LTV A D+G   RS +  V I + D N+ +P F    ++ Y   + E    GT +  V ATD D   N ++TY L             F I+ ++G +  N  LDR       L + AKD G PS
Sbjct:  388 DSPVVYSMVSLLDSRSQSLFKV---DSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFE-AEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETS-DSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQ-----FSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGD----------VSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSG--GRSDTATVHINITDANNFAPIFE---NAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPS 986          
BLAST of protocadherin-1 vs. Ensembl Zebrafish
Match: LO018022.1 (FAT atypical cadherin 4 [Source:NCBI gene;Acc:101882648])

HSP 1 Score: 231.106 bits (588), Expect = 4.102e-61
Identity = 199/613 (32.46%), Postives = 298/613 (48.61%), Query Frame = 2
Query:  407 GINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKL-----FDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDD--ETLITVLINSNSDPEVKRHFQVSAISGLTLISR-LDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSE-MNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLP-PLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDE-FNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGWVGKV--EAYXXXXXXXXXIIFSF---TGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLL--ANNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNG 2191
            G++      I G D+  F+L    N       + L      DRE    Y+L+    DKG PKK G +++ + I+D+ND+ P FD  + Y   V EDA  GS +  I  +D D+     IT L++  +       FQ+   +G  +I   LDYE+  R++++ + AVDNG+P+L T T  TV +LD+NDN P +       +S    + EN    + VA++TV+D+DS   NG +  +++  N +++F++ S    N         I      DRE IS Y +TV   D G P   SS  ++ I++ D ND+PP F +  ++  I E+I  GS I  + ATD D G+NA + Y +           + ++G+VT+    +RE  + I     A D+   P + S  ++ + I D ND +P F  + YH  I E        V   A D+D   N  I FSF   T     + + L S     S    +LDRE +S+Y L + A D+G P   S   V I L+D+NDNSP F  P+   Y   I E    G+ +T V A+D D   NG V Y +   ++  F I   SG+V     LDR E    +L + A D G
Sbjct:  162 GVDHTTYRIISGNDQRKFRLDITVNPSGEGAFLHLVSTGGLDRETTPFYQLLIQVEDKGEPKKFGYLQVNVTIQDINDNPPSFDH-EQYQTSVFEDAAVGSSVLQIAASDLDEGANAEITYLLDEGTP------FQIDPKAGTVVIKEGLDYETK-REYSLTIHAVDNGVPSLYTRTEATVKLLDVNDNDPVVKFRYFPTTSKFASVDENAQVGTVVALLTVSDSDSSTANGNISVSILGGNEQRHFDVHSSPVPNLS------LIKVASVLDRERISSYNLTVSVSDNGKPLARSSFASLVIFVNDINDHPPIFQEAVYRVDISEDIPKGSYIKGVSATDGDSGQNANLRYSLVSGNSLGWFAISENSGLVTSAAELNRETASEIVLNISAKDQGLQPKI-SYTKLIVNITDVNDQVPTFTQNTYHVSITEHSPAGSELVVLSATDSDLGPNGTIRFSFDSETPVSDQNKFRLDSTSGRLSTS-TELDREEESSYLLYIRATDSGAPPLHSVCKVNITLKDVNDNSPVF-YPMQ--YFANIKENEPSGSSVTTVTASDPDLGRNGTVKYAITAGDSSKFHISSTSGKVTTLVALDREEKTAYQLQVTATDGG 755          

HSP 2 Score: 196.823 bits (499), Expect = 2.528e-50
Identity = 188/619 (30.37%), Postives = 295/619 (47.66%), Query Frame = 2
Query:  395 DSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDET---LITVLINSNSDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYR------VTVQCKDQGLP-PLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGY--SGWVGKVEAYXXXXXXXXXIIFSFTGF-LHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLA----NNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPS 2200
            D D   N  I+YS++   KG F + +      +   +++        Y+L  +A+D G+P++T  + + I + D+ND+AP FD    Y + + E     S+   ++ TDKD      ++  +I+ N+    +  F +     L + + LD E   R +++ V+A D  + +L+ S  +++ + DINDN P       + ++  F   E + + + V  V   D D   N  V  +   P  + NFEL         N+       TL + DRE++   R       TV   DQGLP PL  Q  + ++I+D NDNPP F+K  +Q  I E+    + +  + A+D D  KN  + Y I E  +      + ++G VT +   D E   S + K  A D  +  L+S+  +++ + D+ND  P F  S     + E       V  V A D+DS SN+DI +S +    H    I  + G+IF  K  +LD E QS Y+L V AKD+G PSRSSS+ V I + D NDN P F+ P D    K I E L   T +  + A D D + NG + Y +A       +F ID  SG ++ N+ +DR       L I A D   P+
Sbjct:  903 DPDEATNGMIVYSLKQNPKGLFHIHEKHGLISLTGPLEV----TTSSYQLEVVASDLGVPQRTSSLFLTISVYDVNDNAPVFDQ-LSYEVTILESEPVNSRFFRVEATDKDSGVNGEIVYDIISGNT----RDVFGIFPDGQLYIKADLDREVQDR-YSLLVVAKDRAVESLSASVNVSILLDDINDNRP-----LFNSTNYVFHFEEEQERGALVGRVFAEDKDFGPNSEVRYSFETP--QSNFEL---------NAITGVLTSTL-QLDRESLMRQRGAAVFSFTVLSSDQGLPKPLKDQAKVQVYIQDINDNPPKFTKDIYQASIAESAQNMTQLLRVSASDVDENKNGLVHYDITEGNEEKQFSIDSNSGQVTLVGKLDYETTPSYSLKIIAEDSGSVPLSSTCVLSISVLDDNDNSPSFPKSTLSVDVLENMRIGELVASVTATDSDSGSNADITYSISATNNHGTFSISPNTGSIFLVK--KLDYETQSLYKLNVTAKDSGRPSRSSSIPVIIHVRDFNDNPPVFT-PGD--IFKSIPENLPISTSVMSITAHDTDADINGLLEYSIALQTPRGGHFRIDSVSGVIYTNKDIDREFSNLFELTIKATDQAVPA 1489          

HSP 3 Score: 192.2 bits (487), Expect = 5.767e-49
Identity = 186/634 (29.34%), Postives = 301/634 (47.48%), Query Frame = 2
Query:  380 KLSPRDSDYGINSEIIYS-IEGKDKGFFKLLQMKNNKPIFKTMKLF-----DREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEV-----KRHFQVSAISG-LTLISRLDYESSMRK-----FTIPVIAVDNGIPN-LTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGY--SGWVGKVEAYXXXXXXXXXIIFSFT--GFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPS---RSSSVIVQIQLEDINDNSPKF-SQPLDSGYMKKITET-LVPGTLITKVMATDDDENENGKVTYLL--ANNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGT 2194
            ++   D D G+N EI+Y  I G  +  F          IF   +L+     DRE +DRY L+ +A D+ +   +  + + I + D+ND+ P F+   +YV   +E+   G+ +  +   DKD           NS+        + +F+++AI+G LT   +LD ES MR+     F+  V++ D G+P  L     + V + DINDN P+   D    S     + E+    + +  V+ +D D   NG+V  ++ E N ++ F + S       NS    ++  + + D ET   Y + +  +D G  PLSS   ++I + D+NDN PSF K      + EN+  G  + ++ ATD D G NA I Y I     +     +P+TG +  +   D E  +       A D   P  +SS+ V + + D ND  P+F        I E    S  V  + A+D D++ N  + +S         H  I    G I++ K I  DRE  + ++LT++A D  VP+   R +   V I + D NDN P F SQ         + E+ +V G+++T V+A D DE  NG+V Y L   ++  FI+D  SG++ +   L   +L+   L++ A D+GT
Sbjct: 1001 RVEATDKDSGVNGEIVYDIISGNTRDVFG---------IFPDGQLYIKADLDREVQDRYSLLVVAKDRAVESLSASVNVSILLDDINDNRPLFNS-TNYVFHFEEEQERGALVGRVFAEDKD--------FGPNSEVRYSFETPQSNFELNAITGVLTSTLQLDRESLMRQRGAAVFSFTVLSSDQGLPKPLKDQAKVQVYIQDINDNPPKFTKDIYQAS-----IAESAQNMTQLLRVSASDVDENKNGLVHYDITEGNEEKQFSIDS-------NSG---QVTLVGKLDYETTPSYSLKIIAEDSGSVPLSSTCVLSISVLDDNDNSPSFPKSTLSVDVLENMRIGELVASVTATDSDSGSNADITYSISATNNHGTFSISPNTGSIFLVKKLDYETQSLYKLNVTAKDSGRPSRSSSIPVIIHVRDFNDNPPVFTPGDIFKSIPENLPISTSVMSITAHDTDADINGLLEYSIALQTPRGGHFRIDSVSGVIYTNKDI--DREFSNLFELTIKATDQAVPAEFRRFALKNVTIWVTDQNDNIPTFISQ------NALVAESNIVIGSILTTVLAFDPDEGANGEVEYELVRGDSDTFIMDRYSGDIRLASQLIPSKLI-YSLMVSATDHGT 1592          

HSP 4 Score: 177.563 bits (449), Expect = 2.605e-44
Identity = 170/591 (28.76%), Postives = 269/591 (45.52%), Query Frame = 2
Query:  482 NKPIFKTMKLFDREERDRYELVFIATDKGIP-KKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKD---DETLITVLINSNSDPEVKRHFQVSAISGL-TLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIE--PNNKQN-FELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQ---------LDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANN--KYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTP 2197
            N  + K   + DRE    Y L    +D G P  ++    + I + D+NDH P F     Y + + ED  +GS I  +  TD D   +  L   L++ NS       F +S  SGL T  + L+ E++  +  + + A D G+    + T + VN+ D+ND  P     T + ++ +  + E+ P  S + +++ TD+D   NG +  +     P + QN F L S           + R+ T  E DRE  S Y + ++  D G PPL S   + I ++D NDN P F    +   IKEN   GS + T+ A+DPD+G+N  + Y I     +   I + ++G VT LV+ DRE  T+   +  A D      ++   VT+ + D  D   +F    Y F + E     VG +             + + T  LH ++  L + G+  S  GI+         +DRE Q+ YQL V A+   V   +   +V I ++D+NDN+P F   ++        E    G  I +  A+D DE  NG + Y L  N    F I EK G + +   L+ +     +L ++A D G P
Sbjct:  409 NLSLIKVASVLDRERISSYNLTVSVSDNGKPLARSSFASLVIFVNDINDHPPIFQEAV-YRVDISEDIPKGSYIKGVSATDGDSGQNANLRYSLVSGNS----LGWFAISENSGLVTSAAELNRETA-SEIVLNISAKDQGLQPKISYTKLIVNITDVNDQVP-----TFTQNTYHVSITEHSPAGSELVVLSATDSDLGPNGTIRFSFDSETPVSDQNKFRLDST----------SGRLSTSTELDREEESSYLLYIRATDSGAPPLHSVCKVNITLKDVNDNSPVFYPMQYFANIKENEPSGSSVTTVTASDPDLGRNGTVKYAITAGDSSKFHI-SSTSGKVTTLVALDREEKTAYQLQVTATDGGGLRSHTPAIVTVTVVDTQDNPLVFGQKDYSFVMFENVP--VGTI----------IGTVSATTVDLHTNITYLIASGDQRSLFGIKAGQITALGLIDREEQAFYQLRVIARAGEV---TGETLVNITVKDLNDNAPNFMHSVE---HVSAVENWATGHHIFQAKASDPDEATNGMIVYSLKQNPKGLFHIHEKHGLISLTGPLE-VTTSSYQLEVVASDLGVP 958          

HSP 5 Score: 156.762 bits (395), Expect = 5.225e-38
Identity = 168/632 (26.58%), Postives = 288/632 (45.57%), Query Frame = 2
Query:  380 KLSPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERD-----RYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQI----VIDTLSDS---SSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTL-REFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNT--SITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGY--SGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLW-ILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRS--SSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENEN-GKVTYLLANNK---YFIIDEKSGEVFINRTLDRLELVP-RRLLIMAKDNGTPS 2200
            ++S  D D G N +I Y I  + + +F++        I + ++  +    +     R+  +  A+D+GI     E  + I + D ND+ P F+ P  Y   V +    G+++  +   DK D  L + +  + S       F++   +G   ++      + + + + + A D G P L+  TT+ + V + N + P+     V  T+S++    +  + +  + K          D D +MNG++  N+   N+   F + S+             +++L +  D ET   + + V   D G    +S  T+ I + D NDNPP F    +   ++EN+  G+ +  + ATD D G NA + Y I     ++  I +P+TGI+T     D E      +T KAF + +      S   V ++++  N+ +P F+S  Y+F+I E       VG+V A D D   +  + +   G      + I K  G I+      LDRE +    L V AK+ G    +    V+V I + D ND  P F+Q L   Y  ++ E L PG L+T V A D D   +  + TY +A N     F I+ ++G+V +   LDR E VP   L I+A D+G+P+
Sbjct: 2446 QVSATDPDEGFNGKIFYFIRSQTE-YFRINSSSGEIFIKQQLRYQNSSGHNNINVNRHSFIVTASDRGIKPLMSETTVMINVVDSNDNPPTFESPS-YFTPVTKSVKVGTRLLKVTAYDKKDFGLNSEIEYAISGGNSSNKFRLDKQTGSVTVASSLAADTNKVYLLEITASDKGNPPLSDRTTVKIAVTEENHHTPEFSQNQVTVTVSEALTVGTAIRTLSARDK----------DKDKQMNGLITYNISSGNDDGLFSVHSQT-----------GVLSLAKTLDYETKQKHELRVSATDGGWIAKTSYVTVNIQVTDVNDNPPVFDPVEYFPVVQENVPSGTTVVKMNATDKDSGSNALMAYVIQSSDSDLFII-DPNTGIITTQGFLDYEAKQVYHLTVKAFNVPDEERC--SFAYVNIQLKGANEYVPRFVSKQYYFEISEAAPKGTVVGEVFASDRDLGEDGVVYYLIFGRSRKRGFSINKKTGQIYVSG--SLDREKEEKISLKVLAKNAGSIRGADIDEVLVNITVLDAND-PPVFTQEL---YDVQVNEGLSPGGLVTFVSAEDSDSVPSWSRFTYAIAANHERNTFTINPQTGQVSVASELDR-ETVPVYNLTILAVDSGSPA 3044          

HSP 6 Score: 153.68 bits (387), Expect = 5.674e-37
Identity = 168/618 (27.18%), Postives = 272/618 (44.01%), Query Frame = 2
Query:  383 LSPRDSDYGINSEIIYS-IEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEV--KRHFQVSAISG-LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYS--GWVGKVEAYXXXXXXXXXIIFSF----TGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTY--LLANNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPS 2200
            +S  D D G N+ + YS + G   G+F + +   N  +  +    +RE      L   A D+G+  K    K+ + I D+ND  P F     Y + + E +  GS++  +  TD D     T+  + +S+  V  +  F++ + SG L+  + LD E     + + + A D+G P L +   + + + D+NDN P   +       +N K  EN+P  S V  VT +D D   NG V            + + +   + F  S  + ++ TL   DRE  + Y++ V   D G     +   +T+ + D  DNP  F +  +   + EN+  G+ I T+ AT  D+  N  I Y I    Q   S+     G +T L   DRE       +  A       +     V + ++D ND  P F+ S  H    E ++    + + +A D D  +N  I++S      G  H H    +  G I     +++     S+YQL V A D GVP R+SS+ + I + D+NDN+P F Q     Y   I E+    +   +V ATD D   NG++ Y  +  N +        G+++I   LDR       LL++AKD    S
Sbjct:  484 VSATDGDSGQNANLRYSLVSGNSLGWFAISE---NSGLVTSAAELNRETASEIVLNISAKDQGLQPKISYTKLIVNITDVNDQVPTFTQ-NTYHVSITEHSPAGSELVVLSATDSDLGPNGTIRFSFDSETPVSDQNKFRLDSTSGRLSTSTELDREEE-SSYLLYIRATDSGAPPLHSVCKVNITLKDVNDNSP---VFYPMQYFANIK--ENEPSGSSVTTVTASDPDLGRNGTV-----------KYAITAGDSSKFHISSTSGKVTTLVALDREEKTAYQLQVTATDGGGLRSHTPAIVTVTVVDTQDNPLVFGQKDYSFVMFENVPVGTIIGTVSATTVDLHTN--ITYLIASGDQR--SLFGIKAGQITALGLIDREEQAFYQLRVIARAG---EVTGETLVNITVKDLNDNAPNFMHSVEHVSAVENWATGHHIFQAKASDPDEATNGMIVYSLKQNPKGLFHIH----EKHGLISLTGPLEV---TTSSYQLEVVASDLGVPQRTSSLFLTISVYDVNDNAPVFDQ---LSYEVTILESEPVNSRFFRVEATDKDSGVNGEIVYDIISGNTRDVFGIFPDGQLYIKADLDREVQDRYSLLVVAKDRAVES 1063          

HSP 7 Score: 142.51 bits (358), Expect = 1.281e-33
Identity = 167/604 (27.65%), Postives = 262/604 (43.38%), Query Frame = 2
Query:  407 GINSEIIYSI-EGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISGLTLISR-LDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLP-PLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLS-SAYHFKIKEGYSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTY-LLANNK--YFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTP 2197
            G N+ + Y+I  G D  F    ++          +  DRE R +Y L+  A D    +++ +I + I + D+NDH P F     Y   + ED   GS +  I  +D D      +  +   D E    F ++ I+G+  ++R LD+E+    F + V A D G    ++S  +  N+LD+ND+ P       + S     ++E+    + V  V+  D D   +  +           N   +S     F  +     I+T    DRET + Y++ V   D G P PLSS  T+++ + D NDNPP F    +   I  +   GS +F +  TD D G N+++ Y +  +      I +P  G +T   S     ++ +TF     D        S  VT+      D   + L   A+ F   +  +  V KV      +   S  I S  G L N   I +  G +   K   LD E    Y L +EA+D G P  S+   V+I + D+NDN P F Q     +  +I E L P  ++  V A D D   NG++ Y ++  NK   F I+  +GE+   R LDR ++    L + A D G P
Sbjct: 1739 GANALVTYAIISGADDSF----RIDPESGELSATRRLDRERRSKYSLLVRADDG---QQSSDIWVNITVSDINDHTPTFSR-SVYSFDIPEDMSPGSIVAAILASDGDSGVNGEITYSVEEDDE-DSTFLLNPITGVFNVTRALDFET-QPFFILTVRAADGG--GRSSSVRVYFNLLDVNDHPP-----LFNSSVYTTSILESLSAGASVLTVSAADRDHGNSSTL----------LNSVHLSGGDGQFSINPSTGLIITSSLLDRETRASYQLLVVASDGGQPTPLSSSATVSVVVADINDNPPRFHHHPYVTHIPASTSTGSLVFAVTVTDEDSGSNSQLHYSLTGRNSEKFKI-DPIRGAIT--ASEKLTGSSEVTFTVHVKDGGTNPKTDSTTVTVRFVTGGDFPHIKLKDKAFTFPENQPTNTIVTKVTGSSPRAGPLSYYIAS--GNLDNAFHIDQLSGELSIRK--PLDYENIEKYVLWIEARDQGFPPYSAYEKVEIAVLDVNDNHPVFEQ---EPFHAEILENLSPQRVLV-VSALDQDSGPNGQLEYAIIDGNKENSFNINRATGEIRTTRPLDREKVAQYSLRVKATDRGMP 2304          

HSP 8 Score: 140.584 bits (353), Expect = 4.984e-33
Identity = 175/627 (27.91%), Postives = 284/627 (45.30%), Query Frame = 2
Query:  401 DYGINSEIIYSIEGKDKG-FFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDE----TLITVLINSNSDPEVKRHFQVSAISG-LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLM-ENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREF-DRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSF--SKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVE---VTLEIEDENDCIPMFLSSAYHFKIKEGYS--GWVGKVEAYXXXXXXXXXIIFSFTGFLH--------NHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENEN-GKVTYLL----ANNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTP 2197
            D+G+NSEI Y+I G +    F+L +   +  +  ++     +    Y L   A+DKG P  +    + I + + N H PEF       + V E    G+ I  +   DKD +     LIT  I+S +D  +   F V + +G L+L   LDYE+  +K  + V A D G    T+  T+ + V D+NDN P      + D    F ++ EN P  + V  +  TD DS  N ++   +I+ ++   F +             N  I+T + F D E    Y +TV+  +       S   + I ++  N+  P F   +++F+  I E    G+ +  + A+D D+G++  + Y I  + +      N  TG +    S DRE    I+ K  A +    +  + ++   V + + D ND  P+F    Y  ++ EG S  G V  V A D+DS      + S++ F +        N   I    G +      +LDRE    Y LT+ A D+G P+ + S I+ + LEDINDN P     L + Y  ++ E    GT +  + + D D   N G  TY L    A + YF I   +GE+  +R +DR ++    L ++ KD+G P
Sbjct: 2565 DFGLNSEIEYAISGGNSSNKFRLDKQTGSVTVASSLAA---DTNKVYLLEITASDKGNPPLSDRTTVKIAVTEENHHTPEFSQ-NQVTVTVSEALTVGTAIRTLSARDKDKDKQMNGLITYNISSGNDDGL---FSVHSQTGVLSLAKTLDYETK-QKHELRVSATDGGWIAKTSYVTVNIQVTDVNDNPP------VFDPVEYFPVVQENVPSGTTVVKMNATDKDSGSNALM-AYVIQSSDSDLFII-----------DPNTGIITTQGFLDYEAKQVYHLTVKAFNVPDEERCSFAYVNIQLKGANEYVPRFVSKQYYFE--ISEAAPKGTVVGEVFASDRDLGEDGVVYYLIFGRSRKRGFSINKKTGQIYVSGSLDREKEEKISLKVLAKNA-GSIRGADIDEVLVNITVLDAND-PPVFTQELYDVQVNEGLSPGGLVTFVSAEDSDS------VPSWSRFTYAIAANHERNTFTINPQTGQV--SVASELDRETVPVYNLTILAVDSGSPAATGSAILIVTLEDINDNGPT----LVTTY-GEVMENQRAGTPVMTLSSRDPDLAPNQGPFTYSLVSTGAASSYFTI-SPTGELTTSREVDREQISDFYLSVLIKDSGIP 3147          

HSP 9 Score: 139.043 bits (349), Expect = 1.516e-32
Identity = 164/615 (26.67%), Postives = 260/615 (42.28%), Query Frame = 2
Query:  395 DSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISG-LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMEN-KPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKE--GYSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQST------YQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATD-DDENENGKVTYLLANNKY---FIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTP 2197
            D D G NS++ YS+ G++   FK+  ++    I  + KL    E           D G   KT    + ++     D  P   + KD      E+    + +  +  +      L   + + N D      F +  +SG L++   LDYE+ + K+ + + A D G P  +    + + VLD+NDN P            + +++EN  P+   V +V+  D DS  NG ++  +I+ N + +F +          ++    I T R  DRE ++ Y + V+  D+G+PP S+   + I + D NDN P FSK  F   + EN   G  +  +  TD D G NA   Y I +   ++  I +PSTG +T     +RE       K  A D        S +VT+ + D ND  P F   +Y+    E       V +V A D D   N   IF F      +  I  S G IF ++ ++              +   V A D G+    S   V I + D NDN P F  P    Y   +T+++  GT + KV A D  D   N ++ Y ++       F +D+++G V +  +L         L I A D G P
Sbjct: 2045 DEDSGSNSQLHYSLTGRNSEKFKIDPIRG--AITASEKLTGSSE---VTFTVHVKDGGTNPKTDSTTVTVRFVTGGDF-PHIKL-KDKAFTFPENQPTNTIVTKVTGSSPRAGPLSYYIASGNLD----NAFHIDQLSGELSIRKPLDYEN-IEKYVLWIEARDQGFPPYSAYEKVEIAVLDVNDNHP-----VFEQEPFHAEILENLSPQR--VLVVSALDQDSGPNGQLEYAIIDGNKENSFNI----------NRATGEIRTTRPLDREKVAQYSLRVKATDRGMPPKSTAVKVLISVLDVNDNAPRFSK-IFSATVPENAPVGFTVTRVTTTDEDAGANAISRYSITDA--SLPFIIHPSTGDITISRPLNREDTDHYIAKVSAHDSG---WTVSTDVTIFVTDINDNAPRFSKPSYYLDYPELTEIGSIVTQVSATDPDEGFNGK-IFYFIRSQTEYFRINSSSGEIFIKQQLRYQNSSGHNNINVNRHSFIVTASDRGIKPLMSETTVMINVVDSNDNPPTFESP---SYFTPVTKSVKVGTRLLKVTAYDKKDFGLNSEIEYAISGGNSSNKFRLDKQTGSVTVASSLAADTNKVYLLEITASDKGNP 2620          

HSP 10 Score: 133.265 bits (334), Expect = 9.860e-31
Identity = 144/493 (29.21%), Postives = 218/493 (44.22%), Query Frame = 2
Query:  773 EVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGI--VDCNLIEPNNKQNFELISRYFNNFPNSKRNY-RIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPM-----FLSSAYHFKIKEGYSGWVGKVEAYXXXXXXXXXI------IFSFTGFLHNHLWILKSDGNIFSEKGIQ--LDREVQSTYQLTVEAKDNGVP-SRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANN---KYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNG 2191
            E  + F ++A +G+   S +     +    I V+ + +     T  T + + VLDINDN P        D+S      E+      V + T TDAD   NG+      +I  N+++ F L        P+ +  +  +V+    DRET   Y++ +Q +D+G P       + + I+D NDNPPSF    +Q  + E+   GS +  + A+D D G NA+I Y + E     I   +P  G V      D E     +    A+D   P L +  E T+++ D ND  P+     F +++    + E  +  VG V A    S+S+S        +    G    H  +  S     S   +   LDRE  S+Y LTV   DNG P +RSS   + I + DIND+ P F + +   Y   I+E +  G+ I  V ATD D  +N  + Y L +     +F I E SG V     L+R       L I AKD G
Sbjct:   70 EQHKLFSINATTGVIYTSSVIDREVLPGNIINVVVLSS---QPTYPTEVRIVVLDINDNAP-----VFPDASIVVSFKEDASSGRQVILDTATDADIGSNGVDHTTYRIISGNDQRKFRLD---ITVNPSGEGAFLHLVSTGGLDRETTPFYQLLIQVEDKGEPKKFGYLQVNVTIQDINDNPPSFDHEQYQTSVFEDAAVGSSVLQIAASDLDEGANAEITYLLDEGTPFQI---DPKAGTVVIKEGLDYETKREYSLTIHAVDNGVPSLYTRTEATVKLLDVNDNDPVVKFRYFPTTSKFASVDE--NAQVGTVVALLTVSDSDSSTANGNISVSILGGNEQRHFDVHSSPVPNLSLIKVASVLDRERISSYNLTVSVSDNGKPLARSSFASLVIFVNDINDHPPIFQEAV---YRVDISEDIPKGSYIKGVSATDGDSGQNANLRYSLVSGNSLGWFAISENSGLVTSAAELNRETASEIVLNISAKDQG 543          

HSP 11 Score: 124.02 bits (310), Expect = 7.087e-28
Identity = 162/610 (26.56%), Postives = 258/610 (42.30%), Query Frame = 2
Query:  395 DSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPN-LTTSTTITVNVLDINDNFPQI----VIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDR---IKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGW-VGKVEAYXXXXXXXXXIIFSFT-GFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNKY-FIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNG 2191
            D D G+N EI YS+E  D+    LL       +F   +  D E +  + L   A D G   ++  +++Y  + D+NDH P F+    Y   + E    G+ +  +   D+D     T L+NS         F ++  +GL + S L    +   + + V+A D G P  L++S T++V V DINDN P+      +  +  S+S           S V  VTVTD DS             N++ ++ L  R    F        I    +      S    TV  KD G  P +   T+T+      D    F     +D+     EN    + +  +  + P  G  +   Y       N   I   S G ++     D E          A D+  P  ++  +V + + D ND  P+F    +H +I E  S   V  V A D DS  N  + ++   G   N   I ++ G I + +   LDRE  + Y L V+A D G+P +S++V V I + D+NDN+P+FS+     +   + E    G  +T+V  TD+D   N    Y + +    FII   +G++ I+R L+R +       + A D+G
Sbjct: 1836 DGDSGVNGEITYSVEEDDEDSTFLLNPITG--VFNVTRALDFETQPFFILTVRAADGG--GRSSSVRVYFNLLDVNDHPPLFNS-SVYTTSILESLSAGASVLTVSAADRDHGNSST-LLNSVHLSGGDGQFSINPSTGLIITSSLLDRETRASYQLLVVASDGGQPTPLSSSATVSVVVADINDNPPRFHHHPYVTHIPASTST---------GSLVFAVTVTDEDSGS-----------NSQLHYSLTGRNSEKFKIDPIRGAITASEKLTGS--SEVTFTVHVKDGGTNPKTDSTTVTVRFVTGGD----FPHIKLKDKAFTFPENQPTNTIVTKVTGSSPRAGPLS--YYIASGNLDNAFHIDQLS-GELSIRKPLDYENIEKYVLWIEARDQGFPPYSAYEKVEIAVLDVNDNHPVFEQEPFHAEILENLSPQRVLVVSALDQDSGPNGQLEYAIIDGNKENSFNINRATGEIRTTR--PLDREKVAQYSLRVKATDRGMPPKSTAVKVLISVLDVNDNAPRFSKI----FSATVPENAPVGFTVTRVTTTDEDAGANAISRYSITDASLPFIIHPSTGDITISRPLNREDTDHYIAKVSAHDSG 2404          

HSP 12 Score: 121.324 bits (303), Expect = 4.161e-27
Identity = 155/623 (24.88%), Postives = 269/623 (43.18%), Query Frame = 2
Query:  371 LSIKLSPRDSDYGINSEIIYSIEG-KDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKR--HFQVSAISGLTLISR-LDYESSMRKFTIPVIAVDNGIP---NLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQI-----PEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLA---NNKYFIIDEKSGEVFINRTLDRLELVPRRLL-IMAKDNG 2191
            L   ++  DSD G N++I YSI    + G F +    N   IF   KL D E +  Y+L   A D G P ++  I + I +RD ND+ P F  P D    + E+    + +  I   D D +  I  L+  +   +  R  HF++ ++SG+   ++ +D E S   F + + A D  +P          +T+ V D NDN P  +      + SN  +       S +  V   D D   NG V+  L+   +   F ++ RY  +    +   +++  +         Y + V   D G    SS+  +TI ++  +   P FS+  +   +KE    G+ + +L A+ P  G   K+ Y I       K    +      +G++      DRE  + +    + LD +      ++E   +          FL   + FK+     G + +  +      +N+ + ++      +   I    G + + +  +LDRE +S Y L V A D     +SS + V I + DIND++P FS+   S Y   I E + PG+++  ++A+D D   NG++TY +     +  F+++  +G   + R LD  E  P  +L + A D G
Sbjct: 1317 LVASVTATDSDSGSNADITYSISATNNHGTFSI--SPNTGSIFLVKKL-DYETQSLYKLNVTAKDSGRPSRSSSIPVIIHVRDFNDNPPVF-TPGDIFKSIPENLPISTSVMSITAHDTDAD--INGLLEYSIALQTPRGGHFRIDSVSGVIYTNKDIDREFS-NLFELTIKATDQAVPAEFRRFALKNVTIWVTDQNDNIPTFISQNALVAESNIVI------GSILTTVLAFDPDEGANGEVEYELVR-GDSDTF-IMDRYSGDI---RLASQLIPSKLI-------YSLMVSATDHGTDRKSSRTELTIILQGTDG--PVFSQPKYITILKEGQPAGTNVISLDASSPR-GAGTKVEYFIVSVRSGGKAAGRLFTIGRHSGVIQTAAELDREQGSDL----YLLDVY------AIETDAKQPRTQHAEVSFLFD-FFFKVMLLLKGNLREHISQTCAEGANALVTYAIISGADDSFRIDPESGELSATR--RLDRERRSKYSLLVRADDG---QQSSDIWVNITVSDINDHTPTFSR---SVYSFDIPEDMSPGSIVAAILASDGDSGVNGEITYSVEEDDEDSTFLLNPITGVFNVTRALD-FETQPFFILTVRAADGG 1891          

HSP 13 Score: 115.931 bits (289), Expect = 1.697e-25
Identity = 134/528 (25.38%), Postives = 239/528 (45.27%), Query Frame = 2
Query:  392 RDSDYGINSEIIYSIE-GKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDET--LITVLINSNSDPEVKRHFQVSAISGL-TLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVL--DINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSS--QQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPD-IGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGWVGKVEAYXXXXXXXXXIIFSF----TGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDN 1936
            +D D  +N  I Y+I  G D G F +    +   +    K  D E + ++EL   ATD G   KT  + + I++ D+ND+ P FD P +Y   V+E+   G+ +  +  TDKD  +  L+  +I S SD ++   F +   +G+ T    LDYE+  + + + V A +  +P+    +   VN+     N+  P+ V          F++ E  PK + V  V  +D D   +G+V   +   + K+ F +          +K+  +I      DRE      + V  K+ G    +   +  + I + D ND PP F++  +  ++ E + PG  +  + A D D +   ++  Y I   ++      NP TG V+     DRE          A+D  +P    S  + + +ED ND  P  +++ Y   ++   +G      +  +   + +   F++    TG   ++  I  + G + + +  ++DRE  S + L+V  KD+G+P  SS+  V I++ D NDN
Sbjct: 2669 KDKDKQMNGLITYNISSGNDDGLFSV---HSQTGVLSLAKTLDYETKQKHELRVSATDGGWIAKTSYVTVNIQVTDVNDNPPVFD-PVEYFPVVQENVPSGTTVVKMNATDKDSGSNALMAYVIQS-SDSDL---FIIDPNTGIITTQGFLDYEAK-QVYHLTVKAFN--VPDEERCSFAYVNIQLKGANEYVPRFV-----SKQYYFEISEAAPKGTVVGEVFASDRDLGEDGVVYYLIFGRSRKRGFSI----------NKKTGQIYVSGSLDREKEEKISLKVLAKNAGSIRGADIDEVLVNITVLDAND-PPVFTQELYDVQVNEGLSPGGLVTFVSAEDSDSVPSWSRFTYAIAANHERNTFTINPQTGQVSVASELDRETVPVYNLTILAVDSGSPAATGSAILIVTLEDINDNGPTLVTT-YGEVMENQRAGTPVMTLSSRDPDLAPNQGPFTYSLVSTGAASSYFTISPT-GELTTSR--EVDREQISDFYLSVLIKDSGIPQMSSTGTVHIKVNDQNDN 3165          

HSP 14 Score: 112.849 bits (281), Expect = 1.845e-24
Identity = 158/615 (25.69%), Postives = 248/615 (40.33%), Query Frame = 2
Query:  461 KLLQMKNNKPIFKTMKLFDRE--ERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKD------DETLITVLINSNSDPEVKRHFQVSAI---SG----LTLISRLDYESSMRKFTIPVIAV-DNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQD-----RIKENIMPGSPIFTLIATDPDIG-KNAKIIYQI----PEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSS-VEVTLEIEDENDCIPMFLSSAYHFKIKEGY--SGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHL-WILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYL------LANNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTP 2197
            KL  +     +  T  + DRE    +   +V +++    P +     + I + D+ND+AP F      V+  KEDA  G ++     TD D      D T  T  I S +D   +R F++      SG    L L+S    +     F   +I V D G P       + V + DINDN P    +    S     + E+    S V  +  +D D   N  +   L E                F    +   +V     D ET   Y +T+   D G+P L ++   T+ + D NDN P     +F        + EN   G+ +  L  +D D    N  I   I     +++ ++ S P P+  ++      DRE  +S        D   PL  SS   + + + D ND  P+F  + Y   I E      ++  V A D DS  N+++ +S      N L W   S+ +       +L+RE  S   L + AKD G+  + S   + + + D+ND  P F+Q   + Y   ITE    G+ +  + ATD D   NG + +       +++   F +D  SG +  +  LDR E     L I A D+G P
Sbjct:   73 KLFSINATTGVIYTSSVIDREVLPGNIINVVVLSSQPTYPTE-----VRIVVLDINDNAPVFP-DASIVVSFKEDASSGRQVILDTATDADIGSNGVDHT--TYRIISGND---QRKFRLDITVNPSGEGAFLHLVSTGGLDRETTPFYQLLIQVEDKGEPKKFGYLQVNVTIQDINDNPPSFDHEQYQTS-----VFEDAAVGSSVLQIAASDLDEGANAEITYLLDEG-------------TPFQIDPKAGTVVIKEGLDYETKREYSLTIHAVDNGVPSLYTRTEATVKLLDVNDNDPVVKFRYFPTTSKFASVDENAQVGTVVALLTVSDSDSSTANGNISVSILGGNEQRHFDVHSSPVPNLSLIKVASVLDRERISSYNLTVSVSDNGKPLARSSFASLVIFVNDINDHPPIFQEAVYRVDISEDIPKGSYIKGVSATDGDSGQNANLRYSLVS--GNSLGWFAISENSGLVTSAAELNRETASEIVLNISAKDQGLQPKISYTKLIVNITDVNDQVPTFTQ---NTYHVSITEHSPAGSELVVLSATDSDLGPNGTIRFSFDSETPVSDQNKFRLDSTSGRLSTSTELDREEESSYLLYIRATDSGAP 653          

HSP 15 Score: 100.908 bits (250), Expect = 7.198e-21
Identity = 98/364 (26.92%), Postives = 177/364 (48.63%), Query Frame = 2
Query:  377 IKLSPRDSDYGINSEIIYSI-EGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYV-IGVKEDAIEGSKICDIKVTDKDDETL--ITVLINSNSDPEVKRHFQVSAISG-LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPP---LSSQQTITIWIEDENDNPPSFSKFFFQDRI--KENIMPGSPIFTLIATDPDIGKNAKIIYQI 1438
            +++S  D D   N  + Y I EG ++   K   + +N      +   D E    Y L  IA D G    +    + I + D ND++P F  PK  + + V E+   G  +  +  TD D  +   IT  I++ ++      F +S  +G + L+ +LDYE+    + + V A D+G P+ ++S  + ++V D NDN P      +  S     + EN P  + V  +T  D D+++NG+++ ++          L +    +F     +  I T ++ DRE  + + +T++  DQ +P      + + +TIW+ D+NDN P+   F  Q+ +  + NI+ GS + T++A DPD G N ++ Y++
Sbjct: 1214 LRVSASDVDENKNGLVHYDITEGNEE---KQFSIDSNSGQVTLVGKLDYETTPSYSLKIIAEDSGSVPLSSTCVLSISVLDDNDNSPSF--PKSTLSVDVLENMRIGELVASVTATDSDSGSNADITYSISATNN---HGTFSISPNTGSIFLVKKLDYET-QSLYKLNVTAKDSGRPSRSSSIPVIIHVRDFNDNPPVFTPGDIFKS-----IPENLPISTSVMSITAHDTDADINGLLEYSI---------ALQTPRGGHFRIDSVSGVIYTNKDIDREFSNLFELTIKATDQAVPAEFRRFALKNVTIWVTDQNDNIPT---FISQNALVAESNIVIGSILTTVLAFDPDEGANGEVEYEL 1551          

HSP 16 Score: 100.523 bits (249), Expect = 9.119e-21
Identity = 104/425 (24.47%), Postives = 184/425 (43.29%), Query Frame = 2
Query:  377 IKLSPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKD--DETLITVLINSNSDPEVKRHFQVSAISGLTLIS-RLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPS-------TGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDEND 1621
            +K++  D D G N+ + Y I+  D   F +     N  I  T    D E +  Y L   A +    ++     + I+++  N++ P F + K Y   + E A +G+ + ++  +D+D  ++ ++  LI   S    KR F ++  +G   +S  LD E    K ++ V+A + G         + VN+  ++ N P +    L D   N    E       V  V+  D+DS  +       I  N+++N          F  + +  ++    E DRET+  Y +T+   D G P  +    + + +ED NDN P+    + +  + EN   G+P+ TL + DPD+  N     Q P  Y +++S    S       TG +T     DRE  +         D   P ++S+  V +++ D+ND
Sbjct: 2769 VKMNATDKDSGSNALMAYVIQSSDSDLFII---DPNTGIITTQGFLDYEAKQVYHLTVKAFNVPDEERCSFAYVNIQLKGANEYVPRF-VSKQYYFEISEAAPKGTVVGEVFASDRDLGEDGVVYYLIFGRSR---KRGFSINKKTGQIYVSGSLDREKE-EKISLKVLAKNAGSIRGADIDEVLVNITVLDANDPPVFTQELYDVQVN----EGLSPGGLVTFVSAEDSDSVPSWSRFTYAIAANHERN---------TFTINPQTGQVSVASELDRETVPVYNLTILAVDSGSPAATGSAILIVTLEDINDNGPTLVTTYGE--VMENQRAGTPVMTLSSRDPDLAPN-----QGPFTY-SLVSTGAASSYFTISPTGELTTSREVDREQISDFYLSVLIKDSGIPQMSSTGTVHIKVNDQND 3164          

HSP 17 Score: 95.9005 bits (237), Expect = 2.186e-19
Identity = 106/407 (26.04%), Postives = 180/407 (44.23%), Query Frame = 2
Query:  395 DSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTG--EIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDE---TLITVLINSNSDPEVKRHFQVSAISG-LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMN-GIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEV 1594
            D D G +  + Y I G+ +     +  K  + I+ +  L DRE+ ++  L  +A + G  +     E+ + I + D ND  P     + Y + V E    G  +  +   D D     +  T  I +N +   +  F ++  +G +++ S LD E+ +  + + ++AVD+G P  T S  + V + DINDN P +V       ++  ++MEN+   + V  ++  D D   N G    +L+           S YF   P  +    + T RE DRE IS + ++V  KD G+P +SS  T+ I + D+NDNP              N+ PG  +  +   DPDI    +     P     + SIP  +  +++N  S D   + S+       D  +  +NS V V
Sbjct: 2879 DRDLGEDGVVYYLIFGRSRKRGFSINKKTGQ-IYVSGSL-DREKEEKISLKVLAKNAGSIRGADIDEVLVNITVLDAND--PPVFTQELYDVQVNEGLSPGGLVTFVSAEDSDSVPSWSRFTYAIAANHE---RNTFTINPQTGQVSVASELDRET-VPVYNLTILAVDSGSPAATGSAILIVTLEDINDNGPTLV-------TTYGEVMENQRAGTPVMTLSSRDPDLAPNQGPFTYSLVSTGAA------SSYFTISPTGE----LTTSREVDREQISDFYLSVLIKDSGIPQMSSTGTVHIKVNDQNDNPSESRSVEIYVHYFGNMFPGGSLGVVKPQDPDIQDTFQCSLTPPAAL--LFSIPTGTCDLISNSRSTDGTFDLSVRSN----DGVHSAVNSHVRV 3254          

HSP 18 Score: 87.8113 bits (216), Expect = 6.534e-17
Identity = 159/625 (25.44%), Postives = 257/625 (41.12%), Query Frame = 2
Query:  377 IKLSPRDSDYGINSEIIYSI--EGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIP---KKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITV---LINSNSDPEVKRHFQVSAISG-LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDN--FPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISH-YRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYS--GWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKV---TYLLANNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPS 2200
            + ++  D+D  IN  + YSI  +    G F++  +     +  T K  DRE  + +EL   ATD+ +P   ++     + I + D ND+ P F      V   + + + GS +  +   D D+     V   L+  +SD      F +   SG + L S+L    S   +++ V A D+G    ++ T +T+ +L   D   F Q    T+        L E +P  + V  +   DA S             + +   +   R F      + +  I T  E DRE  S  Y + V   +       +Q     ++ D          FFF+  +   ++ G+ +   I+     G NA + Y I     +   I +P +G ++     DRE  +  +    A D      +S + V + + D ND  P F  S Y F I E  S    V  + A D DS  N +I +S      +  ++L     +F+     LD E Q  + LTV A D G   RSSSV V   L D+ND+ P F+    S Y   I E+L  G  +  V A D D   +  +    +L   +  F I+  +G +  +  LDR      +LL++A D G P+
Sbjct: 1424 MSITAHDTDADINGLLEYSIALQTPRGGHFRIDSVSG---VIYTNKDIDREFSNLFELTIKATDQAVPAEFRRFALKNVTIWVTDQNDNIPTFISQNALV--AESNIVIGSILTTVLAFDPDEGANGEVEYELVRGDSDT-----FIMDRYSGDIRLASQL--IPSKLIYSLMVSATDHGTDRKSSRTELTI-ILQGTDGPVFSQPKYITI--------LKEGQPAGTNVISL---DASSPRGAGTKVEYFIVSVRSGGKAAGRLFTI---GRHSGVIQTAAELDREQGSDLYLLDVYAIETDAKQPRTQHAEVSFLFD----------FFFKVML---LLKGN-LREHISQTCAEGANALVTYAIISGADDSFRI-DPESGELSATRRLDRERRSKYSLLVRADDGQQ---SSDIWVNITVSDINDHTPTFSRSVYSFDIPEDMSPGSIVAAILASDGDSGVNGEITYSVEEDDEDSTFLLNPITGVFNVTR-ALDFETQPFFILTVRAADGG--GRSSSVRVYFNLLDVNDHPPLFNS---SVYTTSILESLSAGASVLTVSAADRDHGNSSTLLNSVHLSGGDGQFSINPSTGLIITSSLLDRETRASYQLLVVASDGGQPT 1997          

HSP 19 Score: 80.4925 bits (197), Expect = 1.088e-14
Identity = 47/127 (37.01%), Postives = 64/127 (50.39%), Query Frame = 2
Query: 1820 LDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPS 2200
            LDRE    YQL ++ +D G P +   + V + ++DINDN P F       Y   + E    G+ + ++ A+D DE  N ++TYLL     F ID K+G V I   LD        L I A DNG PS
Sbjct:  202 LDRETTPFYQLLIQVEDKGEPKKFGYLQVNVTIQDINDNPPSFDH---EQYQTSVFEDAAVGSSVLQIAASDLDEGANAEITYLLDEGTPFQIDPKAGTVVIKEGLDYETKREYSLTIHAVDNGVPS 325          
BLAST of protocadherin-1 vs. Ensembl Zebrafish
Match: LO018022.1 (FAT atypical cadherin 4 [Source:NCBI gene;Acc:101882648])

HSP 1 Score: 230.72 bits (587), Expect = 5.202e-61
Identity = 199/613 (32.46%), Postives = 298/613 (48.61%), Query Frame = 2
Query:  407 GINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKL-----FDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDD--ETLITVLINSNSDPEVKRHFQVSAISGLTLISR-LDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSE-MNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLP-PLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDE-FNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGWVGKV--EAYXXXXXXXXXIIFSF---TGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLL--ANNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNG 2191
            G++      I G D+  F+L    N       + L      DRE    Y+L+    DKG PKK G +++ + I+D+ND+ P FD  + Y   V EDA  GS +  I  +D D+     IT L++  +       FQ+   +G  +I   LDYE+  R++++ + AVDNG+P+L T T  TV +LD+NDN P +       +S    + EN    + VA++TV+D+DS   NG +  +++  N +++F++ S    N         I      DRE IS Y +TV   D G P   SS  ++ I++ D ND+PP F +  ++  I E+I  GS I  + ATD D G+NA + Y +           + ++G+VT+    +RE  + I     A D+   P + S  ++ + I D ND +P F  + YH  I E        V   A D+D   N  I FSF   T     + + L S     S    +LDRE +S+Y L + A D+G P   S   V I L+D+NDNSP F  P+   Y   I E    G+ +T V A+D D   NG V Y +   ++  F I   SG+V     LDR E    +L + A D G
Sbjct:  154 GVDHTTYRIISGNDQRKFRLDITVNPSGEGAFLHLVSTGGLDRETTPFYQLLIQVEDKGEPKKFGYLQVNVTIQDINDNPPSFDH-EQYQTSVFEDAAVGSSVLQIAASDLDEGANAEITYLLDEGTP------FQIDPKAGTVVIKEGLDYETK-REYSLTIHAVDNGVPSLYTRTEATVKLLDVNDNDPVVKFRYFPTTSKFASVDENAQVGTVVALLTVSDSDSSTANGNISVSILGGNEQRHFDVHSSPVPNLS------LIKVASVLDRERISSYNLTVSVSDNGKPLARSSFASLVIFVNDINDHPPIFQEAVYRVDISEDIPKGSYIKGVSATDGDSGQNANLRYSLVSGNSLGWFAISENSGLVTSAAELNRETASEIVLNISAKDQGLQPKI-SYTKLIVNITDVNDQVPTFTQNTYHVSITEHSPAGSELVVLSATDSDLGPNGTIRFSFDSETPVSDQNKFRLDSTSGRLSTS-TELDREEESSYLLYIRATDSGAPPLHSVCKVNITLKDVNDNSPVF-YPMQ--YFANIKENEPSGSSVTTVTASDPDLGRNGTVKYAITAGDSSKFHISSTSGKVTTLVALDREEKTAYQLQVTATDGG 747          

HSP 2 Score: 196.438 bits (498), Expect = 2.755e-50
Identity = 188/619 (30.37%), Postives = 295/619 (47.66%), Query Frame = 2
Query:  395 DSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDET---LITVLINSNSDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYR------VTVQCKDQGLP-PLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGY--SGWVGKVEAYXXXXXXXXXIIFSFTGF-LHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLA----NNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPS 2200
            D D   N  I+YS++   KG F + +      +   +++        Y+L  +A+D G+P++T  + + I + D+ND+AP FD    Y + + E     S+   ++ TDKD      ++  +I+ N+    +  F +     L + + LD E   R +++ V+A D  + +L+ S  +++ + DINDN P       + ++  F   E + + + V  V   D D   N  V  +   P  + NFEL         N+       TL + DRE++   R       TV   DQGLP PL  Q  + ++I+D NDNPP F+K  +Q  I E+    + +  + A+D D  KN  + Y I E  +      + ++G VT +   D E   S + K  A D  +  L+S+  +++ + D+ND  P F  S     + E       V  V A D+DS SN+DI +S +    H    I  + G+IF  K  +LD E QS Y+L V AKD+G PSRSSS+ V I + D NDN P F+ P D    K I E L   T +  + A D D + NG + Y +A       +F ID  SG ++ N+ +DR       L I A D   P+
Sbjct:  895 DPDEATNGMIVYSLKQNPKGLFHIHEKHGLISLTGPLEV----TTSSYQLEVVASDLGVPQRTSSLFLTISVYDVNDNAPVFDQ-LSYEVTILESEPVNSRFFRVEATDKDSGVNGEIVYDIISGNT----RDVFGIFPDGQLYIKADLDREVQDR-YSLLVVAKDRAVESLSASVNVSILLDDINDNRP-----LFNSTNYVFHFEEEQERGALVGRVFAEDKDFGPNSEVRYSFETP--QSNFEL---------NAITGVLTSTL-QLDRESLMRQRGAAVFSFTVLSSDQGLPKPLKDQAKVQVYIQDINDNPPKFTKDIYQASIAESAQNMTQLLRVSASDVDENKNGLVHYDITEGNEEKQFSIDSNSGQVTLVGKLDYETTPSYSLKIIAEDSGSVPLSSTCVLSISVLDDNDNSPSFPKSTLSVDVLENMRIGELVASVTATDSDSGSNADITYSISATNNHGTFSISPNTGSIFLVK--KLDYETQSLYKLNVTAKDSGRPSRSSSIPVIIHVRDFNDNPPVFT-PGD--IFKSIPENLPISTSVMSITAHDTDADINGLLEYSIALQTPRGGHFRIDSVSGVIYTNKDIDREFSNLFELTIKATDQAVPA 1481          

HSP 3 Score: 192.2 bits (487), Expect = 6.450e-49
Identity = 186/634 (29.34%), Postives = 301/634 (47.48%), Query Frame = 2
Query:  380 KLSPRDSDYGINSEIIYS-IEGKDKGFFKLLQMKNNKPIFKTMKLF-----DREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEV-----KRHFQVSAISG-LTLISRLDYESSMRK-----FTIPVIAVDNGIPN-LTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGY--SGWVGKVEAYXXXXXXXXXIIFSFT--GFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPS---RSSSVIVQIQLEDINDNSPKF-SQPLDSGYMKKITET-LVPGTLITKVMATDDDENENGKVTYLL--ANNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGT 2194
            ++   D D G+N EI+Y  I G  +  F          IF   +L+     DRE +DRY L+ +A D+ +   +  + + I + D+ND+ P F+   +YV   +E+   G+ +  +   DKD           NS+        + +F+++AI+G LT   +LD ES MR+     F+  V++ D G+P  L     + V + DINDN P+   D    S     + E+    + +  V+ +D D   NG+V  ++ E N ++ F + S       NS    ++  + + D ET   Y + +  +D G  PLSS   ++I + D+NDN PSF K      + EN+  G  + ++ ATD D G NA I Y I     +     +P+TG +  +   D E  +       A D   P  +SS+ V + + D ND  P+F        I E    S  V  + A+D D++ N  + +S         H  I    G I++ K I  DRE  + ++LT++A D  VP+   R +   V I + D NDN P F SQ         + E+ +V G+++T V+A D DE  NG+V Y L   ++  FI+D  SG++ +   L   +L+   L++ A D+GT
Sbjct:  993 RVEATDKDSGVNGEIVYDIISGNTRDVFG---------IFPDGQLYIKADLDREVQDRYSLLVVAKDRAVESLSASVNVSILLDDINDNRPLFNS-TNYVFHFEEEQERGALVGRVFAEDKD--------FGPNSEVRYSFETPQSNFELNAITGVLTSTLQLDRESLMRQRGAAVFSFTVLSSDQGLPKPLKDQAKVQVYIQDINDNPPKFTKDIYQAS-----IAESAQNMTQLLRVSASDVDENKNGLVHYDITEGNEEKQFSIDS-------NSG---QVTLVGKLDYETTPSYSLKIIAEDSGSVPLSSTCVLSISVLDDNDNSPSFPKSTLSVDVLENMRIGELVASVTATDSDSGSNADITYSISATNNHGTFSISPNTGSIFLVKKLDYETQSLYKLNVTAKDSGRPSRSSSIPVIIHVRDFNDNPPVFTPGDIFKSIPENLPISTSVMSITAHDTDADINGLLEYSIALQTPRGGHFRIDSVSGVIYTNKDI--DREFSNLFELTIKATDQAVPAEFRRFALKNVTIWVTDQNDNIPTFISQ------NALVAESNIVIGSILTTVLAFDPDEGANGEVEYELVRGDSDTFIMDRYSGDIRLASQLIPSKLI-YSLMVSATDHGT 1584          

HSP 4 Score: 177.178 bits (448), Expect = 3.091e-44
Identity = 170/591 (28.76%), Postives = 269/591 (45.52%), Query Frame = 2
Query:  482 NKPIFKTMKLFDREERDRYELVFIATDKGIP-KKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKD---DETLITVLINSNSDPEVKRHFQVSAISGL-TLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIE--PNNKQN-FELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQ---------LDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANN--KYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTP 2197
            N  + K   + DRE    Y L    +D G P  ++    + I + D+NDH P F     Y + + ED  +GS I  +  TD D   +  L   L++ NS       F +S  SGL T  + L+ E++  +  + + A D G+    + T + VN+ D+ND  P     T + ++ +  + E+ P  S + +++ TD+D   NG +  +     P + QN F L S           + R+ T  E DRE  S Y + ++  D G PPL S   + I ++D NDN P F    +   IKEN   GS + T+ A+DPD+G+N  + Y I     +   I + ++G VT LV+ DRE  T+   +  A D      ++   VT+ + D  D   +F    Y F + E     VG +             + + T  LH ++  L + G+  S  GI+         +DRE Q+ YQL V A+   V   +   +V I ++D+NDN+P F   ++        E    G  I +  A+D DE  NG + Y L  N    F I EK G + +   L+ +     +L ++A D G P
Sbjct:  401 NLSLIKVASVLDRERISSYNLTVSVSDNGKPLARSSFASLVIFVNDINDHPPIFQEAV-YRVDISEDIPKGSYIKGVSATDGDSGQNANLRYSLVSGNS----LGWFAISENSGLVTSAAELNRETA-SEIVLNISAKDQGLQPKISYTKLIVNITDVNDQVP-----TFTQNTYHVSITEHSPAGSELVVLSATDSDLGPNGTIRFSFDSETPVSDQNKFRLDST----------SGRLSTSTELDREEESSYLLYIRATDSGAPPLHSVCKVNITLKDVNDNSPVFYPMQYFANIKENEPSGSSVTTVTASDPDLGRNGTVKYAITAGDSSKFHI-SSTSGKVTTLVALDREEKTAYQLQVTATDGGGLRSHTPAIVTVTVVDTQDNPLVFGQKDYSFVMFENVP--VGTI----------IGTVSATTVDLHTNITYLIASGDQRSLFGIKAGQITALGLIDREEQAFYQLRVIARAGEV---TGETLVNITVKDLNDNAPNFMHSVE---HVSAVENWATGHHIFQAKASDPDEATNGMIVYSLKQNPKGLFHIHEKHGLISLTGPLE-VTTSSYQLEVVASDLGVP 950          

HSP 5 Score: 162.54 bits (410), Expect = 1.126e-39
Identity = 177/601 (29.45%), Postives = 275/601 (45.76%), Query Frame = 2
Query:  377 IKLSPRDSDYGINSEII----YSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKK-TGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDET---LITVLINSNSDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPE-KYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKE----GYSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLL-ANNKYFIIDEKSGEVFINRTL 2137
            + +S  D D+G +S ++    YS+ G D  F     +  +  +  T  L DRE R  Y+L+ +A+D G P   +    + + + D+ND+ P F     YV  +      GS +  + VTD+D  +   L   L   NS+      F++  I G    S     SS   FT+ V   D G    T STT+TV  +   D FP I    L D +  F   EN+P  + V  VT     S   G +   +   N    F +           + +  +   +  D E I  Y + ++ +DQG PP S+ + + I + D NDN P F +  F   I EN+ P   +  + A D D G N ++ Y I +   +N  +I N +TG +      DRE     + +  A D   P  +++V+V + + D ND  P F S  +   + E    G++  V +V   D D+ +N+   +S T      + I  S G+I   +   L+RE    Y   V A D+G    + S  V I + DINDN+P+FS+P    Y     E    G+++T+V ATD DE  NGK+ Y + +  +YF I+  SGE+FI + L
Sbjct: 1925 LTVSAADRDHGNSSTLLNSVHYSLSGGDGQF----SINPSTGLIITSSLLDRETRASYQLLVVASDGGQPTPLSSSATVSVVVADINDNPPRFHH-HPYVTHIPASTSTGSLVFAVTVTDEDSGSNSQLHYSLTGRNSE-----KFKIDPIRGAITASEKLTGSSEVTFTVHV--KDGGTNPKTDSTTVTVRFVTGGD-FPHI---KLKDKA--FTFPENQPTNTIVTKVT---GSSPRAGPLSYYIASGNLDNAFHI----------DQLSGELSIRKPLDYENIEKYVLWIEARDQGFPPYSAYEKVEIAVLDVNDNHPVFEQEPFHAEILENLSP-QRVLVVSALDQDSGPNGQLEYAIIDGNKENSFNI-NRATGEIRTTRPLDREKVAQYSLRVKATDRGMPPKSTAVKVLISVLDVNDNAPRF-SKIFSATVPENAPVGFT--VTRVTTTDEDAGANAISRYSITDASLPFI-IHPSTGDITISR--PLNREDTDHYIAKVSAHDSG---WTVSTDVTIFVTDINDNAPRFSKP---SYYLDYPELTEIGSIVTQVSATDPDEGFNGKIFYFIRSQTEYFRINSSSGEIFIKQQL 2480          

HSP 6 Score: 156.762 bits (395), Expect = 6.248e-38
Identity = 168/632 (26.58%), Postives = 288/632 (45.57%), Query Frame = 2
Query:  380 KLSPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERD-----RYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQI----VIDTLSDS---SSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTL-REFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNT--SITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGY--SGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLW-ILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRS--SSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENEN-GKVTYLLANNK---YFIIDEKSGEVFINRTLDRLELVP-RRLLIMAKDNGTPS 2200
            ++S  D D G N +I Y I  + + +F++        I + ++  +    +     R+  +  A+D+GI     E  + I + D ND+ P F+ P  Y   V +    G+++  +   DK D  L + +  + S       F++   +G   ++      + + + + + A D G P L+  TT+ + V + N + P+     V  T+S++    +  + +  + K          D D +MNG++  N+   N+   F + S+             +++L +  D ET   + + V   D G    +S  T+ I + D NDNPP F    +   ++EN+  G+ +  + ATD D G NA + Y I     ++  I +P+TGI+T     D E      +T KAF + +      S   V ++++  N+ +P F+S  Y+F+I E       VG+V A D D   +  + +   G      + I K  G I+      LDRE +    L V AK+ G    +    V+V I + D ND  P F+Q L   Y  ++ E L PG L+T V A D D   +  + TY +A N     F I+ ++G+V +   LDR E VP   L I+A D+G+P+
Sbjct: 2440 QVSATDPDEGFNGKIFYFIRSQTE-YFRINSSSGEIFIKQQLRYQNSSGHNNINVNRHSFIVTASDRGIKPLMSETTVMINVVDSNDNPPTFESPS-YFTPVTKSVKVGTRLLKVTAYDKKDFGLNSEIEYAISGGNSSNKFRLDKQTGSVTVASSLAADTNKVYLLEITASDKGNPPLSDRTTVKIAVTEENHHTPEFSQNQVTVTVSEALTVGTAIRTLSARDK----------DKDKQMNGLITYNISSGNDDGLFSVHSQT-----------GVLSLAKTLDYETKQKHELRVSATDGGWIAKTSYVTVNIQVTDVNDNPPVFDPVEYFPVVQENVPSGTTVVKMNATDKDSGSNALMAYVIQSSDSDLFII-DPNTGIITTQGFLDYEAKQVYHLTVKAFNVPDEERC--SFAYVNIQLKGANEYVPRFVSKQYYFEISEAAPKGTVVGEVFASDRDLGEDGVVYYLIFGRSRKRGFSINKKTGQIYVSG--SLDREKEEKISLKVLAKNAGSIRGADIDEVLVNITVLDAND-PPVFTQEL---YDVQVNEGLSPGGLVTFVSAEDSDSVPSWSRFTYAIAANHERNTFTINPQTGQVSVASELDR-ETVPVYNLTILAVDSGSPA 3038          

HSP 7 Score: 153.295 bits (386), Expect = 6.726e-37
Identity = 168/618 (27.18%), Postives = 272/618 (44.01%), Query Frame = 2
Query:  383 LSPRDSDYGINSEIIYS-IEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEV--KRHFQVSAISG-LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYS--GWVGKVEAYXXXXXXXXXIIFSF----TGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTY--LLANNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPS 2200
            +S  D D G N+ + YS + G   G+F + +   N  +  +    +RE      L   A D+G+  K    K+ + I D+ND  P F     Y + + E +  GS++  +  TD D     T+  + +S+  V  +  F++ + SG L+  + LD E     + + + A D+G P L +   + + + D+NDN P   +       +N K  EN+P  S V  VT +D D   NG V            + + +   + F  S  + ++ TL   DRE  + Y++ V   D G     +   +T+ + D  DNP  F +  +   + EN+  G+ I T+ AT  D+  N  I Y I    Q   S+     G +T L   DRE       +  A       +     V + ++D ND  P F+ S  H    E ++    + + +A D D  +N  I++S      G  H H    +  G I     +++     S+YQL V A D GVP R+SS+ + I + D+NDN+P F Q     Y   I E+    +   +V ATD D   NG++ Y  +  N +        G+++I   LDR       LL++AKD    S
Sbjct:  476 VSATDGDSGQNANLRYSLVSGNSLGWFAISE---NSGLVTSAAELNRETASEIVLNISAKDQGLQPKISYTKLIVNITDVNDQVPTFTQ-NTYHVSITEHSPAGSELVVLSATDSDLGPNGTIRFSFDSETPVSDQNKFRLDSTSGRLSTSTELDREEE-SSYLLYIRATDSGAPPLHSVCKVNITLKDVNDNSP---VFYPMQYFANIK--ENEPSGSSVTTVTASDPDLGRNGTV-----------KYAITAGDSSKFHISSTSGKVTTLVALDREEKTAYQLQVTATDGGGLRSHTPAIVTVTVVDTQDNPLVFGQKDYSFVMFENVPVGTIIGTVSATTVDLHTN--ITYLIASGDQR--SLFGIKAGQITALGLIDREEQAFYQLRVIARAG---EVTGETLVNITVKDLNDNAPNFMHSVEHVSAVENWATGHHIFQAKASDPDEATNGMIVYSLKQNPKGLFHIH----EKHGLISLTGPLEV---TTSSYQLEVVASDLGVPQRTSSLFLTISVYDVNDNAPVFDQ---LSYEVTILESEPVNSRFFRVEATDKDSGVNGEIVYDIISGNTRDVFGIFPDGQLYIKADLDREVQDRYSLLVVAKDRAVES 1055          

HSP 8 Score: 142.895 bits (359), Expect = 1.090e-33
Identity = 168/604 (27.81%), Postives = 264/604 (43.71%), Query Frame = 2
Query:  407 GINSEIIYSI-EGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISGLTLISR-LDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLP-PLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLS-SAYHFKIKEGYSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTY-LLANNK--YFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTP 2197
            G N+ + Y+I  G D  F    ++          +  DRE R +Y L+  A D    +++ +I + I + D+NDH P F     Y   + ED   GS +  I  +D D      +  +   D E    F ++ I+G+  ++R LD+E +   F + V A D G    ++S  +  N+LD+ND+ P       + S     ++E+    + V  V+  D D   +  +        N  ++ L S     F  +     I+T    DRET + Y++ V   D G P PLSS  T+++ + D NDNPP F    +   I  +   GS +F +  TD D G N+++ Y +  +      I +P  G +T   S     ++ +TF     D        S  VT+      D   + L   A+ F   +  +  V KV      +   S  I S  G L N   I +  G +   K   LD E    Y L +EA+D G P  S+   V+I + D+NDN P F Q     +  +I E L P  ++  V A D D   NG++ Y ++  NK   F I+  +GE+   R LDR ++    L + A D G P
Sbjct: 1731 GANALVTYAIISGADDSF----RIDPESGELSATRRLDRERRSKYSLLVRADDG---QQSSDIWVNITVSDINDHTPTFSR-SVYSFDIPEDMSPGSIVAAILASDGDSGVNGEITYSVEEDDE-DSTFLLNPITGVFNVTRALDFE-TQPFFILTVRAADGG--GRSSSVRVYFNLLDVNDHPP-----LFNSSVYTTSILESLSAGASVLTVSAADRDHGNSSTL-------LNSVHYSL-SGGDGQFSINPSTGLIITSSLLDRETRASYQLLVVASDGGQPTPLSSSATVSVVVADINDNPPRFHHHPYVTHIPASTSTGSLVFAVTVTDEDSGSNSQLHYSLTGRNSEKFKI-DPIRGAIT--ASEKLTGSSEVTFTVHVKDGGTNPKTDSTTVTVRFVTGGDFPHIKLKDKAFTFPENQPTNTIVTKVTGSSPRAGPLSYYIAS--GNLDNAFHIDQLSGELSIRK--PLDYENIEKYVLWIEARDQGFPPYSAYEKVEIAVLDVNDNHPVFEQ---EPFHAEILENLSPQRVLV-VSALDQDSGPNGQLEYAIIDGNKENSFNINRATGEIRTTRPLDREKVAQYSLRVKATDRGMP 2298          

HSP 9 Score: 140.584 bits (353), Expect = 6.215e-33
Identity = 175/627 (27.91%), Postives = 284/627 (45.30%), Query Frame = 2
Query:  401 DYGINSEIIYSIEGKDKG-FFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDE----TLITVLINSNSDPEVKRHFQVSAISG-LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLM-ENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREF-DRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSF--SKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVE---VTLEIEDENDCIPMFLSSAYHFKIKEGYS--GWVGKVEAYXXXXXXXXXIIFSFTGFLH--------NHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENEN-GKVTYLL----ANNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTP 2197
            D+G+NSEI Y+I G +    F+L +   +  +  ++     +    Y L   A+DKG P  +    + I + + N H PEF       + V E    G+ I  +   DKD +     LIT  I+S +D  +   F V + +G L+L   LDYE+  +K  + V A D G    T+  T+ + V D+NDN P      + D    F ++ EN P  + V  +  TD DS  N ++   +I+ ++   F +             N  I+T + F D E    Y +TV+  +       S   + I ++  N+  P F   +++F+  I E    G+ +  + A+D D+G++  + Y I  + +      N  TG +    S DRE    I+ K  A +    +  + ++   V + + D ND  P+F    Y  ++ EG S  G V  V A D+DS      + S++ F +        N   I    G +      +LDRE    Y LT+ A D+G P+ + S I+ + LEDINDN P     L + Y  ++ E    GT +  + + D D   N G  TY L    A + YF I   +GE+  +R +DR ++    L ++ KD+G P
Sbjct: 2559 DFGLNSEIEYAISGGNSSNKFRLDKQTGSVTVASSLAA---DTNKVYLLEITASDKGNPPLSDRTTVKIAVTEENHHTPEFSQ-NQVTVTVSEALTVGTAIRTLSARDKDKDKQMNGLITYNISSGNDDGL---FSVHSQTGVLSLAKTLDYETK-QKHELRVSATDGGWIAKTSYVTVNIQVTDVNDNPP------VFDPVEYFPVVQENVPSGTTVVKMNATDKDSGSNALM-AYVIQSSDSDLFII-----------DPNTGIITTQGFLDYEAKQVYHLTVKAFNVPDEERCSFAYVNIQLKGANEYVPRFVSKQYYFE--ISEAAPKGTVVGEVFASDRDLGEDGVVYYLIFGRSRKRGFSINKKTGQIYVSGSLDREKEEKISLKVLAKNA-GSIRGADIDEVLVNITVLDAND-PPVFTQELYDVQVNEGLSPGGLVTFVSAEDSDS------VPSWSRFTYAIAANHERNTFTINPQTGQV--SVASELDRETVPVYNLTILAVDSGSPAATGSAILIVTLEDINDNGPT----LVTTY-GEVMENQRAGTPVMTLSSRDPDLAPNQGPFTYSLVSTGAASSYFTI-SPTGELTTSREVDREQISDFYLSVLIKDSGIP 3141          

HSP 10 Score: 139.043 bits (349), Expect = 1.693e-32
Identity = 164/615 (26.67%), Postives = 260/615 (42.28%), Query Frame = 2
Query:  395 DSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISG-LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMEN-KPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKE--GYSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQST------YQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATD-DDENENGKVTYLLANNKY---FIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTP 2197
            D D G NS++ YS+ G++   FK+  ++    I  + KL    E           D G   KT    + ++     D  P   + KD      E+    + +  +  +      L   + + N D      F +  +SG L++   LDYE+ + K+ + + A D G P  +    + + VLD+NDN P            + +++EN  P+   V +V+  D DS  NG ++  +I+ N + +F +          ++    I T R  DRE ++ Y + V+  D+G+PP S+   + I + D NDN P FSK  F   + EN   G  +  +  TD D G NA   Y I +   ++  I +PSTG +T     +RE       K  A D        S +VT+ + D ND  P F   +Y+    E       V +V A D D   N   IF F      +  I  S G IF ++ ++              +   V A D G+    S   V I + D NDN P F  P    Y   +T+++  GT + KV A D  D   N ++ Y ++       F +D+++G V +  +L         L I A D G P
Sbjct: 2039 DEDSGSNSQLHYSLTGRNSEKFKIDPIRG--AITASEKLTGSSE---VTFTVHVKDGGTNPKTDSTTVTVRFVTGGDF-PHIKL-KDKAFTFPENQPTNTIVTKVTGSSPRAGPLSYYIASGNLD----NAFHIDQLSGELSIRKPLDYEN-IEKYVLWIEARDQGFPPYSAYEKVEIAVLDVNDNHP-----VFEQEPFHAEILENLSPQR--VLVVSALDQDSGPNGQLEYAIIDGNKENSFNI----------NRATGEIRTTRPLDREKVAQYSLRVKATDRGMPPKSTAVKVLISVLDVNDNAPRFSK-IFSATVPENAPVGFTVTRVTTTDEDAGANAISRYSITDA--SLPFIIHPSTGDITISRPLNREDTDHYIAKVSAHDSG---WTVSTDVTIFVTDINDNAPRFSKPSYYLDYPELTEIGSIVTQVSATDPDEGFNGK-IFYFIRSQTEYFRINSSSGEIFIKQQLRYQNSSGHNNINVNRHSFIVTASDRGIKPLMSETTVMINVVDSNDNPPTFESP---SYFTPVTKSVKVGTRLLKVTAYDKKDFGLNSEIEYAISGGNSSNKFRLDKQTGSVTVASSLAADTNKVYLLEITASDKGNP 2614          

HSP 11 Score: 132.88 bits (333), Expect = 1.129e-30
Identity = 144/493 (29.21%), Postives = 218/493 (44.22%), Query Frame = 2
Query:  773 EVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGI--VDCNLIEPNNKQNFELISRYFNNFPNSKRNY-RIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPM-----FLSSAYHFKIKEGYSGWVGKVEAYXXXXXXXXXI------IFSFTGFLHNHLWILKSDGNIFSEKGIQ--LDREVQSTYQLTVEAKDNGVP-SRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANN---KYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNG 2191
            E  + F ++A +G+   S +     +    I V+ + +     T  T + + VLDINDN P        D+S      E+      V + T TDAD   NG+      +I  N+++ F L        P+ +  +  +V+    DRET   Y++ +Q +D+G P       + + I+D NDNPPSF    +Q  + E+   GS +  + A+D D G NA+I Y + E     I   +P  G V      D E     +    A+D   P L +  E T+++ D ND  P+     F +++    + E  +  VG V A    S+S+S        +    G    H  +  S     S   +   LDRE  S+Y LTV   DNG P +RSS   + I + DIND+ P F + +   Y   I+E +  G+ I  V ATD D  +N  + Y L +     +F I E SG V     L+R       L I AKD G
Sbjct:   62 EQHKLFSINATTGVIYTSSVIDREVLPGNIINVVVLSS---QPTYPTEVRIVVLDINDNAP-----VFPDASIVVSFKEDASSGRQVILDTATDADIGSNGVDHTTYRIISGNDQRKFRLD---ITVNPSGEGAFLHLVSTGGLDRETTPFYQLLIQVEDKGEPKKFGYLQVNVTIQDINDNPPSFDHEQYQTSVFEDAAVGSSVLQIAASDLDEGANAEITYLLDEGTPFQI---DPKAGTVVIKEGLDYETKREYSLTIHAVDNGVPSLYTRTEATVKLLDVNDNDPVVKFRYFPTTSKFASVDE--NAQVGTVVALLTVSDSDSSTANGNISVSILGGNEQRHFDVHSSPVPNLSLIKVASVLDRERISSYNLTVSVSDNGKPLARSSFASLVIFVNDINDHPPIFQEAV---YRVDISEDIPKGSYIKGVSATDGDSGQNANLRYSLVSGNSLGWFAISENSGLVTSAAELNRETASEIVLNISAKDQG 535          

HSP 12 Score: 121.324 bits (303), Expect = 4.452e-27
Identity = 155/623 (24.88%), Postives = 269/623 (43.18%), Query Frame = 2
Query:  371 LSIKLSPRDSDYGINSEIIYSIEG-KDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKR--HFQVSAISGLTLISR-LDYESSMRKFTIPVIAVDNGIP---NLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQI-----PEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLA---NNKYFIIDEKSGEVFINRTLDRLELVPRRLL-IMAKDNG 2191
            L   ++  DSD G N++I YSI    + G F +    N   IF   KL D E +  Y+L   A D G P ++  I + I +RD ND+ P F  P D    + E+    + +  I   D D +  I  L+  +   +  R  HF++ ++SG+   ++ +D E S   F + + A D  +P          +T+ V D NDN P  +      + SN  +       S +  V   D D   NG V+  L+   +   F ++ RY  +    +   +++  +         Y + V   D G    SS+  +TI ++  +   P FS+  +   +KE    G+ + +L A+ P  G   K+ Y I       K    +      +G++      DRE  + +    + LD +      ++E   +          FL   + FK+     G + +  +      +N+ + ++      +   I    G + + +  +LDRE +S Y L V A D     +SS + V I + DIND++P FS+   S Y   I E + PG+++  ++A+D D   NG++TY +     +  F+++  +G   + R LD  E  P  +L + A D G
Sbjct: 1309 LVASVTATDSDSGSNADITYSISATNNHGTFSI--SPNTGSIFLVKKL-DYETQSLYKLNVTAKDSGRPSRSSSIPVIIHVRDFNDNPPVF-TPGDIFKSIPENLPISTSVMSITAHDTDAD--INGLLEYSIALQTPRGGHFRIDSVSGVIYTNKDIDREFS-NLFELTIKATDQAVPAEFRRFALKNVTIWVTDQNDNIPTFISQNALVAESNIVI------GSILTTVLAFDPDEGANGEVEYELVR-GDSDTF-IMDRYSGDI---RLASQLIPSKLI-------YSLMVSATDHGTDRKSSRTELTIILQGTDG--PVFSQPKYITILKEGQPAGTNVISLDASSPR-GAGTKVEYFIVSVRSGGKAAGRLFTIGRHSGVIQTAAELDREQGSDL----YLLDVY------AIETDAKQPRTQHAEVSFLFD-FFFKVMLLLKGNLREHISQTCAEGANALVTYAIISGADDSFRIDPESGELSATR--RLDRERRSKYSLLVRADDG---QQSSDIWVNITVSDINDHTPTFSR---SVYSFDIPEDMSPGSIVAAILASDGDSGVNGEITYSVEEDDEDSTFLLNPITGVFNVTRALD-FETQPFFILTVRAADGG 1883          

HSP 13 Score: 120.939 bits (302), Expect = 4.887e-27
Identity = 161/611 (26.35%), Postives = 259/611 (42.39%), Query Frame = 2
Query:  395 DSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSN-SDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPN-LTTSTTITVNVLDINDNFPQI----VIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDR---IKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGW-VGKVEAYXXXXXXXXXIIFSFT-GFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNKY-FIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNG 2191
            D D G+N EI YS+E  D+    LL       +F   +  D E +  + L   A D G   ++  +++Y  + D+NDH P F+    Y   + E    G+ +  +   D+D     T+L + + S       F ++  +GL + S L    +   + + V+A D G P  L++S T++V V DINDN P+      +  +  S+S           S V  VTVTD DS             N++ ++ L  R    F        I    +      S    TV  KD G  P +   T+T+      D    F     +D+     EN    + +  +  + P  G  +   Y       N   I   S G ++     D E          A D+  P  ++  +V + + D ND  P+F    +H +I E  S   V  V A D DS  N  + ++   G   N   I ++ G I + +   LDRE  + Y L V+A D G+P +S++V V I + D+NDN+P+FS+     +   + E    G  +T+V  TD+D   N    Y + +    FII   +G++ I+R L+R +       + A D+G
Sbjct: 1828 DGDSGVNGEITYSVEEDDEDSTFLLNPITG--VFNVTRALDFETQPFFILTVRAADGG--GRSSSVRVYFNLLDVNDHPPLFNS-SVYTTSILESLSAGASVLTVSAADRDHGNSSTLLNSVHYSLSGGDGQFSINPSTGLIITSSLLDRETRASYQLLVVASDGGQPTPLSSSATVSVVVADINDNPPRFHHHPYVTHIPASTST---------GSLVFAVTVTDEDSGS-----------NSQLHYSLTGRNSEKFKIDPIRGAITASEKLTGS--SEVTFTVHVKDGGTNPKTDSTTVTVRFVTGGD----FPHIKLKDKAFTFPENQPTNTIVTKVTGSSPRAGPLS--YYIASGNLDNAFHIDQLS-GELSIRKPLDYENIEKYVLWIEARDQGFPPYSAYEKVEIAVLDVNDNHPVFEQEPFHAEILENLSPQRVLVVSALDQDSGPNGQLEYAIIDGNKENSFNINRATGEIRTTR--PLDREKVAQYSLRVKATDRGMPPKSTAVKVLISVLDVNDNAPRFSKI----FSATVPENAPVGFTVTRVTTTDEDAGANAISRYSITDASLPFIIHPSTGDITISRPLNREDTDHYIAKVSAHDSG 2398          

HSP 14 Score: 115.931 bits (289), Expect = 1.992e-25
Identity = 134/528 (25.38%), Postives = 239/528 (45.27%), Query Frame = 2
Query:  392 RDSDYGINSEIIYSIE-GKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDET--LITVLINSNSDPEVKRHFQVSAISGL-TLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVL--DINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSS--QQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPD-IGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGWVGKVEAYXXXXXXXXXIIFSF----TGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDN 1936
            +D D  +N  I Y+I  G D G F +    +   +    K  D E + ++EL   ATD G   KT  + + I++ D+ND+ P FD P +Y   V+E+   G+ +  +  TDKD  +  L+  +I S SD ++   F +   +G+ T    LDYE+  + + + V A +  +P+    +   VN+     N+  P+ V          F++ E  PK + V  V  +D D   +G+V   +   + K+ F +          +K+  +I      DRE      + V  K+ G    +   +  + I + D ND PP F++  +  ++ E + PG  +  + A D D +   ++  Y I   ++      NP TG V+     DRE          A+D  +P    S  + + +ED ND  P  +++ Y   ++   +G      +  +   + +   F++    TG   ++  I  + G + + +  ++DRE  S + L+V  KD+G+P  SS+  V I++ D NDN
Sbjct: 2663 KDKDKQMNGLITYNISSGNDDGLFSV---HSQTGVLSLAKTLDYETKQKHELRVSATDGGWIAKTSYVTVNIQVTDVNDNPPVFD-PVEYFPVVQENVPSGTTVVKMNATDKDSGSNALMAYVIQS-SDSDL---FIIDPNTGIITTQGFLDYEAK-QVYHLTVKAFN--VPDEERCSFAYVNIQLKGANEYVPRFV-----SKQYYFEISEAAPKGTVVGEVFASDRDLGEDGVVYYLIFGRSRKRGFSI----------NKKTGQIYVSGSLDREKEEKISLKVLAKNAGSIRGADIDEVLVNITVLDAND-PPVFTQELYDVQVNEGLSPGGLVTFVSAEDSDSVPSWSRFTYAIAANHERNTFTINPQTGQVSVASELDRETVPVYNLTILAVDSGSPAATGSAILIVTLEDINDNGPTLVTT-YGEVMENQRAGTPVMTLSSRDPDLAPNQGPFTYSLVSTGAASSYFTISPT-GELTTSR--EVDREQISDFYLSVLIKDSGIPQMSSTGTVHIKVNDQNDN 3159          

HSP 15 Score: 112.464 bits (280), Expect = 2.166e-24
Identity = 158/615 (25.69%), Postives = 248/615 (40.33%), Query Frame = 2
Query:  461 KLLQMKNNKPIFKTMKLFDRE--ERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKD------DETLITVLINSNSDPEVKRHFQVSAI---SG----LTLISRLDYESSMRKFTIPVIAV-DNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQD-----RIKENIMPGSPIFTLIATDPDIG-KNAKIIYQI----PEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSS-VEVTLEIEDENDCIPMFLSSAYHFKIKEGY--SGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHL-WILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYL------LANNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTP 2197
            KL  +     +  T  + DRE    +   +V +++    P +     + I + D+ND+AP F      V+  KEDA  G ++     TD D      D T  T  I S +D   +R F++      SG    L L+S    +     F   +I V D G P       + V + DINDN P    +    S     + E+    S V  +  +D D   N  +   L E                F    +   +V     D ET   Y +T+   D G+P L ++   T+ + D NDN P     +F        + EN   G+ +  L  +D D    N  I   I     +++ ++ S P P+  ++      DRE  +S        D   PL  SS   + + + D ND  P+F  + Y   I E      ++  V A D DS  N+++ +S      N L W   S+ +       +L+RE  S   L + AKD G+  + S   + + + D+ND  P F+Q   + Y   ITE    G+ +  + ATD D   NG + +       +++   F +D  SG +  +  LDR E     L I A D+G P
Sbjct:   65 KLFSINATTGVIYTSSVIDREVLPGNIINVVVLSSQPTYPTE-----VRIVVLDINDNAPVFP-DASIVVSFKEDASSGRQVILDTATDADIGSNGVDHT--TYRIISGND---QRKFRLDITVNPSGEGAFLHLVSTGGLDRETTPFYQLLIQVEDKGEPKKFGYLQVNVTIQDINDNPPSFDHEQYQTS-----VFEDAAVGSSVLQIAASDLDEGANAEITYLLDEG-------------TPFQIDPKAGTVVIKEGLDYETKREYSLTIHAVDNGVPSLYTRTEATVKLLDVNDNDPVVKFRYFPTTSKFASVDENAQVGTVVALLTVSDSDSSTANGNISVSILGGNEQRHFDVHSSPVPNLSLIKVASVLDRERISSYNLTVSVSDNGKPLARSSFASLVIFVNDINDHPPIFQEAVYRVDISEDIPKGSYIKGVSATDGDSGQNANLRYSLVS--GNSLGWFAISENSGLVTSAAELNRETASEIVLNISAKDQGLQPKISYTKLIVNITDVNDQVPTFTQ---NTYHVSITEHSPAGSELVVLSATDSDLGPNGTIRFSFDSETPVSDQNKFRLDSTSGRLSTSTELDREEESSYLLYIRATDSGAP 645          

HSP 16 Score: 100.908 bits (250), Expect = 8.033e-21
Identity = 98/364 (26.92%), Postives = 177/364 (48.63%), Query Frame = 2
Query:  377 IKLSPRDSDYGINSEIIYSI-EGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYV-IGVKEDAIEGSKICDIKVTDKDDETL--ITVLINSNSDPEVKRHFQVSAISG-LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPP---LSSQQTITIWIEDENDNPPSFSKFFFQDRI--KENIMPGSPIFTLIATDPDIGKNAKIIYQI 1438
            +++S  D D   N  + Y I EG ++   K   + +N      +   D E    Y L  IA D G    +    + I + D ND++P F  PK  + + V E+   G  +  +  TD D  +   IT  I++ ++      F +S  +G + L+ +LDYE+    + + V A D+G P+ ++S  + ++V D NDN P      +  S     + EN P  + V  +T  D D+++NG+++ ++          L +    +F     +  I T ++ DRE  + + +T++  DQ +P      + + +TIW+ D+NDN P+   F  Q+ +  + NI+ GS + T++A DPD G N ++ Y++
Sbjct: 1206 LRVSASDVDENKNGLVHYDITEGNEE---KQFSIDSNSGQVTLVGKLDYETTPSYSLKIIAEDSGSVPLSSTCVLSISVLDDNDNSPSF--PKSTLSVDVLENMRIGELVASVTATDSDSGSNADITYSISATNN---HGTFSISPNTGSIFLVKKLDYET-QSLYKLNVTAKDSGRPSRSSSIPVIIHVRDFNDNPPVFTPGDIFKS-----IPENLPISTSVMSITAHDTDADINGLLEYSI---------ALQTPRGGHFRIDSVSGVIYTNKDIDREFSNLFELTIKATDQAVPAEFRRFALKNVTIWVTDQNDNIPT---FISQNALVAESNIVIGSILTTVLAFDPDEGANGEVEYEL 1543          

HSP 17 Score: 100.523 bits (249), Expect = 1.053e-20
Identity = 104/425 (24.47%), Postives = 184/425 (43.29%), Query Frame = 2
Query:  377 IKLSPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKD--DETLITVLINSNSDPEVKRHFQVSAISGLTLIS-RLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPS-------TGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDEND 1621
            +K++  D D G N+ + Y I+  D   F +     N  I  T    D E +  Y L   A +    ++     + I+++  N++ P F + K Y   + E A +G+ + ++  +D+D  ++ ++  LI   S    KR F ++  +G   +S  LD E    K ++ V+A + G         + VN+  ++ N P +    L D   N    E       V  V+  D+DS  +       I  N+++N          F  + +  ++    E DRET+  Y +T+   D G P  +    + + +ED NDN P+    + +  + EN   G+P+ TL + DPD+  N     Q P  Y +++S    S       TG +T     DRE  +         D   P ++S+  V +++ D+ND
Sbjct: 2763 VKMNATDKDSGSNALMAYVIQSSDSDLFII---DPNTGIITTQGFLDYEAKQVYHLTVKAFNVPDEERCSFAYVNIQLKGANEYVPRF-VSKQYYFEISEAAPKGTVVGEVFASDRDLGEDGVVYYLIFGRSR---KRGFSINKKTGQIYVSGSLDREKE-EKISLKVLAKNAGSIRGADIDEVLVNITVLDANDPPVFTQELYDVQVN----EGLSPGGLVTFVSAEDSDSVPSWSRFTYAIAANHERN---------TFTINPQTGQVSVASELDRETVPVYNLTILAVDSGSPAATGSAILIVTLEDINDNGPTLVTTYGE--VMENQRAGTPVMTLSSRDPDLAPN-----QGPFTY-SLVSTGAASSYFTISPTGELTTSREVDREQISDFYLSVLIKDSGIPQMSSTGTVHIKVNDQND 3158          

HSP 18 Score: 95.9005 bits (237), Expect = 2.398e-19
Identity = 106/407 (26.04%), Postives = 180/407 (44.23%), Query Frame = 2
Query:  395 DSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTG--EIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDE---TLITVLINSNSDPEVKRHFQVSAISG-LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMN-GIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEV 1594
            D D G +  + Y I G+ +     +  K  + I+ +  L DRE+ ++  L  +A + G  +     E+ + I + D ND  P     + Y + V E    G  +  +   D D     +  T  I +N +   +  F ++  +G +++ S LD E+ +  + + ++AVD+G P  T S  + V + DINDN P +V       ++  ++MEN+   + V  ++  D D   N G    +L+           S YF   P  +    + T RE DRE IS + ++V  KD G+P +SS  T+ I + D+NDNP              N+ PG  +  +   DPDI    +     P     + SIP  +  +++N  S D   + S+       D  +  +NS V V
Sbjct: 2873 DRDLGEDGVVYYLIFGRSRKRGFSINKKTGQ-IYVSGSL-DREKEEKISLKVLAKNAGSIRGADIDEVLVNITVLDAND--PPVFTQELYDVQVNEGLSPGGLVTFVSAEDSDSVPSWSRFTYAIAANHE---RNTFTINPQTGQVSVASELDRET-VPVYNLTILAVDSGSPAATGSAILIVTLEDINDNGPTLV-------TTYGEVMENQRAGTPVMTLSSRDPDLAPNQGPFTYSLVSTGAA------SSYFTISPTGE----LTTSREVDREQISDFYLSVLIKDSGIPQMSSTGTVHIKVNDQNDNPSESRSVEIYVHYFGNMFPGGSLGVVKPQDPDIQDTFQCSLTPPAAL--LFSIPTGTCDLISNSRSTDGTFDLSVRSN----DGVHSAVNSHVRV 3248          

HSP 19 Score: 85.5001 bits (210), Expect = 3.476e-16
Identity = 161/627 (25.68%), Postives = 258/627 (41.15%), Query Frame = 2
Query:  377 IKLSPRDSDYGINSEIIYSI--EGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIP---KKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITV---LINSNSDPEVKRHFQVSAISG-LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDN--FPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISH-YRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYS--GWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENG----KVTYLLAN-NKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPS 2200
            + ++  D+D  IN  + YSI  +    G F++  +     +  T K  DRE  + +EL   ATD+ +P   ++     + I + D ND+ P F      V   + + + GS +  +   D D+     V   L+  +SD      F +   SG + L S+L    S   +++ V A D+G    ++ T +T+ +L   D   F Q    T+        L E +P  + V  +   DA S             + +   +   R F      + +  I T  E DRE  S  Y + V   +       +Q     ++ D          FFF+  +   ++ G+ +   I+     G NA + Y I     +   I +P +G ++     DRE  +  +    A D      +S + V + + D ND  P F  S Y F I E  S    V  + A D DS  N +I +S      +  ++L     +F+     LD E Q  + LTV A D G   RSSSV V   L D+ND+ P F+    S Y   I E+L  G  +  V A D D   +      V Y L+  +  F I+  +G +  +  LDR      +LL++A D G P+
Sbjct: 1416 MSITAHDTDADINGLLEYSIALQTPRGGHFRIDSVSG---VIYTNKDIDREFSNLFELTIKATDQAVPAEFRRFALKNVTIWVTDQNDNIPTFISQNALV--AESNIVIGSILTTVLAFDPDEGANGEVEYELVRGDSDT-----FIMDRYSGDIRLASQL--IPSKLIYSLMVSATDHGTDRKSSRTELTI-ILQGTDGPVFSQPKYITI--------LKEGQPAGTNVISL---DASSPRGAGTKVEYFIVSVRSGGKAAGRLFTI---GRHSGVIQTAAELDREQGSDLYLLDVYAIETDAKQPRTQHAEVSFLFD----------FFFKVML---LLKGN-LREHISQTCAEGANALVTYAIISGADDSFRI-DPESGELSATRRLDRERRSKYSLLVRADDGQQ---SSDIWVNITVSDINDHTPTFSRSVYSFDIPEDMSPGSIVAAILASDGDSGVNGEITYSVEEDDEDSTFLLNPITGVFNVTR-ALDFETQPFFILTVRAADGG--GRSSSVRVYFNLLDVNDHPPLFNS---SVYTTSILESLSAGASVLTVSAADRDHGNSSTLLNSVHYSLSGGDGQFSINPSTGLIITSSLLDRETRASYQLLVVASDGGQPT 1991          

HSP 20 Score: 80.4925 bits (197), Expect = 1.106e-14
Identity = 47/127 (37.01%), Postives = 64/127 (50.39%), Query Frame = 2
Query: 1820 LDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPS 2200
            LDRE    YQL ++ +D G P +   + V + ++DINDN P F       Y   + E    G+ + ++ A+D DE  N ++TYLL     F ID K+G V I   LD        L I A DNG PS
Sbjct:  194 LDRETTPFYQLLIQVEDKGEPKKFGYLQVNVTIQDINDNPPSFDH---EQYQTSVFEDAAVGSSVLQIAASDLDEGANAEITYLLDEGTPFQIDPKAGTVVIKEGLDYETKREYSLTIHAVDNGVPS 317          
BLAST of protocadherin-1 vs. Ensembl Zebrafish
Match: pcdh2aa15 (protocadherin 2 alpha a 15 [Source:ZFIN;Acc:ZDB-GENE-041118-15])

HSP 1 Score: 213.772 bits (543), Expect = 1.206e-56
Identity = 169/536 (31.53%), Postives = 277/536 (51.68%), Query Frame = 2
Query:  386 SPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNK-----PIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDD--ETLITVLINSNSDPEVKRHFQVSAISG-LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRN-YRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQI------PEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGY---------SGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWIL-KSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQL 1918
            + RD D G NS   Y +   +  +F++ ++K+       P+    K  DRE     +L   A D G P K+G++ I I + D+ND+AP F + + Y + + E+   G+ I  +  TD D+    ++   +  + + ++++ F V+ ++G + +   LD+E     + I + A D GI  LTT  ++T+ + D+NDN PQI + +LS +     + E+    + VA+++V+D DS +NG V C+L E      F+L+       P+S+ N Y +VT    DRETI+HY +T++ KD G PPLSS +++T+ I D NDN P FS   +   + EN  PG  +F++ A+D D G N+ + YQI        K+ + I+I N   G +  L SFD E + +  F   A D  +P L+S+V V + I D+ND +P+ L         EG             V KV AYD D   N  ++FS      + L+ L +  G I + +      E Q  ++L +  KDNG  S S++  V +++
Sbjct:  158 AARDPDSGSNSVQTYKLSHTE--YFRI-EIKDRYEDGKVPVLILQKPLDREVTKSIKLQLTALDGGRPPKSGKMTIIIDVLDINDNAPVF-IKEVYSVTLNENTPVGTTILRVNATDLDEGQNGVVVYSLGHDVNDKLRKLFNVNPVTGEIVVTGLLDFEVK-DIYEIDIQASDKGIAPLTTDKSVTIKIADVNDNEPQIEVTSLSST-----IPEDSKPGTTVALISVSDLDSGINGRVTCSLSE---NIPFQLM-------PSSQENTYSLVTTSALDRETIAHYDITLEAKDAGQPPLSSVKSVTVQISDVNDNSPEFSSSPYAFYVMENNAPGKSLFSVSASDKDTGANSAVSYQIWRDGGAENKFTSFINI-NSENGEIYALKSFDFETSKTFQFHILATDSGSPSLSSNVTVNVFILDQNDNVPVILYPVSANGSAEGVEEIPRNVNAGHLVTKVRAYDADIGYNGWLLFSLQEVSDHSLFALDRYTGQIRTLRSFTETDEAQ--HKLVILVKDNGNVSLSATATVIVKV 670          

HSP 2 Score: 157.532 bits (397), Expect = 1.055e-38
Identity = 175/632 (27.69%), Postives = 292/632 (46.20%), Query Frame = 2
Query:  596 IYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDET-LITVLINSNSD---PEVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEK--YQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGWVGK----VEAYXXXXXXXXXIIFS----------FTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSG----YMKKITETLVPGTLITKVMATDDDENENGKVTYLL---ANNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPSXXXXXXXXXXXXNEDEDKQTSVINEKVDQEKTYQEARRKNNIDNYDGFKWNSKEVLISLTVGSVMLIISC 2410
            + + + D+NDHAP F   ++  + + E  + G++       D D  +  +     S+++    E+K  ++   +  L L   LD E + +   + + A+D G P  +   TI ++VLDINDN P  + +  S       L EN P  + +  V  TD D   NG+V  +L    N +    + + FN  P +     IV     D E    Y + +Q  D+G+ PL++ +++TI I D NDN P          I E+  PG+ +  +  +D D G N ++   + E   +Q + S    +  +VT   + DRE          A D   P L+S   VT++I D ND  P F SS Y F + E  +   GK    V A D D+ +NS + +           FT F++    I   +G I++ K    D E   T+Q  + A D+G PS SS+V V + + D NDN P    P+ +      +++I   +  G L+TKV A D D   NG + + L   +++  F +D  +G++   R+    +    +L+I+ KDNG  S + TAT+ +      E K+    ++  + EK  +E    NN+  Y      S  VL  +++  V++++ C
Sbjct:  121 VTVDVIDVNDHAPMFP-EQEKRLEISETVLPGARFQLQAARDPDSGSNSVQTYKLSHTEYFRIEIKDRYEDGKVPVLILQKPLDREVT-KSIKLQLTALDGGRPPKSGKMTIIIDVLDINDNAPVFIKEVYS-----VTLNENTPVGTTILRVNATDLDEGQNGVVVYSLGHDVNDK----LRKLFNVNPVTG---EIVVTGLLDFEVKDIYEIDIQASDKGIAPLTTDKSVTIKIADVNDNEPQIEVTSLSSTIPEDSKPGTTVALISVSDLDSGINGRVTCSLSENIPFQLMPSSQENTYSLVTT-SALDRETIAHYDITLEAKDAGQPPLSSVKSVTVQISDVNDNSPEFSSSPYAFYVMENNAP--GKSLFSVSASDKDTGANSAVSYQIWRDGGAENKFTSFIN----INSENGEIYALK--SFDFETSKTFQFHILATDSGSPSLSSNVTVNVFILDQNDNVPVILYPVSANGSAEGVEEIPRNVNAGHLVTKVRAYDADIGYNGWLLFSLQEVSDHSLFALDRYTGQIRTLRSFTETDEAQHKLVILVKDNGNVSLSATATVIVKVV---EPKEAFAASDVKNAEKDEEE----NNVTFYLIITLGSVSVLFVISI-IVLIVMQC 721          

HSP 3 Score: 122.479 bits (306), Expect = 8.920e-28
Identity = 145/527 (27.51%), Postives = 240/527 (45.54%), Query Frame = 2
Query:  722 KDDETLITVLINSNSDPEV--KRHFQVSAISGLTLIS------------RLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNF--ELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIP----EKYQNIISIPNPSTG--IVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHL---WILKSDGNIFS-EKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLL-----ANNKY--FI-IDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPS 2200
            KD   +  V  +   DP+   +R F++ + SG ++ S            +LD E+   + T  +I +   + N      +TV+V+D+ND+ P        +     ++ E     +   +    D DS  N +    L   ++ + F  E+  RY +      +   ++  +  DRE     ++ +   D G PP S + TI I + D NDN P F K  +   + EN   G+ I  + ATD D G+N  ++Y +     +K + + ++ NP TG  +VT L+ F+ +    I  +A   D+    L +   VT++I D ND  P    ++    I E      G   A  + S+ +S I    T  L  ++    +  S  N +S      LDRE  + Y +T+EAKD G P  SS   V +Q+ D+NDNSP+FS    S Y   + E   PG  +  V A+D D   N  V+Y +     A NK+  FI I+ ++GE++  ++ D       +  I+A D+G+PS
Sbjct:   42 KDGTAVGNVAKDLGIDPKTLKERGFRIVSTSGESMFSVNQNDGVLYVKGKLDRENVCERSTPCLINLKIALENPLEIHYVTVDVIDVNDHAPM-----FPEQEKRLEISETVLPGARFQLQAARDPDSGSNSVQTYKL---SHTEYFRIEIKDRYEDG-----KVPVLILQKPLDREVTKSIKLQLTALDGGRPPKSGKMTIIIDVLDINDNAPVFIKEVYSVTLNENTPVGTTILRVNATDLDEGQNGVVVYSLGHDVNDKLRKLFNV-NPVTGEIVVTGLLDFEVKDIYEIDIQAS--DKGIAPLTTDKSVTIKIADVNDNEPQIEVTSLSSTIPE--DSKPGTTVALISVSDLDSGINGRVTCSLSENIPFQLMPSSQENTYSLVTTSALDRETIAHYDITLEAKDAGQPPLSSVKSVTVQISDVNDNSPEFSS---SPYAFYVMENNAPGKSLFSVSASDKDTGANSAVSYQIWRDGGAENKFTSFININSENGEIYALKSFDFETSKTFQFHILATDSGSPS 547          

HSP 4 Score: 83.5741 bits (205), Expect = 9.249e-16
Identity = 80/310 (25.81%), Postives = 139/310 (44.84%), Query Frame = 2
Query:  383 LSPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHF----QVSAISG-LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNF--KLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWI 1291
            +S  D D GIN  +  S+  ++  F  +   + N     T    DRE    Y++   A D G P  +    + ++I D+ND++PEF     Y   V E+   G  +  +  +DKD      V      D   +  F     +++ +G +  +   D+E+S + F   ++A D+G P+L+++ T+ V +LD NDN P I+    ++ S+    ++  N      V  V   DAD   NG +  +L E ++   F L  RY           +I TLR F     + +++ +  KD G   LS+  T+ + +
Sbjct:  374 ISVSDLDSGINGRVTCSLS-ENIPFQLMPSSQENTYSLVTTSALDRETIAHYDITLEAKDAGQPPLSSVKSVTVQISDVNDNSPEFS-SSPYAFYVMENNAPGKSLFSVSASDKDTGANSAVSYQIWRDGGAENKFTSFININSENGEIYALKSFDFETS-KTFQFHILATDSGSPSLSSNVTVNVFILDQNDNVPVILYPVSANGSAEGVEEIPRNVNAGHLVTKVRAYDADIGYNGWLLFSLQEVSDHSLFAL-DRYTG---------QIRTLRSFTETDEAQHKLVILVKDNGNVSLSATATVIVKV 670          
BLAST of protocadherin-1 vs. Ensembl Zebrafish
Match: pcdh2aa15 (protocadherin 2 alpha a 15 [Source:ZFIN;Acc:ZDB-GENE-041118-15])

HSP 1 Score: 213.386 bits (542), Expect = 1.471e-56
Identity = 169/536 (31.53%), Postives = 277/536 (51.68%), Query Frame = 2
Query:  386 SPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNK-----PIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDD--ETLITVLINSNSDPEVKRHFQVSAISG-LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRN-YRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQI------PEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGY---------SGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWIL-KSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQL 1918
            + RD D G NS   Y +   +  +F++ ++K+       P+    K  DRE     +L   A D G P K+G++ I I + D+ND+AP F + + Y + + E+   G+ I  +  TD D+    ++   +  + + ++++ F V+ ++G + +   LD+E     + I + A D GI  LTT  ++T+ + D+NDN PQI + +LS +     + E+    + VA+++V+D DS +NG V C+L E      F+L+       P+S+ N Y +VT    DRETI+HY +T++ KD G PPLSS +++T+ I D NDN P FS   +   + EN  PG  +F++ A+D D G N+ + YQI        K+ + I+I N   G +  L SFD E + +  F   A D  +P L+S+V V + I D+ND +P+ L         EG             V KV AYD D   N  ++FS      + L+ L +  G I + +      E Q  ++L +  KDNG  S S++  V +++
Sbjct:  158 AARDPDSGSNSVQTYKLSHTE--YFRI-EIKDRYEDGKVPVLILQKPLDREVTKSIKLQLTALDGGRPPKSGKMTIIIDVLDINDNAPVF-IKEVYSVTLNENTPVGTTILRVNATDLDEGQNGVVVYSLGHDVNDKLRKLFNVNPVTGEIVVTGLLDFEVK-DIYEIDIQASDKGIAPLTTDKSVTIKIADVNDNEPQIEVTSLSST-----IPEDSKPGTTVALISVSDLDSGINGRVTCSLSE---NIPFQLM-------PSSQENTYSLVTTSALDRETIAHYDITLEAKDAGQPPLSSVKSVTVQISDVNDNSPEFSSSPYAFYVMENNAPGKSLFSVSASDKDTGANSAVSYQIWRDGGAENKFTSFINI-NSENGEIYALKSFDFETSKTFQFHILATDSGSPSLSSNVTVNVFILDQNDNVPVILYPVSANGSAEGVEEIPRNVNAGHLVTKVRAYDADIGYNGWLLFSLQEVSDHSLFALDRYTGQIRTLRSFTETDEAQ--HKLVILVKDNGNVSLSATATVIVKV 670          

HSP 2 Score: 157.147 bits (396), Expect = 1.357e-38
Identity = 175/632 (27.69%), Postives = 292/632 (46.20%), Query Frame = 2
Query:  596 IYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDET-LITVLINSNSD---PEVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEK--YQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKE----GYSGWVGKVEAYXXXXXXXXXIIFS----------FTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSG----YMKKITETLVPGTLITKVMATDDDENENGKVTYLL---ANNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPSXXXXXXXXXXXXNEDEDKQTSVINEKVDQEKTYQEARRKNNIDNYDGFKWNSKEVLISLTVGSVMLIISC 2410
            + + + D+NDHAP F   ++  + + E  + G++       D D  +  +     S+++    E+K  ++   +  L L   LD E + +   + + A+D G P  +   TI ++VLDINDN P  + +  S       L EN P  + +  V  TD D   NG+V  +L    N +    + + FN  P +     IV     D E    Y + +Q  D+G+ PL++ +++TI I D NDN P          I E+  PG+ +  +  +D D G N ++   + E   +Q + S    +  +VT   + DRE          A D   P L+S   VT++I D ND  P F SS Y F + E    G S +   V A D D+ +NS + +           FT F++    I   +G I++ K    D E   T+Q  + A D+G PS SS+V V + + D NDN P    P+ +      +++I   +  G L+TKV A D D   NG + + L   +++  F +D  +G++   R+    +    +L+I+ KDNG  S + TAT+ +      E K+    ++  + EK  +E    NN+  Y      S  VL  +++  V++++ C
Sbjct:  121 VTVDVIDVNDHAPMFP-EQEKRLEISETVLPGARFQLQAARDPDSGSNSVQTYKLSHTEYFRIEIKDRYEDGKVPVLILQKPLDREVT-KSIKLQLTALDGGRPPKSGKMTIIIDVLDINDNAPVFIKEVYS-----VTLNENTPVGTTILRVNATDLDEGQNGVVVYSLGHDVNDK----LRKLFNVNPVTG---EIVVTGLLDFEVKDIYEIDIQASDKGIAPLTTDKSVTIKIADVNDNEPQIEVTSLSSTIPEDSKPGTTVALISVSDLDSGINGRVTCSLSENIPFQLMPSSQENTYSLVTT-SALDRETIAHYDITLEAKDAGQPPLSSVKSVTVQISDVNDNSPEFSSSPYAFYVMENNAPGKSLF--SVSASDKDTGANSAVSYQIWRDGGAENKFTSFIN----INSENGEIYALK--SFDFETSKTFQFHILATDSGSPSLSSNVTVNVFILDQNDNVPVILYPVSANGSAEGVEEIPRNVNAGHLVTKVRAYDADIGYNGWLLFSLQEVSDHSLFALDRYTGQIRTLRSFTETDEAQHKLVILVKDNGNVSLSATATVIVKVV---EPKEAFAASDVKNAEKDEEE----NNVTFYLIITLGSVSVLFVISI-IVLIVMQC 721          

HSP 3 Score: 122.479 bits (306), Expect = 9.974e-28
Identity = 145/527 (27.51%), Postives = 240/527 (45.54%), Query Frame = 2
Query:  722 KDDETLITVLINSNSDPEV--KRHFQVSAISGLTLIS------------RLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNF--ELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIP----EKYQNIISIPNPSTG--IVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHL---WILKSDGNIFS-EKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLL-----ANNKY--FI-IDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPS 2200
            KD   +  V  +   DP+   +R F++ + SG ++ S            +LD E+   + T  +I +   + N      +TV+V+D+ND+ P        +     ++ E     +   +    D DS  N +    L   ++ + F  E+  RY +      +   ++  +  DRE     ++ +   D G PP S + TI I + D NDN P F K  +   + EN   G+ I  + ATD D G+N  ++Y +     +K + + ++ NP TG  +VT L+ F+ +    I  +A   D+    L +   VT++I D ND  P    ++    I E      G   A  + S+ +S I    T  L  ++    +  S  N +S      LDRE  + Y +T+EAKD G P  SS   V +Q+ D+NDNSP+FS    S Y   + E   PG  +  V A+D D   N  V+Y +     A NK+  FI I+ ++GE++  ++ D       +  I+A D+G+PS
Sbjct:   42 KDGTAVGNVAKDLGIDPKTLKERGFRIVSTSGESMFSVNQNDGVLYVKGKLDRENVCERSTPCLINLKIALENPLEIHYVTVDVIDVNDHAPM-----FPEQEKRLEISETVLPGARFQLQAARDPDSGSNSVQTYKL---SHTEYFRIEIKDRYEDG-----KVPVLILQKPLDREVTKSIKLQLTALDGGRPPKSGKMTIIIDVLDINDNAPVFIKEVYSVTLNENTPVGTTILRVNATDLDEGQNGVVVYSLGHDVNDKLRKLFNV-NPVTGEIVVTGLLDFEVKDIYEIDIQAS--DKGIAPLTTDKSVTIKIADVNDNEPQIEVTSLSSTIPE--DSKPGTTVALISVSDLDSGINGRVTCSLSENIPFQLMPSSQENTYSLVTTSALDRETIAHYDITLEAKDAGQPPLSSVKSVTVQISDVNDNSPEFSS---SPYAFYVMENNAPGKSLFSVSASDKDTGANSAVSYQIWRDGGAENKFTSFININSENGEIYALKSFDFETSKTFQFHILATDSGSPS 547          

HSP 4 Score: 83.1889 bits (204), Expect = 1.106e-15
Identity = 80/310 (25.81%), Postives = 139/310 (44.84%), Query Frame = 2
Query:  383 LSPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHF----QVSAISG-LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNF--KLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWI 1291
            +S  D D GIN  +  S+  ++  F  +   + N     T    DRE    Y++   A D G P  +    + ++I D+ND++PEF     Y   V E+   G  +  +  +DKD      V      D   +  F     +++ +G +  +   D+E+S + F   ++A D+G P+L+++ T+ V +LD NDN P I+    ++ S+    ++  N      V  V   DAD   NG +  +L E ++   F L  RY           +I TLR F     + +++ +  KD G   LS+  T+ + +
Sbjct:  374 ISVSDLDSGINGRVTCSLS-ENIPFQLMPSSQENTYSLVTTSALDRETIAHYDITLEAKDAGQPPLSSVKSVTVQISDVNDNSPEFS-SSPYAFYVMENNAPGKSLFSVSASDKDTGANSAVSYQIWRDGGAENKFTSFININSENGEIYALKSFDFETS-KTFQFHILATDSGSPSLSSNVTVNVFILDQNDNVPVILYPVSANGSAEGVEEIPRNVNAGHLVTKVRAYDADIGYNGWLLFSLQEVSDHSLFAL-DRYTG---------QIRTLRSFTETDEAQHKLVILVKDNGNVSLSATATVIVKV 670          
BLAST of protocadherin-1 vs. Ensembl Zebrafish
Match: pcdh18a (protocadherin 18a [Source:ZFIN;Acc:ZDB-GENE-000607-1])

HSP 1 Score: 213.386 bits (542), Expect = 4.811e-56
Identity = 149/431 (34.57%), Postives = 235/431 (54.52%), Query Frame = 2
Query:  386 SPRDSDYGINSEIIYSIEGKDKGFFKL-LQMKNNKPIFK---TMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDET--LITVLINSNSDPEVKRHFQVSAISG-LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFK-LMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIP-----NPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFL 1639
            S  D D G NS   YS+   D  FFK+ +  + +   +     +K  DRE R  YEL   A+D+G+P K G   + I I D ND+ P F+ P  YVI + E++  GS + D+  TD D+     I    +S+  P++   F++++ +G LTL+ ++D+ES+   + I V A D G  ++     + + V+D+NDN P I ++ +S  +     + E  P ++FVA+V+V D DS +NG V+C L     + +F L   Y       ++NY I+T    DRE  S + +TV  +D+G P LS+ +   + ++DENDN PSF+K  ++    EN  PG+ + ++ A+DPD+G N ++ Y I E   +  SI      +PS G +  L +FDRE  + I+F   A D  NP L S+V V L + DEND  P+ +
Sbjct:  161 SATDPDVGENSLNTYSLTPSD--FFKIDILTRTDGAKYAELVVLKELDREVRASYELQLTASDRGVPPKFGTTLLKISIADSNDNNPVFEKPS-YVINLLENSPLGSLLIDLNATDPDEGANGKIIYSFSSHVSPKILETFKINSDNGHLTLMRKVDFEST-NSYDIDVQAQDMGPNSMPAHCKVIIKVVDVNDNKPDISVNLMSTGNEEIAYISETAPVDTFVALVSVNDLDSGLNGEVECRLY---GQGHFRLQKSY-------EKNYMILTNVTLDREKRSEFSLTVIAEDKGSPSLSTIKNFIVEVQDENDNAPSFAKSRYEISKAENNSPGAYLSSVKASDPDLGPNGQVSYSILESMVHGSSISTYVTIDPSNGDIYALRTFDREDVSQISFLVQARDSGNPPLRSNVTVVLTVLDENDNRPVIM 577          

HSP 2 Score: 124.405 bits (311), Expect = 2.781e-28
Identity = 144/562 (25.62%), Postives = 250/562 (44.48%), Query Frame = 2
Query:  593 KIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKD-DETLITVLINSNSD---PEVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKE--NIMPGSPIFTLIA----TDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYS--GWVGKVEAYXXXXXXXXXIIFS-FTGFLHN-----HLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMK--KITETLVPGTLITKVMATDDDENENGKVTY-LLANNK--YFIIDEKSGEVFINRTLDRLELVPR---RLLIMAKDNGTPS 2200
             I ++I D+ND+AP+F  P    I + E A  G++I     TD D  E  +     + SD    ++      +  + L ++  LD E     + + + A D G+P    +T + +++ D NDN P          S    L+EN P  S +  +  TD D   NG +  +        +  +  +    F  +  N  +  +R+ D E+ + Y + VQ +D G   + +   + I + D NDN P  S        +E   I   +P+ T +A     D D G N ++  ++  +    +        ++   V+ DRE  +  +    A D+ +P L++     +E++DEND  P F  S Y     E  S   ++  V+A D D   N  + +S     +H      ++ I  S+G+I++ +    DRE  S     V+A+D+G P   S+V V + + D NDN P    P    +     +++    G ++T V A D D   NG ++  ++  N+  YF +D K+ E+   RT   ++ VPR    L I+ +D+GTP+
Sbjct:  123 HIEVEILDINDNAPQFARPV-IPIEISETAAVGTRIPLDSATDPDVGENSLNTYSLTPSDFFKIDILTRTDGAKYAELVVLKELDREVRA-SYELQLTASDRGVPPKFGTTLLKISIADSNDNNP-----VFEKPSYVINLLENSPLGSLLIDLNATDPDEGANGKIIYSF-------SSHVSPKILETFKINSDNGHLTLMRKVDFESTNSYDIDVQAQDMGPNSMPAHCKVIIKVVDVNDNKPDISVNLMSTGNEEIAYISETAPVDTFVALVSVNDLDSGLNGEVECRLYGQGHFRLQKSYEKNYMILTNVTLDREKRSEFSLTVIAEDKGSPSLSTIKNFIVEVQDENDNAPSFAKSRYEISKAENNSPGAYLSSVKASDPDLGPNGQVSYSILESMVHGSSISTYVTIDPSNGDIYALR--TFDREDVSQISFLVQARDSGNPPLRSNVTVVLTVLDENDNRPVIMMPQLWNHTADVPVSKYAEIGDVVTVVRAMDHDAGANGDLSCSVVGGNEAGYFNMDPKTCEI---RTNVSIQEVPRDHVELTILVQDHGTPT 665          

HSP 3 Score: 93.5893 bits (231), Expect = 9.673e-19
Identity = 80/317 (25.24%), Postives = 146/317 (46.06%), Query Frame = 2
Query:  353 VD*FWRLSIKLSPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKD----DETLITVLINSNSDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWI 1291
            VD F  L   +S  D D G+N E+   + G+  G F+L +      +  T    DRE+R  + L  IA DKG P  +      ++++D ND+AP F   + Y I   E+   G+ +  +K +D D     +   ++L +      +  +  +   +G     R      + + +  V A D+G P L ++ T+ + VLD NDN P I++  L + +++  + +       V +V   D D+  NG + C+++  N        + YFN  P +      V+++E  R+   H  +T+  +D G P LS++  + + +
Sbjct:  376 VDTFVAL---VSVNDLDSGLNGEVECRLYGQ--GHFRLQKSYEKNYMILTNVTLDREKRSEFSLTVIAEDKGSPSLSTIKNFIVEVQDENDNAPSFAKSR-YEISKAENNSPGAYLSSVKASDPDLGPNGQVSYSILESMVHGSSISTYVTIDPSNGDIYALRTFDREDVSQISFLVQARDSGNPPLRSNVTVVLTVLDENDNRPVIMMPQLWNHTADVPVSKYAEIGDVVTVVRAMDHDAGANGDLSCSVVGGNE-------AGYFNMDPKTCEIRTNVSIQEVPRD---HVELTILVQDHGTPTLSARALLRLSL 676          
BLAST of protocadherin-1 vs. Ensembl Xenopus
Match: ENSXETT00000047798.1 (protocadherin 11 X-linked [Source:NCBI gene;Acc:100493938])

HSP 1 Score: 220.32 bits (560), Expect = 2.207e-58
Identity = 188/618 (30.42%), Postives = 292/618 (47.25%), Query Frame = 2
Query:  395 DSDYGINSEIIYSIEGKDKGFFKLLQMKNNK----PIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKD--DETLITVLINSNSDPEVKRHFQVSAISGL-TLISRLDYESS-MRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDT---LSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYS--GWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTY-LLANNK--YFIIDEKSGEVFIN-RTLDRLELVPRRLLIMAKDNGTP 2197
            D D G+N    Y +  K +  F L  ++  +    P     +  DRE++D Y +     D G P ++    + + + D+ND+ P F   KD  + + EDA  G+ +  +  TD D      I     +      KRHF +   +GL T+   LD E S   K T  V+A D    +  +  T+T+N+ DINDN P I  DT   ++  +   +L E  P  + +A++TVTD D+++NG V C     ++   F L   + N F        + T    D E+   Y + +   D G PPL+    + I I+DENDN P F+         EN  PG+ +  + ATD D G+NA++ Y +      I ++ +  TGI+T +   DRE     TF   A D  NP L ++  VTL + D+ND  P F  + Y+F + E     G VG +   D DS  N+ +  S      N  +I+     +     I  DRE Q +Y   V+A D G P +SS+V V I +ED+NDN P F  P ++     +  +  PG+++ +V A D+D   N  + Y ++  N    F I E+SG + +  + L     V  +L+I   D+G P
Sbjct:  163 DPDVGVNGIQHYELL-KGQNVFGLDVIETPEGDKWPQLIVQQSLDREQKDTYVMKIKVEDGGNPARSSTAILQVTVTDVNDNRPVFKE-KDIEVNIPEDAAVGTSVTQLHATDADLGSNAKIHFYFGNQITNLAKRHFAIDNNTGLITVKEPLDREESPYHKLT--VLASDGS--STPSRATVTINITDINDNIPSI--DTRYIINPVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTCFT---DHDVPFRLKPVFDNQF-------LLETAAPLDYESTREYAIKIVASDSGKPPLNQSAMLLIKIKDENDNAPVFTLPMIGLSFVENNPPGTELTKISATDADSGRNAELSYMLGPNAPTIFNL-DRRTGILTAVRKLDREKQDRYTFTVIAKDNGNPSLQTNTTVTLSVLDQNDNSPSFTHNEYNFYVPENLPMYGTVGLITVTDADSGENAVVTLSLVNARDN--FIIDPLTGVI-RPNITFDREQQGSYTFQVKALDKGSPQKSSTVKVTIFVEDVNDNKPVFVIPSNNYSYDLVQTSTSPGSVVARVYAIDNDTGINADLRYSIIGGNSRGLFAIGERSGNITLKEKLLAGDHGVLYKLVIKVNDSGKP 758          

HSP 2 Score: 128.257 bits (321), Expect = 2.300e-29
Identity = 124/438 (28.31%), Postives = 200/438 (45.66%), Query Frame = 2
Query:  935 DINDN---FPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNI----ISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIP----MFLSSAYHFKIKEGYSGWVGKVEAYXXXXXXXXXIIFSFTGFL-HNHLWILKS--DGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNK--YFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPS 2200
            DINDN   FP  VI        N  + EN    S  ++ +  D D  +NGI    L++  N    ++I       P   +  +++  +  DRE    Y + ++ +D G P  SS   + + + D NDN P F +   +  I E+   G+ +  L ATD D+G NAKI +    +  N+     +I N +TG++T     DRE +        A D  +    S   VT+ I D ND IP     ++ +  +  ++      +    A    ++ ++D+    T F  H+  + LK   D     E    LD E    Y + + A D+G P  + S ++ I+++D NDN+P F+ P+         E   PGT +TK+ ATD D   N +++Y+L  N    F +D ++G +   R LDR +       ++AKDNG PS
Sbjct:  129 DINDNSPLFPSTVI--------NISIPENTAVNSRYSVPSAIDPDVGVNGIQHYELLKGQNVFGLDVIET-----PEGDKWPQLIVQQSLDREQKDTYVMKIKVEDGGNPARSSTAILQVTVTDVNDNRPVFKEKDIEVNIPEDAAVGTSVTQLHATDADLGSNAKIHFYFGNQITNLAKRHFAIDN-NTGLITVKEPLDREESPYHKLTVLASDGSS--TPSRATVTINITDINDNIPSIDTRYIINPVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTCFTDHDVPFRLKPVFDNQFLLETAAPLDYESTREYAIKIVASDSGKPPLNQSAMLLIKIKDENDNAPVFTLPM---IGLSFVENNPPGTELTKISATDADSGRNAELSYMLGPNAPTIFNLDRRTGILTAVRKLDREKQDRYTFTVIAKDNGNPS 547          

HSP 3 Score: 75.8702 bits (185), Expect = 3.466e-13
Identity = 76/297 (25.59%), Postives = 134/297 (45.12%), Query Frame = 2
Query:  380 KLSPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKD--DETLITV-LINSNSDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLRE--FDRETISHYRVTVQCKDQGLP 1255
            K+S  D+D G N+E+ Y +       F L +      I   ++  DRE++DRY    IA D G P       + + + D ND++P F    +Y   V E+      +  I VTD D  +  ++T+ L+N+      + +F +  ++G+   +          +T  V A+D G P  +++  +T+ V D+NDN P  VI   S++ S   +  +    S VA V   D D+ +N  +  ++I  N++  F +  R  N           +TL+E     +    Y++ ++  D G P
Sbjct:  485 KISATDADSGRNAELSYMLGPNAPTIFNLDRRTG---ILTAVRKLDREKQDRYTFTVIAKDNGNPSLQTNTTVTLSVLDQNDNSPSFTH-NEYNFYVPENLPMYGTVGLITVTDADSGENAVVTLSLVNA------RDNFIIDPLTGVIRPNITFDREQQGSYTFQVKALDKGSPQKSSTVKVTIFVEDVNDNKPVFVIP--SNNYSYDLVQTSTSPGSVVARVYAIDNDTGINADLRYSIIGGNSRGLFAIGERSGN-----------ITLKEKLLAGDHGVLYKLVIKVNDSGKP 758          

HSP 4 Score: 72.7886 bits (177), Expect = 3.241e-12
Identity = 99/330 (30.00%), Postives = 139/330 (42.12%), Query Frame = 2
Query: 1277 ITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIIS---IPNPSTGIVTNLV---SFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKE--GYSGWVGKVEAYXXXXXXXXXIIFSF----TGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKD-NGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYM-------KKITETLVPGTLITKVMATDDDENENGKVTYLLANNKYFIIDEKSGEVFINRTLDRLELVPRR---LLIMAKDNGTP 2197
            I   IED NDN P F        I EN    S      A DPD+G N    Y++  K QN+     I  P       L+   S DRE   +   K    D  NP  +S+  + + + D ND  P+F        I E       V ++ A D D  SN+ I F F    T     H  I  + G I  ++   LDRE    ++LTV A D +  PSR++   V I + DINDN P     +D+ Y+        +++E     T I  +  TD D + NGKVT    ++  F +       F+  T   L+    R   + I+A D+G P
Sbjct:  123 IRFLIEDINDNSPLFPSTVINISIPENTAVNSRYSVPSAIDPDVGVNGIQHYEL-LKGQNVFGLDVIETPEGDKWPQLIVQQSLDREQKDTYVMKIKVEDGGNPARSSTAILQVTVTDVNDNRPVFKEKDIEVNIPEDAAVGTSVTQLHATDADLGSNAKIHFYFGNQITNLAKRHFAIDNNTGLITVKE--PLDREESPYHKLTVLASDGSSTPSRAT---VTINITDINDNIPS----IDTRYIINPVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTCFTDHDVPFRLKPVFDNQFLLETAAPLDYESTREYAIKIVASDSGKP 442          
BLAST of protocadherin-1 vs. Ensembl Xenopus
Match: ENSXETT00000047801.1 (protocadherin 11 X-linked [Source:NCBI gene;Acc:100493938])

HSP 1 Score: 220.32 bits (560), Expect = 2.553e-58
Identity = 188/618 (30.42%), Postives = 292/618 (47.25%), Query Frame = 2
Query:  395 DSDYGINSEIIYSIEGKDKGFFKLLQMKNNK----PIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKD--DETLITVLINSNSDPEVKRHFQVSAISGL-TLISRLDYESS-MRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDT---LSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYS--GWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTY-LLANNK--YFIIDEKSGEVFIN-RTLDRLELVPRRLLIMAKDNGTP 2197
            D D G+N    Y +  K +  F L  ++  +    P     +  DRE++D Y +     D G P ++    + + + D+ND+ P F   KD  + + EDA  G+ +  +  TD D      I     +      KRHF +   +GL T+   LD E S   K T  V+A D    +  +  T+T+N+ DINDN P I  DT   ++  +   +L E  P  + +A++TVTD D+++NG V C     ++   F L   + N F        + T    D E+   Y + +   D G PPL+    + I I+DENDN P F+         EN  PG+ +  + ATD D G+NA++ Y +      I ++ +  TGI+T +   DRE     TF   A D  NP L ++  VTL + D+ND  P F  + Y+F + E     G VG +   D DS  N+ +  S      N  +I+     +     I  DRE Q +Y   V+A D G P +SS+V V I +ED+NDN P F  P ++     +  +  PG+++ +V A D+D   N  + Y ++  N    F I E+SG + +  + L     V  +L+I   D+G P
Sbjct:  183 DPDVGVNGIQHYELL-KGQNVFGLDVIETPEGDKWPQLIVQQSLDREQKDTYVMKIKVEDGGNPARSSTAILQVTVTDVNDNRPVFKE-KDIEVNIPEDAAVGTSVTQLHATDADLGSNAKIHFYFGNQITNLAKRHFAIDNNTGLITVKEPLDREESPYHKLT--VLASDGS--STPSRATVTINITDINDNIPSI--DTRYIINPVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTCFT---DHDVPFRLKPVFDNQF-------LLETAAPLDYESTREYAIKIVASDSGKPPLNQSAMLLIKIKDENDNAPVFTLPMIGLSFVENNPPGTELTKISATDADSGRNAELSYMLGPNAPTIFNL-DRRTGILTAVRKLDREKQDRYTFTVIAKDNGNPSLQTNTTVTLSVLDQNDNSPSFTHNEYNFYVPENLPMYGTVGLITVTDADSGENAVVTLSLVNARDN--FIIDPLTGVI-RPNITFDREQQGSYTFQVKALDKGSPQKSSTVKVTIFVEDVNDNKPVFVIPSNNYSYDLVQTSTSPGSVVARVYAIDNDTGINADLRYSIIGGNSRGLFAIGERSGNITLKEKLLAGDHGVLYKLVIKVNDSGKP 778          

HSP 2 Score: 128.642 bits (322), Expect = 2.140e-29
Identity = 124/438 (28.31%), Postives = 200/438 (45.66%), Query Frame = 2
Query:  935 DINDN---FPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNI----ISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIP----MFLSSAYHFKIKEGYSGWVGKVEAYXXXXXXXXXIIFSFTGFL-HNHLWILKS--DGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNK--YFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPS 2200
            DINDN   FP  VI        N  + EN    S  ++ +  D D  +NGI    L++  N    ++I       P   +  +++  +  DRE    Y + ++ +D G P  SS   + + + D NDN P F +   +  I E+   G+ +  L ATD D+G NAKI +    +  N+     +I N +TG++T     DRE +        A D  +    S   VT+ I D ND IP     ++ +  +  ++      +    A    ++ ++D+    T F  H+  + LK   D     E    LD E    Y + + A D+G P  + S ++ I+++D NDN+P F+ P+         E   PGT +TK+ ATD D   N +++Y+L  N    F +D ++G +   R LDR +       ++AKDNG PS
Sbjct:  149 DINDNSPLFPSTVI--------NISIPENTAVNSRYSVPSAIDPDVGVNGIQHYELLKGQNVFGLDVIET-----PEGDKWPQLIVQQSLDREQKDTYVMKIKVEDGGNPARSSTAILQVTVTDVNDNRPVFKEKDIEVNIPEDAAVGTSVTQLHATDADLGSNAKIHFYFGNQITNLAKRHFAIDN-NTGLITVKEPLDREESPYHKLTVLASDGSS--TPSRATVTINITDINDNIPSIDTRYIINPVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTCFTDHDVPFRLKPVFDNQFLLETAAPLDYESTREYAIKIVASDSGKPPLNQSAMLLIKIKDENDNAPVFTLPM---IGLSFVENNPPGTELTKISATDADSGRNAELSYMLGPNAPTIFNLDRRTGILTAVRKLDREKQDRYTFTVIAKDNGNPS 567          

HSP 3 Score: 75.8702 bits (185), Expect = 3.076e-13
Identity = 76/297 (25.59%), Postives = 134/297 (45.12%), Query Frame = 2
Query:  380 KLSPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKD--DETLITV-LINSNSDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLRE--FDRETISHYRVTVQCKDQGLP 1255
            K+S  D+D G N+E+ Y +       F L +      I   ++  DRE++DRY    IA D G P       + + + D ND++P F    +Y   V E+      +  I VTD D  +  ++T+ L+N+      + +F +  ++G+   +          +T  V A+D G P  +++  +T+ V D+NDN P  VI   S++ S   +  +    S VA V   D D+ +N  +  ++I  N++  F +  R  N           +TL+E     +    Y++ ++  D G P
Sbjct:  505 KISATDADSGRNAELSYMLGPNAPTIFNLDRRTG---ILTAVRKLDREKQDRYTFTVIAKDNGNPSLQTNTTVTLSVLDQNDNSPSFTH-NEYNFYVPENLPMYGTVGLITVTDADSGENAVVTLSLVNA------RDNFIIDPLTGVIRPNITFDREQQGSYTFQVKALDKGSPQKSSTVKVTIFVEDVNDNKPVFVIP--SNNYSYDLVQTSTSPGSVVARVYAIDNDTGINADLRYSIIGGNSRGLFAIGERSGN-----------ITLKEKLLAGDHGVLYKLVIKVNDSGKP 778          

HSP 4 Score: 72.4034 bits (176), Expect = 3.322e-12
Identity = 99/330 (30.00%), Postives = 139/330 (42.12%), Query Frame = 2
Query: 1277 ITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIIS---IPNPSTGIVTNLV---SFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKE--GYSGWVGKVEAYXXXXXXXXXIIFSF----TGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKD-NGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYM-------KKITETLVPGTLITKVMATDDDENENGKVTYLLANNKYFIIDEKSGEVFINRTLDRLELVPRR---LLIMAKDNGTP 2197
            I   IED NDN P F        I EN    S      A DPD+G N    Y++  K QN+     I  P       L+   S DRE   +   K    D  NP  +S+  + + + D ND  P+F        I E       V ++ A D D  SN+ I F F    T     H  I  + G I  ++   LDRE    ++LTV A D +  PSR++   V I + DINDN P     +D+ Y+        +++E     T I  +  TD D + NGKVT    ++  F +       F+  T   L+    R   + I+A D+G P
Sbjct:  143 IRFLIEDINDNSPLFPSTVINISIPENTAVNSRYSVPSAIDPDVGVNGIQHYEL-LKGQNVFGLDVIETPEGDKWPQLIVQQSLDREQKDTYVMKIKVEDGGNPARSSTAILQVTVTDVNDNRPVFKEKDIEVNIPEDAAVGTSVTQLHATDADLGSNAKIHFYFGNQITNLAKRHFAIDNNTGLITVKE--PLDREESPYHKLTVLASDGSSTPSRAT---VTINITDINDNIPS----IDTRYIINPVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTCFTDHDVPFRLKPVFDNQFLLETAAPLDYESTREYAIKIVASDSGKP 462          
BLAST of protocadherin-1 vs. Ensembl Xenopus
Match: ENSXETT00000047804.1 (protocadherin 11 X-linked [Source:NCBI gene;Acc:100493938])

HSP 1 Score: 219.935 bits (559), Expect = 2.708e-58
Identity = 188/618 (30.42%), Postives = 292/618 (47.25%), Query Frame = 2
Query:  395 DSDYGINSEIIYSIEGKDKGFFKLLQMKNNK----PIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKD--DETLITVLINSNSDPEVKRHFQVSAISGL-TLISRLDYESS-MRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDT---LSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYS--GWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTY-LLANNK--YFIIDEKSGEVFIN-RTLDRLELVPRRLLIMAKDNGTP 2197
            D D G+N    Y +  K +  F L  ++  +    P     +  DRE++D Y +     D G P ++    + + + D+ND+ P F   KD  + + EDA  G+ +  +  TD D      I     +      KRHF +   +GL T+   LD E S   K T  V+A D    +  +  T+T+N+ DINDN P I  DT   ++  +   +L E  P  + +A++TVTD D+++NG V C     ++   F L   + N F        + T    D E+   Y + +   D G PPL+    + I I+DENDN P F+         EN  PG+ +  + ATD D G+NA++ Y +      I ++ +  TGI+T +   DRE     TF   A D  NP L ++  VTL + D+ND  P F  + Y+F + E     G VG +   D DS  N+ +  S      N  +I+     +     I  DRE Q +Y   V+A D G P +SS+V V I +ED+NDN P F  P ++     +  +  PG+++ +V A D+D   N  + Y ++  N    F I E+SG + +  + L     V  +L+I   D+G P
Sbjct:  183 DPDVGVNGIQHYELL-KGQNVFGLDVIETPEGDKWPQLIVQQSLDREQKDTYVMKIKVEDGGNPARSSTAILQVTVTDVNDNRPVFKE-KDIEVNIPEDAAVGTSVTQLHATDADLGSNAKIHFYFGNQITNLAKRHFAIDNNTGLITVKEPLDREESPYHKLT--VLASDGS--STPSRATVTINITDINDNIPSI--DTRYIINPVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTCFT---DHDVPFRLKPVFDNQF-------LLETAAPLDYESTREYAIKIVASDSGKPPLNQSAMLLIKIKDENDNAPVFTLPMIGLSFVENNPPGTELTKISATDADSGRNAELSYMLGPNAPTIFNL-DRRTGILTAVRKLDREKQDRYTFTVIAKDNGNPSLQTNTTVTLSVLDQNDNSPSFTHNEYNFYVPENLPMYGTVGLITVTDADSGENAVVTLSLVNARDN--FIIDPLTGVI-RPNITFDREQQGSYTFQVKALDKGSPQKSSTVKVTIFVEDVNDNKPVFVIPSNNYSYDLVQTSTSPGSVVARVYAIDNDTGINADLRYSIIGGNSRGLFAIGERSGNITLKEKLLAGDHGVLYKLVIKVNDSGKP 778          

HSP 2 Score: 128.257 bits (321), Expect = 2.295e-29
Identity = 124/438 (28.31%), Postives = 200/438 (45.66%), Query Frame = 2
Query:  935 DINDN---FPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNI----ISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIP----MFLSSAYHFKIKEGYSGWVGKVEAYXXXXXXXXXIIFSFTGFL-HNHLWILKS--DGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNK--YFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPS 2200
            DINDN   FP  VI        N  + EN    S  ++ +  D D  +NGI    L++  N    ++I       P   +  +++  +  DRE    Y + ++ +D G P  SS   + + + D NDN P F +   +  I E+   G+ +  L ATD D+G NAKI +    +  N+     +I N +TG++T     DRE +        A D  +    S   VT+ I D ND IP     ++ +  +  ++      +    A    ++ ++D+    T F  H+  + LK   D     E    LD E    Y + + A D+G P  + S ++ I+++D NDN+P F+ P+         E   PGT +TK+ ATD D   N +++Y+L  N    F +D ++G +   R LDR +       ++AKDNG PS
Sbjct:  149 DINDNSPLFPSTVI--------NISIPENTAVNSRYSVPSAIDPDVGVNGIQHYELLKGQNVFGLDVIET-----PEGDKWPQLIVQQSLDREQKDTYVMKIKVEDGGNPARSSTAILQVTVTDVNDNRPVFKEKDIEVNIPEDAAVGTSVTQLHATDADLGSNAKIHFYFGNQITNLAKRHFAIDN-NTGLITVKEPLDREESPYHKLTVLASDGSS--TPSRATVTINITDINDNIPSIDTRYIINPVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTCFTDHDVPFRLKPVFDNQFLLETAAPLDYESTREYAIKIVASDSGKPPLNQSAMLLIKIKDENDNAPVFTLPM---IGLSFVENNPPGTELTKISATDADSGRNAELSYMLGPNAPTIFNLDRRTGILTAVRKLDREKQDRYTFTVIAKDNGNPS 567          

HSP 3 Score: 75.8702 bits (185), Expect = 3.675e-13
Identity = 76/297 (25.59%), Postives = 134/297 (45.12%), Query Frame = 2
Query:  380 KLSPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKD--DETLITV-LINSNSDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLRE--FDRETISHYRVTVQCKDQGLP 1255
            K+S  D+D G N+E+ Y +       F L +      I   ++  DRE++DRY    IA D G P       + + + D ND++P F    +Y   V E+      +  I VTD D  +  ++T+ L+N+      + +F +  ++G+   +          +T  V A+D G P  +++  +T+ V D+NDN P  VI   S++ S   +  +    S VA V   D D+ +N  +  ++I  N++  F +  R  N           +TL+E     +    Y++ ++  D G P
Sbjct:  505 KISATDADSGRNAELSYMLGPNAPTIFNLDRRTG---ILTAVRKLDREKQDRYTFTVIAKDNGNPSLQTNTTVTLSVLDQNDNSPSFTH-NEYNFYVPENLPMYGTVGLITVTDADSGENAVVTLSLVNA------RDNFIIDPLTGVIRPNITFDREQQGSYTFQVKALDKGSPQKSSTVKVTIFVEDVNDNKPVFVIP--SNNYSYDLVQTSTSPGSVVARVYAIDNDTGINADLRYSIIGGNSRGLFAIGERSGN-----------ITLKEKLLAGDHGVLYKLVIKVNDSGKP 778          

HSP 4 Score: 72.4034 bits (176), Expect = 3.436e-12
Identity = 99/330 (30.00%), Postives = 139/330 (42.12%), Query Frame = 2
Query: 1277 ITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIIS---IPNPSTGIVTNLV---SFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKE--GYSGWVGKVEAYXXXXXXXXXIIFSF----TGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKD-NGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYM-------KKITETLVPGTLITKVMATDDDENENGKVTYLLANNKYFIIDEKSGEVFINRTLDRLELVPRR---LLIMAKDNGTP 2197
            I   IED NDN P F        I EN    S      A DPD+G N    Y++  K QN+     I  P       L+   S DRE   +   K    D  NP  +S+  + + + D ND  P+F        I E       V ++ A D D  SN+ I F F    T     H  I  + G I  ++   LDRE    ++LTV A D +  PSR++   V I + DINDN P     +D+ Y+        +++E     T I  +  TD D + NGKVT    ++  F +       F+  T   L+    R   + I+A D+G P
Sbjct:  143 IRFLIEDINDNSPLFPSTVINISIPENTAVNSRYSVPSAIDPDVGVNGIQHYEL-LKGQNVFGLDVIETPEGDKWPQLIVQQSLDREQKDTYVMKIKVEDGGNPARSSTAILQVTVTDVNDNRPVFKEKDIEVNIPEDAAVGTSVTQLHATDADLGSNAKIHFYFGNQITNLAKRHFAIDNNTGLITVKE--PLDREESPYHKLTVLASDGSSTPSRAT---VTINITDINDNIPS----IDTRYIINPVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTCFTDHDVPFRLKPVFDNQFLLETAAPLDYESTREYAIKIVASDSGKP 462          
BLAST of protocadherin-1 vs. Ensembl Xenopus
Match: ENSXETT00000027070.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:3:19099783:19110965:-1 gene:ENSXETG00000013163.1 transcript:ENSXETT00000027070.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 215.698 bits (548), Expect = 3.642e-57
Identity = 196/634 (30.91%), Postives = 311/634 (49.05%), Query Frame = 2
Query:  386 SPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNK----PIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKD-YVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPE-VKRHFQVSAISG-LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIP-----NPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKE----GYSGWVGKVEAYXXXXXXXXXIIFSFTGF------LHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVP-----GTLITKVMATDDDENENGKVTYLL---ANNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTP 2197
            S +D D G NS   Y +   D  +F +L+  N      P     K  DRE+++   L+  A D G P KTG   I I + D+ND+ P F+  KD Y + V E+   G  + D+  TD D+ +   +    N  PE  +  F ++  +G + +  +LDYE +   + + V A D G   L +   + + V D+NDN P I+I + SD      + E+    + +A+V + D DS  NG V   + E      F LIS       +S   Y++VT  + DRE  S Y +T++ +D+G P L++ +TI + + D NDN P F K  +   I+EN   G+  + + ATDPDI +N K++Y I       I I      N  +G++    SFD E      F   A D+ +P L ++  + L + D ND  P+F    Y   I+E    G S +  +V A D+D N N  +++           L +++ I    G +++++    D E    + + V AKD+G PSRS++  V+I + D NDN+PK   P        + E  +P     G L+TKV+A D D   N  ++Y L    +  + II + +GE+ I R L   + + +R+++M KDNG P
Sbjct:  159 SAKDPDLGNNSIQSYKLSAND--YFGMLEKVNTDGRKYPELVLEKTLDREKKNSSVLILSAFDGGTPSKTGTSLIRIVVTDINDNYPLFN--KDTYRVTVSENVPIGFLVIDLHATDADEGSNAEITYLFNDIPENAQEVFAINPENGSVQITGKLDYEVAT-NYEMTVEAKDGG--GLVSYCKLLIQVSDVNDNAPDILITSFSD-----IIPEDSRVGTVIALVNLDDLDSGENGEVVGQISE---SLPFHLIS-------SSGNYYKLVTSMDLDREKTSEYNITIKAEDKGSPQLTNSKTIRLILTDVNDNAPVFDKMDYVAYIQENNPSGNSFYRVHATDPDINENGKVVYMILTDIIEDIPISSYVSINTVSGVLYAQRSFDYEKLRE--FYIQAEDKGSPQLTNNKTIRLILTDVNDNAPVFEKMDYVAYIQENNPSGSSFF--RVHATDSDINENGKVVYMILTDIIEDMPLSSYISINTVSGVLYAQRS--FDYESLREFYIQVMAKDSGSPSRSANATVKICITDQNDNAPKILYPSQDSEAASVFE-FIPHFSTKGYLVTKVVAVDADSGHNAWLSYHLLQVPDPSFLIIGQNTGEIRITRDLQETDALRQRIVVMVKDNGYP 763          

HSP 2 Score: 127.102 bits (318), Expect = 4.140e-29
Identity = 154/566 (27.21%), Postives = 258/566 (45.58%), Query Frame = 2
Query:  596 IYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKD--DETLITVLINSNSDPEVKRHFQVSA--ISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKR--------NYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQ-NIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKE----GYSGWVGKVEAYXXXXXXXXXIIFS-FTGFLHN-----HLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANN--------KYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPS 2200
            I ++I+D+ND++P F     + I + E A+ G+        D D  + ++ +  +++N    +             L L   LD E       I + A D G P+ T ++ I + V DINDN+P    DT   + S     EN P    V  +  TDAD            E +N +    I+  FN+ P + +        N  +    + D E  ++Y +TV+ KD G   L S   + I + D NDN P      F D I E+   G+ I  +   D D G+N +++ QI E    ++IS       +VT++   DRE  +       A D+ +P L +S  + L + D ND  P+F    Y   I+E    G S +  +V A D D N N  +++   T  + +     ++ I    G +++++    ++      +  ++A+D G P  +++  +++ L D+NDN+P F + +D  Y+  I E    G+   +V ATD D NENGKV Y++  +         Y  I+  SG ++  R+ D   L    + +MAKD+G+PS
Sbjct:  122 INVEIQDVNDNSPSFS-KSIFEISISELAVVGTHFALGSAKDPDLGNNSIQSYKLSANDYFGMLEKVNTDGRKYPELVLEKTLDREKKNSSVLI-LSAFDGGTPSKTGTSLIRIVVTDINDNYPLFNKDTYRVTVS-----ENVPIGFLVIDLHATDAD------------EGSNAE----ITYLFNDIPENAQEVFAINPENGSVQITGKLDYEVATNYEMTVEAKDGG--GLVSYCKLLIQVSDVNDNAPDILITSFSDIIPEDSRVGTVIALVNLDDLDSGENGEVVGQISESLPFHLISSSGNYYKLVTSM-DLDREKTSEYNITIKAEDKGSPQLTNSKTIRLILTDVNDNAPVFDKMDYVAYIQENNPSGNSFY--RVHATDPDINENGKVVYMILTDIIEDIPISSYVSINTVSGVLYAQRSFDYEK----LREFYIQAEDKGSPQLTNNKTIRLILTDVNDNAPVF-EKMD--YVAYIQENNPSGSSFFRVHATDSDINENGKVVYMILTDIIEDMPLSSYISINTVSGVLYAQRSFDYESLREFYIQVMAKDSGSPS 652          

HSP 3 Score: 113.62 bits (283), Expect = 6.368e-25
Identity = 149/547 (27.24%), Postives = 235/547 (42.96%), Query Frame = 2
Query:  371 LSIKLSPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDD-ETLITVLINSNSDPEVKRHFQVSAISGLTLISRLDYE-SSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKR------NYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEK------YQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFL--------SSAY----HFKIKEGYSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKG---IQLDREVQST----YQLTVEAKDNGVPSRSSSVIVQI 1912
            L I L   D+D G N+EI Y      +   ++  +       +     D E    YE+   A D G        K+ I++ D+ND+AP+  +   +   + ED+  G+ I  + + D D  E    V   S S P    H   S+ +   L++ +D +     ++ I + A D G P LT S TI + + D+NDN P  V D +   +    + EN P  +    V  TD D           I  N K  + +++    + P S        +  +   R FD E +  +   +Q +D+G P L++ +TI + + D NDN P F K  +   I+EN   GS  F + ATD DI +N K++Y I           + ISI N  +G++    SFD E       +  A D  +P  +++  V + I D+ND  P  L        +S +    HF  K GY   V KV A D DS            +L  HL  +     +   +    I++ R++Q T     ++ V  KDNG P  SS+V + +
Sbjct:  263 LVIDLHATDADEGSNAEITYLFNDIPENAQEVFAINPENGSVQITGKLDYEVATNYEMTVEAKDGG--GLVSYCKLLIQVSDVNDNAPDI-LITSFSDIIPEDSRVGTVIALVNLDDLDSGENGEVVGQISESLP---FHLISSSGNYYKLVTSMDLDREKTSEYNITIKAEDKGSPQLTNSKTIRLILTDVNDNAP--VFDKMDYVA---YIQENNPSGNSFYRVHATDPD-----------INENGKVVYMILTDIIEDIPISSYVSINTVSGVLYAQRSFDYEKLREFY--IQAEDKGSPQLTNNKTIRLILTDVNDNAPVFEKMDYVAYIQENNPSGSSFFRVHATDSDINENGKVVYMILTDIIEDMPLSSYISI-NTVSGVLYAQRSFDYESLREFYIQVMAKDSGSPSRSANATVKICITDQNDNAPKILYPSQDSEAASVFEFIPHFSTK-GY--LVTKVVAVDADS--------GHNAWLSYHLLQVPDPSFLIIGQNTGEIRITRDLQETDALRQRIVVMVKDNGYPMLSSTVTLNL 773          

HSP 4 Score: 90.8929 bits (224), Expect = 7.373e-18
Identity = 110/380 (28.95%), Postives = 164/380 (43.16%), Query Frame = 2
Query: 1121 ELISRYFNNFPNSKRNYRIVTLR--------EFDRETISHYRVTVQCKDQGL--PPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEK-YQNIISIPNPSTGIVTNLV---SFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGY--SGWVGKVEAYXXXXXXXXXIIFSFTGFLHN--HLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNKYFIIDEKSGEVF---INRTLDRLELVPRRLLIMAKDNGTP 2197
            EL SR F+    SK+ Y  V L           DRE +   +       + +   PL    TI + I+D NDN PSFSK  F+  I E  + G+      A DPD+G N+   Y++    Y  ++   N        LV   + DRE   S      A D   P    +  + + + D ND  P+F    Y   + E       V  + A D D  SN++I + F     N   ++ +  +       G +LD EV + Y++TVEAKD G     S   + IQ+ D+NDN+P     L + +   I E    GT+I  V   D D  ENG+V   ++ +  F +   SG  +    +  LDR +     + I A+D G+P
Sbjct:   61 ELSSRKFHIVSRSKKQYLNVHLENGDLYVADRIDREALCGMQQNCFLNIEAVMESPLHFY-TINVEIQDVNDNSPSFSKSIFEISISELAVVGTHFALGSAKDPDLGNNSIQSYKLSANDYFGMLEKVNTDGRKYPELVLEKTLDREKKNSSVLILSAFDGGTPSKTGTSLIRIVVTDINDNYPLFNKDTYRVTVSENVPIGFLVIDLHATDADEGSNAEITYLFNDIPENAQEVFAINPENGSVQITG-KLDYEVATNYEMTVEAKDGG--GLVSYCKLLIQVSDVNDNAPDI---LITSFSDIIPEDSRVGTVIALVNLDDLDSGENGEVVGQISESLPFHLISSSGNYYKLVTSMDLDREKTSEYNITIKAEDKGSP 433          
BLAST of protocadherin-1 vs. Ensembl Xenopus
Match: FAT4 (FAT atypical cadherin 4 [Source:NCBI gene;Acc:100145590])

HSP 1 Score: 216.468 bits (550), Expect = 2.150e-56
Identity = 189/616 (30.68%), Postives = 289/616 (46.92%), Query Frame = 2
Query:  395 DSDYGINSEIIYSI-EGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDD--ETLITVLINSNSDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDN----GIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQI----PEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGW---VGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLL-ANNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTP 2197
            D D G+N EI Y++ +  D G F L  +     +F   +  D E +  Y L   A D G   +   +++Y  I D+ND+ P F     Y   V E+   GS I    VTD DD   + ++  I+S    +    FQVS    L+++  LD E+  + F   V+ V +      P  T+S  +++ +LD+NDN P  +   L+       + EN P ++ V     TD DS            PN+   + L+    N F     +  +    E DRE IS+Y +T+  KD+G P LSS   + I + D NDN P FS+  F+  I E+ + G+ +  LIA+D D G N  + Y I    P     I S+    TG+++     DRE  +S T K  A D  +   + +  V++ + D ND +P F  S Y   + E        + +V A D+D   NS + +S      +  + L S G +   K   LDREV+  Y L + A D G P+ + +  + IQ+EDINDN P F+  L+  ++  I E    GT I  V  +D D  +NG + Y L   N  F I+  +G++  +  LDR       LL++A D G+P
Sbjct: 1854 DDDSGVNGEITYAVSDDDDDGIFFLNPVTG---VFNVTRALDYELQQYYVLTVCAQDGG--GQDSCVRVYFNILDVNDNPPVFSR-NSYSASVMENLPPGSTILTFNVTDADDGFNSKLSYTISSG---DSMGQFQVSKDGTLSVLQLLDRET--QSFYSLVVQVHDMAPPPAPRYTSSVEVSIILLDVNDNPPSFISPKLT------YVQENTPTDTVVFRAQATDPDSG-----------PNSYIQYSLLGSLGNKFSIGIIDGEVRLTGELDREDISNYTLTIIAKDKGEPSLSSSMDMNIIVLDINDNSPHFSQRHFKVEISESTLTGTDLIQLIASDADEGINGMVRYAIIDGNPSNEFRIDSV----TGVLSIARPLDRERKSSYTLKIQASDRGSSPRSDTATVSILLSDINDVVPKFELSPYTVSVPENLETLPKIILQVVARDDDQGLNSRLTYSLASGNEDGAFTLSSSGQLSLIK--SLDREVKEWYSLLITATDAGFPALTGTGTISIQVEDINDNKPTFA--LNHHFI-TIPEDAPTGTDILMVNCSDSDAGQNGVIRYSLNGGNSQFTINPSTGQIISSSLLDREAKDHYTLLVIATDGGSP 2432          

HSP 2 Score: 200.29 bits (508), Expect = 2.906e-51
Identity = 190/624 (30.45%), Postives = 287/624 (45.99%), Query Frame = 2
Query:  395 DSDYGINSEIIYS---IEGKDKGFFKLLQMKNNKPIFKTMKL-----FDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLIN-SNSDPEVKRHFQVSAISGLTLISR-LDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADS-EMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLP-PLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQ-NIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLS---SAYHFKIKEGYSGWVGK----VEAYXXXXXXXXXIIFSFTG---FLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLL--ANNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNG 2191
            DSD G N     S   + G   G FKL    N       + L      DRE    Y L+    DKG PK+ G +++ + ++D+ND+ P F   + Y   ++ED+  GS +  ++ TD+D+     +    +   P     FQ+   SGL  I   LDYES  R++T+ + A D G P LT  +   V ++D+NDN P +       +S    + EN    + VA++TVTDADS   NG V   ++  N +++FE+ +    N         I      DRE I  Y +TV   DQG P P SS  ++ I++ D ND+PP F +   +  I E++ PGS I  + A+D D G NA + Y I    +    SI + ++G+VT+  + DRE+   +     A D+      S   + + + D ND  P F     + +   + E  +  VG     ++A D D   N  I F F          L+ L       S +   LDRE Q    L + A D G P  SS+  V + L D+NDNSP F  P+   Y   I E   P + +  V A+D D   NG + Y +   +   F +  ++G +     LDR E    +L ++A D G
Sbjct:  153 DSDAGTNGVDHRSYRIVSGNQDGRFKLGITVNPSGEGAFLHLMSQGPLDRETNPCYYLLVEVEDKGTPKRLGHLQVNVTVQDINDNPPVFSSSQ-YQAKIEEDSPVGSSVLKVEATDRDEGPNAAIRYQLAEGTP-----FQIDPESGLVTIREPLDYES-RRQYTLSIQAKDLGTPPLTGRSEALVRLIDVNDNDPVVKFRYFPATSRYASVDENAQVGTVVALLTVTDADSPAANGNVTVAILGGNEQRHFEVQTSKVPNLS------LIKVASSLDRERIPSYNLTVSVSDQGHPRPRSSVASLVIYVNDINDHPPVFQEPHSKVEISEDLPPGSYICGVSASDGDTGLNANLRYSIVSGNKLGWFSI-SENSGLVTSTSALDREIAPQLLLNISARDQGPQPKTSYATLLVNLLDVNDQKPTFTGINVNGHLVSLPE--NSLVGTELLMLKATDGDLGDNGTIRFYFDADNPSQCQGLFRLDPLSGKLSNRA-DLDREQQDRCTLQILATDLGTPPLSSTAKVIVSLLDVNDNSPVF-YPVQ--YFANIQENEPPASFVATVTASDPDLGINGTIRYSIRAGDTSKFQVHPETGAISTKAALDREEKTAYQLQVVATDGG 756          

HSP 3 Score: 194.512 bits (493), Expect = 2.032e-49
Identity = 175/615 (28.46%), Postives = 283/615 (46.02%), Query Frame = 2
Query:  377 IKLSPRDSDYGINSEIIYSI-EGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVE---VTLEIEDENDCIPMFLSSAYHFKIKEGYSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTY-LLANNK--YFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPS 2200
            I+L   D+D GIN  + Y+I +G     F++  +     +    +  DRE +  Y L   A+D+G   ++    + I + D+ND  P+F++   Y + V E+     KI    V   DD+ L + L  S +       F +S+   L+LI  LD E     +++ + A D G P LT + TI++ V DINDN P     T + +     + E+ P  + + MV  +D+D+  NG++  +L   N++            F  +    +I++    DRE   HY + V   D G PPL+S   +T+ I D NDNPP F    +   I      GS +F +  TD DIG NA++ + +  +      I +P  G +    +   E  + ITF     D     LNS  +   VT+   ++ D  P+  +    F   E           + + S   S   +  +G   N   I + +G ++ +    LD E    Y+L VEA+D G P  SS   ++I + D+NDN P+F Q     ++ +I E L P  ++T + A D D   NG+V Y +   NK  +F I+  +GE+   R LDR +     L + A D G+P+
Sbjct: 2161 IQLIASDADEGINGMVRYAIIDGNPSNEFRIDSVTG---VLSIARPLDRERKSSYTLKIQASDRGSSPRSDTATVSILLSDINDVVPKFEL-SPYTVSVPENLETLPKIILQVVARDDDQGLNSRLTYSLASGNEDGAFTLSSSGQLSLIKSLDREVK-EWYSLLITATDAGFPALTGTGTISIQVEDINDNKP-----TFALNHHFITIPEDAPTGTDILMVNCSDSDAGQNGVIRYSLNGGNSQ------------FTINPSTGQIISSSLLDREAKDHYTLLVIATDGGSPPLTSTTNVTVNIRDVNDNPPRFLHHPYVTHIPSPTTAGSFVFAVTVTDEDIGSNAELHFSLKGRNSEKFHI-DPLRGAIRTAGAI--EGASEITFSVHVRDGG---LNSKTDLTTVTVRFANKAD-FPLIRADRKTFTFPENQEVGTLVSTIFGSSSRGGSLSFYIASGNFGNTFHIDELNGQLYIKN--PLDFETMPKYELWVEARDMGFPPFSSYEKLEITVLDVNDNQPQFKQ---DPFIAEIIENLSPRKILT-ISAEDKDSGSNGQVEYTIFDGNKEAFFSINRVNGEIRNTRQLDREKASQYTLSVKASDKGSPA 2740          

HSP 4 Score: 190.274 bits (482), Expect = 3.386e-48
Identity = 182/620 (29.35%), Postives = 284/620 (45.81%), Query Frame = 2
Query:  395 DSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKD---DETLITVLINSNSDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNG--IVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYR------VTVQCKDQGLP-PLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGY--SGWVGKVEAYXXXXXXXXXIIFSFTGF-LHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNK----YFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTP 2197
            D D G+N  + YS++   +  F + ++     +   + +    +   Y++  IA+D G+P+      + I + D+ND+ P FD    Y + + E     S+   +  TDKD   +  +   +I+ N    V   F +     L + S LD E     + + V A D  +  L+T+  +T+ + D+NDN P       + ++  F   E     SFV  +   D DS  NG  +     ++P+    FEL          +     I +  +FDRE +   R      + V   D GLP PL  Q T+ I+I D NDN P FSK  +Q  I E     + +  + ++D D G N  I Y I +  +      + STG V  +   D E   S +    A+D     L+++  +++E+ DEND  P F  +A    + E       V  V A D+DS  N+DI +S TG   H    I  + G+IF  K  +LD E Q+ Y+L + AKD G P RSS++ V I++ D NDN P F         K + E ++ GT I  V ATD D + NG++TY +   K    +F+IDE  G ++ N  +DR       L + A D   P
Sbjct:  906 DPDEGVNGRVSYSLKQNPQSLFYVDEVTGAVSLTGPLDV----DTGSYQVEIIASDMGVPQLASSFILTISVHDVNDNPPVFDQ-LSYEVTLLESEPVNSRFFKVYATDKDSGLNGEITYSIIHGN----VGEAFGIFPDGQLYVKSELDREVK-DLYILQVSASDRAVEPLSTTVNVTIILEDVNDNRP-----LFNSTNYVFYFEEENSGGSFVGRIYAVDKDSGSNGEIMYAFETMQPD----FEL----------NTVTGEITSTHQFDREALMRQRGAAAFTLKVTSTDLGLPKPLKDQATVQIYIRDINDNHPKFSKDLYQASISELASNMTQVLRVSSSDVDEGNNGLISYSIMKGNEEKHFTMDSSTGQVALVGRLDYEATASYSLIIQAVDSGAVPLSATSTLSIEVLDENDNSPSFPKAALFVDVVENMRVGELVSSVTATDSDSGDNADIHYSITGTNNHGTFSISPNTGSIFLAK--KLDFETQALYKLNITAKDKGNPPRSSTMSVIIKVRDFNDNPPSFPA---GDIFKSVVENVLIGTSILTVTATDPDADINGQLTYTIIQQKPRGNHFVIDEVRGTIYTNAEIDREFANLFELTVRASDLAVP 1491          

HSP 5 Score: 173.711 bits (439), Expect = 5.197e-43
Identity = 179/604 (29.64%), Postives = 273/604 (45.20%), Query Frame = 2
Query:  434 IEGKDKGFFKLLQMK-NNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIK-IYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKD---DETLITVLINSNSDPEVKRHFQVSAISGL-TLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVA----MVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKE----GYSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANN--KYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTP 2197
            + G ++  F++   K  N  + K     DRE    Y L    +D+G P+    +  + I + D+NDH P F  P   V  + ED   GS IC +  +D D   +  L   +++ N        F +S  SGL T  S LD E +  +  + + A D G    T+  T+ VN+LD+ND  P     T +  + N  L+ + P+ S V     M+  TD D   NG +       N  Q   L       F     + ++    + DRE      + +   D G PPLSS   + + + D NDN P F    +   I+EN  P S + T+ A+DPD+G N  I Y I     +   + +P TG ++   + DRE  T+   +  A D      ++   VT+ + D  D  P F   +Y F + E    GY+  VG V A   D N+N   + + TG       I +S G I +   +  DRE Q  YQL V A    V   +   IV I ++D+NDNSP F   +++  + +  +T   G +I +  A D DE  NG+V+Y L  N    F +DE +G V +   LD ++    ++ I+A D G P
Sbjct:  390 LGGNEQRHFEVQTSKVPNLSLIKVASSLDRERIPSYNLTVSVSDQGHPRPRSSVASLVIYVNDINDHPPVFQEPHSKV-EISEDLPPGSYICGVSASDGDTGLNANLRYSIVSGNK----LGWFSISENSGLVTSTSALDREIA-PQLLLNISARDQGPQPKTSYATLLVNLLDVNDQKP-----TFTGINVNGHLV-SLPENSLVGTELLMLKATDGDLGDNGTIRFYFDADNPSQCQGL-------FRLDPLSGKLSNRADLDREQQDRCTLQILATDLGTPPLSSTAKVIVSLLDVNDNSPVFYPVQYFANIQENEPPASFVATVTASDPDLGINGTIRYSIRAGDTSKFQV-HPETGAISTKAALDREEKTAYQLQVVATDGGGLQSHNHAIVTITVLDTQDNPPSFSQGSYSFVMFENVAVGYN--VGTVVATTIDLNTNITYLVT-TGDQKGVFTIDRSTGLIMTASVV--DREEQDFYQLKVVASGGAV---TGEAIVNITVKDLNDNSPHFVNAVENVNVVENWKT---GHIIFQAKAVDPDEGVNGRVSYSLKQNPQSLFYVDEVTGAVSLTGPLD-VDTGSYQVEIIASDMGVP 961          

HSP 6 Score: 172.17 bits (435), Expect = 1.515e-42
Identity = 171/625 (27.36%), Postives = 289/625 (46.24%), Query Frame = 2
Query:  380 KLSPRDSDYGINSEIIYSI----EGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISG-LTLISRLDYESSMRK-----FTIPVIAVDNGIPN-LTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGY--SGWVGKVEAYXXXXXXXXXIIFSF--TGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVI---VQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTY--LLANNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGT 2194
            K+   D D G+N EI YSI     G+  G F   Q+             DRE +D Y L   A+D+ +   +  + + I + D+ND+ P F+   +YV   +E+   GS +  I   DKD  +   ++    +   ++  F+++ ++G +T   + D E+ MR+     FT+ V + D G+P  L    T+ + + DINDN P+   D    S S  +L  N  +   V  V+ +D D   NG++  ++++ N +++F + S             ++  +   D E  + Y + +Q  D G  PLS+  T++I + DENDN PSF K      + EN+  G  + ++ ATD D G NA I Y I     +     +P+TG +      D E          A D+ NP  +S++ V +++ D ND  P F +      + E       +  V A D D++ N  + ++        NH  I +  G I++    ++DRE  + ++LTV A D  VP  S       V I + D+NDN P F     S        +L  G++++ + A D DE  NG++ Y  +  + + FI+D  SG++ +   +    L+   L++ A D G 
Sbjct: 1004 KVYATDKDSGLNGEITYSIIHGNVGEAFGIFPDGQL-------YVKSELDREVKDLYILQVSASDRAVEPLSTTVNVTIILEDVNDNRPLFNS-TNYVFYFEEENSGGSFVGRIYAVDKDSGSNGEIMYAFET---MQPDFELNTVTGEITSTHQFDREALMRQRGAAAFTLKVTSTDLGLPKPLKDQATVQIYIRDINDNHPKFSKDLYQASIS--ELASNMTQ---VLRVSSSDVDEGNNGLISYSIMKGNEEKHFTMDS----------STGQVALVGRLDYEATASYSLIIQAVDSGAVPLSATSTLSIEVLDENDNSPSFPKAALFVDVVENMRVGELVSSVTATDSDSGDNADIHYSITGTNNHGTFSISPNTGSIFLAKKLDFETQALYKLNITAKDKGNPPRSSTMSVIIKVRDFNDNPPSFPAGDIFKSVVENVLIGTSILTVTATDPDADINGQLTYTIIQQKPRGNHFVIDEVRGTIYTNA--EIDREFANLFELTVRASDLAVPLESRKYALKNVTILISDLNDNVPTFV----SQNAFAADPSLAIGSVLSTITAFDPDEGSNGEIEYEIISGDTETFIVDRYSGDLRVAAPMLPSHLI-YSLIVAATDLGA 1595          

HSP 7 Score: 163.31 bits (412), Expect = 7.310e-40
Identity = 168/623 (26.97%), Postives = 287/623 (46.07%), Query Frame = 2
Query:  395 DSDYGINSEIIYSIEGKDKGF---------FKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISG-LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVT--NLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGY--SGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSS--SVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENEN-GKVTYLLANNK---YFIIDEKSGEVFINRTLDRLELVP-RRLLIMAKDNGTPS 2200
            DSD G+N  + Y I+ + + F         F    +K   P      +      +R+  +  A+D+G P    E  + I I D ND+AP+F   K Y   V ++A  G+K+  +   D  D  L + +  S S   +   FQ+   +G +T+ S L  + + + + I V A D G P L++   + + V + N + P+      S S  +  ++E+    + +  ++  D D+ MNGI+  N+   N    F +          +     +  L+  D E    + +T+   D G    +    +TI+++D NDNPP F    +   + EN   G+ +  L ATD D   NA I Y +     ++  I +P+TGI+T    + ++ + +  +T KAF + +      S V VT+++E  N+ +P F+S  Y+F++ E       VG+V A D D   + D+ +   G      + +       S  GI LDRE +    L + AK+ G    +    V V I + D ND  P FS  +   Y  +I+E + PGT +T V A D D   +  + +Y + +      F I+ ++G+V +   LDR E+ P   L ++A D+G+PS
Sbjct: 2886 DSDEGLNGHVYYFIKSQSELFRINSTTGEIFNKQHLKYQNP-----SVSGNININRHSFIVSASDRGSPPIMSETTVSINIVDSNDNAPKFSSTK-YFTPVSKNAKIGTKLIKVTAVDDKDFGLNSEVGYSLSTENIHGKFQIDKETGWITVASSLMMDIN-KNYMIKVFAKDKGNPPLSSQALVNITVTEENYHTPE-----FSQSHVSVTVLESLSVGTVIRTISARDRDASMNGIIAYNISSGNEAGLFAI----------NASTGALSLLKNLDYELCQKHDLTISAVDGGWVAKTGYCVVTIYVKDVNDNPPIFKADEYFPSVMENAPSGTTVIRLNATDVDSAPNAVIAYSVQSSDSDLFVI-DPNTGIITTQGFLDYETKQHYHLTVKAFNVPDEERC--SFVTVTVQLEGANEYVPRFVSKLYYFEVSEAAPKGTVVGEVFASDRDGGIDGDVHYLIFGSSRKKGFQIDKKTGKISVSGI-LDREKEERISLKIIAKNVGSIRGADIDEVNVNITILDAND-PPVFSLKV---YNVQISEGVTPGTHVTFVSAFDSDSVPSWSRFSYFIGSGNDKGAFAINPQTGQVTVTTELDR-EMTPLYNLTVLAIDSGSPS 3477          

HSP 8 Score: 156.377 bits (394), Expect = 1.271e-37
Identity = 170/620 (27.42%), Postives = 281/620 (45.32%), Query Frame = 2
Query:  380 KLSPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISGLTL-ISRLDYES-------SMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPK--ESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKE-GYSG-WVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLL---ANNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGT 2194
            +++  D D G N+   Y+I      F     +  N  +    +  +RE+ DRY +   A D G    T    + I + D+ND+AP F  P  Y +   E    GSK+  +  TD D+     V     S  E+   F++++ +G       L Y++       ++ + +  V A D G P + + TT+++N++D NDN P+        S+  F  +    K     + +  V D D  +N  V  +L   N    F++           K    I        +   +Y + V  KD+G PPLSSQ  + I + +EN + P FS+      + E++  G+ I T+ A D D   N  I Y I    +  +   N STG ++ L + D E+         A+D           VT+ ++D ND  P+F +  Y   + E   SG  V ++ A D DS  N+ I +S      + L+++  +  I + +G  LD E +  Y LTV+A +     R S V V +QLE  N+  P+F   L   Y  +++E    GT++ +V A+D D   +G V YL+   +  K F ID+K+G++ ++  LDR +     L I+AK+ G+
Sbjct: 2781 QVTTSDEDAGANAISRYTIADTSLPF----HINLNTGVITVSRPLNREDNDRYIVRVSAHDSGWTVST---DVTIFVTDVNDNAPRFSKPS-YYLDYPETLDIGSKVTQVFATDSDEGLNGHVYYFIKSQSEL---FRINSTTGEIFNKQHLKYQNPSVSGNININRHSFIVSASDRGSPPIMSETTVSINIVDSNDNAPKF------SSTKYFTPVSKNAKIGTKLIKVTAVDDKDFGLNSEVGYSLSTENIHGKFQI----------DKETGWITVASSLMMDINKNYMIKVFAKDKGNPPLSSQALVNITVTEENYHTPEFSQSHVSVTVLESLSVGTVIRTISARDRDASMNGIIAYNISSGNEAGLFAINASTGALSLLKNLDYELCQKHDLTISAVDGGWVAKTGYCVVTIYVKDVNDNPPIFKADEYFPSVMENAPSGTTVIRLNATDVDSAPNAVIAYSVQSS-DSDLFVIDPNTGIITTQGF-LDYETKQHYHLTVKAFNVPDEERCSFVTVTVQLEGANEYVPRFVSKL---YYFEVSEAAPKGTVVGEVFASDRDGGIDGDVHYLIFGSSRKKGFQIDKKTGKISVSGILDREKEERISLKIIAKNVGS 3368          

HSP 9 Score: 154.451 bits (389), Expect = 4.014e-37
Identity = 176/636 (27.67%), Postives = 284/636 (44.65%), Query Frame = 2
Query:  335 IVLPHTVD*FWRLSIKLSPRDSDYGINSEIIYSI-EGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKD--DETLITVLINSNSDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKE----SFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDR-----ETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIAT--DPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGW-VGKVEAYXXXXXXXXXIIFS-FTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNKY-FIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNG 2191
            + +P  ++   ++ +++  RD D G+NS + YS+  G + G F L    ++      +K  DRE ++ Y L+  ATD G P  TG   I I++ D+ND+ P F +   + I + EDA  G+ I  +  +D D     +I   +N  +       F ++  +G  + S L    +   +T+ VIA D G P LT++T +TVN+ D+NDN P+ +         +   + + P      SFV  VTVTD D           I  N + +F L  R      NS++ + I  LR   R     E  S    +V  +D GL   +   T+T+   ++ D P         DR          + TL++T         +   Y     + N   I +   G +      D E          A D   P  +S  ++ + + D ND  P F    +  +I E  S   +  + A D DS SN  + ++ F G       I + +G I + +  QLDRE  S Y L+V+A D G P+RSS V V I + D NDN+P+FSQ     +   + E  V G  +T+V  +D+D   N    Y +A+    F I+  +G + ++R L+R +     + + A D+G
Sbjct: 2253 VSVPENLETLPKIILQVVARDDDQGLNSRLTYSLASGNEDGAFTL----SSSGQLSLIKSLDREVKEWYSLLITATDAGFPALTGTGTISIQVEDINDNKPTFAL-NHHFITIPEDAPTGTDILMVNCSDSDAGQNGVIRYSLNGGNS-----QFTINPSTGQIISSSLLDREAKDHYTLLVIATDGGSPPLTSTTNVTVNIRDVNDNPPRFL---------HHPYVTHIPSPTTAGSFVFAVTVTDED-----------IGSNAELHFSLKGR------NSEK-FHIDPLRGAIRTAGAIEGASEITFSVHVRDGGLNSKTDLTTVTVRFANKADFP-----LIRADRKTFTFPENQEVGTLVSTIFGSSSRGGSLSFYIASGNFGNTFHI-DELNGQLYIKNPLDFETMPKYELWVEARDMGFPPFSSYEKLEITVLDVNDNQPQFKQDPFIAEIIENLSPRKILTISAEDKDSGSNGQVEYTIFDGNKEAFFSINRVNGEIRNTR--QLDREKASQYTLSVKASDKGSPARSSIVKVIIYVLDDNDNAPRFSQI----FSAFVAENAVLGCFVTQVTTSDEDAGANAISRYTIADTSLPFHINLNTGVITVSRPLNREDNDRYIVRVSAHDSG 2839          

HSP 10 Score: 149.828 bits (377), Expect = 1.019e-35
Identity = 173/617 (28.04%), Postives = 264/617 (42.79%), Query Frame = 2
Query:  395 DSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKK--TGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTD-KDDETLITVLINS--NSDPEVKRHFQVSAISG-LTLISRLDYESSMRKFTIPVIAVDN--GIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGY--SGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNG---VPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANN--KYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPS 2200
            D D G N EI Y I   D   F + +   +  +   M          Y L+  ATD G  +K  T E+ I ++ +D     P F  PK Y+  +KE    G+ +  I+    +  ++++   I S       V R F +   +G +   + LD E   R + + V A++    +P  T    + + + DINDN P    D L     +  + EN    S +  +T TDAD   N +V            + +IS   ++F     +  ++  +  DRE  S Y + V+  D GL   SS   I I I D ND+ P FS+  +   + E+ +PGS +  ++ATD D G N +I Y + +   + I   NP TG+     + D E+         A D      +S V V   I D ND  P+F  ++Y   + E       +      D D   NS + ++ +       + +  DG +   +   LDRE QS Y L V+  D      P  +SSV V I L D+NDN P F  P     +  + E     T++ +  ATD D   N  + Y L  +    F I    GEV +   LDR ++    L I+AKD G PS
Sbjct: 1541 DPDEGSNGEIEYEIISGDTETFIVDRYSGDLRVAAPM----LPSHLIYSLIVAATDLGAERKATTTELTIILEGQD----GPVFSQPK-YITILKEGEPVGTNVISIEAASPRGTDSVVEYFIVSVRCEGRTVGRLFTIGRNTGVIQTAAVLDRERGARLYLVDVYAIEKEASLPK-TQRAQVEITLQDINDNPPVFPTDIL-----DLTVEENVGDGSKIMQLTATDADEGPNALV-----------TYTIISGADDSFRIDPESGDLIATKRLDRERRSKYSLLVRA-DDGL--QSSDMRINITISDVNDHIPKFSRAVYSFDVAEDTIPGSIVAAILATDDDSGVNGEITYAVSDDDDDGIFFLNPVTGVFNVTRALDYELQQYYVLTVCAQDGGG--QDSCVRVYFNILDVNDNPPVFSRNSYSASVMENLPPGSTILTFNVTDADDGFNSKLSYTISSGDSMGQFQVSKDGTLSVLQ--LLDRETQSFYSLVVQVHDMAPPPAPRYTSSVEVSIILLDVNDNPPSFISP----KLTYVQENTPTDTVVFRAQATDPDSGPNSYIQYSLLGSLGNKFSIGIIDGEVRLTGELDREDISNYTLTIIAKDKGEPS 2120          

HSP 11 Score: 149.443 bits (376), Expect = 1.532e-35
Identity = 169/624 (27.08%), Postives = 272/624 (43.59%), Query Frame = 2
Query:  395 DSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREE--RDRYELVFI----ATDKGIPKK-TGEIKIYIKIRDLNDHAPEFDMPKD-YVIGVKEDAIEGSKICDIKVTDKDD--ETLITVLINSNSDPEVKRHFQVSAISG-LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEK--YQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVE---VTLEIEDENDCIPMF-----------------LSSAYHFKIKEGYSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLAN--------NKYFIIDEKSGEVFINRTLDR 2143
            D D G N EI+Y+ E     F    ++        +   FDRE   R R    F     +TD G+PK    +  + I IRD+ND+ P+F   KD Y   + E A   +++  +  +D D+    LI+  I   ++   ++HF + + +G + L+ RLDYE++   +++ + AVD+G   L+ ++T+++ VLD NDN P     +   ++    ++EN      V+ VT TD+DS  N  +  ++   NN   F +        PN+     I   ++ D ET + Y++ +  KD+G PP SS  ++ I + D NDNPPSF        + EN++ G+ I T+ ATDPD   N ++ Y I ++    N   I      I TN    DRE          A D   PL +       VT+ I D ND +P F                 LS+   F   EG +   G++E      ++ + I+  ++G L     +L S                   Y L V A D G   ++++  + I LE    + P FSQP    Y+  + E    GT +  + A       +  V Y + +         + F I   +G +     LDR
Sbjct: 1113 DKDSGSNGEIMYAFETMQPDF----ELNTVTGEITSTHQFDREALMRQRGAAAFTLKVTSTDLGLPKPLKDQATVQIYIRDINDNHPKFS--KDLYQASISELASNMTQVLRVSSSDVDEGNNGLISYSIMKGNE---EKHFTMDSSTGQVALVGRLDYEATA-SYSLIIQAVDSGAVPLSATSTLSIEVLDENDNSP-----SFPKAALFVDVVENMRVGELVSSVTATDSDSGDNADIHYSITGTNNHGTFSI-------SPNTGS---IFLAKKLDFETQALYKLNITAKDKGNPPRSSTMSVIIKVRDFNDNPPSFPAGDIFKSVVENVLIGTSILTVTATDPDADINGQLTYTIIQQKPRGNHFVIDEVRGTIYTN-AEIDREFANLFELTVRASDLAVPLESRKYALKNVTILISDLNDNVPTFVSQNAFAADPSLAIGSVLSTITAFDPDEGSN---GEIEYEIISGDTETFIVDRYSGDLRVAAPMLPS----------------HLIYSLIVAATDLGAERKATTTELTIILE--GQDGPVFSQP---KYITILKEGEPVGTNVISIEAA-SPRGTDSVVEYFIVSVRCEGRTVGRLFTIGRNTGVIQTAAVLDR 1685          

HSP 12 Score: 135.961 bits (341), Expect = 2.146e-31
Identity = 136/451 (30.16%), Postives = 203/451 (45.01%), Query Frame = 2
Query:  902 TTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGI--VDCNLIEPNNKQNFELISRYFNNFPNSKRNY-RIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPM-----FLSSAYHFKIKEGYSGWVGKVEAYXXX------XXXXXXIIFSFTGFLHNHLWILKSDGNIFS--EKGIQLDREVQSTYQLTVEAKDNGVP-SRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTY-LLANNK--YFIIDEKSGEVFINRTLDRLELVPRRLL-IMAKDNG 2191
            T  T + + VLDINDN P        + S      E+      V + T TD+D+  NG+      ++  N    F+L        P+ +  +  +++    DRET   Y + V+ +D+G P       + + ++D NDNPP FS   +Q +I+E+   GS +  + ATD D G NA I YQ+ E     I   +P +G+VT     D E     T    A D   P L    E  + + D ND  P+     F +++ +  + E  +  VG V A          + + +  +    G    H  +  S     S  +    LDRE   +Y LTV   D G P  RSS   + I + DIND+ P F +P       +I+E L PG+ I  V A+D D   N  + Y +++ NK  +F I E SG V     LDR E+ P+ LL I A+D G
Sbjct:  108 TYPTEVRITVLDINDNSP-----VFPEPSIVVSFKEDTQGGRQVILDTATDSDAGTNGVDHRSYRIVSGNQDGRFKL---GITVNPSGEGAFLHLMSQGPLDRETNPCYYLLVEVEDKGTPKRLGHLQVNVTVQDINDNPPVFSSSQYQAKIEEDSPVGSSVLKVEATDRDEGPNAAIRYQLAEGTPFQI---DPESGLVTIREPLDYESRRQYTLSIQAKDLGTPPLTGRSEALVRLIDVNDNDPVVKFRYFPATSRYASVDE--NAQVGTVVALLTVTDADSPAANGNVTVAILGGNEQRHFEVQTSKVPNLSLIKVASSLDRERIPSYNLTVSVSDQGHPRPRSSVASLVIYVNDINDHPPVFQEPHSK---VEISEDLPPGSYICGVSASDGDTGLNANLRYSIVSGNKLGWFSISENSGLVTSTSALDR-EIAPQLLLNISARDQG 541          

HSP 13 Score: 135.961 bits (341), Expect = 2.146e-31
Identity = 159/623 (25.52%), Postives = 282/623 (45.26%), Query Frame = 2
Query:  383 LSPRDSDYGINSEIIYSIEG-KDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISGLTLI-SRLDYESSMRKFTIPVIAVDNGIPNLTTSTT---ITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISH--YRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQI------PEKYQNIISIPNPSTGIVTNLVSFDREMNTSITF-KAFALDEFNPLLNSS-VEVTLEIEDENDCIPMFLSSAYHFKIKE--GYSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLA---NNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNG 2191
            ++  DSD G N++I YSI G  + G F +    N   IF   KL D E +  Y+L   A DKG P ++  + + IK+RD ND+ P F    D    V E+ + G+ I  +  TD D +    +            HF +  + G     + +D E +   F + V A D  +P  +       +T+ + D+NDN P  V      S + F    +    S ++ +T  D D   NG ++  +I   + + F ++ RY  +            LR       SH  Y + V   D G    ++   +TI +E ++   P FS+  +   +KE    G+ + ++ A  P  G ++ + Y I            + +I   +TG++      DRE    +     +A+++   L  +   +V + ++D ND  P+F +      ++E  G    + ++ A D D   N+ + ++      +   I    G++ + K  +LDRE +S Y L V A D+G+  +SS + + I + D+ND+ PKFS+ +   Y   + E  +PG+++  ++ATDDD   NG++TY ++   ++  F ++  +G   + R LD        L + A+D G
Sbjct: 1324 VTATDSDSGDNADIHYSITGTNNHGTFSI--SPNTGSIFLAKKL-DFETQALYKLNITAKDKGNPPRSSTMSVIIKVRDFNDNPPSFPA-GDIFKSVVENVLIGTSILTVTATDPDADINGQLTYTIIQQKPRGNHFVIDEVRGTIYTNAEIDREFA-NLFELTVRASDLAVPLESRKYALKNVTILISDLNDNVPTFV------SQNAFAADPSLAIGSVLSTITAFDPDEGSNGEIEYEIIS-GDTETF-IVDRYSGD------------LRVAAPMLPSHLIYSLIVAATDLGAERKATTTELTIILEGQDG--PVFSQPKYITILKEGEPVGTNVISIEAASPR-GTDSVVEYFIVSVRCEGRTVGRLFTI-GRNTGVIQTAAVLDRERGARLYLVDVYAIEKEASLPKTQRAQVEITLQDINDNPPVFPTDILDLTVEENVGDGSKIMQLTATDADEGPNALVTYTIISGADDSFRIDPESGDLIATK--RLDRERRSKYSLLVRA-DDGL--QSSDMRINITISDVNDHIPKFSRAV---YSFDVAEDTIPGSIVAAILATDDDSGVNGEITYAVSDDDDDGIFFLNPVTGVFNVTRALDYELQQYYVLTVCAQDGG 1909          

HSP 14 Score: 131.724 bits (330), Expect = 4.248e-30
Identity = 169/623 (27.13%), Postives = 271/623 (43.50%), Query Frame = 2
Query:  395 DSDYGINSEIIYSIEGKD-KGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISG-LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREF-DRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFA----------LDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYS--GWVGKVEAYXXXXXXXXXIIFSFTGFLHNH--LWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENEN-GKVTYLLAN----NKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTP 2197
            D D+G+NSE+ YS+  ++  G F++ +      +  ++ +   +    Y +   A DKG P  + +  + I + + N H PEF       + V E    G+ I  I   D+D      +  N +S  E    F ++A +G L+L+  LDYE   +K  + + AVD G    T    +T+ V D+NDN P    D    S     +MEN P  + V  +  TD DS  N ++  ++   +        S  F   PN+     I+T + F D ET  HY +TV+  +       S  T+T+ +E  N+  P F    +   + E    G+ +  + A+D D G +  + Y I    +      +  TG ++     DRE    I+ K  A          +DE N        V + I D ND  P+F    Y+ +I EG +    V  V A+D+DS  +      F G  ++     I    G +      +LDRE+   Y LTV A D+G PS + S  + + L+DINDN P  S         ++ E    GT +  + +TD D   N G  +Y L +      YF +    G +   R +DR ++    L ++ +D+G P
Sbjct: 2998 DKDFGLNSEVGYSLSTENIHGKFQIDKETGWITVASSLMM---DINKNYMIKVFAKDKGNPPLSSQALVNITVTEENYHTPEFSQ-SHVSVTVLESLSVGTVIRTISARDRDASMNGIIAYNISSGNEAGL-FAINASTGALSLLKNLDYEL-CQKHDLTISAVDGGWVAKTGYCVVTIYVKDVNDNPPIFKADEYFPS-----VMENAPSGTTVIRLNATDVDSAPNAVIAYSVQSSD--------SDLFVIDPNTG----IITTQGFLDYETKQHYHLTVKAFNVPDEERCSFVTVTVQLEGANEYVPRFVSKLYYFEVSEAAPKGTVVGEVFASDRDGGIDGDVHYLIFGSSRKKGFQIDKKTGKISVSGILDREKEERISLKIIAKNVGSIRGADIDEVN--------VNITILDAND-PPVFSLKVYNVQISEGVTPGTHVTFVSAFDSDSVPSWSRFSYFIGSGNDKGAFAINPQTGQVTVTT--ELDREMTPLYNLTVLAIDSGSPSATGSAALLVTLDDINDNGPTLST-----TKGEVKENYRAGTHVMTLQSTDLDLPPNQGPFSYYLLSTGPATSYFSL-SPGGILTTTREIDREQINEFFLSVVTRDSGFP 3580          

HSP 15 Score: 99.7525 bits (247), Expect = 2.141e-20
Identity = 99/354 (27.97%), Postives = 162/354 (45.76%), Query Frame = 2
Query:  395 DSDYGINSEIIYSIEG--KDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTG--EIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDE---TLITVLINSNSDPEVKRHFQVSAISG-LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQ-NFELIS-----RYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNP--PSFSKFFFQDRIKENIMPGSPIFTLIATDPDI 1408
            D D GI+ ++ Y I G  + KGF    Q+           + DRE+ +R  L  IA + G  +     E+ + I I D ND  P F + K Y + + E    G+ +  +   D D     +  +  I S +D   K  F ++  +G +T+ + LD E +   + + V+A+D+G P+ T S  + V + DINDN P +       S++  ++ EN    + V  +  TD D           + PN    ++ L+S      YF+  P       + T RE DRE I+ + ++V  +D G P +SS  T+ I + D+NDNP  P     F       N+ PG  + ++   DPD+
Sbjct: 3312 DRDGGIDGDVHYLIFGSSRKKGF----QIDKKTGKISVSGILDREKEERISLKIIAKNVGSIRGADIDEVNVNITILDAND-PPVFSL-KVYNVQISEGVTPGTHVTFVSAFDSDSVPSWSRFSYFIGSGND---KGAFAINPQTGQVTVTTELDREMTPL-YNLTVLAIDSGSPSATGSAALLVTLDDINDNGPTL-------STTKGEVKENYRAGTHVMTLQSTDLD-----------LPPNQGPFSYYLLSTGPATSYFSLSPGGI----LTTTREIDREQINEFFLSVVTRDSGFPQMSSTGTVHITVTDQNDNPSEPRAVDIFVH--YYGNLFPGGTLGSVKPQDPDV 3631          

HSP 16 Score: 85.8853 bits (211), Expect = 4.180e-16
Identity = 55/126 (43.65%), Postives = 64/126 (50.79%), Query Frame = 2
Query: 1820 LDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTP 2197
            LDRE    Y L VE +D G P R   + V + ++DINDN P FS    S Y  KI E    G+ + KV ATD DE  N  + Y LA    F ID +SG V I   LD        L I AKD GTP
Sbjct:  200 LDRETNPCYYLLVEVEDKGTPKRLGHLQVNVTVQDINDNPPVFSS---SQYQAKIEEDSPVGSSVLKVEATDRDEGPNAAIRYQLAEGTPFQIDPESGLVTIREPLDYESRRQYTLSIQAKDLGTP 322          

HSP 17 Score: 72.0182 bits (175), Expect = 6.276e-12
Identity = 103/349 (29.51%), Postives = 149/349 (42.69%), Query Frame = 2
Query: 1259 LSSQQT----ITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNA--KIIYQIPEKYQNI-----ISIPNPST-GIVTNLVS---FDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEG--YSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFS---EKGI-----QLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSP--KFSQ-PLDSGYMKKITETLVPGTLITKVMATD-DDENENGKVTY-LLANNKYFIIDEKSGEV------FINRTLDRLELVPRRLLIMAKDNGTP 2197
            LSSQ T    + I + D NDN P F +       KE+   G  +    ATD D G N      Y+I    Q+      I++ NPS  G   +L+S    DRE N          D+  P     ++V + ++D ND  P+F SS Y  KI+E       V KVEA D D   N+ I +              ++G  F    E G+      LD E +  Y L+++AKD G P  +      ++L D+NDN P  KF   P  S Y   + E    GT++  +  TD D    NG VT  +L  N+    + ++ +V       +  +LDR  +    L +   D G P
Sbjct:  103 LSSQPTYPTEVRITVLDINDNSPVFPEPSIVVSFKEDTQGGRQVILDTATDSDAGTNGVDHRSYRIVSGNQDGRFKLGITV-NPSGEGAFLHLMSQGPLDRETNPCYYLLVEVEDKGTPKRLGHLQVNVTVQDINDNPPVFSSSQYQAKIEEDSPVGSSVLKVEATDRDEGPNAAIRYQL------------AEGTPFQIDPESGLVTIREPLDYESRRQYTLSIQAKDLGTPPLTGRSEALVRLIDVNDNDPVVKFRYFPATSRY-ASVDENAQVGTVVALLTVTDADSPAANGNVTVAILGGNEQRHFEVQTSKVPNLSLIKVASSLDRERIPSYNLTVSVSDQGHP 437          
BLAST of protocadherin-1 vs. Ensembl Mouse
Match: Pcdh11x (protocadherin 11 X-linked [Source:MGI Symbol;Acc:MGI:2442849])

HSP 1 Score: 220.32 bits (560), Expect = 1.876e-58
Identity = 192/618 (31.07%), Postives = 297/618 (48.06%), Query Frame = 2
Query:  395 DSDYGINSEIIYSIEGKDKGFFKLLQMK----NNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKD--DETLITVLINSNSDPEVKRHFQVSAISGL-TLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLM-ENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQI----PEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGY--SGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLL--ANNK-YFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTP 2197
            D D GIN    Y +  K +  F L  ++    +  P     K  DREE+D Y +     D G P+++    + + + D ND+ P F + K+  + + E+A  GS +  +  TD D  +   I    ++      KR F ++  +GL T+   LD E S     + V+A D G  +     T+ VNV DINDN P I I  + + ++   L+ EN P  + +A++TV D DSE NG V C     +++  F L   + N F        + T    D E+   Y + +   D G PPL+    + I ++DENDN P F++ F    + EN  PG+ +  + ATD D G+NA+I Y +    P ++ N+    +  TGI+T +   DRE      F   A D   P L S+  V + + D+ND  P+F  + Y+F + E     G VG +   D D   NS +  S    +++   I    G I     I  DRE Q +Y   V+A+D G  SRSS+  V I + D+NDN P F  P  +   + +  +  PGT++ KV+A DDD   N +V Y +   N K  F+I++ SG + +       +L   R+++ A D G P
Sbjct:  165 DPDIGINGVQNYQLI-KSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIF-IEKEIEVSIPENAPIGSSVTQLHATDADIGENARIHFYFSNLVSNIAKRLFHLNTTTGLITVKEPLDREES-PSHKLLVLATDGG--STPARATVLVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKIALITVMDKDSEHNGRVTCFT---DHEVPFRLRPVFSNQF-------LLETAAFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLTKISATDADSGQNAEISYMLGFDAPPEF-NL----DQRTGILTAVKKLDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTHNEYNFYVPESLPKHGTVGLITVTDPDYGENSAVTLSILD-VNDQFTIDPQSGVI--RPNISFDRERQESYTFYVKAEDGGRVSRSSTARVTINVVDVNDNKPIFIDPPSNYSFEWVLPSTNPGTVVFKVVAIDDDIGMNAEVLYSIVGGNTKGLFMIEQTSGNITLKEKCMVSDLGLHRVIVKANDLGQP 759          

HSP 2 Score: 109.383 bits (272), Expect = 1.327e-23
Identity = 148/563 (26.29%), Postives = 238/563 (42.27%), Query Frame = 2
Query:  590 IKIYIKIRDLNDHAPEFDMPKDYV-IGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRH---FQVSAISG--------LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVD---CNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLRE-FDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIM--PGSPIFTLIA----TDPDIGKNAKII----YQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYS--GWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTY-LLANNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNG 2191
            +KI   I D+ND+AP F  P   + I + E++   S+       D D      + IN   + ++ +    F +  I          L +   LD E     + + V   D G P  +++  + V+V D NDN P  +     +      + EN P  S V  +  TDAD   N  +     NL+    K+ F L                ++T++E  DRE    +++ V   D G  P  ++ T+ + + D NDN PS    +  +     ++    +P+ T IA     D D   N ++     +++P + + + S    +  ++      D E       K  A D   P LN S  + ++++DEND  P+F  S     + E  S    + K+ A D DS  N++I +   GF     + L     I +    +LDRE Q  Y  TV A+DNG+P   S+  V + + D NDNSP F+    + Y   + E+L     +  +  TD D  EN  VT  +L  N  F ID +SG +  N + DR         + A+D G
Sbjct:  123 VKIRFLIEDINDNAPLF--PTTVINISIPENSAINSRYSLPAAIDPD------IGINGVQNYQLIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEK-DTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFI-----EKEIEVSIPENAPIGSSVTQLHATDADIGENARIHFYFSNLVSNIAKRLFHL-----------NTTTGLITVKEPLDREESPSHKLLVLATDGGSTP--ARATVLVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKIALITVMDKDSEHNGRVTCFTDHEVPFRLRPVFS----NQFLLETAAFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLTKISATDADSGQNAEISYML-GFDAPPEFNLDQRTGILTAVK-KLDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTH---NEYNFYVPESLPKHGTVGLITVTDPDYGENSAVTLSILDVNDQFTIDPQSGVIRPNISFDRERQESYTFYVKAEDGG 649          

HSP 3 Score: 76.2554 bits (186), Expect = 1.698e-13
Identity = 83/295 (28.14%), Postives = 133/295 (45.08%), Query Frame = 2
Query:  380 KLSPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKD--DETLITVLINSNSDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRET-ISHYRVTVQCKDQGLP 1255
            K+S  D+D G N+EI Y +       F L Q      I   +K  DRE++++Y    +A D GIP       +++ + D ND++P F    +Y   V E   +   +  I VTD D  + + +T+ I      +V   F +   SG+   +          +T  V A D G  + +++  +T+NV+D+NDN P I ID  S+ S  + L    P  + V  V   D D  MN  V  +++  N K  F +I +   N          +TL+E    + +  +RV V+  D G P
Sbjct:  487 KISATDADSGQNAEISYMLGFDAPPEFNLDQRTG---ILTAVKKLDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTH-NEYNFYVPESLPKHGTVGLITVTDPDYGENSAVTLSIL-----DVNDQFTIDPQSGVIRPNISFDRERQESYTFYVKAEDGGRVSRSSTARVTINVVDVNDNKP-IFIDPPSNYSFEWVLPSTNPG-TVVFKVVAIDDDIGMNAEVLYSIVGGNTKGLF-MIEQTSGN----------ITLKEKCMVSDLGLHRVIVKANDLGQP 759          

HSP 4 Score: 68.9366 bits (167), Expect = 3.412e-11
Identity = 92/327 (28.13%), Postives = 133/327 (40.67%), Query Frame = 2
Query: 1277 ITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIIS---IPNPSTGIVTNLV---SFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGY--SGWVGKVEAYXXXXXXXXXIIFSFTGFLHN---HLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNG-VPSRSSSVIVQIQLEDINDNSPKFS-----QPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNKYFIIDEKSGEVFINRTLDRLELVPRR---LLIMAKDNGTP 2197
            I   IED NDN P F        I EN    S      A DPDIG N    YQ+  K QNI     I  P    +  L+     DRE   +   K    D   P  +S+  + + + D ND  P+F+       I E       V ++ A D D   N+ I F F+  + N    L+ L +   + + K   LDRE   +++L V A D G  P+R++   V + + DINDN P         P +   +  ++E     T I  +   D D   NG+VT    +   F +       F+  T   L+    R   + ++A D G P
Sbjct:  125 IRFLIEDINDNAPLFPTTVINISIPENSAINSRYSLPAAIDPDIGINGVQNYQL-IKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFIEKEIEVSIPENAPIGSSVTQLHATDADIGENARIHFYFSNLVSNIAKRLFHLNTTTGLITVKE-PLDREESPSHKLLVLATDGGSTPARAT---VLVNVTDINDNVPSIDIRYIVNPTNGTVL--LSENAPLNTKIALITVMDKDSEHNGRVTCFTDHEVPFRLRPVFSNQFLLETAAFLDFESTREYAIKLLAADAGKP 444          
BLAST of protocadherin-1 vs. Ensembl Mouse
Match: Pcdh11x (protocadherin 11 X-linked [Source:MGI Symbol;Acc:MGI:2442849])

HSP 1 Score: 220.32 bits (560), Expect = 2.447e-58
Identity = 192/618 (31.07%), Postives = 297/618 (48.06%), Query Frame = 2
Query:  395 DSDYGINSEIIYSIEGKDKGFFKLLQMK----NNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKD--DETLITVLINSNSDPEVKRHFQVSAISGL-TLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLM-ENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQI----PEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGY--SGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLL--ANNK-YFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTP 2197
            D D GIN    Y +  K +  F L  ++    +  P     K  DREE+D Y +     D G P+++    + + + D ND+ P F + K+  + + E+A  GS +  +  TD D  +   I    ++      KR F ++  +GL T+   LD E S     + V+A D G  +     T+ VNV DINDN P I I  + + ++   L+ EN P  + +A++TV D DSE NG V C     +++  F L   + N F        + T    D E+   Y + +   D G PPL+    + I ++DENDN P F++ F    + EN  PG+ +  + ATD D G+NA+I Y +    P ++ N+    +  TGI+T +   DRE      F   A D   P L S+  V + + D+ND  P+F  + Y+F + E     G VG +   D D   NS +  S    +++   I    G I     I  DRE Q +Y   V+A+D G  SRSS+  V I + D+NDN P F  P  +   + +  +  PGT++ KV+A DDD   N +V Y +   N K  F+I++ SG + +       +L   R+++ A D G P
Sbjct:  165 DPDIGINGVQNYQLI-KSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIF-IEKEIEVSIPENAPIGSSVTQLHATDADIGENARIHFYFSNLVSNIAKRLFHLNTTTGLITVKEPLDREESPSHKLL-VLATDGG--STPARATVLVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKIALITVMDKDSEHNGRVTCFT---DHEVPFRLRPVFSNQF-------LLETAAFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLTKISATDADSGQNAEISYMLGFDAPPEF-NL----DQRTGILTAVKKLDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTHNEYNFYVPESLPKHGTVGLITVTDPDYGENSAVTLSILD-VNDQFTIDPQSGVI--RPNISFDRERQESYTFYVKAEDGGRVSRSSTARVTINVVDVNDNKPIFIDPPSNYSFEWVLPSTNPGTVVFKVVAIDDDIGMNAEVLYSIVGGNTKGLFMIEQTSGNITLKEKCMVSDLGLHRVIVKANDLGQP 759          

HSP 2 Score: 109.383 bits (272), Expect = 1.247e-23
Identity = 148/563 (26.29%), Postives = 238/563 (42.27%), Query Frame = 2
Query:  590 IKIYIKIRDLNDHAPEFDMPKDYV-IGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRH---FQVSAISG--------LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVD---CNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLRE-FDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIM--PGSPIFTLIA----TDPDIGKNAKII----YQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYS--GWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTY-LLANNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNG 2191
            +KI   I D+ND+AP F  P   + I + E++   S+       D D      + IN   + ++ +    F +  I          L +   LD E     + + V   D G P  +++  + V+V D NDN P  +     +      + EN P  S V  +  TDAD   N  +     NL+    K+ F L                ++T++E  DRE    +++ V   D G  P  ++ T+ + + D NDN PS    +  +     ++    +P+ T IA     D D   N ++     +++P + + + S    +  ++      D E       K  A D   P LN S  + ++++DEND  P+F  S     + E  S    + K+ A D DS  N++I +   GF     + L     I +    +LDRE Q  Y  TV A+DNG+P   S+  V + + D NDNSP F+    + Y   + E+L     +  +  TD D  EN  VT  +L  N  F ID +SG +  N + DR         + A+D G
Sbjct:  123 VKIRFLIEDINDNAPLF--PTTVINISIPENSAINSRYSLPAAIDPD------IGINGVQNYQLIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEK-DTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFI-----EKEIEVSIPENAPIGSSVTQLHATDADIGENARIHFYFSNLVSNIAKRLFHL-----------NTTTGLITVKEPLDREESPSHKLLVLATDGGSTP--ARATVLVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKIALITVMDKDSEHNGRVTCFTDHEVPFRLRPVFS----NQFLLETAAFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLTKISATDADSGQNAEISYML-GFDAPPEFNLDQRTGILTAVK-KLDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTH---NEYNFYVPESLPKHGTVGLITVTDPDYGENSAVTLSILDVNDQFTIDPQSGVIRPNISFDRERQESYTFYVKAEDGG 649          

HSP 3 Score: 77.0258 bits (188), Expect = 1.136e-13
Identity = 83/295 (28.14%), Postives = 133/295 (45.08%), Query Frame = 2
Query:  380 KLSPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKD--DETLITVLINSNSDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRET-ISHYRVTVQCKDQGLP 1255
            K+S  D+D G N+EI Y +       F L Q      I   +K  DRE++++Y    +A D GIP       +++ + D ND++P F    +Y   V E   +   +  I VTD D  + + +T+ I      +V   F +   SG+   +          +T  V A D G  + +++  +T+NV+D+NDN P I ID  S+ S  + L    P  + V  V   D D  MN  V  +++  N K  F +I +   N          +TL+E    + +  +RV V+  D G P
Sbjct:  487 KISATDADSGQNAEISYMLGFDAPPEFNLDQRTG---ILTAVKKLDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTH-NEYNFYVPESLPKHGTVGLITVTDPDYGENSAVTLSIL-----DVNDQFTIDPQSGVIRPNISFDRERQESYTFYVKAEDGGRVSRSSTARVTINVVDVNDNKP-IFIDPPSNYSFEWVLPSTNPG-TVVFKVVAIDDDIGMNAEVLYSIVGGNTKGLF-MIEQTSGN----------ITLKEKCMVSDLGLHRVIVKANDLGQP 759          

HSP 4 Score: 68.5514 bits (166), Expect = 3.974e-11
Identity = 92/327 (28.13%), Postives = 133/327 (40.67%), Query Frame = 2
Query: 1277 ITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIIS---IPNPSTGIVTNLV---SFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGY--SGWVGKVEAYXXXXXXXXXIIFSFTGFLHN---HLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNG-VPSRSSSVIVQIQLEDINDNSPKFS-----QPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNKYFIIDEKSGEVFINRTLDRLELVPRR---LLIMAKDNGTP 2197
            I   IED NDN P F        I EN    S      A DPDIG N    YQ+  K QNI     I  P    +  L+     DRE   +   K    D   P  +S+  + + + D ND  P+F+       I E       V ++ A D D   N+ I F F+  + N    L+ L +   + + K   LDRE   +++L V A D G  P+R++   V + + DINDN P         P +   +  ++E     T I  +   D D   NG+VT    +   F +       F+  T   L+    R   + ++A D G P
Sbjct:  125 IRFLIEDINDNAPLFPTTVINISIPENSAINSRYSLPAAIDPDIGINGVQNYQL-IKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFIEKEIEVSIPENAPIGSSVTQLHATDADIGENARIHFYFSNLVSNIAKRLFHLNTTTGLITVKE-PLDREESPSHKLLVLATDGGSTPARAT---VLVNVTDINDNVPSIDIRYIVNPTNGTVL--LSENAPLNTKIALITVMDKDSEHNGRVTCFTDHEVPFRLRPVFSNQFLLETAAFLDFESTREYAIKLLAADAGKP 444          
BLAST of protocadherin-1 vs. Ensembl Mouse
Match: Pcdh11x (protocadherin 11 X-linked [Source:MGI Symbol;Acc:MGI:2442849])

HSP 1 Score: 220.705 bits (561), Expect = 3.369e-58
Identity = 192/618 (31.07%), Postives = 297/618 (48.06%), Query Frame = 2
Query:  395 DSDYGINSEIIYSIEGKDKGFFKLLQMK----NNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKD--DETLITVLINSNSDPEVKRHFQVSAISGL-TLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLM-ENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQI----PEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGY--SGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLL--ANNK-YFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTP 2197
            D D GIN    Y +  K +  F L  ++    +  P     K  DREE+D Y +     D G P+++    + + + D ND+ P F + K+  + + E+A  GS +  +  TD D  +   I    ++      KR F ++  +GL T+   LD E S     + V+A D G  +     T+ VNV DINDN P I I  + + ++   L+ EN P  + +A++TV D DSE NG V C     +++  F L   + N F        + T    D E+   Y + +   D G PPL+    + I ++DENDN P F++ F    + EN  PG+ +  + ATD D G+NA+I Y +    P ++ N+    +  TGI+T +   DRE      F   A D   P L S+  V + + D+ND  P+F  + Y+F + E     G VG +   D D   NS +  S    +++   I    G I     I  DRE Q +Y   V+A+D G  SRSS+  V I + D+NDN P F  P  +   + +  +  PGT++ KV+A DDD   N +V Y +   N K  F+I++ SG + +       +L   R+++ A D G P
Sbjct:  165 DPDIGINGVQNYQLI-KSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIF-IEKEIEVSIPENAPIGSSVTQLHATDADIGENARIHFYFSNLVSNIAKRLFHLNTTTGLITVKEPLDREESPSHKLL-VLATDGG--STPARATVLVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKIALITVMDKDSEHNGRVTCFT---DHEVPFRLRPVFSNQF-------LLETAAFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLTKISATDADSGQNAEISYMLGFDAPPEF-NL----DQRTGILTAVKKLDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTHNEYNFYVPESLPKHGTVGLITVTDPDYGENSAVTLSILD-VNDQFTIDPQSGVI--RPNISFDRERQESYTFYVKAEDGGRVSRSSTARVTINVVDVNDNKPIFIDPPSNYSFEWVLPSTNPGTVVFKVVAIDDDIGMNAEVLYSIVGGNTKGLFMIEQTSGNITLKEKCMVSDLGLHRVIVKANDLGQP 759          

HSP 2 Score: 109.383 bits (272), Expect = 1.561e-23
Identity = 149/563 (26.47%), Postives = 238/563 (42.27%), Query Frame = 2
Query:  590 IKIYIKIRDLNDHAPEFDMPKDYV-IGVKEDAIEGSKIC-------DIKVTDKDDETLI----TVLINSNSDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVD---CNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLRE-FDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIM--PGSPIFTLIA----TDPDIGKNAKII----YQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYS--GWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTY-LLANNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNG 2191
            +KI   I D+ND+AP F  P   + I + E++   S+         DI +    +  LI       ++    PE  +  Q      L +   LD E     + + V   D G P  +++  + V+V D NDN P  +     +      + EN P  S V  +  TDAD   N  +     NL+    K+ F L                ++T++E  DRE    +++ V   D G  P  ++ T+ + + D NDN PS    +  +     ++    +P+ T IA     D D   N ++     +++P + + + S    +  ++      D E       K  A D   P LN S  + ++++DEND  P+F  S     + E  S    + K+ A D DS  N++I +   GF     + L     I +    +LDRE Q  Y  TV A+DNG+P   S+  V + + D NDNSP F+    + Y   + E+L     +  +  TD D  EN  VT  +L  N  F ID +SG +  N + DR         + A+D G
Sbjct:  123 VKIRFLIEDINDNAPLF--PTTVINISIPENSAINSRYSLPAAIDPDIGINGVQNYQLIKSQNIFGLDVIETPEGDKMPQ------LIVQKELDREEK-DTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFI-----EKEIEVSIPENAPIGSSVTQLHATDADIGENARIHFYFSNLVSNIAKRLFHL-----------NTTTGLITVKEPLDREESPSHKLLVLATDGGSTP--ARATVLVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKIALITVMDKDSEHNGRVTCFTDHEVPFRLRPVFS----NQFLLETAAFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLTKISATDADSGQNAEISYML-GFDAPPEFNLDQRTGILTAVK-KLDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTH---NEYNFYVPESLPKHGTVGLITVTDPDYGENSAVTLSILDVNDQFTIDPQSGVIRPNISFDRERQESYTFYVKAEDGG 649          

HSP 3 Score: 77.7962 bits (190), Expect = 6.831e-14
Identity = 83/295 (28.14%), Postives = 133/295 (45.08%), Query Frame = 2
Query:  380 KLSPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKD--DETLITVLINSNSDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRET-ISHYRVTVQCKDQGLP 1255
            K+S  D+D G N+EI Y +       F L Q      I   +K  DRE++++Y    +A D GIP       +++ + D ND++P F    +Y   V E   +   +  I VTD D  + + +T+ I      +V   F +   SG+   +          +T  V A D G  + +++  +T+NV+D+NDN P I ID  S+ S  + L    P  + V  V   D D  MN  V  +++  N K  F +I +   N          +TL+E    + +  +RV V+  D G P
Sbjct:  487 KISATDADSGQNAEISYMLGFDAPPEFNLDQRTG---ILTAVKKLDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTH-NEYNFYVPESLPKHGTVGLITVTDPDYGENSAVTLSIL-----DVNDQFTIDPQSGVIRPNISFDRERQESYTFYVKAEDGGRVSRSSTARVTINVVDVNDNKP-IFIDPPSNYSFEWVLPSTNPG-TVVFKVVAIDDDIGMNAEVLYSIVGGNTKGLF-MIEQTSGN----------ITLKEKCMVSDLGLHRVIVKANDLGQP 759          

HSP 4 Score: 68.1662 bits (165), Expect = 5.388e-11
Identity = 92/327 (28.13%), Postives = 133/327 (40.67%), Query Frame = 2
Query: 1277 ITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIIS---IPNPSTGIVTNLV---SFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGY--SGWVGKVEAYXXXXXXXXXIIFSFTGFLHN---HLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNG-VPSRSSSVIVQIQLEDINDNSPKFS-----QPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNKYFIIDEKSGEVFINRTLDRLELVPRR---LLIMAKDNGTP 2197
            I   IED NDN P F        I EN    S      A DPDIG N    YQ+  K QNI     I  P    +  L+     DRE   +   K    D   P  +S+  + + + D ND  P+F+       I E       V ++ A D D   N+ I F F+  + N    L+ L +   + + K   LDRE   +++L V A D G  P+R++   V + + DINDN P         P +   +  ++E     T I  +   D D   NG+VT    +   F +       F+  T   L+    R   + ++A D G P
Sbjct:  125 IRFLIEDINDNAPLFPTTVINISIPENSAINSRYSLPAAIDPDIGINGVQNYQL-IKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFIEKEIEVSIPENAPIGSSVTQLHATDADIGENARIHFYFSNLVSNIAKRLFHLNTTTGLITVKE-PLDREESPSHKLLVLATDGGSTPARAT---VLVNVTDINDNVPSIDIRYIVNPTNGTVL--LSENAPLNTKIALITVMDKDSEHNGRVTCFTDHEVPFRLRPVFSNQFLLETAAFLDFESTREYAIKLLAADAGKP 444          
BLAST of protocadherin-1 vs. Ensembl Mouse
Match: Pcdh11x (protocadherin 11 X-linked [Source:MGI Symbol;Acc:MGI:2442849])

HSP 1 Score: 220.705 bits (561), Expect = 3.730e-58
Identity = 192/618 (31.07%), Postives = 297/618 (48.06%), Query Frame = 2
Query:  395 DSDYGINSEIIYSIEGKDKGFFKLLQMK----NNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKD--DETLITVLINSNSDPEVKRHFQVSAISGL-TLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLM-ENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQI----PEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYS--GWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLL--ANNK-YFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTP 2197
            D D GIN    Y +  K +  F L  ++    +  P     K  DREE+D Y +     D G P+++    + + + D ND+ P F + K+  + + E+A  GS +  +  TD D  +   I    ++      KR F ++  +GL T+   LD E S     + V+A D G  +     T+ VNV DINDN P I I  + + ++   L+ EN P  + +A++TV D DSE NG V C     +++  F L   + N F        + T    D E+   Y + +   D G PPL+    + I ++DENDN P F++ F    + EN  PG+ +  + ATD D G+NA+I Y +    P ++ N+    +  TGI+T +   DRE      F   A D   P L S+  V + + D+ND  P+F  + Y+F + E     G VG +   D D   NS +  S    +++   I    G I     I  DRE Q +Y   V+A+D G  SRSS+  V I + D+NDN P F  P  +   + +  +  PGT++ KV+A DDD   N +V Y +   N K  F+I++ SG + +       +L   R+++ A D G P
Sbjct:  165 DPDIGINGVQNYQLI-KSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIF-IEKEIEVSIPENAPIGSSVTQLHATDADIGENARIHFYFSNLVSNIAKRLFHLNTTTGLITVKEPLDREESPSHKLL-VLATDGG--STPARATVLVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKIALITVMDKDSEHNGRVTCFT---DHEVPFRLRPVFSNQF-------LLETAAFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLTKISATDADSGQNAEISYMLGFDAPPEF-NL----DQRTGILTAVKKLDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTHNEYNFYVPESLPKHGTVGLITVTDPDYGENSAVTLSILD-VNDQFTIDPQSGVI--RPNISFDRERQESYTFYVKAEDGGRVSRSSTARVTINVVDVNDNKPIFIDPPSNYSFEWVLPSTNPGTVVFKVVAIDDDIGMNAEVLYSIVGGNTKGLFMIEQTSGNITLKEKCMVSDLGLHRVIVKANDLGQP 759          

HSP 2 Score: 108.612 bits (270), Expect = 2.436e-23
Identity = 149/563 (26.47%), Postives = 238/563 (42.27%), Query Frame = 2
Query:  590 IKIYIKIRDLNDHAPEFDMPKDYV-IGVKEDAIEGSKIC-------DIKVTDKDDETLI----TVLINSNSDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVD---CNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLRE-FDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIM--PGSPIFTLIA----TDPDIGKNAKII----YQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYS--GWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTY-LLANNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNG 2191
            +KI   I D+ND+AP F  P   + I + E++   S+         DI +    +  LI       ++    PE  +  Q      L +   LD E     + + V   D G P  +++  + V+V D NDN P  +     +      + EN P  S V  +  TDAD   N  +     NL+    K+ F L                ++T++E  DRE    +++ V   D G  P  ++ T+ + + D NDN PS    +  +     ++    +P+ T IA     D D   N ++     +++P + + + S    +  ++      D E       K  A D   P LN S  + ++++DEND  P+F  S     + E  S    + K+ A D DS  N++I +   GF     + L     I +    +LDRE Q  Y  TV A+DNG+P   S+  V + + D NDNSP F+    + Y   + E+L     +  +  TD D  EN  VT  +L  N  F ID +SG +  N + DR         + A+D G
Sbjct:  123 VKIRFLIEDINDNAPLF--PTTVINISIPENSAINSRYSLPAAIDPDIGINGVQNYQLIKSQNIFGLDVIETPEGDKMPQ------LIVQKELDREEK-DTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFI-----EKEIEVSIPENAPIGSSVTQLHATDADIGENARIHFYFSNLVSNIAKRLFHL-----------NTTTGLITVKEPLDREESPSHKLLVLATDGGSTP--ARATVLVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKIALITVMDKDSEHNGRVTCFTDHEVPFRLRPVFS----NQFLLETAAFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLTKISATDADSGQNAEISYML-GFDAPPEFNLDQRTGILTAVK-KLDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTH---NEYNFYVPESLPKHGTVGLITVTDPDYGENSAVTLSILDVNDQFTIDPQSGVIRPNISFDRERQESYTFYVKAEDGG 649          

HSP 3 Score: 77.411 bits (189), Expect = 8.415e-14
Identity = 83/295 (28.14%), Postives = 133/295 (45.08%), Query Frame = 2
Query:  380 KLSPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKD--DETLITVLINSNSDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRET-ISHYRVTVQCKDQGLP 1255
            K+S  D+D G N+EI Y +       F L Q      I   +K  DRE++++Y    +A D GIP       +++ + D ND++P F    +Y   V E   +   +  I VTD D  + + +T+ I      +V   F +   SG+   +          +T  V A D G  + +++  +T+NV+D+NDN P I ID  S+ S  + L    P  + V  V   D D  MN  V  +++  N K  F +I +   N          +TL+E    + +  +RV V+  D G P
Sbjct:  487 KISATDADSGQNAEISYMLGFDAPPEFNLDQRTG---ILTAVKKLDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTH-NEYNFYVPESLPKHGTVGLITVTDPDYGENSAVTLSIL-----DVNDQFTIDPQSGVIRPNISFDRERQESYTFYVKAEDGGRVSRSSTARVTINVVDVNDNKP-IFIDPPSNYSFEWVLPSTNPG-TVVFKVVAIDDDIGMNAEVLYSIVGGNTKGLF-MIEQTSGN----------ITLKEKCMVSDLGLHRVIVKANDLGQP 759          

HSP 4 Score: 68.1662 bits (165), Expect = 5.750e-11
Identity = 92/327 (28.13%), Postives = 133/327 (40.67%), Query Frame = 2
Query: 1277 ITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIIS---IPNPSTGIVTNLV---SFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGY--SGWVGKVEAYXXXXXXXXXIIFSFTGFLHN---HLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNG-VPSRSSSVIVQIQLEDINDNSPKFS-----QPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNKYFIIDEKSGEVFINRTLDRLELVPRR---LLIMAKDNGTP 2197
            I   IED NDN P F        I EN    S      A DPDIG N    YQ+  K QNI     I  P    +  L+     DRE   +   K    D   P  +S+  + + + D ND  P+F+       I E       V ++ A D D   N+ I F F+  + N    L+ L +   + + K   LDRE   +++L V A D G  P+R++   V + + DINDN P         P +   +  ++E     T I  +   D D   NG+VT    +   F +       F+  T   L+    R   + ++A D G P
Sbjct:  125 IRFLIEDINDNAPLFPTTVINISIPENSAINSRYSLPAAIDPDIGINGVQNYQL-IKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFIEKEIEVSIPENAPIGSSVTQLHATDADIGENARIHFYFSNLVSNIAKRLFHLNTTTGLITVKE-PLDREESPSHKLLVLATDGGSTPARAT---VLVNVTDINDNVPSIDIRYIVNPTNGTVL--LSENAPLNTKIALITVMDKDSEHNGRVTCFTDHEVPFRLRPVFSNQFLLETAAFLDFESTREYAIKLLAADAGKP 444          
BLAST of protocadherin-1 vs. Ensembl Mouse
Match: Pcdh11x (protocadherin 11 X-linked [Source:MGI Symbol;Acc:MGI:2442849])

HSP 1 Score: 220.705 bits (561), Expect = 4.007e-58
Identity = 192/618 (31.07%), Postives = 297/618 (48.06%), Query Frame = 2
Query:  395 DSDYGINSEIIYSIEGKDKGFFKLLQMK----NNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKD--DETLITVLINSNSDPEVKRHFQVSAISGL-TLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLM-ENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQI----PEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYS--GWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLL--ANNK-YFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTP 2197
            D D GIN    Y +  K +  F L  ++    +  P     K  DREE+D Y +     D G P+++    + + + D ND+ P F + K+  + + E+A  GS +  +  TD D  +   I    ++      KR F ++  +GL T+   LD E S     + V+A D G  +     T+ VNV DINDN P I I  + + ++   L+ EN P  + +A++TV D DSE NG V C     +++  F L   + N F        + T    D E+   Y + +   D G PPL+    + I ++DENDN P F++ F    + EN  PG+ +  + ATD D G+NA+I Y +    P ++ N+    +  TGI+T +   DRE      F   A D   P L S+  V + + D+ND  P+F  + Y+F + E     G VG +   D D   NS +  S    +++   I    G I     I  DRE Q +Y   V+A+D G  SRSS+  V I + D+NDN P F  P  +   + +  +  PGT++ KV+A DDD   N +V Y +   N K  F+I++ SG + +       +L   R+++ A D G P
Sbjct:  165 DPDIGINGVQNYQLI-KSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIF-IEKEIEVSIPENAPIGSSVTQLHATDADIGENARIHFYFSNLVSNIAKRLFHLNTTTGLITVKEPLDREESPSHKLL-VLATDGG--STPARATVLVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKIALITVMDKDSEHNGRVTCFT---DHEVPFRLRPVFSNQF-------LLETAAFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLTKISATDADSGQNAEISYMLGFDAPPEF-NL----DQRTGILTAVKKLDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTHNEYNFYVPESLPKHGTVGLITVTDPDYGENSAVTLSILD-VNDQFTIDPQSGVI--RPNISFDRERQESYTFYVKAEDGGRVSRSSTARVTINVVDVNDNKPIFIDPPSNYSFEWVLPSTNPGTVVFKVVAIDDDIGMNAEVLYSIVGGNTKGLFMIEQTSGNITLKEKCMVSDLGLHRVIVKANDLGQP 759          

HSP 2 Score: 108.997 bits (271), Expect = 2.160e-23
Identity = 149/563 (26.47%), Postives = 238/563 (42.27%), Query Frame = 2
Query:  590 IKIYIKIRDLNDHAPEFDMPKDYV-IGVKEDAIEGSKIC-------DIKVTDKDDETLI----TVLINSNSDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVD---CNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLRE-FDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIM--PGSPIFTLIA----TDPDIGKNAKII----YQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYS--GWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTY-LLANNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNG 2191
            +KI   I D+ND+AP F  P   + I + E++   S+         DI +    +  LI       ++    PE  +  Q      L +   LD E     + + V   D G P  +++  + V+V D NDN P  +     +      + EN P  S V  +  TDAD   N  +     NL+    K+ F L                ++T++E  DRE    +++ V   D G  P  ++ T+ + + D NDN PS    +  +     ++    +P+ T IA     D D   N ++     +++P + + + S    +  ++      D E       K  A D   P LN S  + ++++DEND  P+F  S     + E  S    + K+ A D DS  N++I +   GF     + L     I +    +LDRE Q  Y  TV A+DNG+P   S+  V + + D NDNSP F+    + Y   + E+L     +  +  TD D  EN  VT  +L  N  F ID +SG +  N + DR         + A+D G
Sbjct:  123 VKIRFLIEDINDNAPLF--PTTVINISIPENSAINSRYSLPAAIDPDIGINGVQNYQLIKSQNIFGLDVIETPEGDKMPQ------LIVQKELDREEK-DTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFI-----EKEIEVSIPENAPIGSSVTQLHATDADIGENARIHFYFSNLVSNIAKRLFHL-----------NTTTGLITVKEPLDREESPSHKLLVLATDGGSTP--ARATVLVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKIALITVMDKDSEHNGRVTCFTDHEVPFRLRPVFS----NQFLLETAAFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLTKISATDADSGQNAEISYML-GFDAPPEFNLDQRTGILTAVK-KLDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTH---NEYNFYVPESLPKHGTVGLITVTDPDYGENSAVTLSILDVNDQFTIDPQSGVIRPNISFDRERQESYTFYVKAEDGG 649          

HSP 3 Score: 77.411 bits (189), Expect = 9.278e-14
Identity = 83/295 (28.14%), Postives = 133/295 (45.08%), Query Frame = 2
Query:  380 KLSPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKD--DETLITVLINSNSDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRET-ISHYRVTVQCKDQGLP 1255
            K+S  D+D G N+EI Y +       F L Q      I   +K  DRE++++Y    +A D GIP       +++ + D ND++P F    +Y   V E   +   +  I VTD D  + + +T+ I      +V   F +   SG+   +          +T  V A D G  + +++  +T+NV+D+NDN P I ID  S+ S  + L    P  + V  V   D D  MN  V  +++  N K  F +I +   N          +TL+E    + +  +RV V+  D G P
Sbjct:  487 KISATDADSGQNAEISYMLGFDAPPEFNLDQRTG---ILTAVKKLDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTH-NEYNFYVPESLPKHGTVGLITVTDPDYGENSAVTLSIL-----DVNDQFTIDPQSGVIRPNISFDRERQESYTFYVKAEDGGRVSRSSTARVTINVVDVNDNKP-IFIDPPSNYSFEWVLPSTNPG-TVVFKVVAIDDDIGMNAEVLYSIVGGNTKGLF-MIEQTSGN----------ITLKEKCMVSDLGLHRVIVKANDLGQP 759          

HSP 4 Score: 68.1662 bits (165), Expect = 5.578e-11
Identity = 92/327 (28.13%), Postives = 133/327 (40.67%), Query Frame = 2
Query: 1277 ITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIIS---IPNPSTGIVTNLV---SFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGY--SGWVGKVEAYXXXXXXXXXIIFSFTGFLHN---HLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNG-VPSRSSSVIVQIQLEDINDNSPKFS-----QPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNKYFIIDEKSGEVFINRTLDRLELVPRR---LLIMAKDNGTP 2197
            I   IED NDN P F        I EN    S      A DPDIG N    YQ+  K QNI     I  P    +  L+     DRE   +   K    D   P  +S+  + + + D ND  P+F+       I E       V ++ A D D   N+ I F F+  + N    L+ L +   + + K   LDRE   +++L V A D G  P+R++   V + + DINDN P         P +   +  ++E     T I  +   D D   NG+VT    +   F +       F+  T   L+    R   + ++A D G P
Sbjct:  125 IRFLIEDINDNAPLFPTTVINISIPENSAINSRYSLPAAIDPDIGINGVQNYQL-IKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFIEKEIEVSIPENAPIGSSVTQLHATDADIGENARIHFYFSNLVSNIAKRLFHLNTTTGLITVKE-PLDREESPSHKLLVLATDGGSTPARAT---VLVNVTDINDNVPSIDIRYIVNPTNGTVL--LSENAPLNTKIALITVMDKDSEHNGRVTCFTDHEVPFRLRPVFSNQFLLETAAFLDFESTREYAIKLLAADAGKP 444          
BLAST of protocadherin-1 vs. UniProt/SwissProt
Match: sp|Q9V5N8|STAN_DROME (Protocadherin-like wing polarity protein stan OS=Drosophila melanogaster OX=7227 GN=stan PE=1 SV=4)

HSP 1 Score: 226.483 bits (576), Expect = 8.274e-59
Identity = 192/643 (29.86%), Postives = 303/643 (47.12%), Query Frame = 2
Query:  377 IKLSPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFK---------TMKLFDREERDRYELVFIATDKGIP---KKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKED---AIEGSKICDIKVTDKD---DETLITVLINSNSDPEVKRHFQVSAISG-LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNS--KRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIP---EKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEG--YSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLW------ILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLAN----NKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTP 2197
            I L   D D G N+EI Y IE    G    L      PIF+         T    DRE  D Y L+  A D       ++T    + +K+ D ND+ P+F   + Y + V ED     E + +  I+ TD D   +  +   +I  N+    +  F + ++SG ++L+  LDYE S+R + + + A D G P+ + +T + VNV+D NDN P+       +S     ++EN P    +  V   D+D   N  +  ++ E +            +NFP +   R   + T++  DRE    +   V  KD G+PP S+  ++ I ++D NDN P+F+  +++  + E+  PG+P+ T+ ATDPD  +++++ Y+I     + +  I+  N   G++T   S D +          A D      + +  V + I D N+  P+F ++ Y   + E       V  V A D+D   N+ I +S      N L       I    G I +     LDRE  S Y LTV AKD G PS S +  V+I + D+NDN+P F  PL   Y   I E  + GT + +V A+D D   NG++ YLL++    +  F+ID  SG +  N+ LDR  +    L  +A D G+P
Sbjct:  484 ITLRATDQDIGKNAEIEYGIEAVTDG--AGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFS-ERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNT----QSQFSIDSMSGDVSLVKPLDYE-SVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQES-----VLENVPVGYNIIRVQAYDSDEGANAEITYSISERD------------DNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPD--EDSRLHYEITTGNTRGRFAITSQN-GRGLITIAQSLDYKQEKRFLLTVAATDSGGR--SDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNA--PLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPL---YQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSP 1091          

HSP 2 Score: 199.904 bits (507), Expect = 1.675e-50
Identity = 157/541 (29.02%), Postives = 268/541 (49.54%), Query Frame = 2
Query:  377 IKLSPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISG---LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEK-YQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEG--YSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIF-------SEKG-----IQLDRE-VQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSP 1942
            I++   DSD G N+EI YSI  +D  F   L +       +T+K  DREE+ R+    +A D G+P K+    + I ++D+ND+ P F+ PK Y   V ED   G+ +  +  TD D+++ +   I + +    +  F +++ +G   +T+   LDY+   ++F + V A D+G    + + T+ +N+ D N+  P  + +    S+S F   E+ P  + V +V+ TD+D  +N  +  +L    N+++   +    + F  + +   IVT    DRET S Y +TV  KD G P LS    + I + D NDN P+F    +Q  I E+ + G+ +  + A+DPD+G N +I Y + ++  ++   + +P++G +      DRE        A A+D+ +P L+S+VEV + +ED ND  P F S      + E       VG++ A+D D   N+ + +S  G           D N F       SE+       +LD E  +  ++L V A     P   +   ++I + D+NDN+P
Sbjct:  709 IRVQAYDSDEGANAEITYSISERDDNF--PLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFN-PKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGN---TRGRFAITSQNGRGLITIAQSLDYKQE-KRFLLTVAATDSG--GRSDTATVHINITDANNFAP--IFENAPYSASVF---EDAPVGTTVLVVSATDSDVGVNAQITYSL----NEESINGLGSP-DPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIG---------GDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRAAS---PPLRNDAHIEILVTDVNDNAP 1218          

HSP 3 Score: 186.037 bits (471), Expect = 4.133e-46
Identity = 165/624 (26.44%), Postives = 274/624 (43.91%), Query Frame = 2
Query:  413 NSEIIYS----IEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKD--DETLITVLINSNSD------PEVKRHFQVSAISG-LTLISRLDYESSMRKFTIPVIAVDNGIPN---LTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENK---PKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGWVGKVEAYXXXXXXXXXIIFSF-TGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNKY--------FIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPS 2200
            +S ++YS    ++ + +  FK+    +   +  T    DRE  D +    +ATD   P ++G   + + + D NDH+P F+  + +   ++E A  GS +  ++ TD+D      I   I + +D       +    F++ + SG ++  S LD E+S   + + V A D         T + ++ V VLD NDN+PQ      S+ +   ++ E++    +++ VA +  TDAD   N  +   +I  N +  F + S   +          +  ++  D E++  YR+ ++ +D G P  S+   + + + D NDN P F    FQ+ + EN+  G  I  + A D D G NA+I Y I E+  N     +P TG V  +   DRE      F+  A D   P  ++S  V + ++D ND  P F    Y   + E              D + +S + +   TG       I   +G         LD + +  + LTV A D+G   RS +  V I + D N+ +P F    ++ Y   + E    GT +  V ATD D   N ++TY L             F I+ ++G +  N  LDR       L + AKD G PS
Sbjct:  388 DSPVVYSMVSLLDSRSQSLFKV---DSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFE-AEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETS-DSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQ-----FSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGD----------VSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSG--GRSDTATVHINITDANNFAPIFE---NAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPS 986          
BLAST of protocadherin-1 vs. UniProt/SwissProt
Match: sp|Q6KEQ9|PC11X_PIG (Protocadherin-11 X-linked OS=Sus scrofa OX=9823 GN=PCDH11X PE=2 SV=1)

HSP 1 Score: 216.853 bits (551), Expect = 2.594e-56
Identity = 187/620 (30.16%), Postives = 291/620 (46.94%), Query Frame = 2
Query:  395 DSDYGINSEIIYS-IEGKDKGFFKLLQMKNNK--PIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKD--DETLITVLINSNSDPEVKRHFQVSAISGLTLISR-LDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDS-SSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPS-------TGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGY--SGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLL--ANNK-YFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTP 2197
            D D GIN    Y  I+G+      +++    +  P     K  DREE+D Y +     D G P+++    + + + D ND+ P F    +  + + E+A  GS +  +  TD D  +   I    ++      K+ F +++ +GL  I   LD E S     + V+A D G+        + VNV DINDN P I I  + +  +    L EN P  + +A++TVTD D++ NG V C     +++  F L   + N F        + T    D E+   Y + +   D G PPL+    + I ++DENDN P F++ F    + EN  PG+ +  + A D D G+NA+I Y        ++    PS       TGI+T +   DRE     +F   A D   P L ++  V + + D+ND  P+F  + Y+F + E     G VG +   D D   NS +I S     ++   I    G I  +  I  DRE Q +Y   V+A+D G  SRSS+  V I + D+NDN P F  P  +   + +  +  PGT++  V+A D+D   N ++ Y +   N K  FIID+ SG + +       +L   RL++ AKD G P
Sbjct:  165 DPDTGINGVQNYHLIKGQSIFGLDVIETPEGEKMPQLIVQKELDREEKDTYVMKIKVEDGGFPQRSSTAILQVSVADTNDNRPVFKE-NEIEVSIPENAPVGSSVTQLHATDADIGENAKIHFYFSNLISNMAKKLFHLNSTTGLITIKEPLDREESPNHKLL-VLASDGGL--TPARAMVLVNVTDINDNIPSIDIRYIINPINGTVVLSENAPLNTKIALITVTDKDADHNGWVSCFT---DHEVPFRLRPVFSNQF-------LLETAAYLDYESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQPFLSLSVPENNSPGTQLTKISAMDADSGRNAEINY--------LLGFDAPSEFNLDHRTGILTAVKKLDREKQEKYSFTVLAKDNGMPPLMTNATVLVTVLDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGENSAVILSILD-ANDDFTIDPQTGVI--QPNISFDREKQESYTFYVKAEDGGRISRSSTAKVTINVVDVNDNKPVFVVPSSNYSFELVPPSTNPGTVVFTVVAIDNDTGMNAELRYSMVGGNTKGLFIIDQTSGNITLKEKCVFADLGLHRLVVKAKDLGQP 759          

HSP 2 Score: 149.443 bits (376), Expect = 3.412e-35
Identity = 147/518 (28.38%), Postives = 245/518 (47.30%), Query Frame = 2
Query:  380 KLSPRDSDYGINSEIIYSIEGKDKGFFK-LLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDM-----PKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISG----LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFL--SSAYHFKI---KEGYSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWIL-KSDGNI-FSEKGIQLDREVQSTYQLTVEAKDNGVP 1882
            +L   D+D G N++I +          K L  + +   +    +  DREE   ++L+ +A+D G+        + + + D+ND+ P  D+     P +  + + E+A   +KI  I VTDKD +      ++  +D EV   F++  +      L   + LDYES+ R++ I ++A D G P L  S+ + + V D NDN P      LS       + EN    + +  ++  DADS  N  +           N+ L     + F    R   +  +++ DRE    Y  TV  KD G+PPL +  T+ + + D+NDN P F+   +   + EN+     +  +  TDPD G+N+ +I  I +   +     +P TG++   +SFDRE   S TF   A D      +S+ +VT+ + D ND  P+F+  SS Y F++          V  V A DND+  N+++ +S  G     L+I+ ++ GNI   EK +  D  +   ++L V+AKD G P
Sbjct:  270 QLHATDADIGENAKIHFYFSNLISNMAKKLFHLNSTTGLITIKEPLDREESPNHKLLVLASDGGL--TPARAMVLVNVTDINDNIPSIDIRYIINPINGTVVLSENAPLNTKIALITVTDKDADH--NGWVSCFTDHEVP--FRLRPVFSNQFLLETAAYLDYEST-REYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQPFLS-----LSVPENNSPGTQLTKISAMDADSGRNAEI-----------NYLLGFDAPSEFNLDHRTGILTAVKKLDREKQEKYSFTVLAKDNGMPPLMTNATVLVTVLDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGENSAVILSILDANDDFTI--DPQTGVIQPNISFDREKQESYTFYVKAEDGGRISRSSTAKVTINVVDVNDNKPVFVVPSSNYSFELVPPSTNPGTVVFTVVAIDNDTGMNAELRYSMVGGNTKGLFIIDQTSGNITLKEKCVFADLGL---HRLVVKAKDLGQP 759          

HSP 3 Score: 108.997 bits (271), Expect = 1.208e-22
Identity = 153/569 (26.89%), Postives = 242/569 (42.53%), Query Frame = 2
Query:  590 IKIYIKIRDLNDHAPEFDMPKDYV-IGVKEDAIEGSKICDIKVTDKDDETLITV----LINSNS--------DPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVD---CNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLRE-FDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIM--PGSPIFTLIA----TDPDIGKNAKII----YQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGW--VGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGI-----QLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTY-LLANNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNG 2191
            +KI   I D+ND+AP F  P   + I + E++   S+   +  T   D  +  V    LI   S         PE ++  Q      L +   LD E     + + +   D G P  +++  + V+V D NDN P        ++     + EN P  S V  +  TDAD   N  +     NLI    K+ F L S              ++T++E  DRE   ++++ V   D GL P  ++  + + + D NDN PS    +  + I   ++    +P+ T IA    TD D   N  +     +++P + + + S    +  ++      D E       K  A D   P LN S  + ++++DEND  P+F        + E  S    + K+ A D DS  N++I +   GF         S+ N+    GI     +LDRE Q  Y  TV AKDNG+P   ++  V + + D NDNSP F+    + Y   + E L     +  +  TD D  EN  V   +L  N  F ID ++G +  N + DR +       + A+D G
Sbjct:  123 VKIRFLIEDINDNAPLF--PATVINISIPENSAINSRYA-LPATIDPDTGINGVQNYHLIKGQSIFGLDVIETPEGEKMPQ------LIVQKELDREEK-DTYVMKIKVEDGGFPQRSSTAILQVSVADTNDNRP-----VFKENEIEVSIPENAPVGSSVTQLHATDADIGENAKIHFYFSNLISNMAKKLFHLNS-----------TTGLITIKEPLDREESPNHKLLVLASDGGLTP--ARAMVLVNVTDINDNIPSIDIRYIINPINGTVVLSENAPLNTKIALITVTDKDADHNGWVSCFTDHEVPFRLRPVFS----NQFLLETAAYLDYESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQPFLSLSVPENNSPGTQLTKISAMDADSGRNAEINY-LLGF------DAPSEFNLDHRTGILTAVKKLDREKQEKYSFTVLAKDNGMPPLMTNATVLVTVLDQNDNSPVFTH---NEYNFYVPENLPRHGTVGLITVTDPDYGENSAVILSILDANDDFTIDPQTGVIQPNISFDREKQESYTFYVKAEDGG 649          

HSP 4 Score: 58.9214 bits (141), Expect = 2.740e-7
Identity = 92/328 (28.05%), Postives = 136/328 (41.46%), Query Frame = 2
Query: 1277 ITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIAT-DPDIGKNAKIIYQIPEKYQNIIS---IPNPSTGIVTNLV---SFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEG--YSGWVGKVEAYXXXXXXXXXIIFSFTGFLHN---HLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGV-PSRSSSVIVQIQLEDINDNSPKFS-----QPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNKYFIIDEKSGEVFINRTLDRLELVPRR---LLIMAKDNGTP 2197
            I   IED NDN P F        I EN    S  + L AT DPD G N    Y +  K Q+I     I  P    +  L+     DRE   +   K    D   P  +S+  + + + D ND  P+F  +     I E       V ++ A D D   N+ I F F+  + N    L+ L S   + + K   LDRE    ++L V A D G+ P+R+   +V + + DINDN P         P++   +  ++E     T I  +  TD D + NG V+    +   F +       F+  T   L+    R   + ++A D G P
Sbjct:  125 IRFLIEDINDNAPLFPATVINISIPENSAINS-RYALPATIDPDTGINGVQNYHL-IKGQSIFGLDVIETPEGEKMPQLIVQKELDREEKDTYVMKIKVEDGGFPQRSSTAILQVSVADTNDNRPVFKENEIEVSIPENAPVGSSVTQLHATDADIGENAKIHFYFSNLISNMAKKLFHLNSTTGLITIKE-PLDREESPNHKLLVLASDGGLTPARA---MVLVNVTDINDNIPSIDIRYIINPINGTVV--LSENAPLNTKIALITVTDKDADHNGWVSCFTDHEVPFRLRPVFSNQFLLETAAYLDYESTREYAIKLLAADAGKP 444          
BLAST of protocadherin-1 vs. UniProt/SwissProt
Match: sp|Q9BZA7|PC11X_HUMAN (Protocadherin-11 X-linked OS=Homo sapiens OX=9606 GN=PCDH11X PE=2 SV=1)

HSP 1 Score: 216.468 bits (550), Expect = 4.908e-56
Identity = 198/686 (28.86%), Postives = 319/686 (46.50%), Query Frame = 2
Query:  395 DSDYGINSEIIYSIEGKDKGFFKLLQMK----NNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKD--DETLITVLINSNSDPEVKRHFQVSAISGLTLISR-LDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQI----VIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGY--SGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNK---YFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPSXXXXXXXXXXXXNEDEDKQTSVINEKVDQEKTYQEARRKNNIDNYDGFKWNSKEVLISLTVGSVMLII 2404
            D D GIN    Y +  K +  F L  ++    +  P     K  DREE+D Y +     D G P+++    + + + D ND+ P F    +  + + E+A  G+ +  +  TD D  +   I    ++      +R F ++A +GL  I   LD E +     + V+A D G+  +     + VNV D+NDN P I    +++ ++D+     L EN P  + +A++TVTD D++ NG V C     +++  F L   + N F        + T    D E+   Y + +   D G PPL+    + I ++DENDN P F++ F    I EN  PG  +  + A D D G NAKI Y +        S+ +  TG++T +   DRE      F   A D   P L S+V V + I D+ND  P+F  + Y+F + E     G VG +   D D   NS +  S      N  + + S   +     I  DRE Q +Y   V+A+D G  SRSSS  V I + D+NDN P F  P  +   + +  +  PGT++ +V+A D+D   N +V Y +        F ID+++G + +    D  +L   R+L+ A D G P    +  +  LF NE     T +INE V ++ T         I +      +  ++L++   G++ +++
Sbjct:  165 DPDVGINGVQNYELI-KSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKE-TEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLL-VLASDGGL--MPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDT---VVLSENIPLNTKIALITVTDKDADHNGRVTCFT---DHEIPFRLRPVFSNQF-------LLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAKINYLLGPDAPPEFSL-DCRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSI--LDENDDFTIDSQTGVI-RPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNCSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFVNESVTNAT-LINELV-RKSTEAPVTPNTEIADVSSPTSDYVKILVAAVAGTITVVV 826          

HSP 2 Score: 117.857 bits (294), Expect = 2.455e-25
Identity = 162/602 (26.91%), Postives = 252/602 (41.86%), Query Frame = 2
Query:  491 IFKTMKLFDREER----DRYELVFIATDKGI-PKKTGE-IKIYIKIRDLNDHAPEFDMPKDYV-IGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRH---FQVSAISG--------LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFE---LISRYFNNFPNSKRNYRIVTLRE-FDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRI------KENIMPGSPIFTLIATDPDIGKNAKII----YQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGWV--GKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTY-LLANNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNG 2191
            IF T    DRE+      R E  F   +  I P +    +KI   I D+ND+AP F  P   + I + E++   SK       D D      V IN   + E+ +    F +  I          L +   LD E     + + V   D G P  +++  + V+V D NDN P        ++     + EN P  + V  +  TDAD           I  N K +F    L+S       +      ++T++E  DRE   ++++ V   D GL P  ++  + + + D NDN PS    +  + +       ENI   + I  +  TD D   N ++     ++IP + + + S    +  ++      D E       K  A D   P LN S  + ++++DEND  P+F  S     I E  S  +   KV A D DS  N+ I +           +    G +   K  +LDRE +  Y  T+ AKDNGVP  +S+V V + + D NDNSP F+    + Y   + E L     +  +  TD D  +N  VT  +L  N  F ID ++G +  N + DR +       + A+D G
Sbjct:   84 IFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLF--PATVINISIPENSAINSKYTLPAAVDPD------VGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEK-DTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHP-----VFKETEIEVSIPENAPVGTSVTQLHATDAD-----------IGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMP--ARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFS----NQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAKINYLLGPDAPPEFSLDCRTGMLTVVK--KLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTH---NEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGG 649          

HSP 3 Score: 68.9366 bits (167), Expect = 2.292e-10
Identity = 90/327 (27.52%), Postives = 138/327 (42.20%), Query Frame = 2
Query: 1277 ITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIIS---IPNPSTGIVTNLV---SFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEG--YSGWVGKVEAYXXXXXXXXXIIFSFTGFLHN---HLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGV-PSRSSSVIVQIQLEDINDNSPKFS-----QPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNKYFIIDEKSGEVFINRTLDRLELVPRR---LLIMAKDNGTP 2197
            I   IED NDN P F        I EN    S      A DPD+G N    Y++  K QNI     I  P    +  L+     DRE   +   K    D   P  +S+  + + + D ND  P+F  +     I E       V ++ A D D   N+ I FSF+  + N    L+ L +   + + K   LDRE    ++L V A D G+ P+R+   +V + + D+NDN P         P++   +  ++E +   T I  +  TD D + NG+VT    +   F +       F+  T   L+    +   + ++A D G P
Sbjct:  125 IRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYEL-IKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKE-PLDREETPNHKLLVLASDGGLMPARA---MVLVNVTDVNDNVPSIDIRYIVNPVNDTVV--LSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQFLLETAAYLDYESTKEYAIKLLAADAGKP 444          
BLAST of protocadherin-1 vs. UniProt/SwissProt
Match: sp|Q6WYY1|PC11X_PANPA (Protocadherin-11 X-linked OS=Pan paniscus OX=9597 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 216.468 bits (550), Expect = 6.007e-56
Identity = 190/651 (29.19%), Postives = 306/651 (47.00%), Query Frame = 2
Query:  488 PIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKD--DETLITVLINSNSDPEVKRHFQVSAISGLTLISR-LDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQI----VIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGY--SGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNK---YFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPSXXXXXXXXXXXXNEDEDKQTSVINEKVDQEKTYQEARRKNNIDNYDGFKWNSKEVLISLTVGSVMLII 2404
            P     K  DREE+D Y +     D G P+++    + + + D ND+ P F    +  + + E+A  G+ +  +  TD D  +   I    ++      +R F ++A +GL  I   LD E +     + V+A D G+  +     + VNV D+NDN P I    +++ ++D+     L EN P  + +A++TVTD D++ NG V C     +++  F L   + N F        + T    D E+   Y + +   D G PPL+    + I ++DENDN P F++ F    I EN  PG  +  + ATD D G NA+I Y +        S+ +  TG++T +   DRE      F   A D   P L S+V V + I D+ND  P+F  + Y+F + E     G VG +   D D   NS +  S      N  + + S   +     I  DRE Q +Y   V+A+D G  SRSSS  V I + D+NDN P F  P  +   + +  +  PGT++ +VMA D+D   N +V Y +        F ID+++G + +    D  +L   R+L+ A D G P    +  +  LF NE     T +INE V ++ T         I +      +  ++L++   G++ +++
Sbjct:  199 PQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKE-TEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLL-VLASDGGL--MPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDT---VVLSENIPLNTKIALITVTDKDADHNGRVTCFT---DHEIPFRLRPVFSNQF-------LLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINYLLGPDAPPEFSL-DRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSI--LDENDDFTIDSQTGVI-RPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNYSYELVLPSTNPGTVVFQVMAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFVNESVTNAT-LINELV-RKSTEAPVTPNTEIADVSSPTSDYVKILVAAVAGTITVVV 826          

HSP 2 Score: 117.857 bits (294), Expect = 2.696e-25
Identity = 161/596 (27.01%), Postives = 253/596 (42.45%), Query Frame = 2
Query:  491 IFKTMKLFDREER----DRYELVFIATDKGI-PKKTGE-IKIYIKIRDLNDHAPEFDMPKDYV-IGVKEDAIEGSKICDIKVTDKDDETLITV---LINSNS--DPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFE---LISRYFNNFPNSKRNYRIVTLRE-FDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRI------KENIMPGSPIFTLIATDPDIGKNAKII----YQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGWV--GKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTY-LLANNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNG 2191
            IF T    DRE+      R E  F   +  I P +    +KI   I D+ND+AP F  P   + I + E++   SK       D D  T       LI S +    +V    +   +  L +   LD E     + + V   D G P  +++  + V+V D NDN P        ++     + EN P  + V  +  TDAD           I  N K +F    L+S       +      ++T++E  DRE   ++++ V   D GL P  ++  + + + D NDN PS    +  + +       ENI   + I  +  TD D   N ++     ++IP + + + S    +  ++      D E       K  A D   P LN S  + ++++DEND  P+F  S     I E  S  +   KV A D DS  N++I +           + +  G +   K  +LDRE +  Y  T+ AKDNGVP  +S+V V + + D NDNSP F+    + Y   + E L     +  +  TD D  +N  VT  +L  N  F ID ++G +  N + DR +       + A+D G
Sbjct:   84 IFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLF--PATVINISIPENSAINSKYTLPAAVDPDVGTNGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEK-DTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHP-----VFKETEIEVSIPENAPVGTSVTQLHATDAD-----------IGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMP--ARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFS----NQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVK--KLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTH---NEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGG 649          

HSP 3 Score: 83.1889 bits (204), Expect = 1.198e-14
Identity = 78/295 (26.44%), Postives = 132/295 (44.75%), Query Frame = 2
Query:  380 KLSPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKD--DETLITV-LINSNSDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLP 1255
            K+S  D+D G N+EI Y +       F L +      +   +K  DRE+ D+Y    +A D G+P  T  + +++ I D ND++P F    +Y   V E+      +  I VTD D  D + +T+ +++ N D      F + + +G+   +          +T  V A D G  + ++S  +T+NV+D+NDN P  ++   S+ S    L    P  + V  V   D D+ MN  V  +++  N +  F +     N          I  + + D   +  +RV V+  D G P
Sbjct:  487 KVSATDADSGPNAEINYLLGPDAPPEFSLDRRTG---MLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTH-NEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDD------FTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPP-SNYSYELVLPSTNPG-TVVFQVMAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGN----------ITLMEKCDVTDLGLHRVLVKANDLGQP 759          

HSP 4 Score: 69.707 bits (169), Expect = 1.367e-10
Identity = 90/327 (27.52%), Postives = 138/327 (42.20%), Query Frame = 2
Query: 1277 ITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIIS---IPNPSTGIVTNLV---SFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEG--YSGWVGKVEAYXXXXXXXXXIIFSFTGFLHN---HLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGV-PSRSSSVIVQIQLEDINDNSPKFS-----QPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNKYFIIDEKSGEVFINRTLDRLELVPRR---LLIMAKDNGTP 2197
            I   IED NDN P F        I EN    S      A DPD+G N    Y++  K QNI     I  P    +  L+     DRE   +   K    D   P  +S+  + + + D ND  P+F  +     I E       V ++ A D D   N+ I FSF+  + N    L+ L +   + + K   LDRE    ++L V A D G+ P+R+   +V + + D+NDN P         P++   +  ++E +   T I  +  TD D + NG+VT    +   F +       F+  T   L+    +   + ++A D G P
Sbjct:  125 IRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGTNGVQNYEL-IKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKE-PLDREETPNHKLLVLASDGGLMPARA---MVLVNVTDVNDNVPSIDIRYIVNPVNDTVV--LSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQFLLETAAYLDYESTKEYAIKLLAADAGKP 444          
BLAST of protocadherin-1 vs. UniProt/SwissProt
Match: sp|Q71M42|PC11X_PANTR (Protocadherin-11 X-linked OS=Pan troglodytes OX=9598 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 216.083 bits (549), Expect = 6.444e-56
Identity = 190/651 (29.19%), Postives = 306/651 (47.00%), Query Frame = 2
Query:  488 PIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKD--DETLITVLINSNSDPEVKRHFQVSAISGLTLISR-LDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQI----VIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGY--SGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNK---YFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPSXXXXXXXXXXXXNEDEDKQTSVINEKVDQEKTYQEARRKNNIDNYDGFKWNSKEVLISLTVGSVMLII 2404
            P     K  DREE+D Y +     D G P+++    + + + D ND+ P F    +  + + E+A  G+ +  +  TD D  +   I    ++      +R F ++A +GL  I   LD E +     + V+A D G+  +     + VNV D+NDN P I    +++ ++D+     L EN P  + +A++TVTD D++ NG V C     +++  F L   + N F        + T    D E+   Y + +   D G PPL+    + I ++DENDN P F++ F    I EN  PG  +  + ATD D G NA+I Y +        S+ +  TG++T +   DRE      F   A D   P L S+V V + I D+ND  P+F  + Y+F + E     G VG +   D D   NS +  S      N  + + S   +     I  DRE Q +Y   V+A+D G  SRSSS  V I + D+NDN P F  P  +   + +  +  PGT++ +VMA D+D   N +V Y +        F ID+++G + +    D  +L   R+L+ A D G P    +  +  LF NE     T +INE V ++ T         I +      +  ++L++   G++ +++
Sbjct:  199 PQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKE-TEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLL-VLASDGGL--MPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDT---VVLSENIPLNTKIALITVTDKDADHNGRVTCFT---DHEIPFRLRPVFSNQF-------LLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINYLLGPDAPPEFSL-DRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSI--LDENDDFTIDSQTGVI-RPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNYSYELVLPSTNPGTVVFQVMAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFVNESVTNAT-LINELV-RKSTEAPVTPNTEIADVSSPTSDYVKILVAAVAGTITVVV 826          

HSP 2 Score: 117.857 bits (294), Expect = 2.696e-25
Identity = 161/596 (27.01%), Postives = 253/596 (42.45%), Query Frame = 2
Query:  491 IFKTMKLFDREER----DRYELVFIATDKGI-PKKTGE-IKIYIKIRDLNDHAPEFDMPKDYV-IGVKEDAIEGSKICDIKVTDKDDETLITV---LINSNS--DPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFE---LISRYFNNFPNSKRNYRIVTLRE-FDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRI------KENIMPGSPIFTLIATDPDIGKNAKII----YQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGWV--GKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTY-LLANNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNG 2191
            IF T    DRE+      R E  F   +  I P +    +KI   I D+ND+AP F  P   + I + E++   SK       D D  T       LI S +    +V    +   +  L +   LD E     + + V   D G P  +++  + V+V D NDN P        ++     + EN P  + V  +  TDAD           I  N K +F    L+S       +      ++T++E  DRE   ++++ V   D GL P  ++  + + + D NDN PS    +  + +       ENI   + I  +  TD D   N ++     ++IP + + + S    +  ++      D E       K  A D   P LN S  + ++++DEND  P+F  S     I E  S  +   KV A D DS  N++I +           + +  G +   K  +LDRE +  Y  T+ AKDNGVP  +S+V V + + D NDNSP F+    + Y   + E L     +  +  TD D  +N  VT  +L  N  F ID ++G +  N + DR +       + A+D G
Sbjct:   84 IFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLF--PATVINISIPENSAINSKYTLPAAVDPDVGTNGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEK-DTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHP-----VFKETEIEVSIPENAPVGTSVTQLHATDAD-----------IGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMP--ARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFS----NQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVK--KLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTH---NEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGG 649          

HSP 3 Score: 83.1889 bits (204), Expect = 1.208e-14
Identity = 78/295 (26.44%), Postives = 132/295 (44.75%), Query Frame = 2
Query:  380 KLSPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKD--DETLITV-LINSNSDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLP 1255
            K+S  D+D G N+EI Y +       F L +      +   +K  DRE+ D+Y    +A D G+P  T  + +++ I D ND++P F    +Y   V E+      +  I VTD D  D + +T+ +++ N D      F + + +G+   +          +T  V A D G  + ++S  +T+NV+D+NDN P  ++   S+ S    L    P  + V  V   D D+ MN  V  +++  N +  F +     N          I  + + D   +  +RV V+  D G P
Sbjct:  487 KVSATDADSGPNAEINYLLGPDAPPEFSLDRRTG---MLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTH-NEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDD------FTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPP-SNYSYELVLPSTNPG-TVVFQVMAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGN----------ITLMEKCDVTDLGLHRVLVKANDLGQP 759          

HSP 4 Score: 69.707 bits (169), Expect = 1.379e-10
Identity = 90/327 (27.52%), Postives = 138/327 (42.20%), Query Frame = 2
Query: 1277 ITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIIS---IPNPSTGIVTNLV---SFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEG--YSGWVGKVEAYXXXXXXXXXIIFSFTGFLHN---HLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGV-PSRSSSVIVQIQLEDINDNSPKFS-----QPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNKYFIIDEKSGEVFINRTLDRLELVPRR---LLIMAKDNGTP 2197
            I   IED NDN P F        I EN    S      A DPD+G N    Y++  K QNI     I  P    +  L+     DRE   +   K    D   P  +S+  + + + D ND  P+F  +     I E       V ++ A D D   N+ I FSF+  + N    L+ L +   + + K   LDRE    ++L V A D G+ P+R+   +V + + D+NDN P         P++   +  ++E +   T I  +  TD D + NG+VT    +   F +       F+  T   L+    +   + ++A D G P
Sbjct:  125 IRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGTNGVQNYEL-IKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKE-PLDREETPNHKLLVLASDGGLMPARA---MVLVNVTDVNDNVPSIDIRYIVNPVNDTVV--LSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQFLLETAAYLDYESTKEYAIKLLAADAGKP 444          
BLAST of protocadherin-1 vs. TrEMBL
Match: A0A0S7FQV3 (PCD18 (Fragment) OS=Poeciliopsis prolifica OX=188132 GN=PCD18 PE=4 SV=1)

HSP 1 Score: 285.034 bits (728), Expect = 9.130e-78
Identity = 224/625 (35.84%), Postives = 328/625 (52.48%), Query Frame = 2
Query:  386 SPRDSDYGINSEIIYSIEGKDKGFFKL-LQMKNNKPIFK---TMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDET--LITVLINSNSDPEVKRHFQVSAISG-LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLM-ENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIP-----NPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGY--SGWVGKVEAYXXXXXXXXXIIFSFTGF-LHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLAN----NKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPS 2200
            S  D D G NS   Y++E  +   FK+ +Q +++   +     ++  DRE R  YEL + A+D+G+P +TG   + I I D ND++P F+    YVI + E++  G+ + D+  TD DD T   I    +++  P++   F+++  SG LTLI RLDYE+ +  + I V A D G  ++     I V V+D+NDN P I I+  S  + +   + E  P ++FVA+V V D DS +NG V+C L   + +  F+L   Y NN       Y I+T    DRE  S + +TV  +D+G P LS+ +  T+ + DENDNPP F K  ++    EN  PG+ + ++ ATDPD+  N ++ Y I E + +  SI      +PS G +  L +FDRE   +I+F   A D   P L S+  V L I DEND  P F  S+    + E       V  V A D DS  N+DI +S T    H    I  + G+IF  K  +LD E QS Y+L + AKDNG P RSSS+ V I + D NDN P F+ P D    K I E L     +  ++A D D + NG++ Y +        +F ID  SG ++ N+ +DR       L I A D   P+
Sbjct:  158 SATDPDVGENSLYTYALEPNNN--FKIDVQSRSDGIKYAELVVLRELDREVRSSYELQYTASDRGVPPRTGSTLLKISIADSNDNSPVFEK-SSYVINLPENSPVGTLLIDLNATDADDGTNAKIAYSFSNHVSPKIIETFKINTDSGHLTLIKRLDYET-VNSYDIDVQAQDMGPNSMPAHCKILVKVVDVNDNKPDISINFPSQGNGDAAYVSEASPLDTFVALVRVEDLDSGLNGEVECKL---HGQGYFKLQKTYENN-------YMILTNVSLDREKRSEFSLTVVAEDRGTPSLSTVKHFTVHVTDENDNPPRFEKGRYEIFKTENNAPGAYLTSITATDPDLDANGQVSYSILENFIHGSSISTYVTIDPSNGAIYALRTFDREEVNNISFVVQAKDAGKPPLTSNTTVVLSILDENDNSPSFPKSSLAVDVLENMRIGELVASVTATDADSGRNADITYSITATNNHGTFSISPNTGSIFLIK--KLDFETQSLYKLNITAKDNGRPPRSSSIPVVIYVRDFNDNPPIFA-PGD--IFKSIPENLPLSASVMTIIAHDTDADINGQLQYSIVQQIPRGSHFNIDPSSGLIYTNKEIDREFSNLFELTIKATDQAVPA 763          

HSP 2 Score: 192.971 bits (489), Expect = 9.773e-47
Identity = 188/634 (29.65%), Postives = 296/634 (46.69%), Query Frame = 2
Query:  371 LSIKLSPRDSDYGINSEIIYSIEGK-DKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDM--PKDY---VIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRH------FQVSAISGLTLISRLDYESSMR-KFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGY--SGWVGKVEAYXXXXXXXXXIIFSFTGFL--HNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPS---RSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTY--LLANNKYFIIDEKSGEVFINRTLDRLELVPRRLL----IMAKDNGT 2194
            L I L+  D+D G N++I YS          +  ++  +      +K  D E  + Y++   A D G        KI +K+ D+ND+ P+  +  P         V E +   + +  ++V D D           N + E K H       Q +  +   +++ +  +   R +F++ V+A D G P+L+T    TV+V D NDN P+            FK   N P  +++  +T TD D + NG V  +++E  N  +   IS Y    P+   N  I  LR FDRE +++    VQ KD G PPL+S  T+ + I DENDN PSF K      + EN+  G  + ++ ATD D G+NA I Y I     +     +P+TG +  +   D E  +       A D   P  +SS+ V + + D ND  P+F        I E    S  V  + A+D D++ N  + +S    +   +H  I  S G I++ K  ++DRE  + ++LT++A D  VP+   R +   V I + D+NDN P F     S         +V G+++T VMA D D+ ENG+V Y  L  +   FI+D  SG++ +       +LVP RL+    + A D+GT
Sbjct:  262 LLIDLNATDADDGTNAKIAYSFSNHVSPKIIETFKINTDSGHLTLIKRLDYETVNSYDIDVQAQDMGPNSMPAHCKILVKVVDVNDNKPDISINFPSQGNGDAAYVSEASPLDTFVALVRVEDLDS--------GLNGEVECKLHGQGYFKLQKTYENNYMILTNVSLDREKRSEFSLTVVAEDRGTPSLSTVKHFTVHVTDENDNPPRFE----KGRYEIFKTENNAPG-AYLTSITATDPDLDANGQVSYSILE--NFIHGSSISTYVTIDPS---NGAIYALRTFDREEVNNISFVVQAKDAGKPPLTSNTTVVLSILDENDNSPSFPKSSLAVDVLENMRIGELVASVTATDADSGRNADITYSITATNNHGTFSISPNTGSIFLIKKLDFETQSLYKLNITAKDNGRPPRSSSIPVVIYVRDFNDNPPIFAPGDIFKSIPENLPLSASVMTIIAHDTDADINGQLQYSIVQQIPRGSHFNIDPSSGLIYTNK--EIDREFSNLFELTIKATDQAVPAEFRRFALKNVTIWVTDLNDNVPTFV----SQNALVAEPNIVIGSILTTVMALDPDDGENGEVEYELLEGDADTFIMDRYSGDIRLAS-----QLVPSRLMYTLAVSATDHGT 866          

HSP 3 Score: 144.821 bits (364), Expect = 2.305e-31
Identity = 155/570 (27.19%), Postives = 256/570 (44.91%), Query Frame = 2
Query:  593 KIYIKIRDLNDHAPEFD---MPKDYVIGVKEDAIEGSKICDIKVTDKD--DETLITVLINSNSDPEVKRHFQVSAI--SGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVD---CNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKEN--IMPGSPIFTLIAT----DPDIGKNAKI--------IYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYH-FKIKEGYSG-WVGKVEAYXXXXXXXXXIIFS-FTGFLHN-----HLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLA---NNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTP 2197
             + +++ D+ND+AP F    +P    I + E A  G++I     TD D  + +L T  +  N++ ++    +   I  + L ++  LD E     + +   A D G+P  T ST + +++ D NDN P         SS    L EN P  + +  +  TDAD   N  +     N + P   + F++         N+   + +  ++  D ET++ Y + VQ +D G   + +   I + + D NDN P  S  F      +   +   SP+ T +A     D D G N ++         +++ + Y+N       +  I+TN VS DRE  +  +    A D   P L++    T+ + DEND  P F    Y  FK +    G ++  + A D D ++N  + +S    F+H      ++ I  S+G I++ +    DRE  +     V+AKD G P  +S+  V + + D NDNSP F +   S     + E +  G L+  V ATD D   N  +TY +    N+  F I   +G +F+ + LD       +L I AKDNG P
Sbjct:  120 HVEVEVLDINDNAPHFARALIP----IEISESAAVGARIPLDSATDPDVGENSLYTYALEPNNNFKIDVQSRSDGIKYAELVVLRELDREVR-SSYELQYTASDRGVPPRTGSTLLKISIADSNDNSP-----VFEKSSYVINLPENSPVGTLLIDLNATDADDGTNAKIAYSFSNHVSPKIIETFKI---------NTDSGH-LTLIKRLDYETVNSYDIDVQAQDMGPNSMPAHCKILVKVVDVNDNKPDISINFPSQGNGDAAYVSEASPLDTFVALVRVEDLDSGLNGEVECKLHGQGYFKLQKTYEN-------NYMILTN-VSLDREKRSEFSLTVVAEDRGTPSLSTVKHFTVHVTDENDNPPRFEKGRYEIFKTENNAPGAYLTSITATDPDLDANGQVSYSILENFIHGSSISTYVTIDPSNGAIYALR--TFDREEVNNISFVVQAKDAGKPPLTSNTTVVLSILDENDNSPSFPK---SSLAVDVLENMRIGELVASVTATDADSGRNADITYSITATNNHGTFSISPNTGSIFLIKKLDFETQSLYKLNITAKDNGRP 656          

HSP 4 Score: 88.9669 bits (219), Expect = 4.308e-14
Identity = 90/333 (27.03%), Postives = 145/333 (43.54%), Query Frame = 2
Query: 1277 ITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGI----VTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEG--YSGWVGKVEAYXXXXXXXXXIIFSFTGFL-------------HNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDS---GYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNKYFIID---EKSGEVFINRTLDRLELVPRRLLIMAKDNGTPS 2200
            + + + D NDN P F++      I E+   G+ I    ATDPD+G+N+   Y +       I + + S GI    +  L   DRE+ +S   +  A D   P    S  + + I D ND  P+F  S+Y   + E       +  + A D D  +N+ I +SF+  +               HL ++K           +LD E  ++Y + V+A+D G  S  +   + +++ D+NDN P  S    S   G    ++E     T +  V   D D   NG+V   L    YF +    E +  +  N +LDR +     L ++A+D GTPS
Sbjct:  121 VEVEVLDINDNAPHFARALIPIEISESAAVGARIPLDSATDPDVGENSLYTYALEPNNNFKIDVQSRSDGIKYAELVVLRELDREVRSSYELQYTASDRGVPPRTGSTLLKISIADSNDNSPVFEKSSYVINLPENSPVGTLLIDLNATDADDGTNAKIAYSFSNHVSPKIIETFKINTDSGHLTLIK-----------RLDYETVNSYDIDVQAQDMGPNSMPAHCKILVKVVDVNDNKPDISINFPSQGNGDAAYVSEASPLDTFVALVRVEDLDSGLNGEVECKLHGQGYFKLQKTYENNYMILTNVSLDREKRSEFSLTVVAEDRGTPS 442          
BLAST of protocadherin-1 vs. TrEMBL
Match: A0A0S7FTZ2 (FAT4 (Fragment) OS=Poeciliopsis prolifica OX=188132 GN=FAT4 PE=4 SV=1)

HSP 1 Score: 285.034 bits (728), Expect = 8.205e-76
Identity = 224/625 (35.84%), Postives = 328/625 (52.48%), Query Frame = 2
Query:  386 SPRDSDYGINSEIIYSIEGKDKGFFKL-LQMKNNKPIFK---TMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDET--LITVLINSNSDPEVKRHFQVSAISG-LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLM-ENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIP-----NPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGY--SGWVGKVEAYXXXXXXXXXIIFSFTGF-LHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLAN----NKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPS 2200
            S  D D G NS   Y++E  +   FK+ +Q +++   +     ++  DRE R  YEL + A+D+G+P +TG   + I I D ND++P F+    YVI + E++  G+ + D+  TD DD T   I    +++  P++   F+++  SG LTLI RLDYE+ +  + I V A D G  ++     I V V+D+NDN P I I+  S  + +   + E  P ++FVA+V V D DS +NG V+C L   + +  F+L   Y NN       Y I+T    DRE  S + +TV  +D+G P LS+ +  T+ + DENDNPP F K  ++    EN  PG+ + ++ ATDPD+  N ++ Y I E + +  SI      +PS G +  L +FDRE   +I+F   A D   P L S+  V L I DEND  P F  S+    + E       V  V A D DS  N+DI +S T    H    I  + G+IF  K  +LD E QS Y+L + AKDNG P RSSS+ V I + D NDN P F+ P D    K I E L     +  ++A D D + NG++ Y +        +F ID  SG ++ N+ +DR       L I A D   P+
Sbjct:  158 SATDPDVGENSLYTYALEPNNN--FKIDVQSRSDGIKYAELVVLRELDREVRSSYELQYTASDRGVPPRTGSTLLKISIADSNDNSPVFEK-SSYVINLPENSPVGTLLIDLNATDADDGTNAKIAYSFSNHVSPKIIETFKINTDSGHLTLIKRLDYET-VNSYDIDVQAQDMGPNSMPAHCKILVKVVDVNDNKPDISINFPSQGNGDAAYVSEASPLDTFVALVRVEDLDSGLNGEVECKL---HGQGYFKLQKTYENN-------YMILTNVSLDREKRSEFSLTVVAEDRGTPSLSTVKHFTVHVTDENDNPPRFEKGRYEIFKTENNAPGAYLTSITATDPDLDANGQVSYSILENFIHGSSISTYVTIDPSNGAIYALRTFDREEVNNISFVVQAKDAGKPPLTSNTTVVLSILDENDNSPSFPKSSLAVDVLENMRIGELVASVTATDADSGRNADITYSITATNNHGTFSISPNTGSIFLIK--KLDFETQSLYKLNITAKDNGRPPRSSSIPVVIYVRDFNDNPPIFA-PGD--IFKSIPENLPLSASVMTIIAHDTDADINGQLQYSIVQQIPRGSHFNIDPSSGLIYTNKEIDREFSNLFELTIKATDQAVPA 763          

HSP 2 Score: 144.436 bits (363), Expect = 4.575e-31
Identity = 153/569 (26.89%), Postives = 255/569 (44.82%), Query Frame = 2
Query:  593 KIYIKIRDLNDHAPEFD---MPKDYVIGVKEDAIEGSKICDIKVTDKD--DETLITVLINSNSDPEVKRHFQVSAISGLTLISRLDYESSMR-KFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVD---CNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKEN--IMPGSPIFTLIAT----DPDIGKNAKI--------IYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYH-FKIKEGYSG-WVGKVEAYXXXXXXXXXIIFS-FTGFLHN-----HLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLA---NNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTP 2197
             + +++ D+ND+AP F    +P    I + E A  G++I     TD D  + +L T  +  N++ ++    +   I    L+   + +  +R  + +   A D G+P  T ST + +++ D NDN P         SS    L EN P  + +  +  TDAD   N  +     N + P   + F++         N+   + +  ++  D ET++ Y + VQ +D G   + +   I + + D NDN P  S  F      +   +   SP+ T +A     D D G N ++         +++ + Y+N       +  I+TN VS DRE  +  +    A D   P L++    T+ + DEND  P F    Y  FK +    G ++  + A D D ++N  + +S    F+H      ++ I  S+G I++ +    DRE  +     V+AKD G P  +S+  V + + D NDNSP F +   S     + E +  G L+  V ATD D   N  +TY +    N+  F I   +G +F+ + LD       +L I AKDNG P
Sbjct:  120 HVEVEVLDINDNAPHFARALIP----IEISESAAVGARIPLDSATDPDVGENSLYTYALEPNNNFKIDVQSRSDGIKYAELVVLRELDREVRSSYELQYTASDRGVPPRTGSTLLKISIADSNDNSP-----VFEKSSYVINLPENSPVGTLLIDLNATDADDGTNAKIAYSFSNHVSPKIIETFKI---------NTDSGH-LTLIKRLDYETVNSYDIDVQAQDMGPNSMPAHCKILVKVVDVNDNKPDISINFPSQGNGDAAYVSEASPLDTFVALVRVEDLDSGLNGEVECKLHGQGYFKLQKTYEN-------NYMILTN-VSLDREKRSEFSLTVVAEDRGTPSLSTVKHFTVHVTDENDNPPRFEKGRYEIFKTENNAPGAYLTSITATDPDLDANGQVSYSILENFIHGSSISTYVTIDPSNGAIYALR--TFDREEVNNISFVVQAKDAGKPPLTSNTTVVLSILDENDNSPSFPK---SSLAVDVLENMRIGELVASVTATDADSGRNADITYSITATNNHGTFSISPNTGSIFLIKKLDFETQSLYKLNITAKDNGRP 656          

HSP 3 Score: 126.716 bits (317), Expect = 1.408e-25
Identity = 162/612 (26.47%), Postives = 274/612 (44.77%), Query Frame = 2
Query:  371 LSIKLSPRDSDYGINSEIIYSIEG-KDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKR--HFQVSAISGLTLISR-LDYESSMRKFTIPVIAVDNGIP---NLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLME-NKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQI------PEKYQNIISIPNPSTGIVTNLVSFDREMNTS---ITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKE--GYSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLA---NNKYFIIDEKSGEVFINRTLD 2140
            L   ++  D+D G N++I YSI    + G F +    N   IF   KL D E +  Y+L   A D G P ++  I + I +RD ND+ P F  P D    + E+    + +  I   D D +  I   +  +   ++ R  HF +   SGL   ++ +D E S   F + + A D  +P          +T+ V D+NDN P  V       S N  + E N    S +  V   D D   NG V+  L+E  +   F ++ RY  +    +   ++V  R         Y + V   D G    +S+  +TI ++  +   P FS+  +   +KE   PG+ + +L A+      ++K+ Y I       +    + +I    TG++      DRE  +    +   A   D   P    + EV + ++D ND  P+F +      I+E  G    + ++ A D D   N+ + ++      +   I    G++ + K  +LDRE +S Y L V A D     +SS + + I ++D+ND++PKFS+   + Y   I E + PG+++  ++A+D D   NG+VTY L     +  F+++  +G   + R LD
Sbjct:  591 LVASVTATDADSGRNADITYSITATNNHGTFSI--SPNTGSIFLIKKL-DFETQSLYKLNITAKDNGRPPRSSSIPVVIYVRDFNDNPPIF-APGDIFKSIPENLPLSASVMTIIAHDTDAD--INGQLQYSIVQQIPRGSHFNIDPSSGLIYTNKEIDREFS-NLFELTIKATDQAVPAEFRRFALKNVTIWVTDLNDNVPTFV-------SQNALVAEPNIVIGSILTTVMALDPDDGENGEVEYELLE-GDADTF-IMDRYSGDI---RLASQLVPSRLM-------YTLAVSATDHGTDRKTSRTELTIILQGIDG--PVFSQPKYITILKEGQPPGTNVISLDASS-PRSSSSKVEYFIVAVRSGGKAVGRLFTI-GRHTGVIQTAAELDREQGSDLYLVDVYAIETDASQPRTQRA-EVEITLQDINDNPPVFPNDILDVTIEENVGDGFKIMQLTATDADEGPNALVTYTIISGADDSFRIDPESGDLIATK--KLDRERRSKYSLLVRADDG---KQSSDMRLNITVQDVNDHTPKFSR---ATYSFDIPEDMAPGSIVAAILASDSDSGVNGEVTYSLEEDDEDGTFLLNPVTGVFNVTRPLD 1163          

HSP 4 Score: 116.701 bits (291), Expect = 1.941e-22
Identity = 140/539 (25.97%), Postives = 234/539 (43.41%), Query Frame = 2
Query:  395 DSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDET----LITVLINSNSDPEVKRHFQVSAISG-LTLISRLDYESSMRKFTIPVIAV--DNGIPNLTTSTTITVNVLDINDN---FPQIVIDTL--SDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGI--VTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGWVG--KVEAYXXXXXXXXXIIFSF-TGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSR---SSSVIVQIQLEDINDNSPKFS 1951
            D D G N E+ Y +   D   F + +   +  +   +       R  Y L   ATD G  +KT   ++ I ++ ++   P F  PK Y+  +KE    G+ +  +  +     +       V + S     V R F +   +G +   + LD E     + + V A+  D   P  T    + + + DINDN   FP  ++D     +    FK+M+          +T TDAD   N +V            + +IS   ++F     +  ++  ++ DRE  S Y + V+  D      SS   + I ++D ND+ P FS+  +   I E++ PGS +  ++A+D D G N ++ Y + E  ++   + NP TG+  VT  + ++ +    +T KA    E      S+V V   + D ND  P+F ++ Y   + E      G   V A D D   N+ +++   +G  H H  I K +G +  ++   LDRE QS Y L +   D   P     +S+  V I L D+ND  P F+
Sbjct:  812 DPDDGENGEVEYELLEGDADTFIMDRYSGDIRLASQLV----PSRLMYTLAVSATDHGTDRKTSRTELTIILQGID--GPVFSQPK-YITILKEGQPPGTNVISLDASSPRSSSSKVEYFIVAVRSGGK-AVGRLFTIGRHTGVIQTAAELDREQGSDLYLVDVYAIETDASQPR-TQRAEVEITLQDINDNPPVFPNDILDVTIEENVGDGFKIMQ----------LTATDADEGPNALV-----------TYTIISGADDSFRIDPESGDLIATKKLDRERRSKYSLLVRADDGKQ---SSDMRLNITVQDVNDHTPKFSRATYSFDIPEDMAPGSIVAAILASDSDSGVNGEVTYSLEEDDEDGTFLLNPVTGVFNVTRPLDYETQQYYILTAKA----EDGGGQASTVRVYFNVLDVNDNSPIFNTTVYSASVSESLPPGSGIVTVLASDADDGPNAQLLYKISSGDPHGHFAITK-EGVLKIKRA--LDRETQSFYNLAITVNDLAPPPATRFTSTTQVSIILLDVNDCPPTFT 1310          

HSP 5 Score: 114.775 bits (286), Expect = 6.672e-22
Identity = 113/427 (26.46%), Postives = 200/427 (46.84%), Query Frame = 2
Query:  425 IYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELV---FIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYV-IGVKEDAIEGSKICDIKVTDKDD--ETLITVLINSNSDPEVKRHFQVSAISG-LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFEL--ISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIW--IEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQI----PEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNP----LLNSSVEVTLEIEDENDCIPMFLSSA 1648
            I ++    K   +L  +  +  + +T    DRE+     LV    I TD   P+ T   ++ I ++D+ND+ P F  P D + + ++E+  +G KI  +  TD D+    L+T  I S +D      F++   SG L    +LD E    K+++ ++  D+G    ++   + + V D+ND+ P+      S ++ +F + E+    S VA +  +D+DS +NG V  +L E +    F L  ++  FN              R  D ET  +Y +T + +D G        T+ ++  + D NDN P F+   +   + E++ PGS I T++A+D D G NA+++Y+I    P  +  I        G++    + DRE  +     A  +++  P       S+ +V++ + D NDC P F S  
Sbjct:  925 IVAVRSGGKAVGRLFTIGRHTGVIQTAAELDREQGSDLYLVDVYAIETDASQPR-TQRAEVEITLQDINDNPPVF--PNDILDVTIEENVGDGFKIMQLTATDADEGPNALVTYTIISGAD----DSFRIDPESGDLIATKKLDRERR-SKYSL-LVRADDG--KQSSDMRLNITVQDVNDHTPK-----FSRATYSFDIPEDMAPGSIVAAILASDSDSGVNGEVTYSLEEDDEDGTFLLNPVTGVFN------------VTRPLDYETQQYYILTAKAEDGG----GQASTVRVYFNVLDVNDNSPIFNTTVYSASVSESLPPGSGIVTVLASDADDGPNAQLLYKISSGDPHGHFAITK-----EGVLKIKRALDRETQSFYNL-AITVNDLAPPPATRFTSTTQVSIILLDVNDCPPTFTSCG 1313          

HSP 6 Score: 88.9669 bits (219), Expect = 4.885e-14
Identity = 92/335 (27.46%), Postives = 147/335 (43.88%), Query Frame = 2
Query: 1277 ITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGI----VTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGWVGK----VEAYXXXXXXXXXIIFSFTGFL-------------HNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDS---GYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNKYFIID---EKSGEVFINRTLDRLELVPRRLLIMAKDNGTPS 2200
            + + + D NDN P F++      I E+   G+ I    ATDPD+G+N+   Y +       I + + S GI    +  L   DRE+ +S   +  A D   P    S  + + I D ND  P+F  S+Y   + E  +  VG     + A D D  +N+ I +SF+  +               HL ++K           +LD E  ++Y + V+A+D G  S  +   + +++ D+NDN P  S    S   G    ++E     T +  V   D D   NG+V   L    YF +    E +  +  N +LDR +     L ++A+D GTPS
Sbjct:  121 VEVEVLDINDNAPHFARALIPIEISESAAVGARIPLDSATDPDVGENSLYTYALEPNNNFKIDVQSRSDGIKYAELVVLRELDREVRSSYELQYTASDRGVPPRTGSTLLKISIADSNDNSPVFEKSSYVINLPE--NSPVGTLLIDLNATDADDGTNAKIAYSFSNHVSPKIIETFKINTDSGHLTLIK-----------RLDYETVNSYDIDVQAQDMGPNSMPAHCKILVKVVDVNDNKPDISINFPSQGNGDAAYVSEASPLDTFVALVRVEDLDSGLNGEVECKLHGQGYFKLQKTYENNYMILTNVSLDREKRSEFSLTVVAEDRGTPS 442          
BLAST of protocadherin-1 vs. TrEMBL
Match: G5AQQ6 (Protocadherin gamma-A11 (Fragment) OS=Heterocephalus glaber OX=10181 GN=GW7_10583 PE=4 SV=1)

HSP 1 Score: 265.003 bits (676), Expect = 2.268e-71
Identity = 194/625 (31.04%), Postives = 317/625 (50.72%), Query Frame = 2
Query:  392 RDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKL-----FDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLIN-SNSDPEVKRHFQVSAISGLTLI-SRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIP-------NPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGWVG--KVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPL----DSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLL---ANNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTP 2197
            RD D G NS   Y +      +F L Q++      K  +L      DRE+   + L+  A D G P + G I I   + D+NDH P+F  P  Y + V E+   G+++  +  TD D+ T   V+ +  N + +    FQ+++ +G  L+   LD+E   + + + +   D G   L T+  + + V+D+NDN P+I I     +SS   L+EN P  S +A++ V D DS  NG V C +  PNN   F+L   Y N        Y+++T  E DRE I  Y VT+  KDQG PPL ++  + + + D+NDNPP FS+  +   I EN   G+ IF++ A D D  +NA + Y + E    I  +P       N  TGI+ +L SFD E   ++  +  ALD  +P+L  + ++ +++ D ND  P+F  + Y   ++E         +V A D D  +N++I +SF   L +++ +    G +F+++    D E    ++LT++A+D G P+ S++V +++ + D NDN+P+   P      S     +     PG L+TKV+A D D   N  ++Y +   ++   F +  ++GEV   R L   +    RLL+  +D G P
Sbjct:  199 RDPDVGANSLQSYQL--SPNSYFSL-QVRGGADGVKNPELVLEGGLDREKAAAHHLLLTAADGGDPIRKGTIPIRAVVLDVNDHIPKFTQPV-YQVSVPENLSSGTRVLVVNATDPDEGTNGEVMYSFRNMESKASEIFQMNSKTGEVLVQGPLDFEK-YKFYEMEIQGQDGG--GLLTTAKMLITVVDVNDNAPEITI-----TSSVNSLLENSPPGSVIALLNVRDRDSGENGQVSCFI--PNNLP-FKLEKTYGNY-------YKLITNSELDREQIQSYNVTLTAKDQGSPPLYTEAHLLLNVADDNDNPPVFSQSSYSAYIPENNPRGASIFSVTAVDLDSKENAHVTYSLME--DTIQGVPLSSYVSINSDTGILYSLQSFDYEQFQNLQLRVAALDGGDPVLTGTAQIKIKVTDANDNPPVFTQNVYKVSLRENVPPGTSMLQVTAIDQDEGANAEITYSFKTLL-SYVSVSAQSGVVFAQRA--FDHEQLRAFELTLQARDQGSPALSANVSLRVLVGDRNDNAPRVLYPALGPDGSALFDTVPRAAEPGYLVTKVVAVDADSGHNAWLSYHVLQASDPGLFSLGLRTGEVRTARALGDKDAARHRLLVAVRDGGKP 796          

HSP 2 Score: 120.939 bits (302), Expect = 4.504e-24
Identity = 135/483 (27.95%), Postives = 208/483 (43.06%), Query Frame = 2
Query:  812 LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIP--------EKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEG--YSGWVGKVEAYXXXXXXXXXIIFSFT-----GF-LHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTY----LLANNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPS 2200
            L L   LD E +     + + A D G P    +  I   VLD+ND+ P+      +       + EN    + V +V  TD D   NG V  +       +N E  S+    F  + +   ++     D E    Y + +Q +D G   L +   + I + D NDN P  +     + + EN  PGS I  L   D D G+N ++   IP        + Y N   +       +TN    DRE   S      A D+ +P L +   + L + D+ND  P+F  S+Y   I E       +  V A D DS  N+ + +S       G  L +++ I    G ++S +    D E     QL V A D G P  + +  ++I++ D NDN P F+Q +   Y   + E + PGT + +V A D DE  N ++TY    LL+   Y  +  +SG VF  R  D  +L    L + A+D G+P+
Sbjct:  235 LVLEGGLDREKAAAHHLL-LTAADGGDPIRKGTIPIRAVVLDVNDHIPK-----FTQPVYQVSVPENLSSGTRVLVVNATDPDEGTNGEVMYSF------RNME--SKASEIFQMNSKTGEVLVQGPLDFEKYKFYEMEIQGQDGG--GLLTTAKMLITVVDVNDNAPEITITSSVNSLLENSPPGSVIALLNVRDRDSGENGQVSCFIPNNLPFKLEKTYGNYYKL-------ITN-SELDREQIQSYNVTLTAKDQGSPPLYTEAHLLLNVADDNDNPPVFSQSSYSAYIPENNPRGASIFSVTAVDLDSKENAHVTYSLMEDTIQGVPLSSYVSINSDTGILYSLQ--SFDYEQFQNLQLRVAALDGGDPVLTGTAQIKIKVTDANDNPPVFTQNV---YKVSLRENVPPGTSMLQVTAIDQDEGANAEITYSFKTLLS---YVSVSAQSGVVFAQRAFDHEQLRAFELTLQARDQGSPA 685          

HSP 3 Score: 76.2554 bits (186), Expect = 2.994e-10
Identity = 76/297 (25.59%), Postives = 135/297 (45.45%), Query Frame = 2
Query: 1352 ENIMPGSPIFTLIATDPDIGKNAKIIYQI-PEKYQNII------SIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGW--VGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSD---GNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNKYFIIDEKSG---EVFINRTLDRLELVPRRLLIMAKDNGTP 2197
            E+  PGS      A DPD+G N+   YQ+ P  Y ++        + NP   +   L   DRE   +      A D  +P+   ++ +   + D ND IP F    Y   + E  S    V  V A D D  +N ++++SF         I + +   G +  +    LD E    Y++ ++ +D G    ++ +++ +   D+NDN+P+ +    +  +  + E   PG++I  +   D D  ENG+V+  + NN  F +++  G   ++  N  LDR ++    + + AKD G+P
Sbjct:  185 EHATPGSRFPLPNARDPDVGANSLQSYQLSPNSYFSLQVRGGADGVKNPELVLEGGL---DREKAAAHHLLLTAADGGDPIRKGTIPIRAVVLDVNDHIPKFTQPVYQVSVPENLSSGTRVLVVNATDPDEGTNGEVMYSFRNMESKASEIFQMNSKTGEVLVQG--PLDFEKYKFYEMEIQGQDGGGLLTTAKMLITVV--DVNDNAPEITI---TSSVNSLLENSPPGSVIALLNVRDRDSGENGQVSCFIPNNLPFKLEKTYGNYYKLITNSELDREQIQSYNVTLTAKDQGSP 471          
BLAST of protocadherin-1 vs. TrEMBL
Match: K1QH30 (Protocadherin-11 X-linked OS=Crassostrea gigas OX=29159 GN=CGI_10022471 PE=4 SV=1)

HSP 1 Score: 263.848 bits (673), Expect = 9.118e-70
Identity = 193/617 (31.28%), Postives = 319/617 (51.70%), Query Frame = 2
Query:  386 SPRDSDYGINSEI-IYSIEGKDKGFFKLLQMKNNKPIFKTMKL---FDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDD--ETLITVLINSNSDPEVKRHFQVSAISG-LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPL-LNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSG--WVGKVEAYXXXXXXXXXIIFSFTGFLHNHLW-ILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLA---NNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGT 2194
            S  D D G N+ +  Y +E     F  LL  K ++ +   + L    DRE+   Y +  +A D G+P+++  + I + ++D+ND+ P F   + Y + ++ED   G+ I  +  +D DD    ++    +S  + E ++ F ++  +G + +I +L + +S     I V A+D+G P L++   I ++V+D+N++ P+I I+ LS      K+ E+  K + +A V V D D+  NG V C +I P     F+L          S   Y++V   E DRE    Y V V C+D G+P  +  ++  + + D NDN P F +  +   I EN  PG  I  + A+D D   NA++ Y I   +++   + + STGI+   V FDRE  +SITFK +A D   P+ L ++  V L IED+ND  P F  S+Y+F++ E  +    VG V A D D  SN+ I+++      N  + I  S G I + +  +LDRE + +Y L+V A D GV  ++SS  V + + D ND  P    P       K+  T +P +++T+V A D DE ENG + Y +    ++  F ID K+G++++ R ++  ++    L I   D G 
Sbjct:  159 SALDKDMGENNSLKTYVLEPPSDTFGLLLGRKIDETLEVNLVLTQKLDREKVRSYRVYLVAKDGGLPQRSSTMTINVAVQDINDNKPRFSYSQ-YNVTIQEDITVGTTIMKVSASDDDDGQNGVVEYQFSSTPNGESQKLFSINNNTGEVKVIQQLTF-TSGEPHRIVVSAIDHGFPALSSQAFINIHVVDVNNHAPEININLLSGG----KVSESSNKGTVIAYVAVVDRDTGKNGQVKCKIIHPK----FQLHVL-------SNTEYKVVVSDELDREENIEYIVKVYCEDDGIPKQNKSKSFIVQVLDTNDNEPKFDRDLYNATITENKAPGQMITKVTASDSDQENNAEVHYAIEPNFRSKFEV-DSSTGIIRAKVEFDREQESSITFKVYAADNGTPVPLTATATVKLNIEDDNDEFPTFNKSSYNFQVMENKNADFVVGTVLATDKDIGSNAAIVYTLPFSYQNAPFSINPSTGEIKTNR--RLDREAKPSYTLSVMATDRGVSPKNSSCTVTVTVLDENDEYPHIRFPNRGNESIKVPHTTLPNSIVTQVEAYDKDEGENGTLRYSIVKRDDDNLFYIDAKTGQIYLFRKIESFDIKEFSLFIDVSDQGA 755          

HSP 2 Score: 158.303 bits (399), Expect = 1.878e-35
Identity = 133/424 (31.37%), Postives = 198/424 (46.70%), Query Frame = 2
Query:  377 IKLSPRDSDYGINSEIIYSIEGKDKG-FFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKD---DETLITVLINSNSDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLR-EFDRETISHYRVTVQCKDQGLP-PLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIP 1630
            +K+S  D D G N  + Y       G   KL  + NN    K ++       + + +V  A D G P  + +  I I + D+N+HAPE ++       V E + +G+ I  + V D+D   +  +   +I+    P+ + H   +    + +   LD E ++ ++ + V   D+GIP    S +  V VLD NDN P+   D       N  + ENK     +  VT +D+D E N  V    IEPN +  FE+ S           +  I+  + EFDRE  S     V   D G P PL++  T+ + IED+ND  P+F+K  +  ++ EN      + T++ATD DIG NA I+Y +P  YQN     NPSTG +      DRE   S T    A D      NSS  VT+ + DEND  P
Sbjct:  267 MKVSASDDDDGQNGVVEYQFSSTPNGESQKLFSINNNTGEVKVIQQLTFTSGEPHRIVVSAIDHGFPALSSQAFINIHVVDVNNHAPEININLLSGGKVSESSNKGTVIAYVAVVDRDTGKNGQVKCKIIH----PKFQLHVLSNTEYKVVVSDELDREENI-EYIVKVYCEDDGIPKQNKSKSFIVQVLDTNDNEPKFDRDLY-----NATITENKAPGQMITKVTASDSDQENNAEVHY-AIEPNFRSKFEVDS-----------STGIIRAKVEFDREQESSITFKVYAADNGTPVPLTATATVKLNIEDDNDEFPTFNKSSYNFQVMENKNADFVVGTVLATDKDIGSNAAIVYTLPFSYQNAPFSINPSTGEIKTNRRLDREAKPSYTLSVMATDRGVSPKNSSCTVTVTVLDENDEYP 668          

HSP 3 Score: 129.413 bits (324), Expect = 1.676e-26
Identity = 143/502 (28.49%), Postives = 218/502 (43.43%), Query Frame = 2
Query:  764 SDPEVKRHFQVSAISG-LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVL--DINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPE----KYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPM----FLSSAYHFKIKEGYSGWVGKVEAYXXXX--------XXXXXII---FSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANN--KYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTP 2197
            SD +    FQ++  +G L   S+LD E+      + V+ +  G  + T   TI VN+   D NDN P   ++     S++  + E+    S   + +  D D   N  +   ++EP +     L+ R  +          +V  ++ DRE +  YRV +  KD GLP  SS  TI + ++D NDN P FS   +   I+E+I  G+ I  + A+D D G+N  + YQ       + Q + SI N +TG V  +                A+D   P L+S   + + + D N+  P      LS     K+ E  S   G V AY                 II   F      +    ++ SD         +LDRE    Y + V  +D+G+P ++ S    +Q+ D NDN PKF + L   Y   ITE   PG +ITKV A+D D+  N +V Y +  N    F +D  +G +      DR +       + A DNGTP
Sbjct:   68 SDSDNSDLFQINENTGDLETKSKLDREALCPFQKLCVLPLRIGANSGTFFRTINVNISISDRNDNSPLFPMN-----STSLSIPEDANINSTFPLSSALDKDMGENNSLKTYVLEPPSDTFGLLLGRKID----ETLEVNLVLTQKLDREKVRSYRVYLVAKDGGLPQRSSTMTINVAVQDINDNKPRFSYSQYNVTIQEDITVGTTIMKVSASDDDDGQNGVVEYQFSSTPNGESQKLFSI-NNNTGEVKVIQQLTFTSGEPHRIVVSAIDHGFPALSSQAFINIHVVDVNNHAPEININLLSGG---KVSE--SSNKGTVIAYVAVVDRDTGKNGQVKCKIIHPKFQLHVLSNTEYKVVVSD---------ELDREENIEYIVKVYCEDDGIPKQNKSKSFIVQVLDTNDNEPKFDRDL---YNATITENKAPGQMITKVTASDSDQENNAEVHYAIEPNFRSKFEVDSSTGIIRAKVEFDREQESSITFKVYAADNGTP 542          

HSP 4 Score: 88.9669 bits (219), Expect = 4.702e-14
Identity = 51/134 (38.06%), Postives = 79/134 (58.96%), Query Frame = 2
Query: 1817 QLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLAN------NKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPS 2200
            +LDRE   +Y++ + AKD G+P RSS++ + + ++DINDN P+FS    S Y   I E +  GT I KV A+DDD+ +NG V Y  ++       K F I+  +GEV + + L      P R+++ A D+G P+
Sbjct:  204 KLDREKVRSYRVYLVAKDGGLPQRSSTMTINVAVQDINDNKPRFSY---SQYNVTIQEDITVGTTIMKVSASDDDDGQNGVVEYQFSSTPNGESQKLFSINNNTGEVKVIQQLTFTSGEPHRIVVSAIDHGFPA 334          
BLAST of protocadherin-1 vs. TrEMBL
Match: A0A210QG07 (Protocadherin-11 X-linked OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT13067 PE=4 SV=1)

HSP 1 Score: 264.618 bits (675), Expect = 2.539e-69
Identity = 188/571 (32.92%), Postives = 292/571 (51.14%), Query Frame = 2
Query:  512 FDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKD--DETLITVLINSNSDPEVKRHFQVSAISG-LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGW--VGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLL------ANNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNG 2191
             DRE RD YEL  IA+D+G P +TG +KI I + D ND++P F    +Y   + E+   GS I  +  TD D  +   +T   +S    +V+  F +++ SG +++I+ LDYE    ++   V+  D G P L+ S ++TV++ D+NDN PQI I+    S +   + E      +VA V V+D DS+ NG   C ++      NF L   Y N        Y+I+   + D ET   + VTV C+DQG+P   +  +  I ++D NDN P F+K  +Q  ++E+  PG+ +  +IATD D G N ++ Y +    Q+  SI +P+ G ++ +VS DRE+   I F   A D+ +P L+SS  V + + D ND  P F    +HF + E       VG + A D D+ +NS   F F   +     + +  G I      +LDRE+Q  Y  TV   D G P R S+  V +++ED NDN P    P +      +  T+  GTLI++V A D D+ +N ++ Y +       +   F +   SG + + R L   +    RL++  KD G
Sbjct:  213 LDRETRDFYELKVIASDRGFPVRTGSVKINITVTDFNDNSPAFSR-ANYSTTIPENKAVGSTILIVSATDFDTANNAKLTYSFSSRVSQKVQHKFSINSTSGQISVIAPLDYEQDT-QYQFQVVVRDQGQPPLSASASVTVDIQDLNDNAPQININL---SPAGTDISEAAAVGQYVASVAVSDRDSKANGNARCQVM----GNNFRLEEIYTNM-------YKILIQNKLDYETDKFHNVTVNCQDQGVPQQQNTTSFFIRVQDVNDNAPEFTKTKYQVTMQESNDPGAYVKEVIATDKDSGNNGRVSYSLEPDGQSFFSI-DPTMGTISAIVSLDRELRPVIRFHVTATDQGDPQLSSSTVVEVILGDINDNTPTFTQQKFHFHVLENQDRGPKVGTLTAEDQDAGANSQFSFDFVPPIPADFRLNQDTGVITGY--TKLDRELQKMYNFTVMVTDKGTPRRYSTAQVTVEVEDDNDNIPVIVHPNNFNNTVYLPYTVNAGTLISQVEAYDIDDGDNSRLRYYIDTIDPPNSGDVFSMGLFSGSLVVARKLQLYDADSYRLVLSVKDGG 764          

HSP 2 Score: 136.732 bits (343), Expect = 1.152e-28
Identity = 135/465 (29.03%), Postives = 215/465 (46.24%), Query Frame = 2
Query:  896 NLTTSTTITVNVLDINDNFP-QIVIDTLSDSSSNFKLMENKPKES---FVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELI--SRYFNNFPNS----KRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIY----QIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMF---LSSAYHFKIKEGYSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGI-----------QLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLA--NNKYFIIDEKSGEVFINRTLDRLELVPR-RLLIMAKDNGTP 2197
            N+     +  N LD++   P Q+ +D ++D+S  F   E     S    V  V +T      +G +D +  + N+ Q++EL+  +  F     S      +  +    + DRET   Y + V   D+G P  +    I I + D NDN P+FS+  +   I EN   GS I  + ATD D   NAK+ Y    ++ +K Q+  SI N ++G ++ +   D E +T   F+    D+  P L++S  VT++I+D ND  P     LS A    I E  +  VG+  A          +  S      N     +  GN F  + I           +LD E    + +TV  +D GVP + ++    I+++D+NDN+P+F++   + Y   + E+  PG  + +V+ATD D   NG+V+Y L      +F ID   G +    +LDR EL P  R  + A D G P
Sbjct:  110 NVAVYKQLGTNQLDLHQIIPIQVTVDDVNDNSPVFPASEVALTVSEGVQVGHVILT------SGAIDRDTGQNNSIQSYELVPSNEMFGLIQASDLGGGSDIGLKVRFKLDRETRDFYELKVIASDRGFPVRTGSVKINITVTDFNDNSPAFSRANYSTTIPENKAVGSTILIVSATDFDTANNAKLTYSFSSRVSQKVQHKFSI-NSTSGQISVIAPLDYEQDTQYQFQVVVRDQGQPPLSASASVTVDIQDLNDNAPQININLSPA-GTDISE--AAAVGQYVA---------SVAVSDRDSKANGNARCQVMGNNFRLEEIYTNMYKILIQNKLDYETDKFHNVTVNCQDQGVPQQQNTTSFFIRVQDVNDNAPEFTK---TKYQVTMQESNDPGAYVKEVIATDKDSGNNGRVSYSLEPDGQSFFSIDPTMGTISAIVSLDR-ELRPVIRFHVTATDQGDP 551          

HSP 3 Score: 97.4413 bits (241), Expect = 1.418e-16
Identity = 101/412 (24.51%), Postives = 183/412 (44.42%), Query Frame = 2
Query:  365 WRLSIKLSPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISG-LTLISRLDYESSMRK-FTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDN------PPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLL 1576
            +  S+ +S RDS    N+     + G +   F+L ++  N          D E    + +     D+G+P++      +I+++D+ND+APEF   K Y + ++E    G+ + ++  TDKD        ++ + +P+ +  F +    G ++ I  LD E  +R      V A D G P L++ST + V + DINDN P     T +    +F ++EN+ +   V  +T  D D+  N     + + P    +F L          ++    I    + DRE    Y  TV   D+G P   S   +T+ +ED+NDN      P +F+   +   +   +  G+ I  + A D D G N+++ Y I        +I  P++G V ++  F   +  +   + +  D +  +L
Sbjct:  383 YVASVAVSDRDSKANGNARC--QVMGNN---FRLEEIYTNMYKILIQNKLDYETDKFHNVTVNCQDQGVPQQQNTTSFFIRVQDVNDNAPEFTKTK-YQVTMQESNDPGAYVKEVIATDKDSGN--NGRVSYSLEPDGQSFFSIDPTMGTISAIVSLDRE--LRPVIRFHVTATDQGDPQLSSSTVVEVILGDINDNTP-----TFTQQKFHFHVLENQDRGPKVGTLTAEDQDAGANSQFSFDFVPP-IPADFRL----------NQDTGVITGYTKLDRELQKMYNFTVMVTDKGTPRRYSTAQVTVEVEDDNDNIPVIVHPNNFNNTVY---LPYTVNAGTLISQVEAYDIDDGDNSRLRYYID-------TIDPPNSGDVFSMGLFSGSLVVARKLQLYDADSYRLVL 758          
BLAST of protocadherin-1 vs. Ensembl Cavefish
Match: pcdh18a (protocadherin 18a [Source:ZFIN;Acc:ZDB-GENE-000607-1])

HSP 1 Score: 221.476 bits (563), Expect = 8.098e-59
Identity = 156/431 (36.19%), Postives = 226/431 (52.44%), Query Frame = 2
Query:  386 SPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKL--FDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDET--LITVLINSNSDPEVKRHFQVSAISG-LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVID--TLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIP-----NPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLS 1642
            S  D D G N    YS+         +L   N     + + L   DREER  YEL   ATD G P +TG   + I + D ND++P F+    YV+ + EDA  G  I D+  TD D+ T   I     ++  P+V   F++    G LTL+ ++D+E +   + I V A D G  ++     +TV V D+NDN P + +   T SD  + F + E  P ++FVA+V V DADS +NG V C L+    + +F L   +       ++NY I+T    DRE  S Y +TV  +D+G P +S+ +  T+ ++DENDN PSF K  ++    EN  PG+ + TL A+DPD+G N ++ Y I E      SI      +PSTG +  L +FDRE  + I F   A D  NP L+S+V V L + DEND  P+ L+
Sbjct:  166 SATDLDTGENGLHSYSLASSKTFGIDVLTRPNGAKYAELVVLAPLDREERSSYELELTATDGGDPPRTGTTMLRITVADSNDNSPTFEK-SSYVVTLAEDAPLGMLIVDLNATDPDEGTNGKIVYSFGAHVSPKVLETFRIDPDDGRLTLLRKVDFEMT-DSYDIDVQAQDMGPNSMPAHCKVTVKVRDVNDNKPDVTVSLMTPSDEDAAF-VSETAPTDTFVALVRVDDADSGLNGEVVCRLL---GQGHFRLQKTH-------EKNYMILTNASLDREKRSEYSLTVIAEDRGTPSMSTVKHFTVQVQDENDNAPSFDKSRYEIFKAENNSPGAYLATLQASDPDLGANGQVSYSILESLVQGSSISTYVTVDPSTGALYALRTFDREELSQIYFLVQAKDSGNPSLSSNVSVILNVLDENDNRPVILA 583          

HSP 2 Score: 139.428 bits (350), Expect = 4.901e-33
Identity = 130/447 (29.08%), Postives = 198/447 (44.30%), Query Frame = 2
Query:  923 VNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIY----QIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSS--------AYHFKIKEGYSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKS-DGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLAN--------NKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPS 2200
            V +LD+ND+ P+     +       ++ E+    + V + + TD D+  NG+   +L   +     ++++R     PN  +   +V L   DRE  S Y + +   D G PP +    + I + D NDN P+F K  +   + E+   G  I  L ATDPD G N KI+Y     +  K      I +P  G +T L   D EM  S      A D     + +  +VT+++ D ND  P    S        A           +V  V   D DS  N +++    G    H  + K+ + N        LDRE +S Y LTV A+D G PS S+     +Q++D NDN+P F +   S Y     E   PG  +  + A+D D   NG+V+Y +          + Y  +D  +G ++  RT DR EL     L+ AKD+G PS
Sbjct:  131 VVLLDVNDHAPRFARPMVP-----VEISESAAVGTRVPLDSATDLDTGENGLHSYSLAS-SKTFGIDVLTR-----PNGAKYAELVVLAPLDREERSSYELELTATDGGDPPRTGTTMLRITVADSNDNSPTFEKSSYVVTLAEDAPLGMLIVDLNATDPDEGTNGKIVYSFGAHVSPKVLETFRI-DPDDGRLTLLRKVDFEMTDSYDIDVQAQDMGPNSMPAHCKVTVKVRDVNDNKPDVTVSLMTPSDEDAAFVSETAPTDTFVALVRVDDADSGLNGEVVCRLLG--QGHFRLQKTHEKNYMILTNASLDREKRSEYSLTVIAEDRGTPSMSTVKHFTVQVQDENDNAPSFDK---SRYEIFKAENNSPGAYLATLQASDPDLGANGQVSYSILESLVQGSSISTYVTVDPSTGALYALRTFDREELSQIYFLVQAKDSGNPS 560          

HSP 3 Score: 131.339 bits (329), Expect = 1.896e-30
Identity = 135/561 (24.06%), Postives = 243/561 (43.32%), Query Frame = 2
Query:  599 YIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDD----------ETLITVLINSNSDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPP--SFSKFFFQDRIKENIMPGSPIFTLIAT----DPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYH-FKIKEGYSG-WVGKVEAYXXXXXXXXXIIFSFTGFL------HNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQP--LDSGYMKKITETLVPGTLITKVMATDDDENENGKVT-YLLANNK--YFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGT 2194
            ++ + D+NDHAP F  P    + + E A  G+++     TD D            +  T  I+  + P   ++ ++  ++ L    R  YE       + + A D G P  T +T + + V D NDN P     T   SS    L E+ P    +  +  TD D   NG +  +           +  +    F     + R+  LR+ D E    Y + VQ +D G   + +   +T+ + D NDN P  + S     D     +   +P  T +A     D D G N +++ ++  +    +   +    ++    S DRE  +  +    A D   P +++    T++++DEND  P F  S Y  FK +    G ++  ++A D D  +N  + +S    L        ++ +  S G +++ +    DRE  S     V+AKD+G PS SS+V V + + D NDN P    P   +      ++     G L++ +  TD D   NG V+ +++  N+  YF +D +S E++ N ++  + +    + ++ +D+G+
Sbjct:  130 HVVLLDVNDHAPRFARPM-VPVEISESAAVGTRVPLDSATDLDTGENGLHSYSLASSKTFGIDVLTRPNGAKYAELVVLAPLDREERSSYE-------LELTATDGGDPPRTGTTMLRITVADSNDNSP-----TFEKSSYVVTLAEDAPLGMLIVDLNATDPDEGTNGKIVYSF-------GAHVSPKVLETFRIDPDDGRLTLLRKVDFEMTDSYDIDVQAQDMGPNSMPAHCKVTVKVRDVNDNKPDVTVSLMTPSDEDAAFVSETAPTDTFVALVRVDDADSGLNGEVVCRLLGQGHFRLQKTHEKNYMILTNASLDREKRSEYSLTVIAEDRGTPSMSTVKHFTVQVQDENDNAPSFDKSRYEIFKAENNSPGAYLATLQASDPDLGANGQVSYSILESLVQGSSISTYVTVDPSTGALYALR--TFDREELSQIYFLVQAKDSGNPSLSSNVSVILNVLDENDNRPVILAPPLWNHSAEVPVSRRAEAGELVSAIRVTDRDTGANGDVSCHVIGGNEAGYFSMDSRSCEIYTNTSMREVPVDRVDMTVLVQDHGS 668          

HSP 4 Score: 107.457 bits (267), Expect = 4.227e-23
Identity = 79/306 (25.82%), Postives = 143/306 (46.73%), Query Frame = 2
Query:  395 DSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKD-------DETLITVLINSNSDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWI 1291
            D+D G+N E++  + G+  G F+L +      +  T    DRE+R  Y L  IA D+G P  +      ++++D ND+AP FD  + Y I   E+   G+ +  ++ +D D         +++  L+  +S   +  +  V   +G     R      + +    V A D+G P+L+++ ++ +NVLD NDN P I+   L + S+   +         V+ + VTD D+  NG V C++I  N    F + SR    + N+       ++RE     +    +TV  +D G  PL ++  + + +
Sbjct:  392 DADSGLNGEVVCRLLGQ--GHFRLQKTHEKNYMILTNASLDREKRSEYSLTVIAEDRGTPSMSTVKHFTVQVQDENDNAPSFDKSR-YEIFKAENNSPGAYLATLQASDPDLGANGQVSYSILESLVQGSS---ISTYVTVDPSTGALYALRTFDREELSQIYFLVQAKDSGNPSLSSNVSVILNVLDENDNRPVILAPPLWNHSAEVPVSRRAEAGELVSAIRVTDRDTGANGDVSCHVIGGNEAGYFSMDSRSCEIYTNT-------SMREV---PVDRVDMTVLVQDHGSEPLGTKALLRLTL 681          

HSP 5 Score: 85.1149 bits (209), Expect = 3.245e-16
Identity = 94/370 (25.41%), Postives = 160/370 (43.24%), Query Frame = 2
Query: 1160 KRNYRIVTLREFDRETI-SHYRVTVQCK---DQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQ---NIISIPNPST-GIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEG--YSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLW----ILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPL------DSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNKYFIID---EKSGEVFINRTLDRLELVPRRLLIMAKDNGTPS 2200
            +R+  I      DRET+ S   +   C    D    P    Q   + + D ND+ P F++      I E+   G+ +    ATD D G+N    Y +        ++++ PN +    +  L   DRE  +S   +  A D  +P    +  + + + D ND  P F  S+Y   + E       +  + A D D  +N  I++SF   +   +     I   DG +   +  ++D E+  +Y + V+A+D G  S  +   V +++ D+NDN P  +  L      D+ +   ++ET    T +  V   D D   NG+V   L    +F +    EK+  +  N +LDR +     L ++A+D GTPS
Sbjct:   86 ERDGEISVRARLDRETLCSGGLMEANCTLEFDVLTLPTEHLQLFHVVLLDVNDHAPRFARPMVPVEISESAAVGTRVPLDSATDLDTGENGLHSYSLASSKTFGIDVLTRPNGAKYAELVVLAPLDREERSSYELELTATDGGDPPRTGTTMLRITVADSNDNSPTFEKSSYVVTLAEDAPLGMLIVDLNATDPDEGTNGKIVYSFGAHVSPKVLETFRIDPDDGRLTLLR--KVDFEMTDSYDIDVQAQDMGPNSMPAHCKVTVKVRDVNDNKPDVTVSLMTPSDEDAAF---VSETAPTDTFVALVRVDDADSGLNGEVVCRLLGQGHFRLQKTHEKNYMILTNASLDREKRSEYSLTVIAEDRGTPS 450          
BLAST of protocadherin-1 vs. Ensembl Cavefish
Match: pcdh18a (protocadherin 18a [Source:ZFIN;Acc:ZDB-GENE-000607-1])

HSP 1 Score: 221.09 bits (562), Expect = 1.052e-58
Identity = 156/431 (36.19%), Postives = 226/431 (52.44%), Query Frame = 2
Query:  386 SPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKL--FDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDET--LITVLINSNSDPEVKRHFQVSAISG-LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVID--TLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIP-----NPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLS 1642
            S  D D G N    YS+         +L   N     + + L   DREER  YEL   ATD G P +TG   + I + D ND++P F+    YV+ + EDA  G  I D+  TD D+ T   I     ++  P+V   F++    G LTL+ ++D+E +   + I V A D G  ++     +TV V D+NDN P + +   T SD  + F + E  P ++FVA+V V DADS +NG V C L+    + +F L   +       ++NY I+T    DRE  S Y +TV  +D+G P +S+ +  T+ ++DENDN PSF K  ++    EN  PG+ + TL A+DPD+G N ++ Y I E      SI      +PSTG +  L +FDRE  + I F   A D  NP L+S+V V L + DEND  P+ L+
Sbjct:  168 SATDLDTGENGLHSYSLASSKTFGIDVLTRPNGAKYAELVVLAPLDREERSSYELELTATDGGDPPRTGTTMLRITVADSNDNSPTFEK-SSYVVTLAEDAPLGMLIVDLNATDPDEGTNGKIVYSFGAHVSPKVLETFRIDPDDGRLTLLRKVDFEMT-DSYDIDVQAQDMGPNSMPAHCKVTVKVRDVNDNKPDVTVSLMTPSDEDAAF-VSETAPTDTFVALVRVDDADSGLNGEVVCRLL---GQGHFRLQKTH-------EKNYMILTNASLDREKRSEYSLTVIAEDRGTPSMSTVKHFTVQVQDENDNAPSFDKSRYEIFKAENNSPGAYLATLQASDPDLGANGQVSYSILESLVQGSSISTYVTVDPSTGALYALRTFDREELSQIYFLVQAKDSGNPSLSSNVSVILNVLDENDNRPVILA 585          

HSP 2 Score: 141.354 bits (355), Expect = 1.561e-33
Identity = 130/449 (28.95%), Postives = 199/449 (44.32%), Query Frame = 2
Query:  917 ITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIY----QIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSS--------AYHFKIKEGYSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKS-DGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLAN--------NKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPS 2200
            + V +LD+ND+ P+     +       ++ E+    + V + + TD D+  NG+   +L   +     ++++R     PN  +   +V L   DRE  S Y + +   D G PP +    + I + D NDN P+F K  +   + E+   G  I  L ATDPD G N KI+Y     +  K      I +P  G +T L   D EM  S      A D     + +  +VT+++ D ND  P    S        A           +V  V   D DS  N +++    G    H  + K+ + N        LDRE +S Y LTV A+D G PS S+     +Q++D NDN+P F +   S Y     E   PG  +  + A+D D   NG+V+Y +          + Y  +D  +G ++  RT DR EL     L+ AKD+G PS
Sbjct:  131 VVVELLDVNDHAPRFARPMVP-----VEISESAAVGTRVPLDSATDLDTGENGLHSYSLAS-SKTFGIDVLTR-----PNGAKYAELVVLAPLDREERSSYELELTATDGGDPPRTGTTMLRITVADSNDNSPTFEKSSYVVTLAEDAPLGMLIVDLNATDPDEGTNGKIVYSFGAHVSPKVLETFRI-DPDDGRLTLLRKVDFEMTDSYDIDVQAQDMGPNSMPAHCKVTVKVRDVNDNKPDVTVSLMTPSDEDAAFVSETAPTDTFVALVRVDDADSGLNGEVVCRLLG--QGHFRLQKTHEKNYMILTNASLDREKRSEYSLTVIAEDRGTPSMSTVKHFTVQVQDENDNAPSFDK---SRYEIFKAENNSPGAYLATLQASDPDLGANGQVSYSILESLVQGSSISTYVTVDPSTGALYALRTFDREELSQIYFLVQAKDSGNPS 562          

HSP 3 Score: 131.339 bits (329), Expect = 1.753e-30
Identity = 135/563 (23.98%), Postives = 244/563 (43.34%), Query Frame = 2
Query:  593 KIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDD----------ETLITVLINSNSDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPP--SFSKFFFQDRIKENIMPGSPIFTLIAT----DPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYH-FKIKEGYSG-WVGKVEAYXXXXXXXXXIIFSFTGFL------HNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQP--LDSGYMKKITETLVPGTLITKVMATDDDENENGKVT-YLLANNK--YFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGT 2194
             + +++ D+NDHAP F  P    + + E A  G+++     TD D            +  T  I+  + P   ++ ++  ++ L    R  YE       + + A D G P  T +T + + V D NDN P     T   SS    L E+ P    +  +  TD D   NG +  +           +  +    F     + R+  LR+ D E    Y + VQ +D G   + +   +T+ + D NDN P  + S     D     +   +P  T +A     D D G N +++ ++  +    +   +    ++    S DRE  +  +    A D   P +++    T++++DEND  P F  S Y  FK +    G ++  ++A D D  +N  + +S    L        ++ +  S G +++ +    DRE  S     V+AKD+G PS SS+V V + + D NDN P    P   +      ++     G L++ +  TD D   NG V+ +++  N+  YF +D +S E++ N ++  + +    + ++ +D+G+
Sbjct:  130 HVVVELLDVNDHAPRFARPM-VPVEISESAAVGTRVPLDSATDLDTGENGLHSYSLASSKTFGIDVLTRPNGAKYAELVVLAPLDREERSSYE-------LELTATDGGDPPRTGTTMLRITVADSNDNSP-----TFEKSSYVVTLAEDAPLGMLIVDLNATDPDEGTNGKIVYSF-------GAHVSPKVLETFRIDPDDGRLTLLRKVDFEMTDSYDIDVQAQDMGPNSMPAHCKVTVKVRDVNDNKPDVTVSLMTPSDEDAAFVSETAPTDTFVALVRVDDADSGLNGEVVCRLLGQGHFRLQKTHEKNYMILTNASLDREKRSEYSLTVIAEDRGTPSMSTVKHFTVQVQDENDNAPSFDKSRYEIFKAENNSPGAYLATLQASDPDLGANGQVSYSILESLVQGSSISTYVTVDPSTGALYALR--TFDREELSQIYFLVQAKDSGNPSLSSNVSVILNVLDENDNRPVILAPPLWNHSAEVPVSRRAEAGELVSAIRVTDRDTGANGDVSCHVIGGNEAGYFSMDSRSCEIYTNTSMREVPVDRVDMTVLVQDHGS 670          

HSP 4 Score: 107.842 bits (268), Expect = 3.422e-23
Identity = 84/333 (25.23%), Postives = 152/333 (45.65%), Query Frame = 2
Query:  395 DSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKD-------DETLITVLINSNSDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGS 1372
            D+D G+N E++  + G+  G F+L +      +  T    DRE+R  Y L  IA D+G P  +      ++++D ND+AP FD  + Y I   E+   G+ +  ++ +D D         +++  L+  +S   +  +  V   +G     R      + +    V A D+G P+L+++ ++ +NVLD NDN P I+   L + S+   +         V+ + VTD D+  NG V C++I  N    F + SR    + N+       ++RE     +    +TV  +D G  PL ++  + + + +  +N          D  + +  PGS
Sbjct:  394 DADSGLNGEVVCRLLGQ--GHFRLQKTHEKNYMILTNASLDREKRSEYSLTVIAEDRGTPSMSTVKHFTVQVQDENDNAPSFDKSR-YEIFKAENNSPGAYLATLQASDPDLGANGQVSYSILESLVQGSS---ISTYVTVDPSTGALYALRTFDREELSQIYFLVQAKDSGNPSLSSNVSVILNVLDENDNRPVILAPPLWNHSAEVPVSRRAEAGELVSAIRVTDRDTGANGDVSCHVIGGNEAGYFSMDSRSCEIYTNT-------SMREV---PVDRVDMTVLVQDHGSEPLGTKALLRLTLYENLEN--------LADHHQTSYQPGS 702          
BLAST of protocadherin-1 vs. Ensembl Cavefish
Match: dchs1b (dachsous cadherin-related 1b [Source:ZFIN;Acc:ZDB-GENE-050208-41])

HSP 1 Score: 222.246 bits (565), Expect = 1.769e-58
Identity = 187/578 (32.35%), Postives = 290/578 (50.17%), Query Frame = 2
Query:  509 LFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKD--DETLITVLINS-NSDPEVKRHFQVSAISGL-TLISRLDYESSMRKF-TIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQI-PEK--YQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGWVG--KVEAYXXXXXXXXXIIFSFTGFLHN----HLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLL---ANNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNG 2191
            + DRE+R  Y L+  A D G PKKTG++ + + ++D+NDHAP F+  +   I + E   +GS I  +  +D D  D  L+   IN   SDP+  R+F +   SG+ TL   LDYE  +RK   + V A DN      T+  +T++V D NDN P + I  LS+  S  ++ E      +VA ++V+D D      V+ +L   + K  F L ++           Y I   +  DRE    Y + V   D G PPL ++ + TI + D NDNPP F +  ++  I E + PGS +  + A D D G N  ++Y I P++  + +  +I +P TGI+T     D E   + + K  A D   P L+S+  V + ++D ND  P+F SS Y+  IKE  +      +V A D D  S   + +S      +       I K  G I +   +  D E   +++ TV A D G    SSS +V++ L+DINDN P F  P++  Y   ++    PGT + +V A D D  ENGKVTY       + +F +++ +G + ++R+L         ++I A+D G
Sbjct:  213 VLDREKRASYSLLLEAFDGGSPKKTGQMTLDVTVQDINDHAPIFNQSRYRAI-ISESLPQGSNILQVFASDADEGDNGLVLYEINRRQSDPD--RYFVIDPRSGIITLNKPLDYE--VRKVHELVVQARDNASHPEITNAFVTIHVRDFNDNQPTMTIIFLSEDGSP-RISEGAQPGQYVARISVSDPDYGEYSNVNVSLEGGDGK--FALTTK-------DSIIYLIYVDQVLDREERDSYELRVMATDSGTPPLRAESSFTIQVTDVNDNPPLFDQQAYKQTIPEVVYPGSFVLQVTARDKDHGPNGDVLYSILPDRGTHSDWFTI-DPVTGIITTATQLDYETYPNPSVKVVATDGGKPPLSSTALVEISLQDINDNEPVFGSSVYNVSIKENTAAGTCFLEVTASDADGGSFGAVAYSLGSGAGSSPPTRFSINKETGQICTSAALDRD-EGADSFEFTVTAADGG--GLSSSAVVKVSLQDINDNRPTF-YPVN--YAVSLSSQSAPGTSVIRVTAHDPDGGENGKVTYRTVPGGGSNFFTLNKDTGVISLSRSLHGKANSVIAMVITAQDGG 768          

HSP 2 Score: 177.178 bits (448), Expect = 2.685e-44
Identity = 174/618 (28.16%), Postives = 286/618 (46.28%), Query Frame = 2
Query:  392 RDSDYGINSEIIYSIE-GKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMEN-KPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLL--NSSVEVTLEIEDENDCIPMFLSSAYHFKIKE---GYSGWVGKVEAYXXXXXXXXXIIFSFT----GFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNKY--FIIDEKSGEVFINRT--LDRLELVPRRLLIMAKDNGTPS 2200
            RD+D G N  + Y I+ G   G F L     +  I K M   DREE+D Y L  IA D G P+ +    + +++ D+ND AP F+   +Y + V+E+   G+ +  +  TD+D  T   V   +  D  V   F ++  +G+  ++++        +T+ V A D G+P      T+ + VLD NDN P  V   L  S    +L EN +P E F+  +  TD DS  +G ++  +   +   +F+L S           +  + T R  DRE    Y + V  +D+G P LSS  T+ I + D NDN P+F+   +   + E+   GS +  + A D D G+N +I+Y +  + +   ++ +P TG +      DRE   S +F+  A+D  +P    N++ +VT+ I D ND  P F+       +       +  V  ++A D D  +N  + + F     GF  N L      G I + +   L    QS   L VEA D G P++SS  +V I +++ +    +FS+         I E    GT + +  A   D    G    + + N+   F I   +GE++++ +  LD  E  PR  L++  +  + S
Sbjct: 1566 RDADQGENGRVSYRIQTGNAGGRFSLNPNTGSLSILKAM---DREEQDSYNLTIIAEDHGTPQHSTTQVLSVQVIDVNDEAPWFE-KSEYEVQVRENQPAGTTVLTVSATDRDQGTNGRV---TYGDVTVD-GFIIAPETGVISLTKVLDREQQDHYTVTVYAKDGGMPPNFAKATVHITVLDENDNAP--VFGRLQYS---LELPENLEPVELFI--IKATDQDSGDSGHLEYRITVGDPDGDFQLDSS----------SGALSTSRPLDRERRDSYSLEVVAQDRGTPSLSSTATVEITVLDVNDNSPTFTSSSYTVDVSEDAAVGSSLLDVTAKDADEGQNGQILYFLSSEARGDFTV-DPDTGRIVTAAPLDREKRASYSFQVCAVD-LSPATPRNTTAQVTVTILDVNDNAPFFIQDPLIINVSSRSVATNHVVATMKAEDKDFGANGSVFYRFAMPVRGFSINSL-----TGEIQTTE--LLSSLTQSQRTLIVEAMDQGSPAQSSLGVVIIYVKEQDYQGIRFSRTTRD---VSIQENAAKGTAVAQAQAQYPDGTRGGIAYSIFSGNRQQSFRISSSTGEIWVHSSTGLD-FEDTPRLRLVVKAETASSS 2145          

HSP 3 Score: 176.022 bits (445), Expect = 5.379e-44
Identity = 174/636 (27.36%), Postives = 288/636 (45.28%), Query Frame = 2
Query:  380 KLSPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDD----ETLITVLINSNSDPEVKRHFQVSAISG-LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDR-ETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQ-IPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGY--SGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTY-LLAN--NKYFIIDEKSGEVFINRTLDRLELVPR-RLLIMAKDNGTPSXXXXXXXXXXXXNEDE 2248
            ++S  D DYG  S +  S+EG D G F L    +   +    ++ DREERD YEL  +ATD G P    E    I++ D+ND+ P FD  + Y   + E    GS +  +   DKD     + L ++L +  +  +    F +  ++G +T  ++LDYE+     ++ V+A D G P L+++  + +++ DINDN P         S  N  + EN    +    VT +DAD    G V  +L            S     F  +K   +I T    DR E    +  TV   D G   LSS   + + ++D NDN P+F    +   +     PG+ +  + A DPD G+N K+ Y+ +P    N  ++ N  TG+++   S   + N+ I     A D        +  V + +   +   P+F  + Y F + E       VG V A      +        +G    +  +    G +     + LD E + + +L V+A  +G P       V I + D+NDN+P F        +  + E    G+++ +V A D D  +NG++++ LLA+   + F ++  SGE+ +  +L   + VPR  L ++A+D G P  + T TL +  Q ED+
Sbjct:  388 RISVSDPDYGEYSNVNVSLEGGD-GKFALTTKDSIIYLIYVDQVLDREERDSYELRVMATDSGTPPLRAESSFTIQVTDVNDNPPLFDQ-QAYKQTIPEVVYPGSFVLQVTARDKDHGPNGDVLYSILPDRGTHSD---WFTIDPVTGIITTATQLDYETYPNP-SVKVVATDGGKPPLSSTALVEISLQDINDNEP-----VFGSSVYNVSIKENTAAGTCFLEVTASDADGGSFGAVAYSLGSGAG-------SSPPTRFSINKETGQICTSAALDRDEGADSFEFTVTAADGG--GLSSSAVVKVSLQDINDNRPTFYPVNYAVSLSSQSAPGTSVIRVTAHDPDGGENGKVTYRTVPGGGSNFFTL-NKDTGVISLSRSLHGKANSVIAMVITAQDGGGLTAPVNARVNISVVAGSVAPPVFEQAQYFFTVSEDVLRGTEVGVVRANSRSLATKDISYTISSGDPDGYFTVDSETGAL--RTSLPLDHEARPSLELEVQAS-SGSPPAFGQTRVTITIGDVNDNTPAFLPSYSESLL--LPEVTKIGSVVYRVQAEDRDSGQNGRISFHLLASGGQRAFSVERGSGEIRLISSLS-YDSVPRYDLQVLARDGGVPQRSATFTLVVHVQAEDD 996          

HSP 4 Score: 166.007 bits (419), Expect = 6.618e-41
Identity = 166/621 (26.73%), Postives = 291/621 (46.86%), Query Frame = 2
Query:  380 KLSPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFD--MP-KDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLIN-SNSDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTD-ADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKD-QGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPD-IGKNAKIIYQIPEKY---QNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALD---EFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGWV-GKVEAYXXXXXXXXXIIFSF-TGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTP 2197
            ++S  D D G+NS + Y +   D+ F    Q+ +      T    DRE +  Y+LV +  D G P ++     +I + D ND+AP F   MP K+ +I V+E    GS +  ++  D D+    T+  + S S  E    F ++  +G    S     +   +++I V A D G P  ++S  + + +L  +   P+   +TLS + ++   +E     S +  V   D  D  ++G V   ++   +K    ++ R   +         +   RE D E  + Y + ++ +D     P +    + I ++D ND+ P F +      + EN+ PGS I+T  A D D  G N+++ Y I  +Y    +++++ +P +G++T   + D E  +S+       D   + N     SV   + + DEND  P+F S      +++   G+V   V A D D   N  + +   TG       +  + G++   K   +DRE Q +Y LT+ A+D+G P  S++ ++ +Q+ D+ND +P F +   S Y  ++ E    GT +  V ATD D+  NG+VTY       FII  ++G + + + LDR +     + + AKD G P
Sbjct: 1133 RVSATDRDAGLNSRLTYRLLHTDRNF----QINSQTGEVSTRAALDREHQSSYQLVVVVQDGGTPPRSATGTAHITVLDENDNAPIFSHMMPGKELLIQVQEGLPAGSLLGTLQAKDPDEGENSTIFYSLSGSRAE---RFSLNPNTGELRSSSPLRRAEKSEYSITVSASDRGAPPQSSSCVLRIQILGSSRAAPKP--NTLSMTLNS---VEGAKPGSVIGSVRSHDHRDVVLDGQVTYLVVGGTDKDGTFMVDRLTGD---------VYLARELDYEKGALYTLNIEVEDFSKAYPSTYMIQLDITVQDSNDHAPEFPEDPVTIVVPENMQPGSSIYTFQAADKDGSGPNSEVRYSIQHRYPDRSDLLTL-DPISGVLTLGQALDHEETSSLFLVVRGTDSAVDPNQRRWGSVTARIFVTDENDNAPIFSSPTAVSVMEDQPVGFVLLYVMARDADQGENGRVSYRIQTGNAGGRFSLNPNTGSLSILKA--MDREEQDSYNLTIIAEDHGTPQHSTTQVLSVQVIDVNDEAPWFEK---SEYEVQVRENQPAGTTVLTVSATDRDQGTNGRVTYGDVTVDGFIIAPETGVISLTKVLDREQQDHYTVTVYAKDGGMP 1726          

HSP 5 Score: 161.77 bits (408), Expect = 1.483e-39
Identity = 172/584 (29.45%), Postives = 251/584 (42.98%), Query Frame = 2
Query:  467 LQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLIT--VLINSNS-----DPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTL-REFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQD----RIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVS--FDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKE-GYSG-WVGKVEAYXXXXXXXXXIIFSFTGFLHNHL-WILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANN------KYFIIDEKSGEVFINRTLDRLE 2149
            L +     I +T +  DREERD Y  + + T  G+      +++ I + D+NDHAP F   K   + + E    G+K      TD D + L T   LI   +       E KR         L +   LD E     +++ + A D G P  T   T+ V V DIND+ P       + S     + E+ P+ S +  V  +DAD   NG+V   L E N +Q+     RYF   P S     I+TL +  D E    + + VQ +D    P  +   +TI + D NDN P+ +  F  +    RI E   PG  +  +  +DPD G+ + +   + E      ++    + I    V    DRE   S   +  A D   P L +    T+++ D ND  P+F   AY   I E  Y G +V +V A D D   N D+++S       H  W              QLD E      + V A D G P  SS+ +V+I L+DINDN P F     S Y   I E    GT   +V A+D D    G V Y L +         F I++++G++  +  LDR E
Sbjct:   93 LNIDETTGIIETARRLDREERDHYSFIAV-TMTGL-----TVEVSITVNDINDHAPVFP-KKKASLKIPEQTAVGTKFSLEPATDADKDQLTTQGYLIKEGNVGQVFRLETKRATNKVLYLDLVVNGVLDREKRA-SYSLLLEAFDGGSPKKTGQMTLDVTVQDINDHAP-----IFNQSRYRAIISESLPQGSNILQVFASDADEGDNGLV---LYEINRRQSDP--DRYFVIDPRSG----IITLNKPLDYEVRKVHELVVQARDNASHPEITNAFVTIHVRDFNDNQPTMTIIFLSEDGSPRISEGAQPGQYVARISVSDPDYGEYSNVNVSL-EGGDGKFALTTKDSIIYLIYVDQVLDREERDSYELRVMATDSGTPPLRAESSFTIQVTDVNDNPPLFDQQAYKQTIPEVVYPGSFVLQVTARDKDHGPNGDVLYSILPDRGTHSDWFTIDPVTGIITTATQLDYETYPNPSVKVVATDGGKPPLSSTALVEISLQDINDNEPVFGS---SVYNVSIKENTAAGTCFLEVTASDADGGSFGAVAYSLGSGAGSSPPTRFSINKETGQICTSAALDRDE 650          

HSP 6 Score: 159.458 bits (402), Expect = 6.834e-39
Identity = 168/630 (26.67%), Postives = 292/630 (46.35%), Query Frame = 2
Query:  377 IKLSPRDSDYGINSEIIYSIEGKDK-GFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISG-LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGK------------NAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGW--VGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKS-DGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLAN-----NKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPS 2200
            I++   D D G N ++ YSI+   + G FK+  +  +     T  + DRE   + +LV  ATD+G PK  G   + + I DLND++P   +P++  + V E+++ G++I  +   D D   +++  +  ++  + K  F +   SG + L + LD+E     +T+ V A D+      +   +TV V D+NDN P     T +       L E+ P  S V  VT TD DS  NG V   ++  ++++ F     Y +  PN+   + I    EFD E  S   V ++  D+G PPLSS  T+ I + D NDN P F +  ++  + E+ +PG+ I TL A D D+ +            N    +QI    + I      + G +      D E+ +         D   P  +SSV   + + D ND  P+F  + Y   + EG +    + ++ A D DS  +++I +S +      L+ +    G +  ++   LDRE Q ++ + ++A D       +   + ++++DINDN P F  P+ +     I E     + +T + A D D    G + Y + +      ++F +D+ +GEV   +  D  ++     + +A D G  S
Sbjct: 2184 IQVVAEDVDQGPNGQVTYSIQSSGRSGLFKIDPLSGS---ITTAAIMDREIWMQTKLVITATDRGSPKLAGSATLTVIIVDLNDNSPTIPLPRE--VRVPENSLIGTEITMVTGNDVDSGPVLSYSLRLDTPSQGK--FGIHRYSGRVFLTAPLDFEER-SWYTLTVQASDS---KHQSEANVTVLVGDMNDNVP-----TFTQDLYQVTLPEHSPPGSAVVTVTATDRDSGENGRVTYRVLS-SSREGF-----YID--PNNGTLF-IGQKVEFDPERPS-VSVVIEASDRGKPPLSSIATVQIQLTDVNDNAPMFHQSEYRATVSEDQLPGATILTLEAVDVDLSQENSGFDFAIASGNVGNAFQIESSVRFIEGHGFQTVGTLILAEQLDFELMSRYNLTIVVSDRGVPQRSSSVPAVITVIDVNDNPPVFSHAEYVVALSEGAAAGTEILRLSATDQDSAPHAEIQYSISSGDEMELFSVDQWTGALRLQR--PLDRETQPSHVVIIQASDGH--GHFALAPINVEVKDINDNRPYF--PIQT-MTASIRENQPANSAVTVLHAIDQDTGMYGILKYFMVDRSSQGKEFFAVDQNTGEVRSRQAFDFEKVNSFHFMALAVDAGNNS 2780          

HSP 7 Score: 136.346 bits (342), Expect = 9.136e-32
Identity = 164/608 (26.97%), Postives = 267/608 (43.91%), Query Frame = 2
Query:  374 SIKLSPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKD---DETLITVLINSNSDPEVKRHFQVSAISG-LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTV-QCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFL----SSAYHFKIKEGY--SGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPK---FSQPLDSGYMKKITETLVPGTLITKVMATDD-DENENGKVTYLLA----NNKYFIIDEKSGEVFINRTLD 2140
            S  L+ +D  Y I+S       G   G+F +    +     +T    D E R   EL   A+  G P   G+ ++ I I D+ND+ P F       + + E    GS +  ++  D+D   +  +   L+ S      +R F V   SG + LIS L Y+S  R + + V+A D G+P  + + T+ V+V   +D  P    DTL+      +L EN P  +    V     D   NG     L+    + + +     F   P+S     +      DRE    Y +TV      G    +   T+ + + DENDN P  S+      ++EN+  G+    + ATD D G N+++ Y++    +N     N  TG V+   + DRE  +S        D   P  +++    + + DEND  P+F           +++EG      +G ++A D D   NS I +S +G       +  + G + S     L R  +S Y +TV A D G P +SSS +++IQ+   +  +PK    S  L+S       E   PG++I  V + D  D   +G+VTYL+      +  F++D  +G+V++ R LD
Sbjct:  818 SRSLATKDISYTISS-------GDPDGYFTV---DSETGALRTSLPLDHEARPSLELEVQAS-SGSPPAFGQTRVTITIGDVNDNTPAFLPSYSESLLLPEVTKIGSVVYRVQAEDRDSGQNGRISFHLLASGG----QRAFSVERGSGEIRLISSLSYDSVPR-YDLQVLARDGGVPQRSATFTLVVHVQAEDDQGP--AFDTLT---YRVELKENTPLNTRFLQVRALSRDQLKNGSSPAALLSYRLRPDGDAAG--FGIVPDSGW---LFVKSALDREAKDIYLLTVLATSGSGRMKKTGSATVRVSVTDENDNSPRLSQERVFLAVRENLPTGTGFGRVSATDRDAGLNSRLTYRLLHTDRNFQI--NSQTGEVSTRAALDREHQSSYQLVVVVQDGGTPPRSATGTAHITVLDENDNAPIFSHMMPGKELLIQVQEGLPAGSLLGTLQAKDPDEGENSTIFYSLSGSRAERFSLNPNTGELRSSS--PLRRAEKSEYSITVSASDRGAPPQSSSCVLRIQILGSSRAAPKPNTLSMTLNS------VEGAKPGSVIGSVRSHDHRDVVLDGQVTYLVVGGTDKDGTFMVDRLTGDVYLARELD 1389          

HSP 8 Score: 132.109 bits (331), Expect = 1.738e-30
Identity = 156/620 (25.16%), Postives = 271/620 (43.71%), Query Frame = 2
Query:  377 IKLSPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATD--KGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKI-CDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGWVGKVEAYXXXXXXXXXIIFSFTGFL----HNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTY--LLANNKYFIIDEKSGEVFINRTLDRLELVPRR----LLIMAKDNGTP 2197
            + ++ +D+D G N +I+Y +  + +G F +     +     T    DRE+R  Y     A D     P+ T   ++ + I D+ND+AP F +    +I V   ++  + +   +K  DKD     +V           R F +++++G    + L    +  + T+ V A+D G P     +++ V ++ + +   Q +    S ++ +  + EN  K + VA       D    GI   ++   N +Q+F + S     + +S            D E     R+ V+ +       SS   + + ++D NDN P F    +   ++E     SPI  ++A D D G N ++ Y I    ++ +   +P +G +T     DRE+         A D  +P L  S  +T+ I D ND  P  +      ++ E  +  +G        ++ +S  + S++  L         I +  G +F      LD E +S Y LTV+A D+      S   V + + D+NDN P F+Q L   Y   + E   PG+ +  V ATD D  ENG+VTY  L ++ + F ID  +G +FI +   ++E  P R    ++I A D G P
Sbjct: 1872 LDVTAKDADEGQNGQILYFLSSEARGDFTV---DPDTGRIVTAAPLDREKRASYSFQVCAVDLSPATPRNT-TAQVTVTILDVNDNAPFF-IQDPLIINVSSRSVATNHVVATMKAEDKDFGANGSVFYRFAMP---VRGFSINSLTGEIQTTELLSSLTQSQRTLIVEAMDQGSP---AQSSLGVVIIYVKEQDYQGI--RFSRTTRDVSIQENAAKGTAVAQAQAQYPDGTRGGIA-YSIFSGNRQQSFRISSSTGEIWVHSSTG--------LDFEDTPRLRLVVKAETASS---SSFMAVNLILQDVNDNLPRFQLQNYVAYMREARGYDSPIIQVVAEDVDQGPNGQVTYSIQSSGRSGLFKIDPLSGSITTAAIMDREIWMQTKLVITATDRGSPKLAGSATLTVIIVDLNDNSPT-IPLPREVRVPE--NSLIGTEITMVTGNDVDSGPVLSYSLRLDTPSQGKFGIHRYSGRVFLTA--PLDFEERSWYTLTVQASDS---KHQSEANVTVLVGDMNDNVPTFTQDL---YQVTLPEHSPPGSAVVTVTATDRDSGENGRVTYRVLSSSREGFYIDPNNGTLFIGQ---KVEFDPERPSVSVVIEASDRGKP 2452          

HSP 9 Score: 125.946 bits (315), Expect = 1.384e-28
Identity = 150/623 (24.08%), Postives = 262/623 (42.05%), Query Frame = 2
Query:  377 IKLSPRDSDYGINSEIIY-SIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKN-----AKIIYQI-PEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNS-SVEVTLEIEDENDCIPMFLSSAYHFKIKEGY---SGWVGKVEAYXXXXXXXXXIIFSFTGFLHN--HLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSG-YMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNK--YFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTP 2197
            I+++  D D G N ++ Y ++ G    FF L     +  +    +    +      +V  A D G        ++ I +   +   P F+  + Y   V ED + G+++  ++   +   T       S+ DP+   +F V + +G  L + L  +   R      +   +G P     T +T+ + D+NDN P      L   S +  L E     S V  V   D DS  NG +  +L+    ++ F +               R+++   +D  ++  Y + V  +D G+P  S+  T+ + ++ E+D  P+F    ++  +KEN    +    + A   D  KN     A + Y++ P+       I  P +G +    + DRE          A      +  + S  V + + DEND  P          ++E     +G+ G+V A D D+  NS + +     LH   +  I    G + +     LDRE QS+YQL V  +D G P RS++    I + D NDN+P FS  +     + ++ E L  G+L+  + A D DE EN  + Y L+ ++   F ++  +GE+  +  L R E     + + A D G P
Sbjct:  707 IRVTAHDPDGGENGKVTYRTVPGGGSNFFTL---NKDTGVISLSRSLHGKANSVIAMVITAQDGGGLTAPVNARVNISVVAGSVAPPVFEQAQ-YFFTVSEDVLRGTEVGVVRANSRSLATKDISYTISSGDPD--GYFTVDSETG-ALRTSLPLDHEARPSLELEVQASSGSPPAFGQTRVTITIGDVNDNTPAF----LPSYSESLLLPEVTKIGSVVYRVQAEDRDSGQNGRISFHLLASGGQRAFSV--------ERGSGEIRLISSLSYD--SVPRYDLQVLARDGGVPQRSATFTLVVHVQAEDDQGPAFDTLTYRVELKENTPLNTRFLQVRALSRDQLKNGSSPAALLSYRLRPDGDAAGFGIV-PDSGWLFVKSALDREAKDIYLLTVLATSGSGRMKKTGSATVRVSVTDENDNSPRLSQERVFLAVRENLPTGTGF-GRVSATDRDAGLNSRLTYRL---LHTDRNFQINSQTGEVSTRAA--LDREHQSSYQLVVVVQDGGTPPRSATGTAHITVLDENDNAPIFSHMMPGKELLIQVQEGLPAGSLLGTLQAKDPDEGENSTIFYSLSGSRAERFSLNPNTGELRSSSPLRRAEKSEYSITVSASDRGAP 1301          

HSP 10 Score: 115.161 bits (287), Expect = 2.458e-25
Identity = 122/478 (25.52%), Postives = 210/478 (43.93%), Query Frame = 2
Query:  377 IKLSPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSA------------ISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQ----GLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKY---QNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGW--VGKVEAYXXXXXXXXXIIFSF 1747
            + ++  D D G N  + Y +    +  F +    NN  +F   K+    ER    +V  A+D+G P  +    + I++ D+ND+AP F    +Y   V ED + G+ I  ++  D D     +    + +   V   FQ+ +            +  L L  +LD+E  M ++ + ++  D G+P  ++S    + V+D+NDN P       S +     L E     + +  ++ TD DS  +  +  ++   ++    EL S   + +  + R       R  DRET   + V +Q  D      L P      I + ++D NDN P F        I+EN    S +  L A D D G    + Y + ++    +   ++ + +TG V +  +FD E   S  F A A+D  N     +V+V +  EDE D  P F SSA+ F++ EG      +G+V+A D D   +  +++SF
Sbjct: 2389 VTVTATDRDSGENGRVTYRVLSSSREGFYI--DPNNGTLFIGQKVEFDPERPSVSVVIEASDRGKPPLSSIATVQIQLTDVNDNAPMFHQ-SEYRATVSEDQLPGATILTLEAVDVDLSQENSGFDFAIASGNVGNAFQIESSVRFIEGHGFQTVGTLILAEQLDFEL-MSRYNLTIVVSDRGVPQRSSSVPAVITVIDVNDNPP-----VFSHAEYVVALSEGAAAGTEILRLSATDQDSAPHAEIQYSI---SSGDEMELFS--VDQWTGALR-----LQRPLDRETQPSHVVIIQASDGHGHFALAP------INVEVKDINDNRPYFPIQTMTASIRENQPANSAVTVLHAIDQDTGMYGILKYFMVDRSSQGKEFFAV-DQNTGEVRSRQAFDFEKVNSFHFMALAVDAGNNSATVTVQVYITGEDEYD--PAFTSSAFSFEVPEGAKKGQSIGQVQAVDEDGGVDGIVLYSF 2838          

HSP 11 Score: 113.235 bits (282), Expect = 1.028e-24
Identity = 156/625 (24.96%), Postives = 253/625 (40.48%), Query Frame = 2
Query:  395 DSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFD---MPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLIN-SNSDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQI--------PEKYQNIISIPNPSTGIVTNLVSFDR-EMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKI--KEGYSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLI------TKVMATDDDENENGKVTYLLAN---NKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTP 2197
            D+D G N  ++Y I  +     +   +     I    K  D E R  +ELV  A D     +     + I +RD ND+ P      + +D    + E A  G  +  I V+D D      V ++    D +     + S I  + +   LD E     + + V+A D+G P L   ++ T+ V D+NDN P          +    + E     SFV  VT  D D   NG V  +++           S +F   P +     I T  + D ET  +  V V   D G PPLSS   + I ++D NDN P F    +   IKEN   G+    + A+D D G    + Y +        P ++    SI N  TG +    + DR E   S  F   A D     L+SS  V + ++D ND  P F    Y   +  +      V +V A+D D   N  + +       ++ + L  D  + S     L  +  S   + + A+D G  +   +  V I +   +   P F Q   + Y   ++E ++ GT +      ++ +AT D       ++Y +++   + YF +D ++G +  +  LD  E  P   L +   +G+P
Sbjct:  282 DADEGDNGLVLYEINRRQSDPDRYFVIDPRSGIITLNKPLDYEVRKVHELVVQARDNASHPEITNAFVTIHVRDFNDNQPTMTIIFLSEDGSPRISEGAQPGQYVARISVSDPDYGEYSNVNVSLEGGDGKFALTTKDSIIYLIYVDQVLDREER-DSYELRVMATDSGTPPLRAESSFTIQVTDVNDNPP-----LFDQQAYKQTIPEVVYPGSFVLQVTARDKDHGPNGDVLYSILPDRGTH-----SDWFTIDPVTG---IITTATQLDYETYPNPSVKVVATDGGKPPLSSTALVEISLQDINDNEPVFGSSVYNVSIKENTAAGTCFLEVTASDADGGSFGAVAYSLGSGAGSSPPTRF----SI-NKETGQICTSAALDRDEGADSFEFTVTAADGGG--LSSSAVVKVSLQDINDNRPTFYPVNYAVSLSSQSAPGTSVIRVTAHDPDGGENGKVTYRTVPGGGSNFFTLNKDTGVISLSR-SLHGKANSVIAMVITAQDGGGLTAPVNARVNISVVAGSVAPPVFEQ---AQYFFTVSEDVLRGTEVGVVRANSRSLATKD-------ISYTISSGDPDGYFTVDSETGALRTSLPLDH-EARPSLELEVQASSGSP 873          

HSP 12 Score: 109.383 bits (272), Expect = 1.665e-23
Identity = 151/633 (23.85%), Postives = 259/633 (40.92%), Query Frame = 2
Query:  383 LSPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKT--GEIKIYIKIRDLNDHAPEFD-MPKDYVIGVKEDAIEGSKICDIKVTDKDDET--LITVLINSNSDPEVKRHFQVSAISGLTLI---SRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVL--DINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGY--SGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDD-ENENGKVTYLLANNKY---FIID-----------EKSGEVFINRTLDRLELVPR-RLLIMAKDNGTP 2197
            +   D D+G N  + Y      +GF     + +     +T +L     + +  L+  A D+G P ++  G + IY+K +D       F    +D  + ++E+A +G+ +   +    D     +   + + N     ++ F++S+ +G   +   + LD+E +      P + +       ++S+ + VN++  D+NDN P+  +           + E +  +S +  V   D D   NG V  ++        F++             +  I T    DRE     ++ +   D+G P L+   T+T+ I D NDN P+      + R+ EN + G+ I  +   D D G       ++    Q    I   S G V      D E  +  T    A D  +    S   VT+ + D ND +P F    Y   + E       V  V A D DS  N  + +          +I  ++G +F  + ++ D E + +  + +EA D G P  SS   VQIQL D+NDN+P F Q   S Y   ++E  +PG  I  + A D D   EN    + +A+      F I+           +  G + +   LD  EL+ R  L I+  D G P
Sbjct: 1980 MKAEDKDFGANGSVFYRFAMPVRGF----SINSLTGEIQTTELLSSLTQSQRTLIVEAMDQGSPAQSSLGVVIIYVKEQDY--QGIRFSRTTRD--VSIQENAAKGTAVAQAQAQYPDGTRGGIAYSIFSGNR----QQSFRISSSTGEIWVHSSTGLDFEDT------PRLRLVVKAETASSSSFMAVNLILQDVNDNLPRFQLQNYVAY-----MREARGYDSPIIQVVAEDVDQGPNGQVTYSIQSSGRSGLFKI----------DPLSGSITTAAIMDREIWMQTKLVITATDRGSPKLAGSATLTVIIVDLNDNSPTIP-LPREVRVPENSLIGTEITMVTGNDVDSGPVLSYSLRLDTPSQGKFGIHRYS-GRVFLTAPLDFEERSWYTLTVQASDSKH---QSEANVTVLVGDMNDNVPTFTQDLYQVTLPEHSPPGSAVVTVTATDRDSGENGRVTYRVLSSSREGFYIDPNNGTLFIGQKVEFDPE-RPSVSVVIEASDRGKPPLSSIATVQIQLTDVNDNAPMFHQ---SEYRATVSEDQLPGATILTLEAVDVDLSQENSGFDFAIASGNVGNAFQIESSVRFIEGHGFQTVGTLILAEQLD-FELMSRYNLTIVVSDRGVP 2569          

HSP 13 Score: 96.2857 bits (238), Expect = 1.480e-19
Identity = 85/330 (25.76%), Postives = 151/330 (45.76%), Query Frame = 2
Query:  512 FDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISGLTLISR-LDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEK--YQNIISIPNPSTGIV 1492
             D E   RY L  + +D+G+P+++  +   I + D+ND+ P F    +YV+ + E A  G++I  +  TD+D      +  + +S  E++  F V   +G   + R LD E+      I  I   +G  +   +  I V V DINDN P   I T++ S     + EN+P  S V ++   D D+ M GI+   +++  + Q  E        F   +    + + + FD E ++ +       D G    S+  T+ ++I  E++  P+F+   F   + E    G  I  + A D D G +  ++Y  P    Y ++    N +TG++
Sbjct: 2549 LDFELMSRYNLTIVVSDRGVPQRSSSVPAVITVIDVNDNPPVFSH-AEYVVALSEGAAAGTEILRLSATDQDSAPHAEIQYSISSGDEMEL-FSVDQWTGALRLQRPLDRETQPSHVVI--IQASDGHGHFALAP-INVEVKDINDNRPYFPIQTMTAS-----IRENQPANSAVTVLHAIDQDTGMYGILKYFMVD-RSSQGKEF-------FAVDQNTGEVRSRQAFDFEKVNSFHFMALAVDAGNN--SATVTVQVYITGEDEYDPAFTSSAFSFEVPEGAKKGQSIGQVQAVDEDGGVDGIVLYSFPNTSPYFDV----NKTTGVI 2854          

HSP 14 Score: 94.3597 bits (233), Expect = 5.724e-19
Identity = 156/621 (25.12%), Postives = 249/621 (40.10%), Query Frame = 2
Query:  377 IKLSPRDSDYGINSEIIYSI---EGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETL--ITVLINSNSDPEVKRHFQVSAISGLTLIS-RLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSF--SKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQI----PEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSS-AYHFKIKE--GYSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQS-------TYQLTVEAKDNGVPSRSS--SVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGK-----VTYLL---ANNKYFIIDEKSGEVFINRTLDR 2143
            ++++ RD D+G N +++YSI    G    +F +  +     I  T    D E      +  +ATD G P  +    + I ++D+ND+ P F     Y + +KE+   G+   ++  +D D  +   +   + S +       F ++  +G    S  LD +     F   V A D G   L++S  + V++ DINDN P       + S S+    ++ P  S V  VT  D D   NG V    + P    NF         F  +K    I   R    +  S   + +  +D G         + I +   +  PP F  +++FF   + E+++ G+ +  + A    +     I Y I    P+ Y  + S     TG +   +  D E   S+  +  A     P    +  VT+ I D ND  P FL S +    + E       V +V+A D DS  N  I F        HL           E+G    R + S        Y L V A+D GVP RS+  +++V +Q ED  D  P F       Y  ++ E     T   +V A   D+ +NG      ++Y L    +   F I   SG +F+   LDR
Sbjct:  493 LQVTARDKDHGPNGDVLYSILPDRGTHSDWFTIDPVTG---IITTATQLDYETYPNPSVKVVATDGGKPPLSSTALVEISLQDINDNEPVFG-SSVYNVSIKENTAAGTCFLEVTASDADGGSFGAVAYSLGSGAGSSPPTRFSINKETGQICTSAALDRDEGADSFEFTVTAADGG--GLSSSAVVKVSLQDINDNRPTFYPVNYAVSLSS----QSAPGTS-VIRVTAHDPDGGENGKVTYRTV-PGGGSNF---------FTLNKDTGVISLSRSLHGKANSVIAMVITAQDGGGLTAPVNARVNISVVAGSVAPPVFEQAQYFFT--VSEDVLRGTEVGVVRANSRSLA-TKDISYTISSGDPDGYFTVDS----ETGALRTSLPLDHEARPSLELEVQASSGSPPAFGQT-RVTITIGDVNDNTPAFLPSYSESLLLPEVTKIGSVVYRVQAEDRDSGQNGRISF--------HLLASGGQRAFSVERGSGEIRLISSLSYDSVPRYDLQVLARDGGVPQRSATFTLVVHVQAED--DQGPAFDT---LTYRVELKENTPLNTRFLQVRALSRDQLKNGSSPAALLSYRLRPDGDAAGFGIVPDSGWLFVKSALDR 1071          
BLAST of protocadherin-1 vs. Ensembl Cavefish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 219.55 bits (558), Expect = 1.941e-58
Identity = 183/597 (30.65%), Postives = 282/597 (47.24%), Query Frame = 2
Query:  467 LQMKNNK----PIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKD--DETLITVLINSNSDPEVKRHFQVSAISGL-TLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVID-----TLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQI--PEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGW--VGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLAN---NKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPS 2200
            LQM N++    P    +   DRE +D Y+L   A D G P +     + + I D ND+AP+F+    Y   V E++  G  +  +K  D D      I   I+  SDP V +  Q+   +G+ ++   LD E  +  F   VIA D G    +++T +++ V D NDN P + I      T SD  +N  + E+ P  + VA+V V+D D   N +V C +        F+L     ++  N K+ Y + T    D E I  YRV +   D G P LSS  ++ + + D NDN P FS   F+    E   PG  +  +IA D D G NA+++Y I      + +  I +PS+G V      DRE      F+  A D+  P    +  V +++ D ND  P F+ S+Y F + E       VG V   D D   N+ +  S    + N + +    G I S   I  DRE +S+Y   ++A D G P RSS V V I + D NDN+P  ++P +S + ++++    P +++  V A D D   N ++ Y +A    ++ F I    GE+ + + L R      RL++   D G PS
Sbjct:  182 LQMANDRGEKLPQLIVLGNLDRELKDSYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQFEK-SSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQASDP-VPKMLQIERSTGIISVKGPLDREE-ISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVAN--ISEDMPVGTAVALVQVSDKDEGENAVVTCVVA---GDVPFQLRPAGDSSVDN-KKKYFLQTTTPLDYERIRDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSPIFSPPLFEVEFAEENQPGEKVLDVIALDADSGTNAELVYSIIADSSTRGLFEI-DPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSSYSFSVLENMPPLSPVGMVTVLDMDKGENAQVQLSVEPDVGNFV-VQNGTGTILSS--ISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNAPVVTKPSNSSF-RRLSPLAAPDSVVEVVEAEDIDYGSNAELVYSIAGGNPHELFYISPSDGEIKLTKELTRKHGGLHRLVVKVSDRGKPS 764          

HSP 2 Score: 174.866 bits (442), Expect = 4.109e-44
Identity = 156/533 (29.27%), Postives = 250/533 (46.90%), Query Frame = 2
Query:  377 IKLSPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDM-------PKDYVIGVKEDAIEGSKICDIKVTDKDD-ETLITVLINSNSDPEVKRHFQVSAISG-----LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKL---MENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFL----SSAYHFKIKEGYSGWVGKVEAYXXXXXXXXXIIFSFTGF-LHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQI 1912
            +++   DSD G N EI Y+I        K+LQ++ +  I       DREE   ++   IA DKG   K+    + I++ D ND+AP  ++         D V  + ED   G+ +  ++V+DKD+ E  +   + +   P   R    S++       L   + LDYE  +R + + ++AVD+G P L+++ ++ V V D NDN P         S   F++    EN+P E  + ++ + DADS  N  +  ++I  ++ +        F   P+S     +      DRE    Y   V   D+G+P      T+ I + D NDN P F    +   + EN+ P SP+  +   D D G+NA++   +     N + + N  TG + + +SFDRE  +S TF+  A+D   P  +S V VT+ + DEND  P+      SS             V  VEA D D  SN+++++S  G   H   +I  SDG I   K  +L R+    ++L V+  D G PSR +  +V I
Sbjct:  263 LQVKANDSDLGPNGEIEYTIHQASDPVPKMLQIERSTGIISVKGPLDREEISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPAGDSSVDNKKKYFLQTTTPLDYE-RIRDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSPIF-------SPPLFEVEFAEENQPGEKVLDVIAL-DADSGTNAELVYSIIADSSTRGL------FEIDPSSG---EVRARSPLDREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSSYSFSVLENMPPLSPVGMVTVLDMDKGENAQVQLSVEPDVGNFV-VQN-GTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNAPVVTKPSNSSFRRLSPLAAPDSVVEVVEAEDIDYGSNAELVYSIAGGNPHELFYISPSDGEIKLTK--ELTRKHGGLHRLVVKVSDRGKPSRHAIALVHI 773          

HSP 3 Score: 130.183 bits (326), Expect = 3.222e-30
Identity = 143/565 (25.31%), Postives = 249/565 (44.07%), Query Frame = 2
Query:  590 IKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVS-------AISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLR-EFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDR--------IKENIMPGSPIFTLIATDPDIGKNAKII--------YQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGW--VGKVEAYXXXXXXXXXIIFSFTG--FLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANN-KYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTP 2197
            I+  I+++D+ND+ P+F  P    + V+E+A  G+     + TD+D E    +  + ++ PE    F +         +  L ++  LD E     + + + AVD G P+  +S  + V + D NDN PQ        SS   ++ EN P    V  V   D+D   NG ++  +      Q  + + +        +R+  I++++   DRE IS ++  V  +D+G  P SS   ++I + D+NDN P+        R        I E++  G+ +  +  +D D G+NA +         +Q+  +     S+ N     +      D E       +  A+D  NP L+S+  + +++ D ND  P+F    +  +  E       V  V A D DS +N+++++S            I  S G + +     LDRE +  Y+  V A D GVPS   +  V I++ D NDN PKF   + S Y   + E + P + +  V   D D+ EN +V   +  +   F++   +G +  + + DR +       + A D G P
Sbjct:  115 IEGRIEVQDINDNTPQFPSPV-LTLSVQENAHMGATFAIPQATDRDTERNGVLKYDLSAGPEASALFSLQMANDRGEKLPQLIVLGNLDRELK-DSYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQ-----FEKSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTI-----HQASDPVPKML----QIERSTGIISVKGPLDREEISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQL--RPAGDSSVDNKKKYFLQTTTPLDYERIRDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSPIFSPPLFEVEFAEENQPGEKVLDVIALDADSGTNAELVYSIIADSSTRGLFEIDPSSGEVRARS--PLDREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKF---MLSSYSFSVLENMPPLSPVGMVTVLDMDKGENAQVQLSVEPDVGNFVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEP 656          

HSP 4 Score: 84.7297 bits (208), Expect = 3.662e-16
Identity = 104/338 (30.77%), Postives = 154/338 (45.56%), Query Frame = 2
Query: 1283 IWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQI---PE-------KYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKE----GYSGWVGKVEAYXXXXXXXXXI---IFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPK-----FSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNKYF--------IIDEKSGEVFINRT--LDRLELVPRRLLIMAKDNGTPS 2200
            I ++D NDN P F        ++EN   G+      ATD D  +N  + Y +   PE       +  N      P   ++ NL   DRE+  S      A+D   P   SS  + + I D ND  P F  S+Y  ++ E    GYS  V +V+A D+D   N +I   I   +  +   L I +S G I S KG  LDRE  S+++  V A+D G   +SS+  V I++ D NDN+P            S  +  I+E +  GT +  V  +D DE EN  VT ++A +  F         +D K  + F+  T  LD   +   R+ I+A D+G P+
Sbjct:  119 IEVQDINDNTPQFPSPVLTLSVQENAHMGATFAIPQATDRDTERNGVLKYDLSAGPEASALFSLQMANDRGEKLPQLIVLGNL---DRELKDSYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQFEKSSYEAEVSENSPVGYS--VLQVKANDSDLGPNGEIEYTIHQASDPVPKMLQIERSTG-IISVKG-PLDREEISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPAGDSSVDNKK-KYFLQTTTPLDYERIRDYRVEIVAVDSGNPA 448          
BLAST of protocadherin-1 vs. Ensembl Cavefish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 219.55 bits (558), Expect = 4.793e-58
Identity = 183/597 (30.65%), Postives = 282/597 (47.24%), Query Frame = 2
Query:  467 LQMKNNK----PIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKD--DETLITVLINSNSDPEVKRHFQVSAISGL-TLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVID-----TLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQI--PEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGW--VGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLAN---NKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPS 2200
            LQM N++    P    +   DRE +D Y+L   A D G P +     + + I D ND+AP+F+    Y   V E++  G  +  +K  D D      I   I+  SDP V +  Q+   +G+ ++   LD E  +  F   VIA D G    +++T +++ V D NDN P + I      T SD  +N  + E+ P  + VA+V V+D D   N +V C +        F+L     ++  N K+ Y + T    D E I  YRV +   D G P LSS  ++ + + D NDN P FS   F+    E   PG  +  +IA D D G NA+++Y I      + +  I +PS+G V      DRE      F+  A D+  P    +  V +++ D ND  P F+ S+Y F + E       VG V   D D   N+ +  S    + N + +    G I S   I  DRE +S+Y   ++A D G P RSS V V I + D NDN+P  ++P +S + ++++    P +++  V A D D   N ++ Y +A    ++ F I    GE+ + + L R      RL++   D G PS
Sbjct:  218 LQMANDRGEKLPQLIVLGNLDRELKDSYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQFEK-SSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQASDP-VPKMLQIERSTGIISVKGPLDREE-ISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVAN--ISEDMPVGTAVALVQVSDKDEGENAVVTCVVA---GDVPFQLRPAGDSSVDN-KKKYFLQTTTPLDYERIRDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSPIFSPPLFEVEFAEENQPGEKVLDVIALDADSGTNAELVYSIIADSSTRGLFEI-DPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSSYSFSVLENMPPLSPVGMVTVLDMDKGENAQVQLSVEPDVGNFV-VQNGTGTILSS--ISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNAPVVTKPSNSSF-RRLSPLAAPDSVVEVVEAEDIDYGSNAELVYSIAGGNPHELFYISPSDGEIKLTKELTRKHGGLHRLVVKVSDRGKPS 800          

HSP 2 Score: 174.481 bits (441), Expect = 8.838e-44
Identity = 156/533 (29.27%), Postives = 250/533 (46.90%), Query Frame = 2
Query:  377 IKLSPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDM-------PKDYVIGVKEDAIEGSKICDIKVTDKDD-ETLITVLINSNSDPEVKRHFQVSAISG-----LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKL---MENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFL----SSAYHFKIKEGYSGWVGKVEAYXXXXXXXXXIIFSFTGF-LHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQI 1912
            +++   DSD G N EI Y+I        K+LQ++ +  I       DREE   ++   IA DKG   K+    + I++ D ND+AP  ++         D V  + ED   G+ +  ++V+DKD+ E  +   + +   P   R    S++       L   + LDYE  +R + + ++AVD+G P L+++ ++ V V D NDN P         S   F++    EN+P E  + ++ + DADS  N  +  ++I  ++ +        F   P+S     +      DRE    Y   V   D+G+P      T+ I + D NDN P F    +   + EN+ P SP+  +   D D G+NA++   +     N + + N  TG + + +SFDRE  +S TF+  A+D   P  +S V VT+ + DEND  P+      SS             V  VEA D D  SN+++++S  G   H   +I  SDG I   K  +L R+    ++L V+  D G PSR +  +V I
Sbjct:  299 LQVKANDSDLGPNGEIEYTIHQASDPVPKMLQIERSTGIISVKGPLDREEISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPAGDSSVDNKKKYFLQTTTPLDYE-RIRDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSPIF-------SPPLFEVEFAEENQPGEKVLDVIAL-DADSGTNAELVYSIIADSSTRGL------FEIDPSSG---EVRARSPLDREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSSYSFSVLENMPPLSPVGMVTVLDMDKGENAQVQLSVEPDVGNFV-VQN-GTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNAPVVTKPSNSSFRRLSPLAAPDSVVEVVEAEDIDYGSNAELVYSIAGGNPHELFYISPSDGEIKLTK--ELTRKHGGLHRLVVKVSDRGKPSRHAIALVHI 809          

HSP 3 Score: 129.798 bits (325), Expect = 5.587e-30
Identity = 143/565 (25.31%), Postives = 249/565 (44.07%), Query Frame = 2
Query:  590 IKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVS-------AISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLR-EFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDR--------IKENIMPGSPIFTLIATDPDIGKNAKII--------YQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGW--VGKVEAYXXXXXXXXXIIFSFTG--FLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANN-KYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTP 2197
            I+  I+++D+ND+ P+F  P    + V+E+A  G+     + TD+D E    +  + ++ PE    F +         +  L ++  LD E     + + + AVD G P+  +S  + V + D NDN PQ        SS   ++ EN P    V  V   D+D   NG ++  +      Q  + + +        +R+  I++++   DRE IS ++  V  +D+G  P SS   ++I + D+NDN P+        R        I E++  G+ +  +  +D D G+NA +         +Q+  +     S+ N     +      D E       +  A+D  NP L+S+  + +++ D ND  P+F    +  +  E       V  V A D DS +N+++++S            I  S G + +     LDRE +  Y+  V A D GVPS   +  V I++ D NDN PKF   + S Y   + E + P + +  V   D D+ EN +V   +  +   F++   +G +  + + DR +       + A D G P
Sbjct:  151 IEGRIEVQDINDNTPQFPSPV-LTLSVQENAHMGATFAIPQATDRDTERNGVLKYDLSAGPEASALFSLQMANDRGEKLPQLIVLGNLDRELK-DSYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQ-----FEKSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTI-----HQASDPVPKML----QIERSTGIISVKGPLDREEISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQL--RPAGDSSVDNKKKYFLQTTTPLDYERIRDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSPIFSPPLFEVEFAEENQPGEKVLDVIALDADSGTNAELVYSIIADSSTRGLFEIDPSSGEVRARS--PLDREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKF---MLSSYSFSVLENMPPLSPVGMVTVLDMDKGENAQVQLSVEPDVGNFVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEP 692          

HSP 4 Score: 83.9593 bits (206), Expect = 6.530e-16
Identity = 102/335 (30.45%), Postives = 154/335 (45.97%), Query Frame = 2
Query: 1283 IWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQI---PEKYQNI-ISIPNPSTGIVTNLV---SFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKE----GYSGWVGKVEAYXXXXXXXXXI---IFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPK-----FSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNKYF--------IIDEKSGEVFINRT--LDRLELVPRRLLIMAKDNGTPS 2200
            I ++D NDN P F        ++EN   G+      ATD D  +N  + Y +   PE      + + N     +  L+   + DRE+  S      A+D   P   SS  + + I D ND  P F  S+Y  ++ E    GYS  V +V+A D+D   N +I   I   +  +   L I +S G I S KG  LDRE  S+++  V A+D G   +SS+  V I++ D NDN+P            S  +  I+E +  GT +  V  +D DE EN  VT ++A +  F         +D K  + F+  T  LD   +   R+ I+A D+G P+
Sbjct:  155 IEVQDINDNTPQFPSPVLTLSVQENAHMGATFAIPQATDRDTERNGVLKYDLSAGPEASALFSLQMANDRGEKLPQLIVLGNLDRELKDSYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQFEKSSYEAEVSENSPVGYS--VLQVKANDSDLGPNGEIEYTIHQASDPVPKMLQIERSTG-IISVKG-PLDREEISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPAGDSSVDNKK-KYFLQTTTPLDYERIRDYRVEIVAVDSGNPA 484          
BLAST of protocadherin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008517.1 (pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 gene:ENSPMAG00000007697.1 transcript:ENSPMAT00000008517.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 226.098 bits (575), Expect = 1.720e-60
Identity = 190/604 (31.46%), Postives = 286/604 (47.35%), Query Frame = 2
Query:  410 INSEIIYSI-EGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVK---------RHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETI------SHYRVTVQCKDQGLP-PLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGWVGK----VEAYXXXXXXXXXIIFSF-TGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLAN----NKYFIIDEKSGEVFINRTLDR 2143
            +N+ + Y I  G  +G F + +    + IF T    DREE+  Y+L  +A   G+    GE  + + + D+N+HAP FD    Y + + ED    S+   ++ TDKD          S  + EVK           F +     L +   LD E+   ++++ V A+D G+  L++S T+ V VLD+NDN P       + SS  F   E +   S V  V  TDAD+  NG V  +  +P  + NFEL S             RI +LR FDRE +      + +  +V   D G P PL  + T+ ++++D NDNPP F+K  +Q  + E+    + +  + A+D D G N  + Y I E  +      + STG +T L S DRE   S T    A D     L +S  V +++ DEND  P F  S       E  S  VG+    + A D D+  + D+ ++   G  H    I +S G++F  +  +LD E Q  Y+L V A+D G P RSS+ I+ + + D NDN P F   L       I E +  GT +  V A D D + NG++ Y +A       +F ID +SGE+     +DR
Sbjct:  687 LNANVTYLIVSGDQRGSFSI-EWSGGR-IF-TANAIDREEQAFYQLRVVANSGGV---AGEASVSVLVHDVNNHAPVFDR-ASYEVSIAEDEPVNSRFFSVRATDKD----------SGKNGEVKYEIGEGNGGEKFGIFPDGQLYVRYELDRET-REEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKP-----LFNSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSFEKP--QVNFELDSE----------TGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLLRVTASDVDEGVNGALRYAINEGNEGGKFTVDASTGQITLLGSLDREETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRFTESLLSVDALE--STRVGELLITLTASDEDTGPSGDVRYAIVAGNTHATFAIDRSTGSVFLAR--RLDFETQRLYRLNVSAEDGGRPPRSSATILVVHVRDFNDNPPAF---LPGDVFASIMENIPIGTRVITVTARDPDADVNGELHYSIARQFPPGAHFTIDPESGEICTAAEIDR 1248          

HSP 2 Score: 173.711 bits (439), Expect = 4.723e-44
Identity = 178/608 (29.28%), Postives = 269/608 (44.24%), Query Frame = 2
Query:  413 NSEIIYSI-EGKDKGFFKLLQMKNNKPIFKTMKL---FDREERDRYELVFIATDKGIP-KKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKD---DETLITVLINSNSDPEVKRHFQVSAISGL-TLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYS--GWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLL----ANNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNG 2191
            N E+  SI  G ++G F L       P  + +K+    DRE    Y L  +A+D G P  ++    + + + D+NDHAP F +   Y   + E A  GS + D+   D D   +  L   +++ N        F V   +GL T   ++D E +     + + A D G    T  T++TV +LD+ND  P       + +      +EN     FV  V+  D+D   NG V  N        + ++ ++Y   F       ++ TL+  DRE +  Y + VQ +D+G PPL S   +T+ + D NDN P F    +   I EN   G+ + T+ ATDPD G N  + YQ+         + N  TG V+  VS DRE       +  ALD  +    S   VT+ + D  D  P F    Y F + E  +    VG V A   D N+N   +   +G       I  S G IF+   I  DRE Q+ YQL V A   GV   +S   V + + D+N+++P F +   + Y   I E     +    V ATD D  +NG+V Y +       K+ I  +  G++++   LDR       L + A D G
Sbjct:  263 NGELSVSIVGGNERGHFVL--HAPGVPGLRVLKVASQLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFAL-SAYAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSIVSGND----LGWFSVDESTGLVTTDGKVDREVAS-SVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPP-----LFTQTKYVATAVENSLPGLFVVSVSAADSDLGENGTVRYNF-------DPDMPAQYREMFRLDSLTGKVTTLKSLDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVFYPVQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQLTAGDAARFQV-NAVTGAVSTRVSLDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFARDDYSFVVFENVAPGTLVGSVSASTLDLNANVTYLI-VSGDQRGSFSIEWSGGRIFTANAI--DREEQAFYQLRVVANSGGVAGEAS---VSVLVHDVNNHAPVFDR---ASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGNGGEKFGIFPD--GQLYVRYELDRETREEYSLTVSAMDTG 838          

HSP 3 Score: 171.785 bits (434), Expect = 1.929e-43
Identity = 171/613 (27.90%), Postives = 278/613 (45.35%), Query Frame = 2
Query:  407 GINSEIIYSIEGKDKGFFKLLQMKNNKPIFK-------TMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISGLTLISR-LDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSE-MNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLP-PLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAY-HFKIKEGYSG-WVGKVEAYXXXXXXXXXIIFSFTGFL---HNHLWILKS-DGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLL--ANNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNG 2191
            G+N      + G ++G     ++   +P+ K       T    DRE    Y L   A D G P++ G +++ + ++D ND+ P F+ P  Y   V ED+  G+ + D              L++    P           +G+    + LD+E + R++T+ + A D G P L+   T  + +LD+NDN P I    L  ++ +  + E+    +  A+VTVTDADS   NG +  +++  N + +F L      + P       +    + DRE I  Y +T+   D G P   S+  ++ +++ D ND+ P F+   +   + E    GS +  + A D D G NAK+ Y I           + STG+VT     DRE+ +S+     A D+      +   +T+ + D ND  P+F  + Y    ++    G +V  V A D+D   N  + ++F   +   +  ++ L S  G + + K   LDRE    Y L V+A+D G P   S+  V + + D+NDN P F  P+   Y   I E    GT +T V ATD D   NG V Y L   +   F ++  +G V    +LDR E    +L + A D G
Sbjct:   57 GVNHHAYKIVSGNEEG-----RLVPPRPVTKRAFLHLATTGPLDREANPSYALAVQAEDGGSPRRYGRLQVNVTVQDANDNPPAFEKPA-YRASVAEDSPVGAALRD--------------LLHRGRGPLA---VPFDPKTGMVSTRQPLDFE-ARRQYTLSLRAADGGNPPLSGRATAVIQLLDVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNERGHFVL------HAPGVPGLRVLKVASQLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSIVSGNDLGWFSVDESTGLVTTDGKVDREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFTQTKYVATAVENSLPGLFVVSVSAADSDLGENGTVRYNFDPDMPAQYREMFRLDSLTGKVTTLK--SLDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVF-YPVQ--YFASILENEPGGTAVTTVTATDPDRGANGTVRYQLTAGDAARFQVNAVTGAVSTRVSLDREERAVYQLQVTALDGG 634          

HSP 4 Score: 170.629 bits (431), Expect = 4.627e-43
Identity = 167/629 (26.55%), Postives = 279/629 (44.36%), Query Frame = 2
Query:  383 LSPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSK-----ICDIKVTDKDDETL--ITVLINSNSDPE-VKRHFQVSAISGLTLISR-LDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPP---LSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMP-----GSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIP---------NPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGW--VGKVEAYXXXXXXXXXIIFSF-TGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNKYFIIDEKS--GEVFINRTLDRLELVPRRLLIM 2176
            LS  D+D G N+ + YS+    +G F +        + +  +  DREER  Y L   A+D        + ++ + +RD ND++P F     Y   V EDA    K     I  +   D D      +T  +  + D +     F +  ++G   ++R LD ES    + +   A D G   L  +  + VNVLD NDN P +  D+L+      ++ E+ P  + +  ++ TD D  +N  ++ ++   + +  F +             + ++   R  DRE  S Y + V+  D+   P   LSS   +++ + D NDN P+F+        +  + P     G+ + T+ A DPD G+N+ + Y +    +               N  TG V  +   DRE   S      A+D+  P L S+  + + + D ND  P F    Y   I E       V ++ A+D D  +N ++ +   +G       +    G +   +   LDRE  ++Y+L V A+D G P+RS +  V++ L D+ND SP F     + + ++ T+   P  LI +V+A DDD   +G+VTY  A          S  G V + R+LDR E  P+ +LI+
Sbjct: 1538 LSATDADQGQNALVTYSVLSGSEGAFVVDAASG---VLRASRRLDREERASYLLTVRASDG---THATDARLSVAVRDANDNSPRFSR-HAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLHPVTGALNVTRPLDRESRA-CYVLRARATDGG--GLAATARLYVNVLDANDNAPSVQNDSLA-----AEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDPEGRFAV-----------GNDGQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTS------PRSALAPEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPRFPRREYEAAIAEDEPPGTEVLRLSAWDPDEGANGELRYDIASGDPTGDFRLDPVLGTLAVAR--PLDRERTASYELAVRARDGGGPARSDTASVRVTLSDVNDCSPAFQLSPYTVHARENTQG--PPVLILQVVARDDDLGSSGQVTYAAAGGNDGGAFSVSPDGHVHLLRSLDR-EAQPQHVLII 2129          

HSP 5 Score: 165.622 bits (418), Expect = 1.389e-41
Identity = 170/626 (27.16%), Postives = 286/626 (45.69%), Query Frame = 2
Query:  377 IKLSPRDSDYGINSEIIYSIE----GKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISGLTLISRLDYESSMRK-FTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEK--YQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAY--HFKIKEGYSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSD-GNIFSEKGIQLDREV------QSTYQLTVEAKDNGVPSR-SSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANN---KYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGT 2194
            + +S  DSD G N  + Y+ +     + +  F+L  +        T+K  DREE + Y LV  A D+G P      K+ + + DLND+ P F  P  Y   + E+   G+ +  +  TD D     TV     +    +  FQV+A++G  + +R+  +   R  + + V A+D G     +   +T+ V D  D  P    D  S     F + EN    + V  V+ +  D  +N  V   ++  + + +F +               RI T    DRE  + Y++ V     G+   + + ++++ + D N++ P F +  ++  I E+    S  F++ ATD D GKN ++ Y+I E    +     P+   G +      DRE     +    A+D     L+SSV V + + D ND  P+F SS+Y  HF  ++     VG V+A D D+ SN  + +SF     N  + L S+ G I S +    DRE        +++  +V A D G P        VQ+ ++D+NDN P+F++   S Y   ++E+    T + +V A+D DE  NG + Y +        F +D  +G++ +  +LDR E     L++ A D+GT
Sbjct:  466 VSVSAADSDLGENGTVRYNFDPDMPAQYREMFRLDSLTGK---VTTLKSLDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVF-YPVQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQLTAGDAAR--FQVNAVTG-AVSTRVSLDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFARDDYS-----FVVFENVAPGTLVGSVSASTLD--LNANVTYLIVSGDQRGSFSI----------EWSGGRIFTANAIDREEQAFYQLRVVANSGGV---AGEASVSVLVHDVNNHAPVFDRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGNGGEKFGIFPD---GQLYVRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSFEKPQVN--FELDSETGRIASLR--VFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAK---SVYQASVSESASNLTQLLRVTASDVDEGVNGALRYAINEGNEGGKFTVDASTGQITLLGSLDREETASYTLVVSATDSGT 1054          

HSP 6 Score: 160.999 bits (406), Expect = 4.077e-40
Identity = 171/614 (27.85%), Postives = 275/614 (44.79%), Query Frame = 2
Query:  395 DSDYGINSEIIYSI-EGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSD--PEVKRHFQVSAISG-LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEG--YSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNKY-FIIDEKSGEVFINRTLDRLELVPR------RLLIMAKDNGTP 2197
            D+D G+N+++ YSI  G D G+F + +      +  T    DRE      L   A D+G   KT    + + + D+ND  P F   K YV    E+++ G  +  +   D D     TV  N + D   + +  F++ +++G +T +  LD E  + ++ + V A D G P L ++  +TV V D+NDN P  V   +   +S   ++EN+P  + V  VT TD D   NG V            ++L +     F  +     + T    DRE  + Y++ V   D G     S   +TI + D  D PP+F++  +   + EN+ PG+ + ++ A+  D+  NA + Y I    Q        S G +    + DRE       +  A    +  +     V++ + D N+  P+F  ++Y   I E    +     V A D DS  N ++ +          + +  DG ++     +LDRE +  Y LTV A D GV   SSSV V + + D+NDN P F+    S Y+    E    G+L+  V ATD D   NG VTY     +  F +D ++G +   R  DR  L+ +         ++A D G P
Sbjct:  367 DADSGLNAKLRYSIVSGNDLGWFSVDESTG---LVTTDGKVDREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFTQTK-YVATAVENSLPGLFVVSVSAADSDLGENGTVRYNFDPDMPAQYREMFRLDSLTGKVTTLKSLDRE-ELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHP--VFYPVQYFAS---ILENEPGGTAVTTVTATDPDRGANGTV-----------RYQLTAGDAARFQVNAVTGAVSTRVSLDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFARDDYSFVVFENVAPGTLVGSVSASTLDL--NANVTYLIVSGDQRGSFSIEWSGGRIFTANAIDREEQAFYQLRVVA---NSGGVAGEASVSVLVHDVNNHAPVFDRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGNGGEKFGIFPDGQLYVR--YELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNS---SSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSFEKPQVNFELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRP 949          

HSP 7 Score: 155.992 bits (393), Expect = 1.527e-38
Identity = 168/613 (27.41%), Postives = 263/613 (42.90%), Query Frame = 2
Query:  395 DSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLF-----DREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISG-LTLISRLDYESSMRK-----FTIPVIAVDNGIPN-LTTSTTITVNVLDINDNFPQ----IVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGY--SGWVGKVEAYXXXXXXXXXIIFSFTGFL--HNHLWILKSDGNIFSEKGIQLDREVQST-YQLTVEAKDNGVP---SRSSSVIVQIQLEDINDNSPKFSQP---LDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNK---YFIIDEKSGEVFINRTLDR 2143
            D D G N E+ Y I G+  G  K         IF   +L+     DRE R+ Y L   A D G+   +  + + + + D+ND+ P F+    YV    E+   GS +  ++ TD D  +   V   S   P+V  +F++ + +G +  +   D E+ +R+     F+  V+A D G P  L    T+ V V D+NDN PQ    +   ++S+S+SN   +           VT +D D  +NG +   + E N    F +               +I  L   DRE  + Y + V   D G  PL++  T+ + + DENDNPP F++        E+   G  + TL A+D D G +  + Y I     +     + STG V      D E          A D   P  +S+  + + + D ND  P FL       I E       V  V A D D++ N ++ +S         H  I    G I +    ++DREV    +++TV A D  +P    RS+   V + + D NDN+P+F  P   L  G           G+++  + A+D DE EN  V Y +        F +D ++G +  +  LDR
Sbjct:  784 DKDSGKNGEVKYEI-GEGNGGEKF-------GIFPDGQLYVRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNS-SSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTY-SFEKPQV--NFELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQL---------LRVTASDVDEGVNGALRYAINEGNEGGKFTV----------DASTGQITLLGSLDREETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRFTESLLSVDALESTRVGELLITLTASDEDTGPSGDVRYAIVAGNTHATFAIDRSTGSVFLARRLDFETQRLYRLNVSAEDGGRPPRSSATILVVHVRDFNDNPPAFLPGDVFASIMENIPIGTRVITVTARDPDADVNGELHYSIARQFPPGAHFTIDPESGEICTAA--EIDREVTGGLFEVTVRATDKAIPVHTRRSALKNVTVLVTDENDNAPRFVTPTAILVDGLRAAA------GSVVGTLQASDPDEAENAAVRYAVTGGDAAILFRLDRRTGIIETSTELDR 1357          

HSP 8 Score: 142.124 bits (357), Expect = 2.396e-34
Identity = 136/503 (27.04%), Postives = 211/503 (41.95%), Query Frame = 2
Query:  395 DSDYGINSEIIYSIEGKDK-----GFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLIN-SNSDPEVKRHFQVSAISGLTLISRLDYE-SSMRKFTIPVIAVDNGIP-NLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSG---WVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKD 1870
            D+D G   E+ Y++   +      G F L  +          +  DRE R  Y L   ATD G    T   ++Y+ + D ND+AP           V EDA  G+ +  I  TD D+     +  + S+ DPE +  F V     L++   LD E  S     + V       P  L+++  +++ + D+NDN P         S  +    E+ P  + VA V   D DS  N  V+  L   + ++           F  +     +  +RE DRE    Y +TV   D+G PPL+S  T+ + + D NDN P F +  ++  I E+  PG+ +  L A DPD G N ++ Y I           +P  G +      DRE   S      A D   P  + +  V + + D NDC P F  S Y    +E   G    + +V A D+D  S+  + ++  G      + +  DG++   +   LDRE Q  + L + A D
Sbjct: 1648 DADSGPFGEVTYALAPSEDSDWADGAFGLHPVTG---ALNVTRPLDRESRACYVLRARATDGGGLAATA--RLYVNVLDANDNAPSVQN-DSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDPEGR--FAVGNDGQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFT------SPRSALAPEDSPVGAVVATVQAVDPDSGRNSYVEYALAT-DGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPRFPRREYEAAIAEDEPPGTEVLRLSAWDPDEGANGELRYDIASGDPTGDFRLDPVLGTLAVARPLDRERTASYELAVRARDGGGPARSDTASVRVTLSDVNDCSPAFQLSPYTVHARENTQGPPVLILQVVARDDDLGSSGQVTYAAAGGNDGGAFSVSPDGHVHLLR--SLDREAQPQHVLIITATD 2133          

HSP 9 Score: 137.502 bits (345), Expect = 6.137e-33
Identity = 133/497 (26.76%), Postives = 215/497 (43.26%), Query Frame = 2
Query:  395 DSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDR------YELVFIATDKGIPKKTGE-IKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISG-LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIP-NPSTGIVTNLVSFDREMNTSI-------TFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHF--KIKEGYSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDRE 1831
            D+D G N  + YS E     F    ++ +      ++++FDRE   R      +    +ATD G PK   +   + + ++D+ND+ P+F     Y   V E A   +++  +  +D D+     +    N   E  + F V A +G +TL+  LD E +   +T+ V A D+G   L  S T+ V VLD NDN P+     LS        +E+      +  +T +D D+  +G V   ++  N    F +           +    +   R  D ET   YR+ V  +D G PP SS   + + + D NDNPP+F        I ENI  G+ + T+ A DPD   N ++ Y I  ++        +P +G +      DRE+   +       T KA  +      L +   VT+ + DEND  P F++        ++      VG ++A D D   N+ + ++ TG     L+ L     I  E   +LDRE
Sbjct:  888 DADAGSNGGVTYSFEKPQVNF----ELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQF-AKSVYQASVSESASNLTQLLRVTASDVDEGVNGALRYAINEGNEGGK-FTVDASTGQITLLGSLDREETA-SYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRFTESLLS-----VDALESTRVGELLITLTASDEDTGPSGDVRYAIVAGNTHATFAI----------DRSTGSVFLARRLDFETQRLYRLNVSAEDGGRPPRSSATILVVHVRDFNDNPPAFLPGDVFASIMENIPIGTRVITVTARDPDADVNGELHYSIARQFPPGAHFTIDPESGEICTAAEIDREVTGGLFEVTVRATDKAIPVHTRRSALKN---VTVLVTDENDNAPRFVTPTAILVDGLRAAAGSVVGTLQASDPDEAENAAVRYAVTGGDAAILFRLDRRTGII-ETSTELDRE 1358          

HSP 10 Score: 136.732 bits (343), Expect = 1.320e-32
Identity = 147/553 (26.58%), Postives = 239/553 (43.22%), Query Frame = 2
Query:  593 KIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDD--ETLITVLINSNSDPEVKRHFQVSAISGLTLISR-LDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEK-YQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPL-LNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGWV-GKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGI--------QLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNKY---FIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPS 2200
            ++ I + D+ND+ P F +P+   + V+E+  EG  I  +  TD D     L+T  + S S    +  F V A SG+   SR LD E     + + V A D       T   ++V V D NDN P+      S   +     + K   + +  V   DADS   G V   L      ++ +     F   P +     +   R  DRE+ + Y +  +  D G   L++   + + + D NDN PS         + E+  PG+ +  + ATD D G NA++ + I     +   ++ N     V   +  +R+   ++  +        P  L+S+V V+L + D ND  P F S       ++   G V   V+A D DS  NS + ++             +    F+   +        +LDRE + +Y LTV A D G P  +S+  + + + D NDN+P+F +     Y   I E   PGT + ++ A D DE  NG++ Y +A+      F +D   G + + R LDR       L + A+D G P+
Sbjct: 1501 QVEISVEDVNDNPPVFAVPE-MELEVEENTGEGEVIFTLSATDADQGQNALVTYSVLSGS----EGAFVVDAASGVLRASRRLDREERA-SYLLTVRASDG---THATDARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAP---SEDSDWADGAFGLHPVTGA---LNVTRPLDRESRACYVLRARATDGG--GLAATARLYVNVLDANDNAPSVQNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDPEGRFAVGNDGQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSPRSALAPEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPRFPR---REYEAAIAEDEPPGTEVLRLSAWDPDEGANGELRYDIASGDPTGDFRLDPVLGTLAVARPLDRERTASYELAVRARDGGGPA 2033          

HSP 11 Score: 119.013 bits (297), Expect = 2.956e-27
Identity = 112/399 (28.07%), Postives = 187/399 (46.87%), Query Frame = 2
Query:  377 IKLSPRDSDYGINSEIIYSI-EGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICD--IKVTDKDDETLIT-----VLINSNSDPEVKRHFQVSAISG-LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYF---NNFPNSKRNYRIVTLREFDRE-TISHYRVTVQCKDQGLP---PLSSQQTITIWIEDENDNPPSF--SKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDRE 1519
            ++++  D D G+N  + Y+I EG + G F +        +  ++   DREE   Y LV  ATD G         + +++ D ND+ P F    + ++ V  DA+E +++ +  I +T  D++T  +      ++  N+       F +   +G + L  RLD+E+  R + + V A D G P  +++T + V+V D NDN P  +   +  S     +MEN P  + V  VT  D D+++NG +  +            I+R F    +F     +  I T  E DRE T   + VTV+  D+ +P     S+ + +T+ + DENDN P F        D ++     GS + TL A+DPD  +NA + Y +      I+   +  TGI+      DRE
Sbjct:  992 LRVTASDVDEGVNGALRYAINEGNEGGKFTVDASTGQITLLGSL---DREETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRF---TESLLSV--DALESTRVGELLITLTASDEDTGPSGDVRYAIVAGNT----HATFAIDRSTGSVFLARRLDFET-QRLYRLNVSAEDGGRPPRSSATILVVHVRDFNDNPPAFLPGDVFAS-----IMENIPIGTRVITVTARDPDADVNGELHYS------------IARQFPPGAHFTIDPESGEICTAAEIDREVTGGLFEVTVRATDKAIPVHTRRSALKNVTVLVTDENDNAPRFVTPTAILVDGLRA--AAGSVVGTLQASDPDEAENAAVRYAVTGGDAAILFRLDRRTGIIETSTELDRE 1358          

HSP 12 Score: 116.316 bits (290), Expect = 1.912e-26
Identity = 143/568 (25.18%), Postives = 230/568 (40.49%), Query Frame = 2
Query:  593 KIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDD-----ETLITVLINSNSD-------PEVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFF------QDRIKENIMPGSPIFTLIATDPDI----GKNAKIIYQIPEKYQNIISIPN-PSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSS-VEVTLEIEDENDCIPMFLSSAYHFKIKEGY--SGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHL-WILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTY-----LLAN-NKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTP 2197
            ++ + + D+ND+AP F  P    +  KEDA  G ++      D+D            +++ N +       P  KR F   A +G      LD E++   + + V A D G P       + V V D NDN P          +    + E+ P                    V   L +  ++    L        P   +   + T +  D E    Y ++++  D G PPLS + T  I + D NDN P+  +F +         + E+  PG+    +  TD D     G+ +  I    E+   ++  P  P   ++      DRE          A D   P+  S+   + + + D ND  P F  SAY   + EG     +V  V A D DS  N+ + +S      N L W    +         ++DREV S+  L + A+D G   +++   + + L D+ND  P F+Q   + Y+    E  +PG  +  V A D D  ENG V Y     + A   + F +D  +G+V   ++LDR EL    L++ A+D G+P
Sbjct:    8 EVRVVVGDVNDNAPSFPEPGVMEVAFKEDAAVGRQVLLDTAVDRDVGPNGVNHHAYKIVSGNEEGRLVPPRPVTKRAFLHLATTG-----PLDREANP-SYALAVQAEDGGSPRRYGRLQVNVTVQDANDNPP-----AFEKPAYRASVAEDSP--------------------VGAALRDLLHRGRGPLA------VPFDPKTGMVSTRQPLDFEARRQYTLSLRAADGGNPPLSGRATAVIQLLDVNDNDPAI-RFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNERGHFVLHAPGVPGLRVLKVASQLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSIVS--GNDLGWFSVDESTGLVTTDGKVDREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFTQ---TKYVATAVENSLPGLFVVSVSAADSDLGENGTVRYNFDPDMPAQYREMFRLDSLTGKVTTLKSLDREELEEYPLVVQAQDRGSP 532          

HSP 13 Score: 112.079 bits (279), Expect = 4.016e-25
Identity = 98/397 (24.69%), Postives = 173/397 (43.58%), Query Frame = 2
Query:  377 IKLSPRDSDYGINSEIIYSIEGKD-KGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKG--IPKK-TGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKD-------DETLIT-VLINSNSDPEVKRHFQVSAISG-LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTL--IATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREM 1522
            +++S  D D G+N+E+ +SI   D +G F +     N       +  DRE +  Y LV   +D+    P + +  +++ + + D+ND+AP F  P+  +    ED+  G+ +  ++  D D       +  L T               F ++ ++G + L+  LD E + + + + V+AVD G P LT++ T+ V V D NDN P+              + E++P  + V  ++  D D   NG +  ++   +   +F L                +   R  DRE  + Y + V+ +D G P  S   ++ + + D ND  P+F    +    +EN   G P+  L  +A D D+G + ++ Y             +P  G V  L S DRE 
Sbjct: 1749 LRISATDDDEGVNAELEFSISSGDPEGRFAV----GNDGQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSPRSAL--APEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDRE-ARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPR-----FPRREYEAAIAEDEPPGTEVLRLSAWDPDEGANGELRYDIASGDPTGDFRLDPVLGT----------LAVARPLDRERTASYELAVRARDGGGPARSDTASVRVTLSDVNDCSPAFQLSPYTVHARENTQ-GPPVLILQVVARDDDLGSSGQVTYAAAGGNDGGAFSVSPD-GHVHLLRSLDREA 2121          

HSP 14 Score: 109.768 bits (273), Expect = 2.098e-24
Identity = 116/475 (24.42%), Postives = 198/475 (41.68%), Query Frame = 2
Query:  881 DNGI-----PNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPG-----SPIFTLIATDPDIGKNAKIIYQIPEK----YQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGWVG--KVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNG--VPSR-SSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVP-----GTLITKVMATDDDENENGKVTYLLANN------------KYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTP 2197
            DNG      P +++   + ++V D+NDN P   +  +       ++ EN  +   +  ++ TDAD   N +V            + ++S     F     +  +   R  DRE  + Y +TV+  D      ++   +++ + D NDN P FS+  +   + E+  P      + I T++A D D G   ++ Y +       + +     +P TG +      DRE       +A A D     L ++  + + + D ND  P   + +   ++ E         ++ A D+D   N+++ FS +       + + +DG +   +   LDRE QS Y L V   D     P+R SS+V V + L D+NDN+P F+ P  +         L P     G ++  V A D D   N  V Y LA +              F ++  +GEV + R LDR       L ++A D G P
Sbjct: 1485 DNGAGSFIRPPMSSFNQVEISVEDVNDNPPVFAVPEM-----ELEVEENTGEGEVIFTLSATDADQGQNALV-----------TYSVLSGSEGAFVVDAASGVLRASRRLDREERASYLLTVRASDG---THATDARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLHPVTGALNVTRPLDRESRACYVLRARATDGGG--LAATARLYVNVLDANDNAPSVQNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDPEGRFAVGNDGQLSVARA--LDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSPRSA---------LAPEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRP 1927          

HSP 15 Score: 106.686 bits (265), Expect = 1.702e-23
Identity = 116/456 (25.44%), Postives = 194/456 (42.54%), Query Frame = 2
Query:  902 TTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELIS-----RYFNNFPNSKRNY-RIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIP-NPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPM-----FLSSAYHFKIKEGYSGWVGKVEAYXXXX-----XXXXXIIFSFTGFLHNHLWILKSDG----NIFSEKGIQLDREVQSTYQLTVEAKDNGVP-SRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANN---KYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGT 2194
            T  T + V V D+NDN P      + + +  FK  E+      V + T  D D   NG+         N   ++++S     R     P +KR +  + T    DRE    Y + VQ +D G P    +  + + ++D NDNPP+F K  ++  + E+   G+ +  L+                  + +  +++P +P TG+V+     D E     T    A D  NP L+      +++ D ND  P         +A    + E  S   G V A    +      +N ++  S  G      ++L + G     +  +   QLDRE    Y LT+ A DNG P +RS++  + + + D+ND++P+F+    S Y   ++E    G+ +  V A D D   N K+ Y + +     +F +DE +G V  +  +DR       L I A+D G 
Sbjct:    4 TYPTEVRVVVGDVNDNAPSFPEPGVMEVA--FK--EDAAVGRQVLLDTAVDRDVGPNGV---------NHHAYKIVSGNEEGRLVPPRPVTKRAFLHLATTGPLDREANPSYALAVQAEDGGSPRRYGRLQVNVTVQDANDNPPAFEKPAYRASVAEDSPVGAALRDLL-----------------HRGRGPLAVPFDPKTGMVSTRQPLDFEARRQYTLSLRAADGGNPPLSGRATAVIQLLDVNDNDPAIRFVYLPPAARSASVDE--SAAPGTVAALVTVTDADSPTANGELSVSIVGGNERGHFVLHAPGVPGLRVL-KVASQLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFAL---SAYAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSIVSGNDLGWFSVDESTGLVTTDGKVDREVASSVVLNISAQDQGA 423          

HSP 16 Score: 56.6102 bits (135), Expect = 4.038e-8
Identity = 41/116 (35.34%), Postives = 59/116 (50.86%), Query Frame = 2
Query: 1865 KDNGV-----PSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMK-KITETLVPGTLITKVMATDDDENENGKVTY--LLANNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDN 2188
            +DNG      P  SS   V+I +ED+NDN P F+ P     M+ ++ E    G +I  + ATD D+ +N  VTY  L  +   F++D  SG +  +R LDR E     L + A D 
Sbjct: 1484 RDNGAGSFIRPPMSSFNQVEISVEDVNDNPPVFAVP----EMELEVEENTGEGEVIFTLSATDADQGQNALVTYSVLSGSEGAFVVDAASGVLRASRRLDREERASYLLTVRASDG 1595          
BLAST of protocadherin-1 vs. Ensembl Sea Lamprey
Match: si:ch211-199f5.1 (protocadherin 8 [Source:HGNC Symbol;Acc:HGNC:8660])

HSP 1 Score: 195.282 bits (495), Expect = 1.492e-51
Identity = 161/552 (29.17%), Postives = 267/552 (48.37%), Query Frame = 2
Query:  392 RDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKL---FDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNS--DPEVKRHFQVSAISG-LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLM-ENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIP-----NPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFL-------SSAYHFKIKEGYSGWVGKVEAYXXXXXXXXXIIFSFT-GFLHNHLWILKSDGNIFSEKGIQLDREVQST-YQLTVEAKDNGVPSRSSSVIVQIQL--EDINDNSPKFSQPLDSGYMK 1978
            RD D G N+   Y ++  ++ F   L+ + +   +  + +    DRE+   Y L   A D G P ++G   + I + D ND++P F      V  V+EDA  G+ +  +  TD D+     V+ + +S  D EV+R FQ+   +G L+L  +LD+E +  ++ I + A D G  ++     + V+V DINDN P+I +D +  S  +   + E    ESFV +VTV+D DS  NG+V C+L       +F+L+          + +Y +VT    DRE ++ Y + ++  D G PP  + +  T+ + DENDN P F +  ++  + EN  PG+ + T+ A D D   N  I Y + E      S+      NPS+G +  L   D E  TS+TF+  A D+  P L ++  V++ I DEND  P+         +         G    V  V A D+DS +N ++ +    G   N   I +  G +F+      D    +T + L V  +D G P+ S++  ++I++      D+    +QPLD+  + 
Sbjct:  161 RDLDVGGNALRAYHLDENER-FGLALRARTDGAKYAELVVKSRLDREQEGEYTLQLTAWDGGDPPRSGTTLVRITVLDSNDNSPVFAQTSCNVT-VREDATPGTVLLTLNATDVDEGPNGEVVYSFSSPVDAEVRRLFQLDPKTGKLSLKGQLDHELN-SEYEISIQARDMGPSSIPAHCKVLVHVEDINDNAPEIKLDFIMQSRGDTVFVSEGAAYESFVGLVTVSDIDSAENGLVACHL---RGHPHFKLLP--------YRDDYVVVTNSSLDREQMADYFLVLEASDGGTPPRVAARQFTVRLLDENDNEPRFHRSTYEASLLENNSPGAYVTTVTAWDADAEHNGMIAYNVVESEVAGASVSTYVSINPSSGAIYALRPLDYEAMTSLTFQVQARDDGVPPLVTNATVSVRIVDENDNAPVVTHPPLRNGTGVVRLPRDAGLGYLVTVVRARDSDSEANGELSYRIVQGNERNLFRINRLGGEVFTNAASVTDAAASATRHSLVVMVRDRGSPALSATAAIEIRVGAHGDGDDGADETQPLDASMLA 698          

HSP 2 Score: 134.42 bits (337), Expect = 2.812e-32
Identity = 140/572 (24.48%), Postives = 253/572 (44.23%), Query Frame = 2
Query:  590 IKIYIKIRDLNDHAPEF-------DMPKDYVIGVKEDAIEGSKICDI-----KVTDKDDETLITVLINSNSDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLR-EFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFS-KFFFQDR-----IKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYS--GWVGKVEAYXXXXXXXXXIIFSFT------GFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQ-PLDSGY-MKKITETLVPGTLITKVMATDDDENENGKVTYLLANN---KYFIIDEKSGEVFINRT--LDRLELVPRR-LLIMAKDNGTPS 2200
            +   +++ D+NDHAP+F       ++ +   +G +   +EG++  D+     +    D+     + + + +D         +  + L + SRLD E    ++T+ + A D G P  + +T + + VLD NDN P       + +S N  + E+    + +  +  TD D   NG V  +   P + +    + R F   P + +    ++L+ + D E  S Y +++Q +D G   + +   + + +ED NDN P     F  Q R     + E     S +  +  +D D  +N  +   +   + +   +P     +V    S DRE          A D   P   ++ + T+ + DEND  P F  S Y   + E  S   +V  V A+D D+  N  I ++          +  ++ I  S G I++ +   LD E  ++    V+A+D+GVP   ++  V +++ D NDN+P  +  PL +G  + ++      G L+T V A D D   NG+++Y +        F I+   GEVF N     D      R  L++M +D G+P+
Sbjct:  120 VHAEVELLDINDHAPDFARSEMHVEISESVALGTRV-PLEGARDLDVGGNALRAYHLDENERFGLALRARTDG--------AKYAELVVKSRLDREQEG-EYTLQLTAWDGGDPPRSGTTLVRITVLDSNDNSP-----VFAQTSCNVTVREDATPGTVLLTLNATDVDEGPNGEVVYSFSSPVDAE----VRRLFQLDPKTGK----LSLKGQLDHELNSEYEISIQARDMGPSSIPAHCKVLVHVEDINDNAPEIKLDFIMQSRGDTVFVSEGAAYESFVGLVTVSDIDSAENGLVACHL-RGHPHFKLLPYRDDYVVVTNSSLDREQMADYFLVLEASDGGTPPRVAARQFTVRLLDENDNEPRFHRSTYEASLLENNSPGAYVTTVTAWDADAEHNGMIAYNVVESEVAGASVSTYVSINPSSGAIYALR--PLDYEAMTSLTFQVQARDDGVPPLVTNATVSVRIVDENDNAPVVTHPPLRNGTGVVRLPRDAGLGYLVTVVRARDSDSEANGELSYRIVQGNERNLFRINRLGGEVFTNAASVTDAAASATRHSLVVMVRDRGSPA 665          
BLAST of protocadherin-1 vs. Ensembl Sea Lamprey
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 190.274 bits (482), Expect = 9.714e-50
Identity = 170/581 (29.26%), Postives = 274/581 (47.16%), Query Frame = 2
Query:  488 PIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDET-------LITVLINSNSDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVI-DTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGY--SGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTY-LLANNKY--FIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNG 2191
            P     K  DREER  YE+   A D G P  +G   + I + D ND++P FD   +  + + E++  G+ +  +  +D+D  +       L T    + S    KR F++   SGL  ++ L        + I ++A D G   +  + T+TV V D+NDN P I I D ++  +    + E       VA++TV+D D   NG V C +  P      + ++     +PN    Y + T    D ET + Y V ++  D G   LS   ++TI + D NDN P F++  ++  + EN + G  + T+ ATD D+ KNA+++Y +      +  + +P TGI++     DRE   + +F   A D+  P+L  +  V + + D ND  P F  + + F + E       VG V   D+D   N  +  S  G  +  L+ +  +  +     +  DRE +  Y L V+A D G P RSS+V V I + DINDNSP    P  +   K +    +PGT++T+V A D+D   N ++ Y ++  N +  F ID   G + +   L        RL++   D G
Sbjct:  217 PYLVVRKSLDREERQLYEMNLRAVDGGSPPHSGSAVLRINVTDTNDNSPVFDQ-AEVNVEIPENSPVGTHVVQLHASDRDAGSNAEVVYRLGTSTGGAGSGQGGKRLFRLDQNSGLVTVNGLLNREESPVYRIIILATDKGPEPVPATATVTVTVTDVNDNSPTIEIRDIVAPVNGVIYISEASHVNLPVALITVSDPDIGANGAVTCYIYNPEVPFQLKKLT-----YPN---QYLLETRETLDYETKNEYVVQIKAADAGATSLSRTMSVTIKLLDSNDNAPVFTEPTYKVSVPENNVIGKHLITVSATDRDMDKNAEMVYFLGPDAPTMFHM-DPETGIISLTEQLDREKKANYSFTILAKDQGIPVLEGNATVIVNVLDVNDNRPRFSLAEFDFYVNENVPKHSTVGMVTVADSDEGENGRVRLSILGTDNRQLFSIDPESGMI-RSNVGFDREQRHYYVLEVQATDGGEPVRSSTVKVVIHVMDINDNSPIVLMPPSNTTYKFVVPRTLPGTIVTEVSAVDNDAEINAELRYHIVGGNPHNLFHIDPVIGNITLMEPLTETHHGLHRLVVRVSDIG 786          

HSP 2 Score: 116.316 bits (290), Expect = 1.483e-26
Identity = 145/570 (25.44%), Postives = 258/570 (45.26%), Query Frame = 2
Query:  377 IKLSPRDSDYGINSEIIYSIEGKDKGFF------KLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDM-----PKDYVIGVKEDAIEGSKICDIKVTDKD--DETLITVLINSNSDPEVKRHFQVSAISG-----LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLRE-FDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQI-PEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFL----SSAYHFKIKEGYSGW-VGKVEAYXXXXXXXXXIIFSFTGF-LHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSV-IVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPG 2005
            ++L   D D G N+E++Y +     G        +L ++  N  +     L +REE   Y ++ +ATDKG         + + + D+ND++P  ++     P + VI + E +     +  I V+D D      +T  I    +PEV   FQ+  ++      L     LDYE+   ++ + + A D G  +L+ + ++T+ +LD NDN P       ++ +    + EN      +  V+ TD D + N  +    + P+    F +                I++L E  DRE  ++Y  T+  KDQG+P L    T+ + + D NDN P FS   F   + EN+   S +  +   D D G+N ++   I     + + SI +P +G++ + V FDRE       +  A D   P+ +S+V+V + + D ND  P+ L    ++ Y F +     G  V +V A DND+  N+++ +   G   HN   I    GNI   +   L       ++L V   D G+  +  +V +V + + +  +N+  + + L +G ++   +T V G
Sbjct:  287 VQLHASDRDAGSNAEVVYRLGTSTGGAGSGQGGKRLFRLDQNSGLVTVNGLLNREESPVYRIIILATDKGPEPVPATATVTVTVTDVNDNSPTIEIRDIVAPVNGVIYISEASHVNLPVALITVSDPDIGANGAVTCYI---YNPEVP--FQLKKLTYPNQYLLETRETLDYETK-NEYVVQIKAADAGATSLSRTMSVTIKLLDSNDNAP-----VFTEPTYKVSVPENNVIGKHLITVSATDRDMDKNAEM-VYFLGPDAPTMFHM-----------DPETGIISLTEQLDREKKANYSFTILAKDQGIPVLEGNATVIVNVLDVNDNRPRFSLAEFDFYVNENVPKHSTVGMVTVADSDEGENGRVRLSILGTDNRQLFSI-DPESGMIRSNVGFDREQRHYYVLEVQATDGGEPVRSSTVKVVIHVMDINDNSPIVLMPPSNTTYKFVVPRTLPGTIVTEVSAVDNDAEINAELRYHIVGGNPHNLFHIDPVIGNITLME--PLTETHHGLHRLVVRVSDIGIAVQHHAVALVHVFVNETLENA-TYIEWLIAGSLQTPLDTDVAG 829          

HSP 3 Score: 115.161 bits (287), Expect = 3.234e-26
Identity = 141/565 (24.96%), Postives = 234/565 (41.42%), Query Frame = 2
Query:  590 IKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDET-LITVLINSNSDPEVKRHFQVSA--------ISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLRE-FDRETISHYRVTVQCKDQG----------LPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQI--PEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGWVGK----VEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLA---NNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTP 2197
            I++ I + D+ND+AP F  P    + V E+A  G +       D D E   +       SDP     F++S         +  L +   LD E   + + + + AVD G P  + S  + +NV D NDN P         +  N ++ EN P  + V  +  +D D+  N  V   L             +         +N  +VT+    +RE    YR+ +   D+G             ++     +  IE  +   P     +  +    N+    P+  +  +DPDIG N  +   I  PE    +  +  P+  ++    + D E       +  A D     L+ ++ VT+++ D ND  P+F    Y   + E  +  +GK    V A D D + N+++++ F G     ++ +  +  I S    QLDRE ++ Y  T+ AKD G+P    +  V + + D+NDN P+FS      Y   + E +   + +  V   D DE ENG+V   +    N + F ID +SG +  N   DR +     L + A D G P
Sbjct:  137 IEVRINVEDINDNAPAFAAPV-LTVSVPENAPAGKRFPIQPANDPDSEANGVRRYELLPSDPATVSAFELSVTETANGEKVPYLVVRKSLDREER-QLYEMNLRAVDGGSPPHSGSAVLRINVTDTNDNSP-----VFDQAEVNVEIPENSPVGTHVVQLHASDRDAGSNAEVVYRLGTSTGGAGSGQGGKRLFRL---DQNSGLVTVNGLLNREESPVYRIIILATDKGPEPVPATATVTVTVTDVNDNSPTIEIRDIVAPVNGVIYISEASHVNL----PVALITVSDPDIGANGAVTCYIYNPEVPFQLKKLTYPNQYLLETRETLDYETKNEYVVQIKAADAGATSLSRTMSVTIKLLDSNDNAPVFTEPTYKVSVPE--NNVIGKHLITVSATDRDMDKNAEMVY-FLGPDAPTMFHMDPETGIISLTE-QLDREKKANYSFTILAKDQGIPVLEGNATVIVNVLDVNDNRPRFSLAEFDFY---VNENVPKHSTVGMVTVADSDEGENGRVRLSILGTDNRQLFSIDPESGMIRSNVGFDREQRHYYVLEVQATDGGEP 680          
BLAST of protocadherin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010725.1 (pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 gene:ENSPMAG00000009713.1 transcript:ENSPMAT00000010725.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 176.022 bits (445), Expect = 2.336e-45
Identity = 180/661 (27.23%), Postives = 283/661 (42.81%), Query Frame = 2
Query:  389 PR--DSDYGINSEIIYSI-----EGKDKGFFKLLQ----------------MKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKD---DETLITVLINSNSDPEVKRHFQVSAISGLTLI---SRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDS---SSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSK--------FFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIP-----EKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSA------YHFKIKEGYS--GWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSD---GNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLI-TKVMATDDDENENGKVTY-LLANN--KYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNG 2191
            PR  D D G NS   Y I     +G   G F L++                   ++ + +  +  DRE    YEL+    D G PK +G + + I + D ND+AP F  P    + + E +  G+ +  ++  D D   +  +        +    +    V   +GL  +    +LD E +M    + V+A D G  + + S T+TV + D NDN P   +  L          K++EN P  + V +++V+D D   +G VD  L  P      EL S      PN K  + + T R  D E    Y V+V   D+G P LS    + I + D NDN P F            ++  ++EN   G+ +  L+ATD D G N  I + +      E    + S+ N  TG +T     DRE          A D  +P   +   V + + DEND  P F+  +      Y F ++E  S   +VG V   D D   N+ +  +         WI  +    G +     + LDRE +  Y+L+V A D+G P+ S+S  V I + D NDN+P  + P  +   K +      G L+   V A D D  +NG+  Y ++  N    F+++  SG + + RT+  L+    RL++  +D G
Sbjct:  166 PRAIDPDAGTNSIQHYRISAASGDGLQLGPFSLVESDDDDDGGGVGVDGDGGMGHRALLELREQLDREAVPSYELLLWGEDGGNPKLSGSVLLTIVVVDANDNAPVFVDPPTRPVRITEHSKVGTSVVQLRAADPDAGPNGAIAYSFHTKLTSLATQAALHVDGTTGLVTVRNAEKLDRE-TMPVHRLVVVARDGGQLSRSASVTVTVELNDDNDNAPVFEVIALQGEYLPDGGVKIVENLPSGTPVVLISVSDPDLGSSGTVDVRLEFPTGA---ELAS------PN-KVQFLLKTTRLLDYEEAQQYNVSVLAADRGTPKLSKLLNLIISVVDINDNTPVFMNPASIEGDVAVYEVSLRENGPAGTVVLNLLATDADSGPNGAITFTLSELAGGESVAELFSL-NMRTGQLTLATPLDREKRMRYELSVEACDGGSPQRKARAIVRVTVLDENDNAPTFVGVSNSTNCMYQFFVEEETSVGTYVGTVSTSDLDEGDNARVALNLVREAGPD-WIGGAGDTPGGVVRTL-VVLDREDRVQYELSVRAVDSGRPALSASCRVSITVSDTNDNAPVITSPNTNDTWKHVRTFSPAGMLVGVSVTANDIDAGDNGRPLYEIIGGNPKGIFLLNADSGALSLARTVSSLDEGLHRLVVRVRDRG 812          

HSP 2 Score: 130.954 bits (328), Expect = 3.948e-31
Identity = 152/609 (24.96%), Postives = 249/609 (40.89%), Query Frame = 2
Query:  590 IKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISG-----------------------------------LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLR---EFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQD--------RIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSA--------YHFKIKE-GYSGWVG-KVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFS--------EKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKF---SQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNK-----YFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPS 2200
            + + + +RD+NDHAP F  P    + + E    G ++   +  D D  T        NS     +H+++SA SG                                   L L  +LD E+ +  + + +   D G P L+ S  +T+ V+D NDN P  V       +   ++ E+    + V  +   D D+  NG +  +        + +L S       +      +VT+R   + DRET+  +R+ V  +D G    S+  T+T+ + D+NDN P F     Q         +I EN+  G+P+  +  +DPD+G +  +  ++       ++ PN    ++      D E          A D   P L+  + + + + D ND  P+F++ A        Y   ++E G +G V   + A D DS  N  I F+ +      L   +S   +FS             LDRE +  Y+L+VEA D G P R +  IV++ + D NDN+P F   S   +  Y   + E    GT +  V  +D DE +N +V   L             D   G V     LDR + V   L + A D+G P+
Sbjct:  128 LDVQLLVRDINDHAPAFRAPH-LNVSISESEAVGRRVPLPRAIDPDAGT--------NS----IQHYRISAASGDGLQLGPFSLVESDDDDDGGGVGVDGDGGMGHRALLELREQLDREA-VPSYELLLWGEDGGNPKLSGSVLLTIVVVDANDNAPVFV----DPPTRPVRITEHSKVGTSVVQLRAADPDAGPNGAIAYSF-------HTKLTSLATQAALHVDGTTGLVTVRNAEKLDRETMPVHRLVVVARDGGQLSRSASVTVTVELNDDNDNAPVFEVIALQGEYLPDGGVKIVENLPSGTPVVLISVSDPDLGSSGTVDVRLEFPTGAELASPNKVQFLLKTTRLLDYEEAQQYNVSVLAADRGTPKLSKLLNLIISVVDINDNTPVFMNPASIEGDVAVYEVSLRENGPAGTVVLNLLATDADSGPNGAITFTLS-----ELAGGESVAELFSLNMRTGQLTLATPLDREKRMRYELSVEACDGGSPQRKARAIVRVTVLDENDNAPTFVGVSNSTNCMYQFFVEEETSVGTYVGTVSTSDLDEGDNARVALNLVREAGPDWIGGAGDTPGGVVRTLVVLDREDRVQYELSVRAVDSGRPA 706          

HSP 3 Score: 129.028 bits (323), Expect = 1.622e-30
Identity = 138/544 (25.37%), Postives = 232/544 (42.65%), Query Frame = 2
Query:  377 IKLSPRDSDYGINSEIIYSIEGKDKGFF--KLLQMKNNKPIF--KTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFD---MPKDYVI--GVK--EDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSA-------ISGLTLISRL-DYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSS----NFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSF------SKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQI-----PEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLS-----SAYHFKIKEGYSGWVG-KVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQS----TYQLTVEAKDNG 1876
            ++L   D D G N  I YS   K         L +     +   +  +  DRE    + LV +A D G   ++  + + +++ D ND+AP F+   +  +Y+   GVK  E+   G+ +  I V+D D        + S+   +V+  F   A       +  L   +RL DYE + +++ + V+A D G P L+    + ++V+DINDN P + ++  S           L EN P  + V  +  TDADS  NG +   L E    ++   +      F  + R  ++      DRE    Y ++V+  D G P   ++  + + + DENDN P+F      +   +Q  ++E    G+ + T+  +D D G NA++   +     P+        P    G+V  LV  DRE          A+D   P L++S  V++ + D ND  P+  S     +  H +        VG  V A D D+  N   ++   G     +++L +D    S     L R V S     ++L V  +D G
Sbjct:  293 VQLRAADPDAGPNGAIAYSFHTKLTSLATQAALHVDGTTGLVTVRNAEKLDRETMPVHRLVVVARDGGQLSRSASVTVTVELNDDNDNAPVFEVIALQGEYLPDGGVKIVENLPSGTPVVLISVSDPD--------LGSSGTVDVRLEFPTGAELASPNKVQFLLKTTRLLDYEEA-QQYNVSVLAADRGTPKLSKLLNLIISVVDINDNTP-VFMNPASIEGDVAVYEVSLRENGPAGTVVLNLLATDADSGPNGAITFTLSELAGGESVAEL------FSLNMRTGQLTLATPLDREKRMRYELSVEACDGGSPQRKARAIVRVTVLDENDNAPTFVGVSNSTNCMYQFFVEEETSVGTYVGTVSTSDLDEGDNARVALNLVREAGPDWIGGAGDTPG---GVVRTLVVLDREDRVQYELSVRAVDSGRPALSASCRVSITVSDTNDNAPVITSPNTNDTWKHVRTFSPAGMLVGVSVTANDIDAGDNGRPLYEIIGGNPKGIFLLNADSGALS-----LARTVSSLDEGLHRLVVRVRDRG 812          

HSP 4 Score: 105.916 bits (263), Expect = 2.038e-23
Identity = 108/396 (27.27%), Postives = 175/396 (44.19%), Query Frame = 2
Query: 1175 IVTLRE-FDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQD-RIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIP----NPSTGIVT--NLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGWVGKVEAYXXXXXXXXXII----FSFTGFLHNHLWILKSDGNIFSEKGIQ--------LDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLD-----SGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLAN-------NKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPSXXXXXXXXXXXXNEDEDKQTSV 2266
            ++ LRE  DRE +  Y + +  +D G P LS    +TI + D NDN P F     +  RI E+   G+ +  L A DPD G N  I Y    K  ++ +      + +TG+VT  N    DRE          A D      ++SV VT+E+ D+ND  P+F   A   +      G V  VE   + +      +       +G +   L    +   + S   +Q        LD E    Y ++V A D G P  S  + + I + DINDN+P F  P       + Y   + E    GT++  ++ATD D   NG +T+ L+         + F ++ ++G++ +   LDR + +   L + A D G+P     A +++   +E+++  T V
Sbjct:  223 LLELREQLDREAVPSYELLLWGEDGGNPKLSGSVLLTIVVVDANDNAPVFVDPPTRPVRITEHSKVGTSVVQLRAADPDAGPNGAIAYSFHTKLTSLATQAALHVDGTTGLVTVRNAEKLDRETMPVHRLVVVARDGGQLSRSASVTVTVELNDDNDNAPVFEVIALQGEYLP--DGGVKIVENLPSGTPVVLISVSDPDLGSSGTVDVRLE-FPTGAELASPNKVQFLLKTTRLLDYEEAQQYNVSVLAADRGTPKLSKLLNLIISVVDINDNTPVFMNPASIEGDVAVYEVSLRENGPAGTVVLNLLATDADSGPNGAITFTLSELAGGESVAELFSLNMRTGQLTLATPLDREKRMRYELSVEACDGGSPQRKARAIVRVTVLDENDNAPTFV 615          
BLAST of protocadherin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006996.1 (pep scaffold:Pmarinus_7.0:GL476780:2096:143714:1 gene:ENSPMAG00000006222.1 transcript:ENSPMAT00000006996.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 172.94 bits (437), Expect = 8.158e-44
Identity = 175/640 (27.34%), Postives = 291/640 (45.47%), Query Frame = 2
Query:  377 IKLSPRDSDYGINSEIIYSI--EGKDKGFFKLLQMKNNKPIFKTMKLFDREE--RDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDE------TLITVLINSNSDPEVKRHFQVSAISG-LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNV--LDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETI------SHYRVTVQCKDQGLPP--LSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNP------STGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYS--GWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILK-SDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPS--RSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTY-LLANNK--YFIIDEKSGEVFINRT-LDRLELVPRRLLIMAKDN 2188
            +++   D D   N++I YSI        +F +  +     +    +  D E+       L  +A D G P     +   +++ D ND++P FD    Y I + E+ + G+ +  +  TD D        +LI  L       E    F+++A SG +T  + LD E+ + ++ + V AVD G  N   +   TVN+  LD+NDN P        D      ++EN P  + +  V+  D D   NG +    I+P N          F     +    R   L + DRE +      S   + V   D+G PP   ++  T+T+ ++D NDN PSF    +  ++ E +   S +F + ATDPD G N  + Y +        ++P P      +TG++T LV  DRE   +   +  A D   P L+S+  ++L + D ND  P F  +     + E  +    V  +   D DS  N+++ F  TG   +  + +   DG + +   + LDRE +++Y L +EA DNG     R+ +  + + + D+NDN P F   L+  Y   + E +  G +I +V ATD DE  NG+V Y +++ N+   F+++  SG +    T LDR  +    L + A +N
Sbjct:  151 VRVRATDEDSPPNNQITYSILPTSAYSSYFSI-TVSGGYGVVTLARALDYEKIPGGTISLTIMALDGGSPPLNSTVTAIVEVFDENDNSPIFDR-NSYSIAIPENILAGATVLYVNATDGDQSPEYGQLSLIYSL-------EGSTQFRINARSGDITSTTLLDREA-VSQYILIVRAVDGGDGNDQKTGIATVNITLLDVNDNDP-----AWRDLPYAVTIVENTPGGTDIFTVSAADPDLNENGTL-VYAIDPPNP---------FYRINAASGKIRTTGL-QLDREDLNPISFASMRSIVVSGADRGSPPRRATASATVTVLLQDVNDNEPSFVGLPYALQVLEGLPANSTLFQVTATDPDEGANGNVTYSM------TAALPRPDFQLDAATGLITTLVQLDREAVAAYQLRLVATDRGTPALSSTTTLSLVVLDVNDNAPTFHPARSAVSLMESVARDSVVISLNCTDADSGLNAELSFFITGGNQDGQFSVGFRDGLVRTV--VSLDRETKASYSLVIEAIDNGPAGSRRTGTTTLDVLVLDVNDNRPLF---LEGSYEVSVPENVTRGAIILQVQATDIDEGINGRVWYRIISGNQDGNFLVNVSSGLISRGATPLDRETVALHALQVEAFNN 753          

HSP 2 Score: 155.992 bits (393), Expect = 1.451e-38
Identity = 163/565 (28.85%), Postives = 256/565 (45.31%), Query Frame = 2
Query:  584 GEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISGL-TLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELI--SRYFNNFP-NSKRNYRIVTL-REFDRETI--SHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATD----PDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALD--EFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGW--VGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDRE------VQSTYQLTVEAKDNGVPSR--SSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLAN---NKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPS 2200
            G  +++I + + ND+ P F +P  Y + V E+A  G+ +  +  TD D      V  + + D +    F +   SGL ++ + LD+E++ R FT+ V+A D G     T+  + +N+LD+NDN P    D+   ++      EN    + V  V  TD DS            PNN+  + ++  S Y + F       Y +VTL R  D E I      +T+   D G PPL+S  T  + + DENDN P F +  +   I ENI+ G+ +  + ATD    P+ G+   +IY +    Q  I   N  +G +T+    DRE  +       A+D  + N        V + + D ND  P +    Y   I E   G   +  V A D D N N  ++++      N  + + +        G+QLDRE        S   + V   D G P R  ++S  V + L+D+NDN P F   +   Y  ++ E L   + + +V ATD DE  NG VTY +        F +D  +G +     LDR  +   +L ++A D GTP+
Sbjct:   12 GSARVHITLINENDNRPIFSLPL-YNVSVWENATLGTSVVQVLATDLDAGVFGQVSYHFSDDSD---KFSLDPASGLISVAAALDFEATPR-FTVTVMARDGG--GQETAGRVRINLLDVNDNTPVFQRDSYVGTAR-----ENDNSLTPVVRVRATDEDSP-----------PNNQITYSILPTSAYSSYFSITVSGGYGVVTLARALDYEKIPGGTISLTIMALDGGSPPLNSTVTAIVEVFDENDNSPIFDRNSYSIAIPENILAGATVLYVNATDGDQSPEYGQ-LSLIYSLEGSTQFRI---NARSGDITSTTLLDREAVSQYILIVRAVDGGDGNDQKTGIATVNITLLDVNDNDPAWRDLPYAVTIVENTPGGTDIFTVSAADPDLNENGTLVYAIDP--PNPFYRINAASGKIRTTGLQLDREDLNPISFASMRSIVVSGADRGSPPRRATASATVTVLLQDVNDNEPSF---VGLPYALQVLEGLPANSTLFQVTATDPDEGANGNVTYSMTAALPRPDFQLDAATGLITTLVQLDREAVAAYQLRLVATDRGTPA 544          

HSP 3 Score: 155.221 bits (391), Expect = 2.682e-38
Identity = 176/635 (27.72%), Postives = 286/635 (45.04%), Query Frame = 2
Query:  413 NSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEI-------KIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAI----SGLTLI--SRLDYESSMRKFTI-PVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTN---LVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFL--SSAYHFKIKEGYSGWVGKVE--AYXXXXXXXXXIIFSF--TGFLHNHLW----ILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVP-SRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKK---ITETLVPGTLITKVM-ATDDDENENGKVTYLLA----NNKYFIIDEKSGEVFINRTLDRLELVPRRLLIM---AKDNGTPS 2200
            N+E+I +++G+                  T    DRE  D Y L  ++ D G P++   +        +Y+ + D ND++PEF+     ++ V+E A  G+ +  +  TD+D  +  TV   +++    +   Q   I    SG+T++  ++ D+     +F +  ++A+D G P  +T+  ++V VLD+NDN P      LS       ++E     + VA V  TDAD+  NG V    IE        +          S    R+      DRET + Y + V   D+G PPLS    + + ++D ND  P+F        + E++  GS + T+ AT+   G N K  Y+I    +N  ++ + ++G+VT+   L S++R         A A D   P L     + +E+ D ND  P+F+   +     I E     +  VE  A D D   N  + +SF   G + +  W    I  + G I + +   LDRE Q+ Y L + A D G P S  S+  +Q+ L+DI+DN P F    D G   +   I E   PGT +  V  A D D   N  V Y +A     NK+ +   + G + +   LDR E+ P   +I+   +  N TP+
Sbjct: 1774 NAELIAALQGE----------------ITTQAALDREATDSYMLTVLSRDGG-PREAIAVLTNKPGAYVYVNVTDENDNSPEFEAGSATLVEVRESAAPGTLLTVLHATDRDAGSNGTVSARAHTHTGTRIPPQYILIIQNESGVTIVDVAKADFVEKTSQFILFRIVALDGGSPPRSTTFNLSVIVLDVNDNVPIF----LSPGGYAVSVVELGAPGTLVASVWATDADAGPNGQVTFR-IESGGGDKLSI--------GPSDGIIRVAPGANIDRETRAAYTLMVVAVDRGNPPLSGSAIVRVLVDDVNDERPAFLAPVQTVSVLESLSVGSFVATVKATENYKGHNTKYTYKIAGIGKNAFTV-HATSGLVTSTRLLKSYER-----FNLTAVATDHGRPPLWGQAGLYVEVLDVNDHRPVFVLPPNGTVVNITEVMPVVIRIVEVLAVDGDEGQNGAVRYSFLHAGGVGSRDWESFRINATSGIISTARA--LDRESQAVYSLILLASDQGQPVSYESTQPLQVVLDDIDDNEPVFIVLPDGGAPYQSFSIPEHSPPGTAVGNVSGAVDADVGANAIVYYFIAAGNEGNKFNL--SRWGLLVVLSDLDR-EVSPYYAIIVKASSNPNWTPA 2367          

HSP 4 Score: 150.214 bits (378), Expect = 9.218e-37
Identity = 163/633 (25.75%), Postives = 276/633 (43.60%), Query Frame = 2
Query:  377 IKLSPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKD----DETLITVLINSNSDPEVKRHFQVSAISG---LTLISRLDYES-SMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNN--FPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLP--PLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQI--PEKYQNIISIPNPSTG-IVTNLVSFDREMNTSITFKAF------ALDEFNP--LLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSG--WVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLAN---NKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNG 2191
            +++   D D G+  ++ Y        F     +     +       D E   R+ +  +A D G  +  G ++I   + D+ND+ P F     YV   +E+    + +  ++ TD+D    ++   ++L  S        +F ++   G   +TL   LDYE       ++ ++A+D G P L ++ T  V V D NDN P         +S +  + EN    + V  V  TD D             P   Q   LI     +  F  + R+  I +    DRE +S Y + V+  D G      +   T+ I + D NDN P++    +   I EN   G+ IFT+ A DPD+ +N  ++Y I  P  +  I    N ++G I T  +  DRE    I+F +         D  +P     +S  VT+ ++D ND  P F+   Y  ++ EG      + +V A D D  +N ++ +S T  L    + L +   + +   +QLDRE  + YQL + A D G P+ SS+  + + + D+NDN+P F  P  S     + E++   +++  +  TD D   N ++++ +     +  F +  + G V    +LDR       L+I A DNG
Sbjct:   50 VQVLATDLDAGVFGQVSYHFSDDSDKF----SLDPASGLISVAAALDFEATPRFTVTVMARDGGGQETAGRVRI--NLLDVNDNTPVFQR-DSYVGTARENDNSLTPVVRVRATDEDSPPNNQITYSILPTS----AYSSYFSITVSGGYGVVTLARALDYEKIPGGTISLTIMALDGGSPPLNSTVTAIVEVFDENDNSP-----IFDRNSYSIAIPENILAGATVLYVNATDGDQS-----------PEYGQ-LSLIYSLEGSTQFRINARSGDITSTTLLDREAVSQYILIVRAVDGGDGNDQKTGIATVNITLLDVNDNDPAWRDLPYAVTIVENTPGGTDIFTVSAADPDLNENGTLVYAIDPPNPFYRI----NAASGKIRTTGLQLDREDLNPISFASMRSIVVSGADRGSPPRRATASATVTVLLQDVNDNEPSFVGLPYALQVLEGLPANSTLFQVTATDPDEGANGNVTYSMTAALPRPDFQLDAATGLITTL-VQLDREAVAAYQLRLVATDRGTPALSSTTTLSLVVLDVNDNAPTF-HPARSAV--SLMESVARDSVVISLNCTDADSGLNAELSFFITGGNQDGQFSVGFRDGLVRTVVSLDRETKASYSLVIEAIDNG 646          

HSP 5 Score: 144.821 bits (364), Expect = 4.398e-35
Identity = 164/637 (25.75%), Postives = 275/637 (43.17%), Query Frame = 2
Query:  395 DSDYGI--NSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDI-----KVTDKDDETLITVLINSNSDPEVKRHFQ--------VSAISG-LTLISRLDYESSMRKFTIPVIAVDNG----IPNLTT--STTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPN-SKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSF-SKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGI--VTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYS--GWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTY--LLANN------KYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTP 2197
            D D G+     + YSI       F +     +  +  T+   D E R  Y L+ +ATD+  P  T   ++ + +++  D    F +   Y   + E A+ G+ +  +     K   K    L  ++   + D   KRH Q        ++A+ G +T  + LD E++   + + V++ D G    I  LT      + VNV D NDN P+      + S++  ++ E+    + + ++  TD D+  NG V       +      +  +Y     N S      V   +F  +T       +   D G PP S+   +++ + D NDN P F S   +   + E   PG+ + ++ ATD D G N ++ ++I     + +SI  PS GI  V    + DRE   + T    A+D  NP L+ S  V + ++D ND  P FL+      + E  S   +V  V+A +N    N+   +   G   N   +  + G + S + ++        + LT  A D+G P       + +++ D+ND+ P F  P  +G +  ITE +     I +V+A D DE +NG V Y  L A        + F I+  SG +   R LDR       L+++A D G P
Sbjct: 1637 DRDLGVCDAGTVRYSIASGGNDTFGI---DESTGLIVTVAPIDYETRPEYLLMVVATDQAPPFHTASCELRVSLQNELDEKLSFSLAA-YQAALSEAAVPGTVVVRVAAPQMKAPPKLPLPLAILVQKWHED---KRHKQQESDNAELIAALQGEITTQAALDREAT-DSYMLTVLSRDGGPREAIAVLTNKPGAYVYVNVTDENDNSPEFE----AGSATLVEVRESAAPGTLLTVLHATDRDAGSNGTVSA---RAHTHTGTRIPPQYILIIQNESGVTIVDVAKADFVEKTSQFILFRIVALDGGSPPRSTTFNLSVIVLDVNDNVPIFLSPGGYAVSVVELGAPGTLVASVWATDADAGPNGQVTFRIESGGGDKLSI-GPSDGIIRVAPGANIDRETRAAYTLMVVAVDRGNPPLSGSAIVRVLVDDVNDERPAFLAPVQTVSVLESLSVGSFVATVKATENYKGHNTKYTYKIAGIGKNAFTVHATSGLVTSTRLLK----SYERFNLTAVATDHGRPPLWGQAGLYVEVLDVNDHRPVFVLP-PNGTVVNITEVMPVVIRIVEVLAVDGDEGQNGAVRYSFLHAGGVGSRDWESFRINATSGIISTARALDRESQAVYSLILLASDQGQP 2252          

HSP 6 Score: 136.732 bits (343), Expect = 1.299e-32
Identity = 143/517 (27.66%), Postives = 233/517 (45.07%), Query Frame = 2
Query:  422 IIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIP--KKTGEIKIYIKIRDLNDHAPEF-DMPKDYVIGVKEDAIEGSKICDIKVTDKD---DETLITVLINSNSDPEVKRHFQVSAISG--LTLISRLDYE-------SSMRKFTIPVIAVDNGIP--NLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLE--IEDENDCIPMFLSSAYHFKIKEGYS--GWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQ 1909
            +IYS+EG  +  F++     +     +  L DRE   +Y L+  A D G    +KTG   + I + D+ND+ P + D+P  Y + + E+   G+ I  +   D D   + TL+  +     DP     ++++A SG   T   +LD E       +SMR  +I V   D G P    T S T+TV + D+NDN P  V           +++E  P  S +  VT TD D   NG V  ++     + +F+L                I TL + DRE ++ Y++ +   D+G P LSS  T+++ + D NDN P+F        + E++   S + +L  TD D G NA++ + I    Q+         G+V  +VS DRE   S +    A+D        +   TL+  + D ND  P+FL  +Y   + E  +    + +V+A D D   N  + +       +  +++     + S     LDRE  + + L VEA +N     SS + V+
Sbjct:  279 LIYSLEGSTQ--FRINARSGD---ITSTTLLDREAVSQYILIVRAVDGGDGNDQKTGIATVNITLLDVNDNDPAWRDLP--YAVTIVENTPGGTDIFTVSAADPDLNENGTLVYAI-----DPP-NPFYRINAASGKIRTTGLQLDREDLNPISFASMR--SIVVSGADRGSPPRRATASATVTVLLQDVNDNEPSFV-----GLPYALQVLEGLPANSTLFQVTATDPDEGANGNVTYSMTAALPRPDFQL----------DAATGLITTLVQLDREAVAAYQLRLVATDRGTPALSSTTTLSLVVLDVNDNAPTFHPARSAVSLMESVARDSVVISLNCTDADSGLNAELSFFITGGNQDGQFSVGFRDGLVRTVVSLDRETKASYSLVIEAIDNGPAGSRRTGTTTLDVLVLDVNDNRPLFLEGSYEVSVPENVTRGAIILQVQATDIDEGINGRVWYRIISGNQDGNFLVNVSSGLISRGATPLDRETVALHALQVEAFNNDSVGLSSVIRVR 765          

HSP 7 Score: 127.872 bits (320), Expect = 7.386e-30
Identity = 145/561 (25.85%), Postives = 251/561 (44.74%), Query Frame = 2
Query:  593 KIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDD---ETLITVLINSNSDPEVKRHFQVSAISG-LTLISRLDYESSMRKFTIPVIAVD---NGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKN-AKIIYQIPEKYQNI--ISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNP-----LLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGY-SGWV-----GKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREV--QSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLAN--NKYFIIDEKSGEVFINRTLDRLELVPRRLL-IMAKDNGTP 2197
             + I+I D ND+AP F      V+  +  +  G  + ++  +D D+     ++  +++ N+       F +   +G LT +  LD+E S   + + V A D   +    LT++ T++V+V D+ND  P      L        + E +P    +A    +D DS +NG ++ ++I+ + +  F +IS        +  + R+    E DRET + Y +T+  KD G PPL+S  T+ + + D +DN P F        + E     + +  + A+D + G+N A ++   P  + N       +  TG+V      DRE            D  NP         S  + + I DEND  P+F    Y  +I E   +G V     G + A D D   N+ + +S  G    +  I +  GN+    G  LDRE       +LT+  +D G   R+++V + + + D+NDN+P F+    + ++ + +  +    ++ K M  D    + G V Y +A+  N  F IDE +G +     +D  E  P  LL ++A D   P
Sbjct: 1157 SVLIRITDENDNAPAFGAATYEVLLTEGPSTAGVAVANVTASDPDEGDNARVVYAIVSGNT----AATFGIDNGTGVLTAVKALDFEVSAGLYLLVVTATDQPRDPARRLTSTATVSVHVADVNDVTPWF----LRSYEGPIDVSEGQPGPR-IATFMASDQDSGLNGELEYSIIDGDPRNEF-VISP-------ADGDLRVRRYVELDRETQAFYNLTIMAKDMGTPPLNSTLTVGVRVLDVHDNDPVFLNLPANASLSEAAAVLAIVSRVRASDANEGRNCAALLQHSPTSFCNGERAFYADSQTGLVYVNRPLDRERVAEYRLTLTVRD--NPDNPSYARKDSDIMIVTILDENDNSPVFSQVTYEAEIPENSPNGTVLTVLNGPIYASDADFGVNATLAYSLLGGSSAYFLIDRDRGNVSMALGQGLDREGIPGGRLELTILVQDGG--RRNATVRLGVTVLDVNDNTPTFNVTSQTAHVLENSPAVGTSVIVVKAMDRDLGVCDAGTVRYSIASGGNDTFGIDESTGLIVTVAPID-YETRPEYLLMVVATDQAPP 1695          

HSP 8 Score: 119.783 bits (299), Expect = 2.151e-27
Identity = 95/326 (29.14%), Postives = 160/326 (49.08%), Query Frame = 2
Query: 1256 PLSSQQTITIWIEDENDNPPSFSKFFFQDRIKEN-IMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAF-ALDE-FNPL--LNSSVEVTLEIEDENDCIPMFLSSAYH--FKIKEGYSG-WVGKVEAYXXXXXXXXXIIFSFT-GFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKV------TYLLANNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDN 2188
            P  +  ++ I I DENDN P+F    ++  + E     G  +  + A+DPD G NA+++Y I           +  TG++T + + D E++  +      A D+  +P   L S+  V++ + D ND  P FL S Y     + EG  G  +    A D DS  N ++ +S   G   N   I  +DG++   + ++LDRE Q+ Y LT+ AKD G P  +S++ V +++ D++DN P F   L+      ++E      ++++V A+D +E  N         T      + F  D ++G V++NR LDR  +   RL +  +DN
Sbjct: 1151 PAQATTSVLIRITDENDNAPAFGAATYEVLLTEGPSTAGVAVANVTASDPDEGDNARVVYAIVSGNTAATFGIDNGTGVLTAVKALDFEVSAGLYLLVVTATDQPRDPARRLTSTATVSVHVADVNDVTPWFLRS-YEGPIDVSEGQPGPRIATFMASDQDSGLNGELEYSIIDGDPRNEFVISPADGDLRVRRYVELDRETQAFYNLTIMAKDMGTPPLNSTLTVGVRVLDVHDNDPVF---LNLPANASLSEAAAVLAIVSRVRASDANEGRNCAALLQHSPTSFCNGERAFYADSQTGLVYVNRPLDRERVAEYRLTLTVRDN 1472          

HSP 9 Score: 115.931 bits (289), Expect = 2.805e-26
Identity = 154/652 (23.62%), Postives = 276/652 (42.33%), Query Frame = 2
Query:  395 DSDYGINSEIIYSI-EGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEF-DMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSN--SDPEVKRHFQVSAISGLTLISR-LDYESSMRKFTIPVIAVDNGIPNLTT-----STTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAM----VTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYR--VTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENI-MPGSPIFTLIATDPDIG--KNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGWVGKVEAYXXXXXXXXXIIFSFTGFLH--------------NHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVI-------VQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNK--------YFIIDEKSGEVFINRT-LDRLELVPRRLL--IMAKDNGTP 2197
            D D G+N E+ YSI +G  +  F +     +  + + ++L DRE +  Y L  +A D G P     + + +++ D++D+ P F ++P +    + E A   + +  ++ +D ++      L+  +  S    +R F   + +GL  ++R LD E  + ++ + +   DN  P+  +     S  + V +LD NDN P       S  +   ++ EN P  + + +    +  +DAD  +N  +  +L+       + LI R        + N  +   +  DRE I   R  +T+  +D G    + +  +T+   D NDN P+F+       + EN    G+ +  + A D D+G      + Y I     +   I + STG++  +   D E          A D+  P   +S E+ + +++E D    F  +AY   + E        V        +   +       +               N   I    G I ++    LDRE   +Y LTV ++D G P  + +V+       V + + D NDNSP+F     S  + ++ E+  PGTL+T + ATD D   NG V+     +           II  +SG   ++    D +E   + +L  I+A D G+P
Sbjct: 1308 DQDSGLNGELEYSIIDGDPRNEFVISPADGDLRVRRYVEL-DRETQAFYNLTIMAKDMGTPPLNSTLTVGVRVLDVHDNDPVFLNLPAN--ASLSEAAAVLAIVSRVRASDANEGRNCAALLQHSPTSFCNGERAFYADSQTGLVYVNRPLDRE-RVAEYRLTLTVRDN--PDNPSYARKDSDIMIVTILDENDNSP-----VFSQVTYEAEIPENSPNGTVLTVLNGPIYASDADFGVNATLAYSLL--GGSSAYFLIDR-------DRGNVSMALGQGLDREGIPGGRLELTILVQDGGRRNATVRLGVTVL--DVNDNTPTFNVTSQTAHVLENSPAVGTSVIVVKAMDRDLGVCDAGTVRYSIASGGNDTFGI-DESTGLIVTVAPIDYETRPEYLLMVVATDQAPPFHTASCELRVSLQNELDEKLSFSLAAYQAALSEAAVPGTVVVRVAAPQMKAPPKLPLPLAILVQKWHEDKRHKQQESDNAELIAALQGEITTQAA--LDREATDSYMLTVLSRDGG-PREAIAVLTNKPGAYVYVNVTDENDNSPEFEA--GSATLVEVRESAAPGTLLTVLHATDRDAGSNGTVSARAHTHTGTRIPPQYILIIQNESGVTIVDVAKADFVEKTSQFILFRIVALDGGSP 1931          

HSP 10 Score: 94.7449 bits (234), Expect = 8.708e-20
Identity = 132/555 (23.78%), Postives = 224/555 (40.36%), Query Frame = 2
Query:  548 FIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDD--ETLITVLINSNSDPEVKRHFQVSAISGLTLIS---RLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIV--IDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSP----IFTLIATDPDIGKNAKIIYQ------IPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVE-VTLEIEDENDCIPMFL-----SSAYH-FKIKEGY--SGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIF--SEKGI-----QLDREVQSTYQLTVEAKDNGVPSRSSSVI---------------VQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTY 2068
             +A D G P ++    + + + D+ND+ P F  P  Y + V E    G+ +  +  TD D      +T  I S    +      +    G+  ++    +D E+    +T+ V+AVD G P L+ S  + V V D+ND  P  +  + T+S       ++E+    SFVA V  T+           N    N K  +++     N F     +  + + R    ++   + +T    D G PPL  Q  + + + D ND+ P F      +    NI    P    I  ++A D D G+N  + Y       +  +      I N ++GI++   + DRE     +    A D+  P+   S + + + ++D +D  P+F+      + Y  F I E       VG V    +     + I++ F            ++GN F  S  G+      LDREV   Y + V+A  N  P+ + +V                V++ LEDIND  P F+   +  Y   +      G+ + ++ A D D   N  V Y
Sbjct: 1923 IVALDGGSPPRSTTFNLSVIVLDVNDNVPIFLSPGGYAVSVVELGAPGTLVASVWATDADAGPNGQVTFRIESGGGDK----LSIGPSDGIIRVAPGANIDRETRA-AYTLMVVAVDRGNPPLSGSAIVRVLVDDVNDERPAFLAPVQTVS-------VLESLSVGSFVATVKATE-----------NYKGHNTKYTYKIAGIGKNAFTVHATSGLVTSTRLL--KSYERFNLTAVATDHGRPPLWGQAGLYVEVLDVNDHRPVF--VLPPNGTVVNITEVMPVVIRIVEVLAVDGDEGQNGAVRYSFLHAGGVGSRDWESFRI-NATSGIISTARALDRESQAVYSLILLASDQGQPVSYESTQPLQVVLDDIDDNEPVFIVLPDGGAPYQSFSIPEHSPPGTAVGNVSGAVDADVGANAIVYYFIA--------AGNEGNKFNLSRWGLLVVLSDLDREVSPYYAIIVKASSN--PNWTPAVTTGPEFDPSKDRTLREVRVYLEDINDQWPVFT---NHEYTAGVAVDAKVGSELLQLEAVDRDVGNNSIVLY 2436          

HSP 11 Score: 92.4337 bits (228), Expect = 4.127e-19
Identity = 91/367 (24.80%), Postives = 157/367 (42.78%), Query Frame = 2
Query:  407 GINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKD-YVIGVKEDAIEGSKICDIKVTDKDD----ETLITVLINSNSDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVL-DINDNFPQIVIDTLSDSSS---NFKLMENKPKESFVAMVT-VTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQG--LPPLSSQ-----------QTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQI 1438
            G N++  Y I G  K  F +        +  + +L    ER  + L  +ATD G P   G+  +Y+++ D+NDH P F +P +  V+ + E      +I ++   D D+        + L            F+++A SG+   +R     S   +++ ++A D G P    ST     VL DI+DN P  ++  L D  +   +F + E+ P  + V  V+   DAD   N IV   +   N    F L            R   +V L + DRE   +Y + V+        P +++            + + +++ED ND  P F+   +   +  +   GS +  L A D D+G N+ ++Y+I
Sbjct: 2090 GHNTKYTYKIAGIGKNAFTVHATSG---LVTSTRLLKSYER--FNLTAVATDHGRPPLWGQAGLYVEVLDVNDHRPVFVLPPNGTVVNITEVMPVVIRIVEVLAVDGDEGQNGAVRYSFLHAGGVGSRDWESFRINATSGIISTARALDRESQAVYSLILLASDQGQPVSYESTQPLQVVLDDIDDNEPVFIV--LPDGGAPYQSFSIPEHSPPGTAVGNVSGAVDADVGANAIVYYFIAAGNEGNKFNL-----------SRWGLLVVLSDLDREVSPYYAIIVKASSNPNWTPAVTTGPEFDPSKDRTLREVRVYLEDINDQWPVFTNHEYTAGVAVDAKVGSELLQLEAVDRDVGNNSIVLYRI 2438          
BLAST of protocadherin-1 vs. Ensembl Nematostella
Match: EDO46189 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQM0])

HSP 1 Score: 239.965 bits (611), Expect = 1.093e-64
Identity = 186/610 (30.49%), Postives = 313/610 (51.31%), Query Frame = 2
Query:  380 KLSPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISGLTLISR-LDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTL-REFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQ-IPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYS--GWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTY-LLANNK--YFIIDEKSGEVFINRTLDRLELVPRRLLIMAKD 2185
            +L+  D D GIN+ + YS+   D  +F +    +++ + +T   FDRE +  Y++   A D G P ++G+  + I+I D+ND+ P F   + Y   V ED   G+ +  +  +DKD+      L  S +       F + A++G+  +SR LD+E     + + +   D G P LT ++ + +NV DINDN P       S S+   ++ EN P  +    V+ TD DS  NG +   +I+ N+   F +             +  I+++ +  D E  + Y +TVQ +D+G+P       +TI+IED ND+ P FS   +  +I E+ + GS + T+ ATD D G   ++ Y+ I    +   +I + ++G +      DRE   S + +  A D  +   +SS  VT+ ++D ND  P+F    Y F++ E  S    +G+V A D D +SN D+ ++ +   +  ++ + +   + + K  QLD E ++ Y +TV AKD G PSRSS  +V++ ++D+NDN P+F++ L   Y   + E L  G  +  V ATD D   NGK++Y +L+ N+   F +D  +GE+     LDR  +    L I A D
Sbjct:  189 QLTAVDLDVGINARLSYSLVSGDTSYFTV----DSQGVIRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQ-YTASVDEDVAIGAAMVTVTASDKDNGNNAD-LRYSFTSGNTNHAFTLDAVTGVVTVSRSLDFE-QRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPP-----VFSPSAYQSRVKENTPAGT---QVSATDRDSSTNGALVFGIIKGNDDGVFTI-----------DGSTGIISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFSPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLISGNVKGAFNI-DANSGSIRVSSELDRETTPSYSLQVEARDGGSTSRSSSTRVTIALQDINDNSPIF-QGPYVFRVSESSSPGHQIGQVAATDADDSSNGDVRYALSD--NTDVFSINTSTGLITLK-TQLDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQFAKSL---YTCTVGENLAAGVAVCYVTATDADSGANGKISYSILSGNENMAFAMDRFTGEITTRVPLDRETIASYSLTINADD 764          

HSP 2 Score: 213.772 bits (543), Expect = 2.669e-56
Identity = 175/614 (28.50%), Postives = 297/614 (48.37%), Query Frame = 2
Query:  380 KLSPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIG-VKEDAIEGSKICDIKVTDKDDET--LITVLINSNSDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGW--VGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLL--ANNKYFIIDEKSGEVFINRTLDRLELVPR-RLLIMAKDNGTP 2197
            +L+  D D G N  + Y+I   ++G     Q+     I       DRE    Y LV  A+D G P+++    I++ + D+ND+AP F+  K    G ++EDA   S +  +KV DKD+ +   IT+ ++     E   +F + +   +   + LDYE++   + + V A D G P+ + +  + + ++++NDN P  V      S     + E+    + V  +  TD+D      +  +++E N   +F++           + +  I   +  DRET ++Y + V+  + G    S     TI + D NDN P F+   +   + EN+  G  +  + ATD D G+NAK+ Y++     +   + NP+TG+VT     DRE   S + +  A+D   P  ++   +TL I D ND  P F  S Y   + E  +    + +V A D D+ +N  + +S     H + + + S     +  G+ +DRE  ++Y LT+ AKD+GVP   S+  V I + D NDNSP F+   ++ Y   I E +  G+ +  V ATD DE  N +V Y +   +   F I+  +G + + + ++R E VP   L I A D G+P
Sbjct:  810 QLTATDRDIGPNGAVTYAIISGNQG--NSFQLDPRSGILSVRSTLDRETIPSYTLVVKASDAGSPQQSITASIHVSVLDVNDNAPRFE--KSLFSGEIREDASVHSTVLQVKVEDKDEGSNGAITLSLSG----EGSDNFTIDSTGFVLSKTPLDYETTA-AYQLTVTARDGGSPSKSATAQVKITIINVNDNVPSFVSPAQVTS-----IPEDVAINTHVVKLNATDSDGTP---LTFDIVEGNAGSSFKI----------DQSSGLISVAKRLDRETTANYTLVVRATETGSQGESVYNNATIRVLDVNDNAPVFNPGSYAKSLHENLPIGQTVAKVTATDRDEGENAKVTYELSVGDTSKFEV-NPATGLVTTKRPLDREDQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFSQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISGNHGNAFRIDSTTGRITVVGV-VDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFASN-ETSY--GIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGDTSAFAINAMNGVLTVKKEINR-ETVPTYTLTIRASDRGSP 1390          

HSP 3 Score: 212.231 bits (539), Expect = 7.889e-56
Identity = 172/615 (27.97%), Postives = 287/615 (46.67%), Query Frame = 2
Query:  380 KLSPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKD---DETLITVLINSNSDPEVKRHFQVSAISG-LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRY-FNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQI----PEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTP 2197
            K++  D D G N+++ Y +   D   F++        +  T +  DRE++  Y L   A D G P ++    I + I DLND++P+F   K Y + V E+   GS I  +  +D D   +  +   +I+ N        F++ + +G +T++  +D E+ +  + + + A D+G+P   ++  + + V D NDN P       + + +++ + E     S VA+VT TD D            E +N Q F  I R   + F  +  N  +   +E +RET+  Y +T++  D+G P ++S + +T+ + D NDNPP F+   +   ++EN    + + T+ A D D+G NA + Y I     EK   I    N ++G++      D E  +    +  A D       +   VT+ + + ND  P F    Y   ++E        V+   +D +S   + +S  G   +  + +     I S   + LDRE+ S Y + V   D G P  S+   V I++ D NDNSPKF       Y   I E   P +   K+ ATD DE  N ++TY L+ N  F+I   SG + + + LDR       L I A+D+GTP
Sbjct: 1120 KVTATDRDEGENAKVTYELSVGDTSKFEVNPATG---LVTTKRPLDREDQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFSQSK-YTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISGNH----GNAFRIDSTTGRITVVGVVDREA-LASYNLTISAKDSGVPPWVSTAFVAITVADENDNSP-----IFASNETSYGIDEGVSIGSRVAVVTATDRD------------EGSNAQVFYSIVRGDTSAFAINAMNGVLTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGNDEKRFKI----NSTSGVIMTTTPLDFEEKSQYGLEVTATDS---KYTAKTNVTIRVINLNDITPAFTQQNYTASVRENSPTSTSVVKVSASDRDSFGSLSYSIVGGKDSDKFSIDQRSGIISTADV-LDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSS---YSSSILENSAPSSFSFKLAATDADEGTNARITYNLSRNDAFMIGASSGVITLAQPLDRENKSTYDLAIQARDHGTP 1697          

HSP 4 Score: 210.69 bits (535), Expect = 2.098e-55
Identity = 186/617 (30.15%), Postives = 288/617 (46.68%), Query Frame = 2
Query:  380 KLSPRDSDYGINSEIIYSI-EGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDE---TLITVLINSNSDPEVKRHFQVSAISG-LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLR-EFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEG--YSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLA--NNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPS 2200
            ++S  D D   N  +++ I +G D G F +     +  I    K  D E + RY+L   A D+G+P K    ++ I I D+NDH+P F  P +Y   + E  + GS +  +  TD D      L   LI+ N    VK  F + A SG + + S LD E++   +++ V A D G  + ++ST +T+ + DINDN P      +      F++ E+      +  V  TDAD   NG  D      +N   F +             +  ++TL+ + D E  + Y VTV  KD G P  SS   + + ++D NDNPP F+K  +   + EN+  G  +  + ATD D G N KI Y I    +N+    +  TG +T  V  DRE   S +    A D       ++  V + I DEND  P F   +  F I E       VG++ A D D   N  + ++       + + L     I S +   LDRE   +Y L V+A D G P +S +  + + + D+NDN+P+F + L SG +++  +  V  T++ +V   D DE  NG +T  L+   +  F ID  +G V     LD       +L + A+D G+PS
Sbjct:  394 QVSATDRDSSTNGALVFGIIKGNDDGVFTI---DGSTGIISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFS-PSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLISGN----VKGAFNIDANSGSIRVSSELDRETTP-SYSLQVEARDGGSTSRSSSTRVTIALQDINDNSP------IFQGPYVFRVSESSSPGHQIGQVAATDADDSSNG--DVRYALSDNTDVFSI-----------NTSTGLITLKTQLDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQFAKSLYTCTVGENLAAGVAVCYVTATDADSGANGKISYSILSGNENMAFAMDRFTGEITTRVPLDRETIASYSLTINADDGSLVRFMAATTVNISIADENDNQPTFTGPS-RFNISEDSPTGTRVGQLTATDRDIGPNGAVTYAIISGNQGNSFQLDPRSGILSVRST-LDRETIPSYTLVVKASDAGSPQQSITASIHVSVLDVNDNAPRFEKSLFSGEIRE--DASVHSTVL-QVKVEDKDEGSNGAITLSLSGEGSDNFTID-STGFVLSKTPLDYETTAAYQLTVTARDGGSPS 976          

HSP 5 Score: 197.208 bits (500), Expect = 4.336e-51
Identity = 178/593 (30.02%), Postives = 282/593 (47.55%), Query Frame = 2
Query:  428 YSI-EGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDET--LITVLINSNSDPEVKRHFQVSAISG-LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTY-LLANN--KYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKD 2185
            YSI +G D+G F +    +   I  T + FDRE   RY L  +A D       G   + I ++D ND+APEF +   YV  ++E+    +++  +  TD+D  T   IT  + S      +  F +++ +G +  ++ LD+E+    +T+ + A D    + T    ITV+  D+NDN P   +     S     + E+    S V  +T  D D  +N            + ++ L+S   + F    +   I T   FDRET + Y+V ++ +D G P  S Q T+ I I D NDN P FS   +   + E++  G+ + T+ A+D D G NA + Y       N     +  TG+VT   S D E  +S        D  +P L  +  + + + D ND  P+F  SAY  ++KE       +V A D DS++N  ++F       + ++ +     I S      D E ++ Y LTV+A+D GVP +  +  V I +ED+ND+SP FS    S Y K+I E+ V G+ +  V ATD D    G++ Y L++ N    F ID  SG + ++  LDR       L + A+D
Sbjct:    1 YSIMDGNDQGMFTI--DSSTGSITTTGRKFDRESESRYRLTVLAQDAANRCHKGRTVVVIDVKDENDNAPEFPL-NSYVFNIRENT-PAAQVAIVTATDRDSGTNAAITYSLFSG-----ENKFMMNSKTGEIRTVTPLDHETK-DSYTMRISAFDG--KHTTFVPLITVD--DVNDNAPFFAL-----SVYKTGVYEDVAVGSIVRQLTAVDLDVGINA-----------RLSYSLVSGDTSYFTVDSQGV-IRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTSGNTNHAFTLDAVTGVVTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKENTPAGT-QVSATDRDSSTNGALVFGIIKGNDDGVFTIDGSTGIIS-IAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFSP---SNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLISGNVKGAFNIDANSGSIRVSSELDRETTPSYSLQVEARD 557          

HSP 6 Score: 193.741 bits (491), Expect = 4.823e-50
Identity = 175/615 (28.46%), Postives = 282/615 (45.85%), Query Frame = 2
Query:  383 LSPRDSDYGINSEIIYSI-EGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKD---DETLITVLINSNSDPEVKRHFQVSAISG-LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGY--SGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNKY---FIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTP 2197
            ++  D+D G N +I YSI  G +   F + +         T    DRE    Y L   A D  + +      + I I D ND+ P F  P  +   + ED+  G+++  +  TD+D   +  +   +I+ N        FQ+   SG L++ S LD E+ +  +T+ V A D G P  + + +I V+VLD+NDN P+      S      ++ E+    S V  V V D D   NG +  +L       NF + S  F           +++    D ET + Y++TV  +D G P  S+   + I I + NDN PSF        I E++   + +  L ATD D      + + I E         + S+G+++     DRE   + T    A +  +   +     T+ + D ND  P+F   +Y   + E       V KV A D D   N+ + +  +    +   +  + G + +++   LDRE Q++Y L V A D+G PS+S+   + + + D+NDNSP+FSQ   S Y   +TE    G+ I +V+A+D D   NG+VTY + +  +   F ID  +G + +   +DR  L    L I AKD+G P
Sbjct:  707 VTATDADSGANGKISYSILSGNENMAFAMDRFTGE---ITTRVPLDRETIASYSLTINADDGSLVRFMAATTVNISIADENDNQPTFTGPSRF--NISEDSPTGTRVGQLTATDRDIGPNGAVTYAIISGNQ----GNSFQLDPRSGILSVRSTLDRET-IPSYTLVVKASDAGSPQQSITASIHVSVLDVNDNAPRFEKSLFSG-----EIREDASVHSTVLQVKVEDKDEGSNGAITLSL-SGEGSDNFTIDSTGF-----------VLSKTPLDYETTAAYQLTVTARDGGSPSKSATAQVKITIINVNDNVPSFVSPAQVTSIPEDVAINTHVVKLNATDSD---GTPLTFDIVEGNAGSSFKIDQSSGLISVAKRLDRETTANYTLVVRATETGSQGESVYNNATIRVLDVNDNAPVFNPGSYAKSLHENLPIGQTVAKVTATDRDEGENAKVTYELSVGDTSKFEVNPATGLVTTKR--PLDREDQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFSQ---SKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISGNHGNAFRIDSTTGRITVVGVVDREALASYNLTISAKDSGVP 1286          

HSP 7 Score: 184.882 bits (468), Expect = 2.628e-47
Identity = 163/559 (29.16%), Postives = 266/559 (47.58%), Query Frame = 2
Query:  383 LSPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKD---DETLITVLINSNSDPEVKRHFQVSAISGLTLISR-LDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGY--SGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDD 2041
            ++  D D G N+++ YSI   D   F +  M     +    K  +RE    Y L   A+D+G P  T + ++ + + D+ND+ P F+  + Y+  V+E++ + + +  +   D D   +  L   +I+ N     ++ F++++ SG+ + +  LD+E    ++ + V A D+     T  T +T+ V+++ND  P       + S     + EN P  + V  V+ +D DS   G +  +++   +   F +           +R+  I T    DRE +S Y + V+  D G PPLS+   +TI I DENDN P F    +   I EN  P S  F L ATD D G NA+I Y +      +I     S+G++T     DRE  ++      A D   P   SS+ + + + D ND  P+  SS+    ++E       V ++ A D D+  N+++ FS     H  ++ L +     S K + LDRE Q+ Y L +   D G PS SS   V I + D +DN P+F QP +  Y   I+E+L  G  I +V A D D
Sbjct: 1330 VTATDRDEGSNAQVFYSIVRGDTSAFAINAMNG---VLTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFN-SQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGND----EKRFKINSTSGVIMTTTPLDFEEK-SQYGLEVTATDS---KYTAKTNVTIRVINLNDITPAFTQQNYTAS-----VRENSPTSTSVVKVSASDRDSF--GSLSYSIVGGKDSDKFSI----------DQRSGIISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFKLAATDADEGTNARITYNLSRNDAFMI---GASSGVITLAQPLDRENKSTYDLAIQARDHGTPPQASSITIRVTVIDINDHRPLINSSSLRGSVRENQPKETHVMRILASDADTGLNAELTFSLLSNEHKSVFTLDNTTGDISTK-VPLDREQQAVYTLRIGVADKGNPSLSSVADVIIDVIDEDDNCPRF-QPTE--YNVTISESLPRGASIVQVTARDID 1852          

HSP 8 Score: 161.384 bits (407), Expect = 4.706e-40
Identity = 161/617 (26.09%), Postives = 289/617 (46.84%), Query Frame = 2
Query:  377 IKLSPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITV---LINSNSDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQI-PEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGY--SGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNKY---FIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPS 2200
            +++   D D G N  + YSI   + G     ++ +       + + DRE    Y L   A D G+P       + I + D ND++P F    +   G+ E    GS++  +  TD+D+ +   V   ++  ++       F ++A++G+  + +     ++  +T+ + A D G P +T+   +TV V D+NDN P       +  S    + EN  + + V  V   D+D   N ++  ++I  N+++ F++         NS     I+T    D E  S Y + V   D      +++  +TI + + ND  P+F++  +   ++EN    + +  + A+D D      + Y I   K  +  SI   S GI++     DRE+ +    +    D  NP L++   VT++I DEND  P F SS+Y   I E    S +  K+ A D D  +N+ I ++ +   ++   I  S G I   +   LDRE +STY L ++A+D+G P ++SS+ +++ + DIND+ P  +    S     + E     T + +++A+D D   N ++T+ L +N++   F +D  +G++     LDR +     L I   D G PS
Sbjct: 1223 LRVLASDPDAGANGRVTYSIISGNHG--NAFRIDSTTGRITVVGVVDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIF-ASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGDT-----SAFAINAMNGVLTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPP-----VFNSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGNDEKRFKI---------NSTSGV-IMTTTPLDFEEKSQYGLEVTATDS---KYTAKTNVTIRVINLNDITPAFTQQNYTASVRENSPTSTSVVKVSASDRD--SFGSLSYSIVGGKDSDKFSIDQRS-GIISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFKLAATDADEGTNARITYNLS--RNDAFMIGASSGVITLAQ--PLDRENKSTYDLAIQARDHGTPPQASSITIRVTVIDINDHRPLINS---SSLRGSVRENQPKETHVMRILASDADTGLNAELTFSLLSNEHKSVFTLDNTTGDISTKVPLDREQQAVYTLRIGVADKGNPS 1803          

HSP 9 Score: 107.842 bits (268), Expect = 1.428e-23
Identity = 107/347 (30.84%), Postives = 160/347 (46.11%), Query Frame = 2
Query:  377 IKLSPRDSD-YGINSEIIYSI-EGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLIN-SNSDPEVKRHFQVSAISG-LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPD 1405
            +K+S  D D +G    + YSI  GKD   F + Q      I  T  + DRE    Y +    TD G P  +    + IKI D ND++P+FD        + E++   S    +  TD D+ T   +  N S +D      F + A SG +TL   LD E+    + + + A D+G P   +S TI V V+DIND+ P I     + SS    + EN+PKE+ V  +  +DAD+ +N  +  +L+   +K  F L                I T    DRE  + Y + +   D+G P LSS   + I + DE+DN P F    +   I E++  G+ I  + A D D
Sbjct: 1534 VKVSASDRDSFG---SLSYSIVGGKDSDKFSIDQRSG---IISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSS-ILENSAPSSFSFKLAATDADEGTNARITYNLSRNDA-----FMIGASSGVITLAQPLDRENK-STYDLAIQARDHGTPPQASSITIRVTVIDINDHRPLI-----NSSSLRGSVRENQPKETHVMRILASDADTGLNAELTFSLLSNEHKSVFTL----------DNTTGDISTKVPLDREQQAVYTLRIGVADKGNPSLSSVADVIIDVIDEDDNCPRFQPTEYNVTISESLPRGASIVQVTARDID 1852          
BLAST of protocadherin-1 vs. Ensembl Nematostella
Match: EDO35412 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLK9])

HSP 1 Score: 219.935 bits (559), Expect = 2.574e-58
Identity = 203/625 (32.48%), Postives = 284/625 (45.44%), Query Frame = 2
Query:  395 DSDYGINSEIIYSI-EGKDKGFFKLLQMK---NNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISGLTLI------------SRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLM-ENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNF--ELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYS--GWVGKVEAYXXXXXXXXXIIF--SFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLA---NNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNG 2191
            D D G N  + Y+I  G +   F L        +     T K  DRE  D Y+L   ATD+G P   G   I I I D NDHAP F     Y+  + E+   G  I  +   D+D          S S+ ++K      AI   ++               LD+E     +T  VIA D G+P+     T+T+NVLD NDN PQ+ I  L   + +  +  EN    + +A + VTD DS  N   +  +   +++  F  E +  YF           I   +  DRE +  Y +T+   D+G+P  S+   + I + D NDN P+F+   +   I E    GS +  L ATDPD G N  + Y I           +  +G+VT     DRE  +S+T    A D  +     S  VT+ I D ND  P F+ S+Y   I EG S    V +V A D DS  N  I +  S +    N L+ L +   +   K  QLDRE +S Y  TV AKD+G P   SSV V++ + DINDN+P F  P++  Y   I E   PG L+ +V ATD DE  N  ++Y +    NN  F ID  +G +    +LD        L+I AKD G
Sbjct:  121 DPDAGNNGTVDYTIASGDNTATFSLGTTACPTGSTLCVITKKPLDRETTDFYQLNITATDRGTPALMGYCLINITILDENDHAPVFTQ-NSYLGSIAENTKPGVSILRVSAADRD----------SGSNGDIKYAIDWDAIQSNSIFDLDSSTGVIRTKQNLDFEVK-NSYTFNVIASDGGVPSKNDLATVTINVLDTNDNSPQLKITYLPPHNGDKAIRSENSLINTNIAYILVTDKDSNTNSQTELKITNGDDEGCFKVEFLGFYF-----------IQLQKPLDRELVPFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAFTSNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYSITGGNDLGWFQVDFQSGLVTTAKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMKSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEISSSDAQVNGLFELNTQTGVLWTKS-QLDRETKSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVF-YPVE--YFASIMENEPPGKLL-QVTATDADEGTNAVISYDIIGGNNNGNFSIDSSTGVISTLASLDHEVEEFFSLIISAKDGG 717          

HSP 2 Score: 188.734 bits (478), Expect = 1.696e-48
Identity = 170/614 (27.69%), Postives = 288/614 (46.91%), Query Frame = 2
Query:  377 IKLSPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDM----PKDYVIGVK-EDAIEGSKICDIKVTDKDDET-LITVLINSNSDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISI--PNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGY-SGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANN---KYFIIDEKSGEVFINRTLDRLELVPRRLLIMAK 2182
            +++S  D D G N +I Y+I+        +  + ++  + +T +  D E ++ Y    IA+D G+P K     + I + D ND++P+  +    P +    ++ E+++  + I  I VTDKD  T   T L  +N D E     +      + L   LD E  +  + + +   D G+P+ +T   + ++V D+NDN P    +  + + S  +L +N    S+V  +  TD D   NG V  ++   N+   F++      +F    ++  + T +  DRE +S   +T+  +D G  P +   T+T+ I D NDN P F K  ++  I E    G+ +  + ATD D G N +I Y+I      +  +   N  TG++      DRE  +  +F   A D  +P L SSV+V L I D ND  P+F    Y   I E    G + +V A D D  +N+ I +   G  +N  + + S   + S     LD EV+  + L + AKD G    + + +V + + +  DN P F   L   Y   + E +  GTL+ +V AT  D  +NG ++Y + +      F++D   G + IN  +DR E     L ++A+
Sbjct:  226 LRVSAADRDSGSNGDIKYAIDWDAIQSNSIFDLDSSTGVIRTKQNLDFEVKNSYTFNVIASDGGVPSKNDLATVTINVLDTNDNSPQLKITYLPPHNGDKAIRSENSLINTNIAYILVTDKDSNTNSQTELKITNGDDEGCFKVEFLGFYFIQLQKPLDREL-VPFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAFTSNAYTANIS--ELAQNG---SYVLQLNATDPDEGDNGTVSYSITGGNDLGWFQV------DF----QSGLVTTAKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMKSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEISSSDAQVNGLFELNTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVFYPVEYFASIMENEPPGKLLQVTATDADEGTNAVISYDIIGGNNNGNFSIDSSTGVISTLA-SLDHEVEEFFSLIISAKDGGNKYAAKTAVVNVTVLNKADNLPVF---LYEMYNFTVYENVPKGTLVGRVYATTKD--KNGSISYAIVSGDPTNLFLVDSTGGIIKINGDMDREEKAQYLLAVIAR 817          

HSP 3 Score: 170.629 bits (431), Expect = 6.070e-43
Identity = 160/603 (26.53%), Postives = 270/603 (44.78%), Query Frame = 2
Query:  377 IKLSPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITV---LINSNSDPEVKRHFQVSAISG-LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLR-EFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNS--SVEVTLEIEDENDCIPMFLSSAY--HFKIKEGYSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTY-LLANNKYFIIDEKSGEVFINRTLDRLELV 2155
            +++S  D D G N  I Y I   D     L ++     +  T    DRE +  Y    +A D G P+    +K+ + I D+ND+AP F  P +Y   + E+   G K+  +  TD D+ T   +   +I  N++     +F + + +G ++ ++ LD+E     F++ + A D G      +  + V VL+  DN P  + +       NF + EN PK + V  V  T  D              N   ++ ++S    N         I+ +  + DRE  + Y + V  +   + PLS+Q T+ I + D NDN P FS       I    + G  ++   A D D GKN  + YQ+    + ++ I N ++G++           T  T +  A D  +P  +S  ++ +TL I       P F  S+Y  H    +  S     V A D DS  N  + +S        L+ +   G ++  K   L + ++ +Y L V A D GVPS S+SV V I ++D ND+   F   +++ +   + E   PGTL+  ++A   D +    + Y L+++  +F +D +SG++     LDR EL+
Sbjct:  550 LQVSATDVDSGDNGRITYEISSSDAQVNGLFELNTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVF-YPVEYFASIMENEPPG-KLLQVTATDADEGTNAVISYDIIGGNNN----GNFSIDSSTGVISTLASLDHEVE-EFFSLIISAKDGGNKYAAKTAVVNVTVLNKADNLPVFLYEMY-----NFTVYENVPKGTLVGRVYATTKDK-------------NGSISYAIVSGDPTNLFLVDSTGGIIKINGDMDREEKAQYLLAVIARVGTVKPLSAQATVNIEVLDRNDNAPQFSTSSVIVDIDGTWLVGQVVYNAAAVDLDAGKNGLVRYQLTSNAEGLLWI-NSTSGVIKLARKLTDGDETQYTVQVLASDSGSPPQHSTMTIHITLSINHP----PKFTLSSYVTHVLASQPLSYQFFYVVAVDQDSGKNGQLFYSIPQGNEEGLFGIFPGGKLYIRK--SLLQALKGSYDLIVRATDGGVPSFSASVPVTIYIQDSNDHRSLF---VNNTFRFAVAENSSPGTLVGTLVAHALDHSRTKDIVYSLISSESHFAVDVRSGQITTRVRLDREELI 1117          

HSP 4 Score: 149.828 bits (377), Expect = 1.864e-36
Identity = 150/547 (27.42%), Postives = 240/547 (43.88%), Query Frame = 2
Query:  596 IYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIY----QIPEKYQNIISIPNPSTGIVTNLVSFDREM----NTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNKY---FIIDEKSGEVFINRTLDRLELVPR-RLLIMAKDNGTPS 2200
            + + + DLND+AP F     Y I V E ++ GS +  IK  D D+        +  S   + + F  S+   L L   LD E++   + + V A D    NL ++  I + V D ND  P        +S     + E+    S V  +  +D D   NG++  ++   N    F++ S             R++  +  D ET   Y +T+  +D GL PLSS   +T+ + D NDN P F        ++EN+  G P+    A+D D G NA I +    Q P K  ++    N +T  +T + + D E       S      A D+ +P L++   +T+++ DEND  P F+S         G S  V  + A D D NSN  + +S     + +  +  S G +   + I    +  + YQLT++A D G PSR +  +V +  E      P FS    + Y   +TE  V GT +  V+A     + NG + Y L ++     F + + +G V   R +DR  +     L++ A D   PS
Sbjct: 1145 VIVTVTDLNDNAPVFSRAV-YAITVSELSLPGSPVFRIKAMDADEGDNAKFFYSLVSGTGMDKFFINSSTGELHLSKTLDRETT-SSYNLVVKATDASNANLYSTAKIEITVGDSNDQRP-----VFPESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSISNGNLAAMFDVESA----------TGRLIVAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAPLFPTQPVTLTVRENVNTGFPVGRCTASDRDTGTNAHIAFSMYSQTPSKTFSV----NSATCEITTIAAIDLETMPAGRDSFQLVVMATDQGSPKLSTRKSITVQVTDENDNSPGFVSPP---AAAAGSSLNVMTITAEDPDRNSNGKVTYSIISGNNGYFNLHPSTGQL---QMIHQIPDNPTIYQLTIQASDGGQPSRQTQTVVSVFKEGPIGGGPTFSS---ADYQGSVTENKVAGTSVVTVLAAYPQSSLNGNIEYYLTSDSSKGGFEVVKSTGVVKTTRGIDREGMGASFNLVVYAVDKQGPS 1661          

HSP 5 Score: 146.747 bits (369), Expect = 1.510e-35
Identity = 176/625 (28.16%), Postives = 267/625 (42.72%), Query Frame = 2
Query:  395 DSDYGINSEIIYSI-EGKDKGFFKLLQMKNNKPIFKTMKLFDREE-----RDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDD---ETLITVLINSNSDPEVKRHFQVSAISG-LTLISRLDYESSMRKFTIPV-IAVDNGIPNLTT----STTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGY-SGW-VGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDG-NIFSEKGIQLDR--EVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTY--LLANNKYFIIDEKSGEV-FINRTLDRLELVPRRLLIMAKDNGTPS 2200
            D D G N ++ YSI +G ++G F          IF   KL+ R+      +  Y+L+  ATD G+P  +  + + I I+D NDH   F +   +   V E++  G+ +  +     D    + ++  LI+S S      HF V   SG +T   RLD E  ++     V I     + N TT       + V V D+NDN P       S +     + E     S V  +   DAD   N     +L+       F         F NS     +   +  DRET S Y + V+  D     L S   I I + D ND  P F +  +   I E+ + GS +  L A+D DIG+N  I Y I       +     +TG +    S D E          A D     L+S+V VT+ + D ND  P+F +      ++E   +G+ VG+  A D D+ +N+ I FS      +  + + S    I +   I L+     + ++QL V A D G P  S+   + +Q+ D NDNSP F  P  +     +         +  + A D D N NGKVTY  +  NN YF +   +G++  I++  D   +   +L I A D G PS
Sbjct:  972 DQDSGKNGQLFYSIPQGNEEGLFG---------IFPGGKLYIRKSLLQALKGSYDLIVRATDGGVPSFSASVPVTIYIQDSNDHRSLF-VNNTFRFAVAENSSPGTLVGTLVAHALDHSRTKDIVYSLISSES------HFAVDVRSGQITTRVRLDREELIKNTGSNVYIMQAEAMYNDTTIKRDKAIVIVTVTDLNDNAP-----VFSRAVYAITVSELSLPGSPVFRIKAMDADEGDNAKFFYSLVSGTGMDKF---------FINSSTG-ELHLSKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFPESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSISNGNLAAMFDVESATGRLIVAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAPLFPTQPVTLTVRENVNTGFPVGRCTASDRDTGTNAHIAFSMYSQTPSKTFSVNSATCEITTIAAIDLETMPAGRDSFQLVVMATDQGSPKLSTRKSITVQVTDENDNSPGFVSPPAAAAGSSLN--------VMTITAEDPDRNSNGKVTYSIISGNNGYFNLHPSTGQLQMIHQIPDNPTI--YQLTIQASDGGQPS 1555          

HSP 6 Score: 134.42 bits (337), Expect = 1.011e-31
Identity = 145/535 (27.10%), Postives = 239/535 (44.67%), Query Frame = 2
Query:  380 KLSPRDSDYGINSEIIYSI---EGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKD--DETLITVLINSNSDPEVKRHFQVSAISGLTLISR-LDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETI----SHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSP--IFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSF-DREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKE---GYSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDRE-VQSTYQLTVEAKDNGVPS-RSSSVIVQIQLEDIN 1930
            ++   D+D G N++  YS+    G DK FF    + ++       K  DRE    Y LV  ATD          KI I + D ND  P F    DY + + EDA+ GS + ++  +DKD     LI   I   S+  +   F V + +G  ++++ LD+E++ + + + + A D+G+  L+++  +TVNVLD+NDN P      ++       + EN      V   T +D D+  N  +  ++      + F + S              I T+   D ET+      +++ V   DQG P LS++++IT+ + DENDN P F               GS   + T+ A DPD   N K+ Y I        ++ +PSTG +  +    D      +T +A   D   P   +   V++  E      P F S+ Y   + E     +  V  + AY   S + +   +  +        ++KS G + + +GI  DRE + +++ L V A D   PS R+SS  V I ++D+N
Sbjct: 1180 RIKAMDADEGDNAKFFYSLVSGTGMDK-FF----INSSTGELHLSKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFP-ESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSI---SNGNLAAMFDVESATGRLIVAKSLDFETT-QLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAPLFPTQPVT-----LTVRENVNTGFPVGRCTASDRDTGTNAHIAFSMYSQTPSKTFSVNSA----------TCEITTIAAIDLETMPAGRDSFQLVVMATDQGSPKLSTRKSITVQVTDENDNSPGFVS-------PPAAAAGSSLNVMTITAEDPDRNSNGKVTYSIISGNNGYFNL-HPSTGQLQMIHQIPDNPTIYQLTIQAS--DGGQPSRQTQTVVSVFKEGPIGGGPTFSSADYQGSVTENKVAGTSVVTVLAAYPQSSLNGNIEYYLTSDSSKGGFEVVKSTGVVKTTRGI--DREGMGASFNLVVYAVDKQGPSARTSSATVTITVQDVN 1677          

HSP 7 Score: 129.413 bits (324), Expect = 3.552e-30
Identity = 116/421 (27.55%), Postives = 182/421 (43.23%), Query Frame = 2
Query:  371 LSIKLSPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISGLTLISRLDYE---SSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDRE-MNTSITFKAFALDEFNP-LLNSSVEVTLEIEDEN 1618
            L I L+  D D G N  I YSI   +     +  +++        K  D E    YEL   A D G+   +  + + + + D+ND+AP F   +   + V+E+   G  +     +D+D  T   +  +  S    K     SA   +T I+ +D E   +    F + V+A D G P L+T  +ITV V D NDN P  V    + + S+  +M           +T  D D   NG V  ++I  NN         YFN  P++ +   I  +   D  TI  Y++T+Q  D G P   +Q  ++++ E      P+FS   +Q  + EN + G+ + T++A  P    N  I Y +             STG+V      DRE M  S     +A+D+  P    SS  VT+ ++D N
Sbjct: 1282 LVINLNASDKDIGQNGLIKYSI--SNGNLAAMFDVESATGRLIVAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAPLFPT-QPVTLTVRENVNTGFPVGRCTASDRDTGTNAHIAFSMYSQTPSKTFSVNSATCEITTIAAIDLETMPAGRDSFQLVVMATDQGSPKLSTRKSITVQVTDENDNSPGFVSPPAAAAGSSLNVM----------TITAEDPDRNSNGKVTYSIISGNNG--------YFNLHPSTGQLQMIHQIP--DNPTI--YQLTIQASDGGQPSRQTQTVVSVFKEGPIGGGPTFSSADYQGSVTENKVAGTSVVTVLAAYPQSSLNGNIEYYLTSDSSKGGFEVVKSTGVVKTTRGIDREGMGASFNLVVYAVDKQGPSARTSSATVTITVQDVN 1677          

HSP 8 Score: 107.842 bits (268), Expect = 1.213e-23
Identity = 153/620 (24.68%), Postives = 255/620 (41.13%), Query Frame = 2
Query:  449 KGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKE--DAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISGLTL--ISR--LDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNG----IVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFF----QDRI--KENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQN-----------IISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKE--GYSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSD---GNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLAN-----NKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTP 2197
            +G  K     +N  +  T    DRE   +  L      + +      I + +++ D+ND+ P F     Y + ++E  D    + I      D  +   +   I S  +         +  +G TL  I++  LD E++   + + + A D G P L     I + +LD ND+ P       + +S    + EN      +  V+  D DS  NG     +D + I+ N+   F+L S              I T +  D E  + Y   V   D G+P  +   T+TI + D NDN P     +      D+    EN +  + I  ++ TD D   N++   +I                  I +  P           DRE+           D+  P  ++   V +++ D ND  P F S+AY   I E      +V ++ A D D   N  + +S TG   N L   + D   G + + K   LDRE  S+  +T+ A+D+G   ++ S  V + + D NDN P+F   + S Y   I+E    G  + +V ATD D  +NG++TY +++     N  F ++ ++G ++    LDR         ++AKD+G P
Sbjct:   36 EGSPKQFGFNSNTGVISTTARIDRETTTQISLQL----RTLNPSNQPISVQVQVDDINDNEPRFPTLY-YTLRIRESMDVNTTNPINTATDPDAGNNGTVDYTIASGDNTATFSLGTTACPTGSTLCVITKKPLDRETT-DFYQLNITATDRGTPALMGYCLINITILDENDHAP-----VFTQNSYLGSIAENTKPGVSILRVSAADRDSGSNGDIKYAIDWDAIQSNSI--FDLDSS----------TGVIRTKQNLDFEVKNSYTFNVIASDGGVPSKNDLATVTINVLDTNDNSPQLKITYLPPHNGDKAIRSENSLINTNIAYILVTDKDSNTNSQTELKITNGDDEGCFKVEFLGFYFIQLQKP----------LDRELVPFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAFTSNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYSITG--GNDLGWFQVDFQSGLVTTAK--PLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRF---MKSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEISSSDAQVNGLFELNTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDP 615          

HSP 9 Score: 98.5969 bits (244), Expect = 9.549e-21
Identity = 113/363 (31.13%), Postives = 159/363 (43.80%), Query Frame = 2
Query: 1175 IVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKE--NIMPGSPIFTLIATDPDIGKNAKIIYQIPEK------YQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGWVG--KVEAYXXXXXXXXXIIFS--FTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFS---QPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANN---KYFIIDEKSGEVFI--NRTLDRLELVP-RRLLIMAKDNGTPS 2200
            I T    DRET +   + ++  +    P+S Q    + ++D NDN P F   ++  RI+E  ++   +PI T  ATDPD G N  + Y I              + P  ST  V      DRE          A D   P L     + + I DEND  P+F  ++Y   I E     V   +V A D DS SN DI ++  +     N ++ L S   +   K   LD EV+++Y   V A D GVPS++    V I + D NDNSP+      P  +G     +E  +  T I  ++ TD D N N +    + N      F + E  G  FI   + LDR ELVP   L +   D G PS
Sbjct:   51 ISTTARIDRETTTQISLQLRTLNPSNQPISVQ----VQVDDINDNEPRFPTLYYTLRIRESMDVNTTNPINT--ATDPDAGNNGTVDYTIASGDNTATFSLGTTACPTGSTLCVITKKPLDRETTDFYQLNITATDRGTPALMGYCLINITILDENDHAPVFTQNSYLGSIAENTKPGVSILRVSAADRDSGSNGDIKYAIDWDAIQSNSIFDLDSSTGVIRTKQ-NLDFEVKNSYTFNVIASDGGVPSKNDLATVTINVLDTNDNSPQLKITYLPPHNGDKAIRSENSLINTNIAYILVTDKDSNTNSQTELKITNGDDEGCFKV-EFLGFYFIQLQKPLDR-ELVPFYNLTLNVTDKGVPS 404          
BLAST of protocadherin-1 vs. Ensembl Nematostella
Match: EDO34815 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN97])

HSP 1 Score: 197.978 bits (502), Expect = 2.853e-52
Identity = 186/626 (29.71%), Postives = 284/626 (45.37%), Query Frame = 2
Query:  377 IKLSPRDSDYGINSEIIYSI-EGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKI-YIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKI---CDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISGL--TLIS---RLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLR-EFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKI--KEGYSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLT-----VEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTY-LLANNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTP 2197
            + ++  D+D G N+ + YS+  G   G F+ +   +N    +     DRE  D Y L   ATD G+P     I I  ++I D ND+ P+F   + Y   ++E++  G  +     I  TD+D E+   V    N    ++  F V+  +G+  T +S    LD+E +   +T  VIA D       +   + ++VLD NDN P+ +      SS    + E       VA VT  D DS +NG +  + I   ++  FE+            R+  +V +    DRE  + Y + V   D    P     T+T+ ++D NDN P F+K  F   + E +  GS I    ATDPD G NA I Y +      I    N +TG VT     DRE   + +F   A D     L S+V V +EI DEND  P F +  Y   +  +      V  V A D D  +N  + ++    L     I+   GNI +    +LDRE QS Y L      +   D+GV   +S  ++ I + D NDN P+F+Q   S Y   + E +  GT +T V A D+D   N ++ Y L   +  F I+  +G++ + + ++R       + I A D GTP
Sbjct:  134 LDVTATDADSGQNAYVTYSVTAGDSHGLFRAVTKVSNHGTIEVAGNLDREVNDFYNLTITATDGGVPISRTAIAIALVRILDRNDNVPKFSHAR-YTGSIQENSGPGVPVQMASSIMATDRDIESNADVRYRLNGSDSIQ--FAVNPRTGVITTRVSPPPSLDHERTT-NYTFHVIAADQAGTGHESLAEVVIHVLDANDNTPRFI-----PSSIQSTISEAASIGQSVARVTANDPDSGLNGRIFFS-INSGSEGKFEI-----------GRSDGVVRVSGSLDREAKAVYVLNVSAIDGSYSPREGYGTVTVTLQDVNDNTPKFTKPAFNVDVSEGVAVGSVIVNATATDPDQGSNAAITYSMSYPGFAI----NSNTGSVTITRPLDRETKQAYSFTVHARDGGG--LESNVAVNVEIGDENDNSPQFPTVQYQTDVIDRTPVGTIVLAVNAEDRDVGNNGHVTYA---ILILPFIIVPDTGNINTSS--KLDREQQSLYTLVHYVLNLSVTDHGVTQFTSFALLNISVTDFNDNQPQFNQ---SEYSATVLENMPVGTKVTMVTARDEDSGINSQIMYSLTGGDGVFSIEPSTGQIRLQKAINREAKENYHVTITASDRGTP 724          

HSP 2 Score: 189.504 bits (480), Expect = 1.593e-49
Identity = 155/518 (29.92%), Postives = 239/518 (46.14%), Query Frame = 2
Query:  680 AIEGSKICDIKVTDKDDETLITV---LINSN-SDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTIT-IWIEDENDNPPSFSKFFFQDRIKENIMPGSPI---FTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVS----FDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYS--GWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNG 2191
            +  G  I  +K TD DD     V   +++ N  DP     F +   +G+   +R         + + + A D+G+P+ + +T +++ V D+NDN P       + ++ +  + EN P  + +  VT TDADS  N  V  ++   ++   F  +++  N+         I      DRE    Y +T+   D G+P   +   I  + I D NDN P FS   +   I+EN  PG P+    +++ATD DI  NA + Y++     +I    NP TG++T  VS     D E  T+ TF   A D+      S  EV + + D ND  P F+ S+    I E  S    V +V A D DS  N  I FS          I +SDG +    G  LDRE ++ Y L V A D     R     V + L+D+NDN+PKF++P    +   ++E +  G++I    ATD D+  N  +TY ++    F I+  +G V I R LDR         + A+D G
Sbjct:   17 STRGVLIATVKATDSDDGANGDVDYSIVDGNVGDPRSNSDFTLDPNTGMIKTARNLERQQTFSYNLTIGAADHGLPSFSATTRVSIVVGDLNDNNP-----VFNPTNYSTTVFENSPVGTSLLDVTATDADSGQNAYVTYSVTAGDSHGLFRAVTKVSNHG-------TIEVAGNLDREVNDFYNLTITATDGGVPISRTAIAIALVRILDRNDNVPKFSHARYTGSIQENSGPGVPVQMASSIMATDRDIESNADVRYRL-NGSDSIQFAVNPRTGVITTRVSPPPSLDHERTTNYTFHVIAADQAGTGHESLAEVVIHVLDANDNTPRFIPSSIQSTISEAASIGQSVARVTANDPDSGLNGRIFFSINSGSEGKFEIGRSDG-VVRVSG-SLDREAKAVYVLNVSAIDGSYSPREGYGTVTVTLQDVNDNTPKFTKP---AFNVDVSEGVAVGSVIVNATATDPDQGSNAAITYSMS-YPGFAINSNTGSVTITRPLDRETKQAYSFTVHARDGG 515          

HSP 3 Score: 154.836 bits (390), Expect = 1.820e-38
Identity = 165/627 (26.32%), Postives = 255/627 (40.67%), Query Frame = 2
Query:  368 RLSIKLSPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKL-----FDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISGLTLIS-RLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIP---NPSTGIVTNLVSFDREMNTSITFKAFAL-----DEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGY--SGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITE-TLVPGTLITKVMATDDDENENGKVTYLLANNK--YFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNG 2191
            +++  +   D D   N+++ Y + G D   F +    N +    T ++      D E    Y    IA D+         ++ I + D ND+ P F +P      + E A  G  +  +   D D      +  + NS  E K  F++    G+  +S  LD E+    + + V A+D          T+TV + D+NDN P+      +  + N  + E     S +   T TD D   N  +  ++  P               F  +     +   R  DRET   Y  TV  +D G   L S   + + I DENDN P F    +Q  + +    G+ +  + A D D+G N  + Y I       + +P    P TG +      DRE  +  T   + L     D       S   + + + D ND  P F  S Y   + E       V  V A D DS  NS I++S TG       I  S G I  +K I  +RE +  Y +T+ A D G P  SS   V + + D+NDN P F+  +   Y + ++E     G  + +V ATD D   NG VTY + +     F I+E +G +     L+R       L++MA+D G
Sbjct:  243 QMASSIMATDRDIESNADVRYRLNGSDSIQFAV----NPRTGVITTRVSPPPSLDHERTTNYTFHVIAADQAGTGHESLAEVVIHVLDANDNTPRF-IPSSIQSTISEAASIGQSVARVTANDPDSGLNGRIFFSINSGSEGK--FEIGRSDGVVRVSGSLDREAKA-VYVLNVSAIDGSYSPREGYGTVTVTLQDVNDNTPK-----FTKPAFNVDVSEGVAVGSVIVNATATDPDQGSNAAITYSMSYPG--------------FAINSNTGSVTITRPLDRETKQAYSFTVHARDGG--GLESNVAVNVEIGDENDNSPQFPTVQYQTDVIDRTPVGTIVLAVNAEDRDVGNNGHVTYAI-------LILPFIIVPDTGNINTSSKLDREQQSLYTLVHYVLNLSVTDHGVTQFTSFALLNISVTDFNDNQPQFNQSEYSATVLENMPVGTKVTMVTARDEDSGINSQIMYSLTGG-DGVFSIEPSTGQIRLQKAI--NREAKENYHVTITASDRGTPVLSSDAKVHVHVLDVNDNPPVFTSRV---YERTMSEGNAAAGEFVVQVNATDADVERNGHVTYTIMHGALGMFTINETTGVIRTQGVLNRESKDFYTLIVMARDQG 827          

HSP 4 Score: 154.451 bits (389), Expect = 2.094e-38
Identity = 168/599 (28.05%), Postives = 256/599 (42.74%), Query Frame = 2
Query:  395 DSDYGINSEIIYSIEGKDKGFFKL---LQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDD--ETLITVLINSNSDPEVKRHF-QVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTIT-VNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVT---VTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGWVGKV----EAYXXXXXXXXXIIF--SFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNKYFIIDEKSGEVFINRTLDR 2143
            DSD G N ++ YSI   + G  +      +  N  + KT +  +R++   Y L   A D G+P  +   ++ I + DLND+ P F+ P +Y   V E++  G+ + D+  TD D      +T  + +     + R   +VS    + +   LD E +   + + + A D G+P   T+  I  V +LD NDN P+      S +     + EN      V M +    TD D E N  V   L   ++ Q F +  R            R+      D E  ++Y   V   DQ      S   + I + D NDN P F     Q  I E    G  +  + A DPD G N +I + I    +    I   S G+V    S DRE          A+D           VT+ ++D ND  P F   A++  + EG +  VG V     A D D  SN+ I +  S+ GF  N      + G++   +   LDRE +  Y  TV A+D G     S+V V +++ D NDNSP+F       Y   + +    GT++  V A D D   NG VTY +    + I+ + +G +  +  LDR
Sbjct:   30 DSDDGANGDVDYSIVDGNVGDPRSNSDFTLDPNTGMIKTARNLERQQTFSYNLTIGAADHGLPSFSATTRVSIVVGDLNDNNPVFN-PTNYSTTVFENSPVGTSLLDVTATDADSGQNAYVTYSVTAGDSHGLFRAVTKVSNHGTIEVAGNLDREVN-DFYNLTITATDGGVPISRTAIAIALVRILDRNDNVPK-----FSHARYTGSIQENSGPGVPVQMASSIMATDRDIESNADVRYRLNGSDSIQ-FAVNPR------TGVITTRVSPPPSLDHERTTNYTFHVIAADQAGTGHESLAEVVIHVLDANDNTPRFIPSSIQSTISEAASIGQSVARVTANDPDSGLNGRIFFSINSGSEGKFEI-GRSDGVVRVSGSLDREAKAVYVLNVSAIDGSYSPREGYGTVTVTLQDVNDNTPKFTKPAFNVDVSEGVA--VGSVIVNATATDPDQGSNAAITYSMSYPGFAIN-----SNTGSVTITR--PLDRETKQAYSFTVHARDGG--GLESNVAVNVEIGDENDNSPQFPTVQ---YQTDVIDRTPVGTIVLAVNAEDRDVGNNGHVTYAILILPFIIVPD-TGNINTSSKLDR 598          

HSP 5 Score: 132.109 bits (331), Expect = 2.475e-31
Identity = 138/533 (25.89%), Postives = 238/533 (44.65%), Query Frame = 2
Query:  380 KLSPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISGLTLISR-LDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQI-VIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRE-----TISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSG---WVGKVEAYXXXXXXXXXIIFSFTGFLHNHL--WILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSP 1942
            +++  D D G+N  I +SI    +G F++ +      + +     DRE +  Y L   A D     + G   + + ++D+ND+ P+F  P  + + V E    GS I +   TD D  +   +   S S P     F +++ +G   I+R LD E+  + ++  V A D G   L ++  + V + D NDN PQ   +   +D      +++  P  + V  V   D D   NG V            + ++   F   P++     I T  + DRE     T+ HY + +   D G+   +S   + I + D NDN P F++  +   + EN+  G+ +  + A D D G N++I+Y +      + SI  PSTG +    + +RE   +      A D   P+L+S  +V + + D ND  P+F S  Y   + EG +    +V +V A D D   N  + ++    +H  L  + +     +   +G+ L+RE +  Y L V A+D G         + + + D NDN+P
Sbjct:  355 RVTANDPDSGLNGRIFFSINSGSEGKFEIGRSDG---VVRVSGSLDREAKAVYVLNVSAIDGSYSPREGYGTVTVTLQDVNDNTPKFTKPA-FNVDVSEGVAVGSVIVNATATDPDQGSNAAITY-SMSYPG----FAINSNTGSVTITRPLDRETK-QAYSFTVHARDGG--GLESNVAVNVEIGDENDNSPQFPTVQYQTD------VIDRTPVGTIVLAVNAEDRDVGNNGHV-----------TYAILILPFIIVPDTGN---INTSSKLDREQQSLYTLVHYVLNLSVTDHGVTQFTSFALLNISVTDFNDNQPQFNQSEYSATVLENMPVGTKVTMVTARDEDSGINSQIMYSLTGG-DGVFSI-EPSTGQIRLQKAINREAKENYHVTITASDRGTPVLSSDAKVHVHVLDVNDNPPVFTSRVYERTMSEGNAAAGEFVVQVNATDADVERNGHVTYT---IMHGALGMFTINETTGVIRTQGV-LNRESKDFYTLIVMARDQGAVPYMDFGTIDVHVIDKNDNTP 849          
BLAST of protocadherin-1 vs. Ensembl Nematostella
Match: EDO41767 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3G3])

HSP 1 Score: 189.889 bits (481), Expect = 1.190e-48
Identity = 177/613 (28.87%), Postives = 280/613 (45.68%), Query Frame = 2
Query:  377 IKLSPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISGLTLI-SRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGY--SGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLA---NNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTP 2197
            +++   D D G N  + Y++  KDK   +   +  +     T    DRE++  +E    ATD G  + T    +   + D+ND  P+F    +++  VKEDA+ G  +  I  TD+D  T +   I S  DP+ +  F +   +G+  +   LD E S+  + + + A D G+   T+   + +++ D NDN P   I T S    + K  EN P  S V  V  TDAD  +N            +  + +  + F  F   K N ++  L E DRET   Y   V   D G     S   I+I ++D NDN P FS+  +   + E+      +  + A D D+G N K+ Y +        +I    TGI++     +RE+  + T     +D   P L+S   V +++ + ND  P F  S YH  + E       V +V A   +S+++        G       I + +G I   +  +LD E    Y LTVEA D G P   S+  V+I + D NDN P+FS+     Y  K+ E    GT + +V ATD D   N ++ Y +A   + K F I E++G + ++  +DR E+   RL + A+D G P
Sbjct: 2776 LRVFAEDLDSGSNGMVTYALVSKDKLVKEKFDIDQHTGWITTRGALDREKQPSFEFQVRATDNGTTRLTSLTTVRAIVLDVNDTPPKFSQ-SEFMASVKEDALIGQSVTTITATDEDLNTELYYFILSG-DPQAR--FGIERKTGVIFVHGSLDRE-SVGSYDLNISASD-GL--FTSFAQMKIDIEDANDNPP---ICTQSIYVEHIK--ENTPLGSTVLTVGATDADVGVNA-----------ELTYSVFGQGFGTFAVDK-NGKMTNLVELDRETRPFYNFMVSAADIGGQACYSN--ISIHLDDVNDNRPLFSQSSYFTAVYEDAPLKKVLLQVKADDADVGVNRKLTYSLVTDAGGTFTIET-GTGIISLEKPLNRELKENYTLNVEVMDGGTPPLSSIATVQIKVLNINDVPPEFSHSIYHGNVSEDAPIGNEVVRVRAVSRESSNDVITYAILRGADSGLFSIDRKNGTIHVNR--KLDYETTKLYTLTVEASDAGPPVLRSTSYVRISVTDSNDNGPEFSEKR---YSAKVDENSALGTFVLQVFATDRDSGTNAQIKYSIAEGNDAKKFKIVEETGVIKVSGDIDREEVASYRLKVRAQDQGLP 3355          

HSP 2 Score: 163.696 bits (413), Expect = 1.365e-40
Identity = 164/577 (28.42%), Postives = 263/577 (45.58%), Query Frame = 2
Query:  497 KTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDET--LITVLINSNSDPEVKRHFQVSAISG-LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFV--AMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEG--YSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLL---ANNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTP 2197
            + +   D E R+RY ++  A    I  +     + +++ D+ND  P+F +   Y+  + E+   GSK+  +   D D  +  ++T  + S  D  VK  F +   +G +T    LD E     F   V A DNG   LT+ TT+   VLD+ND  P+          S  + M +  +++ +  ++ T+T  D ++N  +   ++  + +  F +           ++   I      DRE++  Y + +   D GL   +S   + I IED NDNPP  ++  + + IKEN   GS + T+ ATD D+G NA++ Y +    Q   +      G +TNLV  DRE      F   A D       S++ + L  +D ND  P+F  S+Y   + E       + +V+A D D   N  + +S          I    G I  EK   L+RE++  Y L VE  D G P  SS   VQI++ +IND  P+FS  +   Y   ++E    G  + +V A    E+ N  +TY +   A++  F ID K+G + +NR LD        L + A D G P
Sbjct: 2710 RVIGRLDYEIRNRYVMIVEANVSAI-NQIARTVVVVQVLDINDVTPKF-VSDPYLASIPENIDIGSKVLRVFAEDLDSGSNGMVTYALVSK-DKLVKEKFDIDQHTGWITTRGALDREK-QPSFEFQVRATDNGTTRLTSLTTVRAIVLDVNDTPPKF---------SQSEFMASVKEDALIGQSVTTITATDEDLNTELYYFILSGDPQARFGI----------ERKTGVIFVHGSLDRESVGSYDLNISASD-GL--FTSFAQMKIDIEDANDNPPICTQSIYVEHIKENTPLGSTVLTVGATDADVGVNAELTYSVFG--QGFGTFAVDKNGKMTNLVELDRETRPFYNFMVSAADIGGQACYSNISIHL--DDVNDNRPLFSQSSYFTAVYEDAPLKKVLLQVKADDADVGVNRKLTYSLVTDAGGTFTIETGTGIISLEK--PLNRELKENYTLNVEVMDGGTPPLSSIATVQIKVLNINDVPPEFSHSI---YHGNVSEDAPIGNEVVRVRAV-SRESSNDVITYAILRGADSGLFSIDRKNGTIHVNRKLDYETTKLYTLTVEASDAGPP 3250          

HSP 3 Score: 144.821 bits (364), Expect = 9.302e-35
Identity = 171/619 (27.63%), Postives = 261/619 (42.16%), Query Frame = 2
Query:  395 DSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPK--KTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSF--SKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQ-NIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDC---IPMFLSSAYHFKIKEGYSGWVGKVEAYXXXXXXX----XXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNK------YFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTP 2197
            D D G   EI +S+    + F     + +   + +  +  D E++  Y L    TDKG P      E+ + +   + N  AP F   +     + E++  G+ +   K TD+D   L   +I+      V +         +     LD+E +   + + V A D     L T+  + +N++D+ND  P       + S+    L EN P  S V  VT  D DS   G +    I   N+QN         NF    ++  I TLR  DRE  S Y++TV   D G PP+S+  T T+ I DENDN P F   ++      ++       ++ ++ATD DIG NA + Y I +  + N   I + S  I TN+   D E   S      A D   P L++S  V +++   N      P+F +  Y   I+E       ++ ++     +       I ++     H + + +   G  F      LDRE +S Y L VEA D      ++SV V I + D+NDNSP   QP    Y   + E    GTL+T V   D D   NG+V Y +           F I+  SG +   + LD   +    L I A D G P
Sbjct:  922 DPDSGPGGEIEFSLPESTRKF----NIDSKSGVIRLRQRLDFEQKSTYNLTVRVTDKGSPALFTDVEVVVNVLDVNENSLAPVFSGGRILETSINENSPVGTVVISPKATDQDSWYLKYAIIDGTG---VDKFIIDPDTGAIRTAGELDHEVA-DHYWLTVQAKDGESYPLYTNIPVLINIVDLNDEAPY-----FAPSTYYPVLAENLPSGSSVVQVTAKDPDS--GGSLLRYTITKGNEQN---------NFVIDPQSGLITTLRPLDREFKSEYKLTVSASDGGTPPVSTDVTFTVKITDENDNQPEFKEKQYVVGVFARQATSKSFGLYQVVATDEDIGSNADLRYSITKGNRDNKFIIDSRSGEIFTNVSLVDGE---SYDLTIVAEDNGLPKLSTSTNVLIDVIQGNKPSKNAPVFWNKQYSADIQEDK-----RINSFVLIIGAEDPDFDQITYNIASGNHGNKFTIDRYGG-FITVAHSLDREEKSFYSLRVEATDG---YNTASVPVTINILDVNDNSP---QPARREYRAHVAENSDVGTLVTTV--KDPDAGVNGEVEYCIVQTAKAESASLFKIESHSGRILTVKPLDYETMQEHVLTIKASDRGIP 1499          

HSP 4 Score: 140.198 bits (352), Expect = 2.175e-33
Identity = 182/620 (29.35%), Postives = 284/620 (45.81%), Query Frame = 2
Query:  395 DSDYGINSEIIYSI-EGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDET--LITVLINSNSDPEVKRHFQVSAISGLTLIS-RLDYESSMRKFTIPVIAVDNGIPNL-TTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLRE-FDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKE-NIMPGSPIFTLI----ATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGWVGKVEAYXXXXXXXXXII-FSFT-GFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKF--SQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLA----NNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTP 2197
            D D G N  ++YSI EG     F +        +   M L DRE    Y L   A D G  +K+    + +KI D+ND +P FD    Y + + E+   G  +  +  +DKD  T   IT  I +    +    F+V+ ISG+  +   LDYE     + I + A+D+ + N    ST + V +LDINDN P      +     N  + E+    + V  +  +D DS   G ++ +L E   K N +           SK    ++ LR+  D E  S Y +TV+  D+G P L +   + + + D N+N  S +  F   RI E +I   SP+ T++    ATD D   +  + Y I +       I +P TG +      D E+         A D  +  L +++ V + I D ND  P F  S Y+  + E        V+    D +S   ++ ++ T G   N+  I    G I + +   LDRE +S Y+LTV A D G P  S+ V   +++ D NDN P+F   Q +   + ++ T        + +V+ATD+D   N  + Y +     +NK FIID +SGE+F N +L  ++     L I+A+DNG P
Sbjct:  712 DEDKGYNGLVLYSIVEGDVDSVFNINMFTGELTV--AMPL-DRETISSYTLNISAVDCGKHRKSAYTILNVKITDVNDCSPVFDKTV-YEVTLPENITVGQTVTHVHASDKDQGTNGFITYQIVN----DFGGKFRVNRISGVVSVGDYLDYE-EQEMYKIEIQAMDSSVDNQKVGSTHVIVTLLDINDNSP-----IVKPKKFNVTVQEDLLVNAVVTSIHASDPDSGPGGEIEFSLPESTRKFNID-----------SKSG--VIRLRQRLDFEQKSTYNLTVRVTDKGSPALFTDVEVVVNVLDVNEN--SLAPVFSGGRILETSINENSPVGTVVISPKATDQD---SWYLKYAIIDGTGVDKFIIDPDTGAIRTAGELDHEVADHYWLTVQAKDGESYPLYTNIPVLINIVDLNDEAPYFAPSTYYPVLAENLPSGSSVVQVTAKDPDSGGSLLRYTITKGNEQNNFVIDPQSGLITTLR--PLDREFKSEYKLTVSASDGGTPPVSTDVTFTVKITDENDNQPEFKEKQYVVGVFARQATSKSFG---LYQVVATDEDIGSNADLRYSITKGNRDNK-FIIDSRSGEIFTNVSL--VDGESYDLTIVAEDNGLP 1291          

HSP 5 Score: 126.331 bits (316), Expect = 3.567e-29
Identity = 150/575 (26.09%), Postives = 237/575 (41.22%), Query Frame = 2
Query:  377 IKLSPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKD---DETLITVLINSNSDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPE----KYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMF-------------LSSAYHFKIKEGYSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDD 2041
            + +   D+D G+N+E+ YS+ G+  GF      KN K     +   DRE R  Y  +  A D G       I I++   D+ND+ P F     Y   V EDA     +  +K  D D   +  L   L+      +    F +   +G+  + +         +T+ V  +D G P L++  T+ + VL+IND  P+      S S  +  + E+ P  + V  V     +S  N ++   ++   +   F +           ++N  I   R+ D ET   Y +TV+  D G P L S   + I + D NDN P FS+  +  ++ EN   G+ +  + ATD D G NA+I Y I E    K   I+      TG++      DRE   S   K  A D+  P   +   V +E+ D ND  P F             L +A    ++      +G    Y     S     F     LH++  I K  G++    G          Y+L V   DNG P +S+ V + +++ +   + P    PL + Y+      L  G +I +V ATD D
Sbjct: 2983 LTVGATDADVGVNAELTYSVFGQ--GFGTFAVDKNGK--MTNLVELDRETRPFYNFMVSAADIGGQACYSNISIHLD--DVNDNRPLFSQ-SSYFTAVYEDAPLKKVLLQVKADDADVGVNRKLTYSLVT-----DAGGTFTIETGTGIISLEKPLNRELKENYTLNVEVMDGGTPPLSSIATVQIKVLNINDVPPE-----FSHSIYHGNVSEDAPIGNEVVRVRAVSRESS-NDVITYAILRGADSGLFSI----------DRKNGTIHVNRKLDYETTKLYTLTVEASDAGPPVLRSTSYVRISVTDSNDNGPEFSEKRYSAKVDENSALGTFVLQVFATDRDSGTNAQIKYSIAEGNDAKKFKIVE----ETGVIKVSGDIDREEVASYRLKVRAQDQGLPPQVADTVVDIEVTDVNDNSPEFSSTNLTTVLSESSLPNAAVIHLRPHDRDALGNGAPYQFTLISGDASRFK----LHSNGLITKI-GDVSHSDG---------QYRLRVLVADNGHPPQSTEVSITVKIAESKTHPPNV-HPL-TVYVNLYGSNL-NGGVIGRVKATDKD 3508          

HSP 6 Score: 125.561 bits (314), Expect = 6.909e-29
Identity = 122/506 (24.11%), Postives = 222/506 (43.87%), Query Frame = 2
Query:  368 RLSIKLSPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDET-LITVLINSNSDPEVKRHFQVSAISGLTLISR-LDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPD-IGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMF--LSSAYHFKIKEGYSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKD 1870
            ++ +++   D+D G+N ++ YS+     G F +   +    I    K  +RE ++ Y L     D G P  +    + IK+ ++ND  PEF     Y   V EDA  G+++  ++   ++    +IT  I   +D  +   F +   +G   ++R LDYE++ + +T+ V A D G P L +++ + ++V D NDN P+      S+   + K+ EN    +FV  V  TD DS  N  +  ++ E N+ + F+++          +    I    + DRE ++ YR+ V+ +DQGLPP  +   + I + D NDN P FS       + E+ +P + +  L   D D +G  A   YQ      +       S G++T +       +     +    D  +P  ++ V +T++I +     P    L+   +        G +G+V+A          + +S      + L ++  +G + +   I        TY L V   D
Sbjct: 3081 KVLLQVKADDADVGVNRKLTYSLVTDAGGTFTI---ETGTGIISLEKPLNRELKENYTLNVEVMDGGTPPLSSIATVQIKVLNINDVPPEFSH-SIYHGNVSEDAPIGNEVVRVRAVSRESSNDVITYAILRGADSGL---FSIDRKNGTIHVNRKLDYETT-KLYTLTVEASDAGPPVLRSTSYVRISVTDSNDNGPE-----FSEKRYSAKVDENSALGTFVLQVFATDRDSGTNAQIKYSIAEGNDAKKFKIV----------EETGVIKVSGDIDREEVASYRLKVRAQDQGLPPQVADTVVDIEVTDVNDNSPEFSSTNLTTVLSESSLPNAAVIHLRPHDRDALGNGAP--YQFTLISGDASRFKLHSNGLITKIGDVSHS-DGQYRLRVLVADNGHPPQSTEVSITVKIAESKTHPPNVHPLTVYVNLYGSNLNGGVIGRVKA---TDKDGDLLHYSLVSSEQSSLLMISDEGTVRARANIS-----PGTYNLNVSVTD 3552          

HSP 7 Score: 123.25 bits (308), Expect = 3.761e-28
Identity = 159/624 (25.48%), Postives = 274/624 (43.91%), Query Frame = 2
Query:  392 RDSDYGINSEIIYSIEGKDKG-FFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDET---LITVLINSNSDPEVKRHFQVSAISGLTLIS-RLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLI-----------ATDPDIGKNAKIIYQIPE-KYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIK-EGYSGW-VGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLAN-NKYFIIDEKSGEVFINRT--LDRLELVPRRLLIMAKDNGTP 2197
            +D D G+N E+ Y I    K     L +++++     T+K  D E    + L   A+D+GIPK+     + + + D+NDH PEF  P  +   V   A  G+ I  +  TDKDD T   L   +++ N++    +   V   SG+  ++ RL   + + ++ + V + D G P L T   + V V  I  NF                L EN P +  +A V         NGI+    I P         S  + +F   +++  I++ + FD E ++H ++ ++          S   + + I+D+NDN P     F   RI  ++  GSP  T +           ATD DI  + K+ Y+I E   +++ SI +P+TG +T     D E+     FK    D  NP L++  +V + + D ND  P+F +S YH  +    Y+G  V  V A   D +S +++ FS        L+ +     + +     L R    T +LTV   ++   +R     V+I+ E++  +  +FS+     Y   + E +   + +  V A          +TY + N ++ F I   +G + I     LDR  +   ++++ A+D+  P
Sbjct: 1438 KDPDAGVNGEVEYCIVQTAKAESASLFKIESHSGRILTVKPLDYETMQEHVLTIKASDRGIPKRETLFSVVVSVDDVNDHKPEFLSPL-FESEVDVSAKAGTAILRVIATDKDDGTNSKLKYSIVSGNTN----KSLSVDQNSGVVKVAGRL--STLVHQYALKVQSTDGGEPPLKTQVDVKVKVRGIVKNF------AFEKPKYEVSLPENSPPDQAIATVV-------YNGILPVYEIVPGR-------SPCWRDFTVQRQSGVIISKKSFDAEEVTHCKLEIRANSTD--GQHSSTLVIVTIQDKNDNQP----IFEHARITGHVTEGSPQGTAVLDHKGSQLVAVATDQDISGD-KLTYEIVETSARDVFSI-HPATGAITTAKVLDYEVTPQYAFKIKVTDSGNPRLSAFADVKIHVTDINDIAPVFSASTYHATVYLPSYAGTRVTMVTA--TDGDSAANLTFSL-ARQDTELFAVNPLTGVVTVSNAALLRRDTYTIKLTVSDGNHTAHAR-----VRIRCENLPSSDLQFSR---KNYSASVREGVSVDSELVTVRAL--GYPIGSTITYTIINPSELFHIVPSTGVMSIRAGFDLDRESIDAYQVIVQARDDSVP 2013          

HSP 8 Score: 119.013 bits (297), Expect = 6.312e-27
Identity = 142/577 (24.61%), Postives = 250/577 (43.33%), Query Frame = 2
Query:  500 TMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPV-IAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLR---EFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSF--SKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLAN----NKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPS 2200
            T K+ D E   +Y      TD G P+ +    + I + D+ND AP F     Y   V   +  G+++  +  TD D    +T  + +  D E+   F V+ ++G+  +S     + +R+ T  + + V +G  N T    + +      +N P      L  S  N+     +       +VTV      +   +   +I P         S  F+  P++     ++++R   + DRE+I  Y+V VQ +D  +PP  +Q  + + + D NDN P F  S +F    ++  +  G+ I    ATD DIG NA + Y +        SI   +  +V      D ++    T    A D    L  +   V +++ D+    P+F   ++   + E  +    +V +    S + + I++S TG    + + +     + +     LD E ++ Y+L V A D    S S   +     + +ND +P F++ L   Y+  I+E+    T +  V A D D   N ++ Y + N      +F ID+KSG VF+ ++LD    V   ++I+A D G PS
Sbjct: 1788 TAKVLDYEVTPQYAFKIKVTDSGNPRLSAFADVKIHVTDINDIAPVFSA-STYHATVYLPSYAGTRVTMVTATDGDSAANLTFSL-ARQDTEL---FAVNPLTGVVTVSN---AALLRRDTYTIKLTVSDG--NHTAHARVRIRC----ENLPS---SDLQFSRKNYSASVREGVSVDSELVTVRALGYPIGSTITYTIINP---------SELFHIVPSTG----VMSIRAGFDLDRESIDAYQVIVQARDDSVPPNVAQAAVHVQVIDRNDNQPVFINSPYFIV--LQLGVAQGTIIGQAQATDADIGSNANLRYDLIGGDPGYFSISRKTGEVVVRRTLDDVKVPRLFTLMVEATDG---LFRTEAVVKIKVVDKE--TPVFDQLSFSKVLAED-TPIGSEVTSVTARSPNGAGILYSITGGDPVNQFSIDFKTGVVTLVS-SLDYETRTKYKLVVRATDARTSSHSDVAVDVTVTD-VNDVAPAFNRSL---YLATISESTPVDTAVVTVKAIDGDSGINKEINYFIQNVSRVGAFFKIDKKSGVVFVAKSLDYESRVVHEMIIVAADEGKPS 2321          

HSP 9 Score: 116.701 bits (291), Expect = 3.318e-26
Identity = 164/616 (26.62%), Postives = 260/616 (42.21%), Query Frame = 2
Query:  398 SDYGINSEIIYSI-EGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRH----FQVSAISGLTLISRLDYESSMRKF-TIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKE--GYSGWVGKVEAYXXXXXXXXXIIFSFT-GFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNKYFII--DEKSGEVFINRTLDRLELVPR-----RLLIMAKDNGTP 2197
            +D  +N+E+ Y I  G  +  F +   +    IF    L DRE    Y+L   A+D G+     ++KI   I D ND+ P       YV  +KE+   GS +  +  TD D      V +N+     V       F V     +T +  LD E+  R F    V A D G       + I++++ D+NDN P       S SS    + E+ P +  +  V   DAD           +  N K  + L++     F        I   +  +RE   +Y + V+  D G PPLSS  T+ I + + ND PP FS   +   + E+   G+ +  + A   +   N  I Y I     + +   +   G +      D E     T    A D   P+L S+  V + + D ND  P F    Y  K+ E      +V +V A D DS +N+ I +S   G       I++  G I     I  DRE  ++Y+L V A+D G+P + +  +V I++ D+NDNSP+FS    +     ++E+ +P   +  +   D D   NG      A  ++ +I  D    ++  N  + ++  V       RL ++  DNG P
Sbjct: 2888 TDEDLNTELYYFILSGDPQARFGI--ERKTGVIFVHGSL-DRESVGSYDLNISASD-GLFTSFAQMKI--DIEDANDNPP-ICTQSIYVEHIKENTPLGSTVLTVGATDAD------VGVNAELTYSVFGQGFGTFAVDKNGKMTNLVELDRET--RPFYNFMVSAADIG--GQACYSNISIHLDDVNDNRP-----LFSQSSYFTAVYEDAPLKKVLLQVKADDAD-----------VGVNRKLTYSLVTDAGGTFTIETGTGIISLEKPLNRELKENYTLNVEVMDGGTPPLSSIATVQIKVLNINDVPPEFSHSIYHGNVSEDAPIGNEVVRVRAVSRE-SSNDVITYAILRGADSGLFSIDRKNGTIHVNRKLDYETTKLYTLTVEASDAGPPVLRSTSYVRISVTDSNDNGPEFSEKRYSAKVDENSALGTFVLQVFATDRDSGTNAQIKYSIAEGNDAKKFKIVEETGVIKVSGDI--DREEVASYRLKVRAQDQGLPPQVADTVVDIEVTDVNDNSPEFSS---TNLTTVLSESSLPNAAVIHLRPHDRDALGNG------APYQFTLISGDASRFKLHSNGLITKIGDVSHSDGQYRLRVLVADNGHP 3458          

HSP 10 Score: 110.923 bits (276), Expect = 1.879e-24
Identity = 145/615 (23.58%), Postives = 266/615 (43.25%), Query Frame = 2
Query:  395 DSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISGL-TLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFP----QIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALD-EFNPLLN-SSVEVTLEIEDENDCIPMFLSSAYHFKIKEGY--SGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDRE--VQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNK---YFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTP 2197
            D+D G N+ + Y + G D G+F + +      + +T+   D +    + L+  ATD G+ +     +  +KI+ ++   P FD    +   + ED   GS++  +     +   ++  +  +  DP     F +   +G+ TL+S LDYE+   K+ + V A D    + +           +ND  P     + + T+S+S+         P ++ V  V   D DS +N  ++  +      QN   +SR    F   K++  +   +  D E+   + + +   D+G P L+ +  + + + D NDN P F K  +   I  +  PG  +  ++ATDPD G   K+ Y I           +  +G++T      R +      K + LD E +  ++ S+ +V + I D ND  P+F    Y     E Y    +V  V A D DS + + + +S         + + +D  +   + +  DRE   Q+   + + A D G   R    +V++ L D NDN P F       Y   I+ ++  GT +    A+D D + N  +TY++  ++    F I+  +G + ++R     E+      ++ KD G P
Sbjct: 2061 DADIGSNANLRYDLIGGDPGYFSISRKTGEVVVRRTLD--DVKVPRLFTLMVEATD-GLFRT----EAVVKIKVVDKETPVFDQ-LSFSKVLAEDTPIGSEVTSVTARSPNGAGILYSI--TGGDP--VNQFSIDFKTGVVTLVSSLDYETRT-KYKLVVRATDARTSSHSDVAVDVTVTD-VNDVAPAFNRSLYLATISEST---------PVDTAVVTVKAIDGDSGINKEINYFI------QN---VSRVGAFFKIDKKSGVVFVAKSLDYESRVVHEMIIVAADEGKPSLTGETRVRVVLMDANDNAPRFDKSMYAASILGSASPGQFVTRILATDPDEGDAKKLRYSITGGQGRQHFQIDSQSGVIT----LSRVVGIK-QGKVYGLDVEVSDSVHVSTSKVRVIIGDTNDHSPIFSEDVYKVSFNENYPEGTFVTMVSATDLDSGNYAHLTYSIDSVDAMRKFRIDADSGMLYSR-LMFDRENSSQAIMSVPIRATDGG--GRFGFCVVEVHLIDENDNQPIFEL---KNYDTTISRSVTMGTPVLMTSASDPDASSNAALTYVIVGHQTPPVFTINAATGVIQVSR---EPEVKSYNFFVLVKDGGNP 2629          

HSP 11 Score: 109.768 bits (273), Expect = 4.491e-24
Identity = 154/601 (25.62%), Postives = 248/601 (41.26%), Query Frame = 2
Query:  434 IEGKDKGFFKLLQMKNNKPIF---KTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSN-----SDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGI----PNLTTSTTITVNVLDINDNFPQIVIDT----LSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVD-CNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETIS-HYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLN---SSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGW--VGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVP-SRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVP-GTLITKVMATD---DDENENGKVTYLLAN-NKYFIIDEKSGEVFINRTLDRLE 2149
            I G ++G F +   + +   F   KT K  +RE    YEL  +  DK   +     K+ I + D ND+ P F + K Y+  + ED    + I  I+  D D        +  N     S  E    F ++ ISG+  +++    +S R   + V+A D  +    P  + +  + VNV  +N   P+  + T    +S+ +S              A + + D D   NG +D   +   N    F + S        S  +Y +  ++  DRE     Y VT+   D+G P  +    + + + DENDN P F++  +   + E     +P+  ++ATD D G N  I+Y I    +      N  TG +      D E          ALD   PL +   S+V V + I D ND  P F +  Y   + E  +    V  V A D DS  N  + +S          I    G I +   +  D  +     L V A D G P  R +  +V+++++++NDN+P   Q         + +   P G LIT V A D    D++++        N  K F +D K+GE+   R+L  L+
Sbjct:   34 ISGNEQGMFSVDSRQVSDFNFMDIKTSKRLNRESVASYELNVVVQDKRTKRTLDRTKVNITVDDSNDNRPIF-LKKKYLKTIPEDIPMHTSIARIEAVDAD--------VGPNGLIYYSFKEKTTSFAINPISGVVSVAQ-KLSNSARIHRLTVVARDRALPPSKPKSSRNCQLIVNVQAVNQFSPEFSVKTQLQNVSEGTSGI----------VYATLGIIDKDKGSNGDIDRVEITSGNLDGAFSIKS--------SPNDYAVQVIKPLDRELAPFGYNVTLTAYDKGTPVRNGSYVLRVNVLDENDNNPEFNQSRYITNLSELAPIHTPVLRVLATDKDAGSNGNIMYVITRGNELGKFEINSKTGQIYTKGDLDYESRQRFDLTVAALDGV-PLQSRKISTVPVVVNILDANDHDPEFKAPEYRKDLYEDLTPGTSVFTVSAEDLDSGGNGKVRYSLANLRPVPFEIEPDTGIIRTTTNLDRDTGLPEFINLQVRASDFGTPLRRETETLVKMRVKEMNDNAPVLKQ----FKCNILVDRNAPVGVLITTVTAIDIDISDKDQSLMYKSTFGNTGKAFSLDPKTGELRTARSLRGLQ 601          

HSP 12 Score: 108.612 bits (270), Expect = 8.909e-24
Identity = 167/669 (24.96%), Postives = 273/669 (40.81%), Query Frame = 2
Query:  377 IKLSPRDSDYGINSEIIYSI-EGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIP---KKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITV---LINSNSDPEVKRHFQVSAISGLT-LISRLDYESSMRKF-TIPVIAVDNGIP-NLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDAD-----------SEMNGIVDCNLIEPNN------------KQNFELISRYFNNFPNSKRNY------RIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKEN--------------IMPGSPIFTLI----ATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYS--GWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRS-SSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLA-NNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPS 2200
            +++   D D G N  I+Y I  G + G F   ++ +      T    D E R R++L   A D G+P   +K   + + + I D NDH PEF  P +Y   + ED   G+ +  +   D D      V   L N    P     F++   +G+    + LD ++ + +F  + V A D G P    T T + + V ++NDN P      L     N  +  N P    +  VT  D D           S          ++P              ++ F LI +  +    S   +       IV  R+  R+  +H  V+ +C D    PL ++    + I+ E  +  S     F      N              I   +PI T++    ATD D G N  ++Y I E   + +   N  TG +T  +  DRE  +S T    A+D      ++   + ++I D NDC P+F  + Y   + E  +    V  V A D D  +N  I +           + +  G +    G  LD E Q  Y++ ++A D+ V ++   S  V + L DINDNSP   +P    +   + E L+   ++T + A+D D    G++ + L  + + F ID KSG + + + LD  +     L +   D G+P+
Sbjct:  339 LRVLATDKDAGSNGNIMYVITRGNELGKF---EINSKTGQIYTKGDLDYESRQRFDLTVAALD-GVPLQSRKISTVPVVVNILDANDHDPEFKAP-EYRKDLYEDLTPGTSVFTVSAEDLDSGGNGKVRYSLANLRPVP-----FEIEPDTGIIRTTTNLDRDTGLPEFINLQVRASDFGTPLRRETETLVKMRVKEMNDNAP-----VLKQFKCNILVDRNAPVGVLITTVTAIDIDISDKDQSLMYKSTFGNTGKAFSLDPKTGELRTARSLRGLQREFTLIIKATDGIQESPDTHPVILKISIVGGRQA-RKLQNH--VSTKCVDS---PLYAK---ALKIKQEQKSYSSLQPLIFATAKLHNRHHPVFRSHDQNIHISESTPIATVVSQFMATDEDKGYNGLVLYSIVEGDVDSVFNINMFTGELTVAMPLDRETISSYTLNISAVDCGKHRKSAYTILNVKITDVNDCSPVFDKTVYEVTLPENITVGQTVTHVHASDKDQGTNGFITYQIVNDFGGKFRVNRISGVV--SVGDYLDYEEQEMYKIEIQAMDSSVDNQKVGSTHVIVTLLDINDNSP-IVKP--KKFNVTVQEDLLVNAVVTSIHASDPDSGPGGEIEFSLPESTRKFNIDSKSGVIRLRQRLDFEQKSTYNLTVRVTDKGSPA 978          

HSP 13 Score: 104.375 bits (259), Expect = 1.886e-22
Identity = 103/384 (26.82%), Postives = 180/384 (46.88%), Query Frame = 2
Query: 1079 VDCNLIEPNNKQNFELISRYFNNFPNSKRNYR-IVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVT---NLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGWVGKVEAYXXXXXXXXXII--FSFTGFLHNHLWILKSDGNIFSEKGIQ-LDREVQS-TYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANN---KYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTP 2197
            VD  +I  N +  F + SR  ++F     N+  I T +  +RE+++ Y + V  +D+       +  + I ++D NDN P F K  +   I E+I   + I  + A D D+G N  I Y   EK  +     NP +G+V+    L +  R    ++  +  AL    P  + + ++ + ++  N   P F        + EG SG V       +    ++  I     T    +  + +KS  N ++ + I+ LDRE+    Y +T+ A D G P R+ S ++++ + D NDN+P+F+Q   S Y+  ++E     T + +V+ATD D   NG + Y++        F I+ K+G+++    LD  E   R  L +A  +G P
Sbjct:   29 VDFIIISGNEQGMFSVDSRQVSDF-----NFMDIKTSKRLNRESVASYELNVVVQDKRTKRTLDRTKVNITVDDSNDNRPIFLKKKYLKTIPEDIPMHTSIARIEAVDADVGPNGLIYYSFKEKTTSFAI--NPISGVVSVAQKLSNSARIHRLTVVARDRALPPSKPKSSRNCQLIVNVQAVNQFSPEFSVKTQLQNVSEGTSGIVYATLGIIDKDKGSNGDIDRVEITSGNLDGAFSIKSSPNDYAVQVIKPLDRELAPFGYNVTLTAYDKGTPVRNGSYVLRVNVLDENDNNPEFNQ---SRYITNLSELAPIHTPVLRVLATDKDAGSNGNIMYVITRGNELGKFEINSKTGQIYTKGDLD-YESRQRFDLTVAALDGVP 401          

HSP 14 Score: 103.605 bits (257), Expect = 3.159e-22
Identity = 141/633 (22.27%), Postives = 266/633 (42.02%), Query Frame = 2
Query:  395 DSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMP----KDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISG-LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIED-----------------ENDCIPMFLSSAYHFKIKEGYSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLI-----TKVMATDDDENENG-KVTYLLANNK---YFIIDEKSGEVFINRTLDRLELVPRRLL-IMAKDNGTP 2197
            D D G N+++ YSI   ++    ++  ++ + IF  + L D E    Y+L  +A D G+PK +    + I +  +  + P  + P    K Y   ++ED    S +  I   D D + +   + + N        F +    G +T+   LD E     +++ V A D      T S  +T+N+LD+NDN PQ        +   ++    +  +    + TV D D+ +NG V+  +++    ++  L       F     + RI+T++  D ET+  + +T++  D+G+P   +  ++ + ++D ND+ P F    F+  +  +   G+ I  +IATD D G N+K+ Y I     N     + ++G+V  +      +      K  + D   P L + V+V +++                   EN      +++  +  I   Y    G+   +             FT        + +  G I S+K      + +      +E + N    + SS +V + ++D NDN P F     +G+   +TE    GT +     ++++A   D++ +G K+TY +        F I   +G +   + LD  E+ P+    I   D+G P
Sbjct: 1236 DEDIGSNADLRYSITKGNRDNKFIIDSRSGE-IFTNVSLVDGES---YDLTIVAEDNGLPKLSTSTNVLIDV--IQGNKPSKNAPVFWNKQYSADIQEDKRINSFVLIIGAEDPDFDQITYNIASGNH----GNKFTIDRYGGFITVAHSLDREEK-SFYSLRVEATDG---YNTASVPVTINILDVNDNSPQ-------PARREYRAHVAENSDVGTLVTTVKDPDAGVNGEVEYCIVQTAKAESASL-------FKIESHSGRILTVKPLDYETMQEHVLTIKASDRGIPKRETLFSVVVSVDDVNDHKPEFLSPLFESEVDVSAKAGTAILRVIATDKDDGTNSKLKYSIVSGNTNKSLSVDQNSGVV-KVAGRLSTLVHQYALKVQSTDGGEPPLKTQVDVKVKVRGIVKNFAFEKPKYEVSLPENSPPDQAIATVVYNGILPVYEIVPGRSPCWR-----------DFT--------VQRQSGVIISKKSF----DAEEVTHCKLEIRANSTDGQHSSTLVIVTIQDKNDNQPIFEHARITGH---VTEGSPQGTAVLDHKGSQLVAVATDQDISGDKLTYEIVETSARDVFSIHPATGAITTAKVLD-YEVTPQYAFKIKVTDSGNP 1812          

HSP 15 Score: 88.9669 bits (219), Expect = 1.021e-17
Identity = 136/477 (28.51%), Postives = 203/477 (42.56%), Query Frame = 2
Query:  827 RLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQT----ITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKI--IYQIPEKYQNIISI-PNPSTGIVTNLVSFDREM---NTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKE--GYSGWVGKVEAYXXXXXXXXXIIFSFT-GFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRS---SSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNK--YFIIDEKSGEVFINRTLDRLELVPR--RLLIMAKDNGTP 2197
            RL+ ES +  + + V+  D         T + + V D NDN P  +      +     + E+ P  + +A +   DAD   NG++  +  E         IS   +       + RI             +R+TV  +D+ LPP   + +    + + ++  N   P FS       + E    G    TL   D D G N  I  +           SI  +P+   V  +   DRE+     ++T  A+  D+  P+ N S  + + + DEND  P F  S Y   + E       V +V A D D+ SN +I++  T G       I    G I++ KG  LD E +  + LTV A D GVP +S   S+V V + + D ND+ P+F  P    Y K + E L PGT +  V A D D   NGKV Y LAN +   F I+  +G +     LDR   +P    L + A D GTP
Sbjct:   62 RLNRES-VASYELNVVVQDKRTKRTLDRTKVNITVDDSNDNRPIFLKKKYLKT-----IPEDIPMHTSIARIEAVDADVGPNGLIYYSFKEKTTSFAINPISGVVSVAQKLSNSARI-------------HRLTVVARDRALPPSKPKSSRNCQLIVNVQAVNQFSPEFSVKTQLQNVSEG-TSGIVYATLGIIDKDKGSNGDIDRVEITSGNLDGAFSIKSSPNDYAVQVIKPLDRELAPFGYNVTLTAY--DKGTPVRNGSYVLRVNVLDENDNNPEFNQSRYITNLSELAPIHTPVLRVLATDKDAGSNGNIMYVITRGNELGKFEINSKTGQIYT-KG-DLDYESRQRFDLTVAALD-GVPLQSRKISTVPVVVNILDANDHDPEFKAPE---YRKDLYEDLTPGTSVFTVSAEDLDSGGNGKVRYSLANLRPVPFEIEPDTGIIRTTTNLDRDTGLPEFINLQVRASDFGTP 510          

HSP 16 Score: 88.5817 bits (218), Expect = 1.111e-17
Identity = 112/440 (25.45%), Postives = 186/440 (42.27%), Query Frame = 2
Query:  380 KLSPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDR--YELVFIATDKGIP----KKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDET---LITVLINSNSDPEVKRHFQVSAIS---GLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLS---SQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIP---NPSTGIVTNLVSFDREMNTS--ITFKAFALDEFNPLLN-SSVEVTLEIEDENDCIPMF 1636
            ++   D+D G N  I YS + K   F          PI   + +  +       + L  +A D+ +P    K +   ++ + ++ +N  +PEF + K  +  V E    G     + + DKD  +   +  V I S +   +   F + +      + +I  LD E +   + + + A D G P    S  + VNVLD NDN P+      + S     L E  P  + V  V  TD D+  NG +   +   N    FE+         NSK   +I T  + D E+   + +TV   D G+P  S   S   + + I D ND+ P F    ++  + E++ PG+ +FT+ A D D G N K+ Y +     N+  +P    P TGI+    + DR+      I  +  A D   PL   +   V + +++ ND  P+ 
Sbjct:  126 RIEAVDADVGPNGLIYYSFKEKTTSFAI-------NPISGVVSVAQKLSNSARIHRLTVVARDRALPPSKPKSSRNCQLIVNVQAVNQFSPEFSV-KTQLQNVSE-GTSGIVYATLGIIDKDKGSNGDIDRVEITSGN---LDGAFSIKSSPNDYAVQVIKPLDRELAPFGYNVTLTAYDKGTPVRNGSYVLRVNVLDENDNNPE-----FNQSRYITNLSELAPIHTPVLRVLATDKDAGSNGNIMYVITRGNELGKFEI---------NSKTG-QIYTKGDLDYESRQRFDLTVAALD-GVPLQSRKISTVPVVVNILDANDHDPEFKAPEYRKDLYEDLTPGTSVFTVSAEDLDSGGNGKVRYSL----ANLRPVPFEIEPDTGIIRTTTNLDRDTGLPEFINLQVRASDFGTPLRRETETLVKMRVKEMNDNAPVL 533          

HSP 17 Score: 70.4774 bits (171), Expect = 3.706e-12
Identity = 112/415 (26.99%), Postives = 174/415 (41.93%), Query Frame = 2
Query:  992 NFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALD-EFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGY--SGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGI-----QLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLV-----PGTLITKVMATDDDENENGKVTYLLANNK---YFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDN 2188
            N  + E+ P  + V+    TD D   NG+V  +++E +    F +     N F        +      DRETIS Y + +   D G    S+   + + I D ND  P F K  ++  + ENI  G  +  + A+D D G N  I YQI   +     + N  +G+V+     D E       +  A+D   +     S  V + + D ND  P+     ++  ++E    +  V  + A D DS    +I FS                NI S+ G+     +LD E +STY LTV   D G P+  + V V + + D+N+NS     P+ SG   +I ET +      GT++    ATD D   +  + Y + +      FIID  +G +     LD        L + AKD 
Sbjct:  692 NIHISESTPIATVVSQFMATDEDKGYNGLVLYSIVEGDVDSVFNI-----NMFTG-----ELTVAMPLDRETISSYTLNISAVDCGKHRKSAYTILNVKITDVNDCSPVFDKTVYEVTLPENITVGQTVTHVHASDKDQGTNGFITYQIVNDFGGKFRV-NRISGVVSVGDYLDYEEQEMYKIEIQAMDSSVDNQKVGSTHVIVTLLDINDNSPIVKPKKFNVTVQEDLLVNAVVTSIHASDPDSGPGGEIEFSLPESTRKF--------NIDSKSGVIRLRQRLDFEQKSTYNLTVRVTDKGSPALFTDVEVVVNVLDVNENS---LAPVFSG--GRILETSINENSPVGTVVISPKATDQD---SWYLKYAIIDGTGVDKFIIDPDTGAIRTAGELDHEVADHYWLTVQAKDG 1079          
BLAST of protocadherin-1 vs. Ensembl Nematostella
Match: EDO30364 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T100])

HSP 1 Score: 188.348 bits (477), Expect = 2.119e-48
Identity = 166/595 (27.90%), Postives = 284/595 (47.73%), Query Frame = 2
Query:  380 KLSPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKD--DETLITVLINSNSDPEVKRHFQVSAISGLTLI--SRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEG--YSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATD-DDENENGKVTYLLAN---NKYFIIDEKSGEVFINRT 2134
            K++  D D G    I YSI   D   + L  + N     +T+   DRE   +YEL F+     +   +  +K+ +++ D+ND+ P F MP  Y I   E++ EG+ I  +K  D D  D   +   I  N    V  +  V+AI+G+  +  S+LD E     F   + A D+G+P+ +++ ++ + ++DINDN P       +++     + EN+P  + V +VT +D D           +  N K ++ L    +  F        I T    +RE    Y +T++  D  +        + I + D ND+ P F++  +   ++E++  G  +  +  TD DI  NA++ Y I     +++   N +TGI++   + DRE N S T    A D   P L S+  V + IED ND  P+F  S Y+  ++E       V +V A D D  +N    +  T    + ++ + ++  + + K  +LD E  S Y LTV A+D G P  + +  V+I + D++DN+P F +P    Y  ++ E +  G  +  V ATD D E  + +V Y + +   +  F+I E+SG + +N T
Sbjct: 1213 KITALDKDIG--DTISYSIANGDP--YGLFTIDNVTGEIRTVAELDRENVTQYEL-FVQAKDSVNLVSDLLKVVVQVEDVNDNPPVFSMPG-YTIEYWEESPEGTSILQVKAIDADIGDNAAVLYSIVEN----VTDYVTVNAITGVISLGSSQLDREVE-EYFNFTIRATDSGVPSKSSTASVAIKLVDINDNSP-----VFNNTDYYAYVRENQPAGTPVLVVTASDKD-----------VGTNAKLSYVLSGVLYTRFAIDPDTGNITTREPLNREETGSYTLTLRAVDSAIRAREGTTRVIITVTDANDHVPQFTQSGYAFSVREDVKVGHTVGRVATTDEDINDNARVRYYISSGNTSLMFSVNETTGIISTTSTLDREQNASYTLIITAKDHGIPALESNTSVMITIEDVNDNKPLFSKSVYNVTLRESVFLKTQVVQVIATDPDEGANGQFTYKITAGDTDDVFYIDANTGLITIKA-KLDYEKTSLYNLTVSAQDLGTPPLTGACFVEIHVSDVDDNAPVFHKPR---YSAELYENVTRGHHVITVNATDIDAEASHKRVYYRIESGNTDSMFLIGEQSGVITLNCT 1776          

HSP 2 Score: 172.555 bits (436), Expect = 1.884e-43
Identity = 169/624 (27.08%), Postives = 277/624 (44.39%), Query Frame = 2
Query:  383 LSPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKD--DETLITVLINSNSDPEVKRHFQVS-AISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLR-EFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDI-GKNAKIIYQIPEKYQNIISIPNPSTGIVT-NLV---SFDREMNTSITFKAFALDEFNPLLNSS-VEVTLEIEDENDCIPMFLSSAYHFKIKEGYS----GWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKK-----ITETLVPGTLITKVMATDDDENENGKVTYLLANN---KYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDN 2188
            ++  D D G N+++ Y + G     +    +  +     T +  +REE   Y L   A D  I  + G  ++ I + D NDH P+F     Y   V+ED   G  +  +  TD+D  D   +   I+S +       F V+     ++  S LD E +   +T+ + A D+GIP L ++T++ + + D+NDN P       S S  N  L E+   ++ V  V  TD D   NG     +   +    F +             N  ++T++ + D E  S Y +TV  +D G PPL+    + I + D +DN P F K  +   + EN+  G  + T+ ATD D    + ++ Y+I     + + +    +G++T N       +RE +     +  A+   N     S V   + + D ND  P F S +Y   + E         +  V+A D D   + +IIF+      N ++ + +   + + +   LDRE  S Y L V A+D G P+ SSSV V I + D+NDN P    P+D    ++     + E L  G  +  V A D D      + Y + N    KYFI++E SGE+    TLDR +     L + A ++
Sbjct: 1421 VTASDKDVGTNAKLSYVLSGV---LYTRFAIDPDTGNITTREPLNREETGSYTLTLRAVDSAIRAREGTTRVIITVTDANDHVPQFTQ-SGYAFSVREDVKVGHTVGRVATTDEDINDNARVRYYISSGN---TSLMFSVNETTGIISTTSTLDREQNA-SYTLIITAKDHGIPALESNTSVMITIEDVNDNKP-----LFSKSVYNVTLRESVFLKTQVVQVIATDPDEGANGQFTYKITAGDTDDVFYI-----------DANTGLITIKAKLDYEKTSLYNLTVSAQDLGTPPLTGACFVEIHVSDVDDNAPVFHKPRYSAELYENVTRGHHVITVNATDIDAEASHKRVYYRIESGNTDSMFLIGEQSGVITLNCTPSGCLNRETHARYELQVAAISRVNLTEQKSLVPAVITVLDVNDNAPRFDSESYVRSVLEDTGPITDATILTVKAQDGDEGESGEIIFTIVSGNENGVFQMDNKTGVLT-RTRPLDREDTSFYSLVVMAEDKGEPALSSSVTVNITVLDMNDNLPILQTPMDVLIPERRTTFSVKENLDAGVPVGVVAAQDLDTKN--LIYYYITNTEEQKYFILNETSGELRTRITLDREDSSVHYLYVKASND 2017          

HSP 3 Score: 167.933 bits (424), Expect = 5.387e-42
Identity = 169/636 (26.57%), Postives = 285/636 (44.81%), Query Frame = 2
Query:  362 FWRLS------IKLSPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDET---LITVLINSNSDPEVKRHFQVSAISG-LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYS--GWVGKVEAYXXXXXXXXXIIFSF--TGFLHNHLWILKSDGNI---FSEKGIQLDREVQSTYQLTVEAKDN-GVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGT--LITKVMATDDDENENGKVTYLLAN---NKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPS 2200
            +W  S      +++   D+D G N+ ++YSI      +  +  +     +  +    DRE  + +     ATD G+P K+    + IK+ D+ND++P F+   DY   V+E+   G+ +  +  +DKD  T   L  VL        +   F +   +G +T    L+ E +   +T+ + AVD+ I     +T + + V D ND+ PQ      + S   F + E+      V  V  TD D   N  V   +   N    F +          ++    I T    DRE  + Y + +  KD G+P L S  ++ I IED NDN P FSK  +   ++E++   + +  +IATDPD G N +  Y+I     + +   + +TG++T     D E  +       A D   P L  +  V + + D +D  P+F    Y  ++ E  +    V  V A D D+ ++   ++    +G   +   I +  G I    +  G  L+RE  + Y+L V A     +  + S V   I + D+NDN+P+F       Y++ + E   P T   I  V A D DE E+G++ + + +   N  F +D K+G +   R LDR +     L++MA+D G P+
Sbjct: 1303 YWEESPEGTSILQVKAIDADIGDNAAVLYSIVENVTDYVTVNAITGVISLGSSQ--LDREVEEYFNFTIRATDSGVPSKSSTASVAIKLVDINDNSPVFNN-TDYYAYVRENQPAGTPVLVVTASDKDVGTNAKLSYVLSGV-----LYTRFAIDPDTGNITTREPLNREET-GSYTLTLRAVDSAIRAREGTTRVIITVTDANDHVPQ-----FTQSGYAFSVREDVKVGHTVGRVATTDEDINDNARVRYYISSGNTSLMFSV----------NETTGIISTTSTLDREQNASYTLIITAKDHGIPALESNTSVMITIEDVNDNKPLFSKSVYNVTLRESVFLKTQVVQVIATDPDEGANGQFTYKITAGDTDDVFYIDANTGLITIKAKLDYEKTSLYNLTVSAQDLGTPPLTGACFVEIHVSDVDDNAPVFHKPRYSAELYENVTRGHHVITVNATDIDAEASHKRVYYRIESGNTDSMFLIGEQSGVITLNCTPSGC-LNRETHARYELQVAAISRVNLTEQKSLVPAVITVLDVNDNAPRFDS---ESYVRSVLEDTGPITDATILTVKAQDGDEGESGEIIFTIVSGNENGVFQMDNKTGVLTRTRPLDREDTSFYSLVVMAEDKGEPA 1910          

HSP 4 Score: 160.229 bits (404), Expect = 1.246e-39
Identity = 158/535 (29.53%), Postives = 256/535 (47.85%), Query Frame = 2
Query:  617 LNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISGLTLI-SRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVS-FDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGW--VGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNK---YFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPS 2200
            +ND +P F+    Y + V E A  G  I  +  TD+D E +  ++  S++  E K  F VS  +G  ++ S LD E     + + V A +       T+T + + V D+ D+ P       + SS   KL EN    + V  +T  D D     I D       N   + L +   +N     R     T+ E DRE ++ Y + VQ KD  +  +S    + + +ED NDNPP FS   +     E    G+ I  + A D DIG NA ++Y I E   + +++ N  TG+++   S  DRE+     F   A D   P  +S+  V +++ D ND  P+F ++ Y+  ++E       V  V A D D  +N+ + +  +G L+    I    GNI + +   L+RE   +Y LT+ A D+ + +R  +  V I + D ND+ P+F+Q   SGY   + E +  G  + +V  TD+D N+N +V Y +++      F ++E +G +    TLDR +     L+I AKD+G P+
Sbjct: 1082 INDESPLFEKSM-YYVNVSESASRGIVIGRVTATDRD-EGINAIIFYSSNGAEAK--FYVSRSTGDIIVDSPLDREFK-NVYILNVTAANIVAGAQDTTTQVHITVTDVIDDKPY-----FNSSSLTVKLSENASIGTNVTKITALDKD-----IGDTISYSIANGDPYGLFT--IDNVTGEIR-----TVAELDRENVTQYELFVQAKDS-VNLVSDLLKVVVQVEDVNDNPPVFSMPGYTIEYWEESPEGTSILQVKAIDADIGDNAAVLYSIVENVTDYVTV-NAITGVISLGSSQLDREVEEYFNFTIRATDSGVPSKSSTASVAIKLVDINDNSPVFNNTDYYAYVRENQPAGTPVLVVTASDKDVGTNAKLSYVLSGVLYTRFAIDPDTGNITTRE--PLNREETGSYTLTLRAVDSAIRAREGTTRVIITVTDANDHVPQFTQ---SGYAFSVREDVKVGHTVGRVATTDEDINDNARVRYYISSGNTSLMFSVNETTGIISTTSTLDREQNASYTLIITAKDHGIPA 1587          

HSP 5 Score: 157.147 bits (396), Expect = 1.003e-38
Identity = 176/659 (26.71%), Postives = 289/659 (43.85%), Query Frame = 2
Query:  377 IKLSPRDSDYGINSEIIYSI-EGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKED-AIEGSKICD-IKVTDKDD----ETLITVLINSNSDPEVKRHFQVSAISGLTLISR-LDYESSMRKFTI-----------------------PVIAVDNGIP-NLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQG-LPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSS-AYHFKIKEGYSG---WVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFS-QPLDSGYMKKITETLVPGTL---ITKVMATDDDENENGKVTYLLANNK--YFIIDEKSGEVFINRTLDRLELVPRR---------LLIMAKDNGTP 2197
            + +  RD D GIN+ I+Y I  G   G F +    +N  +       D E+ D + +   A++   P     + + + + D+ND+ P F +   Y+  V+ED A+ G  + D ++VTD D       ++  L+ ++SD      F +   SG   I++ LDYE  +  FT                         V+A +       + + ++T+ ++++NDN P       + SS N+ + E     + +A +T TDAD    G +            +EL       F  +  N  I   +  D +T+  Y+ ++  KD G      +  T+T+ ++D NDN P F+   +   I EN+  G+ +F + ATD D G+N ++ + I           N S G+VT     DRE   + T    A D      +  V++T+ + DEND  P           I EG  G    +  + A D D+ SN  + +S +G   +  + L S           LDRE++ +Y L +   DNG P  ++S  V + + D+NDN+P F   P  S     IT    PGT+   +  + ATD D + NGKV Y L+ ++  +F +D  +GE+ + + LDR      R         L I A D  TP
Sbjct:  173 VTVEARDGDVGINNPILYEIISGNSDGVFTI---DSNTGVITVNGSIDAEKTDVFRITVKASEVPDPNSNTTVTVVVTVVDVNDNRPAF-LQSVYIFDVREDVALPGRVVSDQLQVTDGDKNPVFRRVLYHLVGADSD-----KFAIDPTSGTLYINKTLDYEKQI-NFTFDWERGCGSGGGSGWDWTGRGEEKKVVATETDTSEKFSANASVTLTLINVNDNKPM-----FAKSSYNYTMDEEITPGTHIADITATDADLGTFGAL-----------TYELRGGQAAYFSVNADNGTISAAQILDYDTLRQYQFSLVVKDGGGFYQEIAIATVTVTLQDVNDNDPEFTGMPYTSDIAENLPAGTIVFQVTATDKDSGENGRLSFNISAGDDGGHFSINGS-GLVTTARELDRETIATYTLTVSAYDHGVSSRHKHVQLTVNVLDENDNTPQITDGLTITTNISEGAGGGTVLLSSIAAVDPDAGSNGQLTYSMSG--GDSRFTLNSATGRLQISPTGLDRELKDSYDLIINVTDNGSPPNTNSTTVHVTILDVNDNTPAFDPNPAQSLATYVITVDEGPGTINKTLIDINATDPDADANGKVAYSLSGDEHGFFRLDPVTGELSVRKELDRESPQMSRNAQGDGRFLLDITATDQATP 802          

HSP 6 Score: 147.902 bits (372), Expect = 8.724e-36
Identity = 162/636 (25.47%), Postives = 282/636 (44.34%), Query Frame = 2
Query:  383 LSPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKG-IPKKTGEIKIYIKIRDLNDHAPEF-DMPKDYVIGVKEDAIEGSKICDIKVTDKD--DETLITVLINSNSDPEVKRHFQVSAISGLTLISR-LDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKES-FVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSF----SKFFFQDRIKENIMPGSPIFTLI---ATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREM---------NTSITFKAFALDEFNPLLN---SSVEVTLEIEDENDCIPMFLSSAYHFKIKEGY--SGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLAN---NKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPS 2200
            ++  D+D G    + Y + G    +F +     +       ++ D +   +Y+   +  D G   ++     + + ++D+ND+ PEF  MP  Y   + E+   G+ +  +  TDKD  +   ++  I++  D     HF ++  SGL   +R LD E+ +  +T+ V A D+G+ +      +TVNVLD NDN PQI  D L+ +++   + E     +  ++ +   D D+  NG +  ++   +++  F L         NS      ++    DRE    Y + +   D G PP ++  T+ + I D NDN P+F    ++      I  +  PG+   TLI   ATDPD   N K+ Y +         + +P TG ++     DRE          +        A D+  P+ +   ++V V++ + D ND  P F S  Y  ++ E       V +V A D D      +I++ T    N    ++           +L R      +  V  K++      + V+  I ++D+NDN P F+Q   S Y   + E    GT + +V A+D D+  NGK+TY L N   +  F I+  +GE+ +   +DR  +    L + A+D G PS
Sbjct:  411 ITATDADLGTFGALTYELRGGQAAYFSV---NADNGTISAAQILDYDTLRQYQFSLVVKDGGGFYQEIAIATVTVTLQDVNDNDPEFTGMP--YTSDIAENLPAGTIVFQVTATDKDSGENGRLSFNISAGDD---GGHFSING-SGLVTTARELDRET-IATYTLTVSAYDHGVSSRHKHVQLTVNVLDENDNTPQIT-DGLTITTN---ISEGAGGGTVLLSSIAAVDPDAGSNGQLTYSMSGGDSR--FTL---------NSATGRLQISPTGLDRELKDSYDLIINVTDNGSPPNTNSTTVHVTILDVNDNTPAFDPNPAQSLATYVITVDEGPGTINKTLIDINATDPDADANGKVAYSLSGDEHGFFRL-DPVTGELSVRKELDRESPQMSRNAQGDGRFLLDITATDQATPISDRKSATVRVSITVRDTNDNSPQFQSQNYETRLSEAARPGSNVIQVSATDQDLEYKGKVIYNITDGDENRKCEVE-----------KLVRHYNWHKKNCVLCKESKCSVERTYVV--IYVDDVNDNDPVFNQ---SKYAADVLENSPTGTPVLRVHASDRDQGANGKITYKLTNGNKDDAFSINNVTGEITVAGVIDREAVHTFVLTVQAEDQGEPS 1004          

HSP 7 Score: 135.576 bits (340), Expect = 4.358e-32
Identity = 166/624 (26.60%), Postives = 267/624 (42.79%), Query Frame = 2
Query:  377 IKLSPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREE---------RDRYELVFIATDKGIP---KKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQT---ITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGW--VGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANN---KYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDN 2188
            I ++  D D   N ++ YS+ G + GFF+L  +     + K +   DRE            R+ L   ATD+  P   +K+  +++ I +RD ND++P+F   ++Y   + E A  GS +  +  TD+D E    V+ N  +D +  R  +V       L+   ++    +K  +        +      T + + V D+NDN P       + S     ++EN P  + V  V  +D D   NG +   L   N    F +     NN         I      DRE +  + +TVQ +DQG P  SS++T   + I ++DENDN P FS   ++  I EN    SP+ + I   PD         +I        S P     ++T      RE                        +TL I DE+   P+F  S Y+  + E  S    +G+V A D D   N+ I +S  G      ++ +S G+I  +    LDRE ++ Y L V A +    ++ ++  V I + D+ D+ P F+    S    K++E    GT +TK+ A D D  +   ++Y +AN      F ID  +GE+     LDR  +    L + AKD+
Sbjct:  731 IDINATDPDADANGKVAYSLSGDEHGFFRLDPVTGELSVRKEL---DRESPQMSRNAQGDGRFLLDITATDQATPISDRKSATVRVSITVRDTNDNSPQF-QSQNYETRLSEAARPGSNVIQVSATDQDLEYKGKVIYNI-TDGDENRKCEVEK-----LVRHYNWH---KKNCVLCKESKCSVER----TYVVIYVDDVNDNDP-----VFNQSKYAADVLENSPTGTPVLRVHASDRDQGANGKITYKLTNGNKDDAFSI-----NNVTG-----EITVAGVIDREAVHTFVLTVQAEDQGEP--SSRKTFAEVVITVKDENDNFPQFSFTGYEGEIAEN----SPVGSTITMVPD--------QKISSSTLRPRSSPRAPAALLTA-----REKR---------------------PITL-INDES---PLFEKSMYYVNVSESASRGIVIGRVTATDRDEGINAIIFYSSNG-AEAKFYVSRSTGDIIVDS--PLDREFKNVYILNVTAANIVAGAQDTTTQVHITVTDVIDDKPYFNS---SSLTVKLSENASIGTNVTKITALDKDIGDT--ISYSIANGDPYGLFTIDNVTGEIRTVAELDRENVTQYELFVQAKDS 1270          

HSP 8 Score: 134.806 bits (338), Expect = 8.982e-32
Identity = 142/532 (26.69%), Postives = 229/532 (43.05%), Query Frame = 2
Query:  551 IATDKGIPKK-TGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISG-LTLISRLDYESSMRKFTIPVIAVDNG-IPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFS-KFFFQDRIKENIMPGSPIFTLIAT-DPDIGKNAKIIYQIPEKYQNIISIPNPSTG-IVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMF------LSSAYHFKIKEGYSGWVGK----VEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGI-----QLDREVQS--TYQLTVEAKDNGVP---SRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTY 2068
            +AT+    +K +    + + + ++ND+ P F     Y   + E+   G+ I DI  TD D  T   +            +F V+A +G ++    LDY++ +R++   ++  D G         T+TV + D+NDN P+      +       + EN P  + V  VT TD DS  NG +  N+   ++  +F +                + T RE DRETI+ Y +TV   D G+        +T+ + DENDN P  +        I E    G+ + + IA  DPD G N ++ Y +           N +TG +  +    DRE+  S        D  +P   +S  V + I D ND  P F        + Y   + EG  G + K    + A D D+++N  + +S +G  H    +    G +   K +     Q+ R  Q    + L + A D   P    +S++V V I + D NDNSP+F       Y  +++E   PG+ + +V ATD D    GKV Y
Sbjct:  359 VATETDTSEKFSANASVTLTLINVNDNKPMF-AKSSYNYTMDEEITPGTHIADITATDADLGTFGALTYELRGGQAA--YFSVNADNGTISAAQILDYDT-LRQYQFSLVVKDGGGFYQEIAIATVTVTLQDVNDNDPE-----FTGMPYTSDIAENLPAGTIVFQVTATDKDSGENGRLSFNISAGDDGGHFSINGSGL-----------VTTARELDRETIATYTLTVSAYDHGVSSRHKHVQLTVNVLDENDNTPQITDGLTITTNISEGAGGGTVLLSSIAAVDPDAGSNGQLTYSMSGGDSRFTL--NSATGRLQISPTGLDRELKDSYDLIINVTDNGSPPNTNSTTVHVTILDVNDNTPAFDPNPAQSLATYVITVDEG-PGTINKTLIDINATDPDADANGKVAYSLSGDEHGFFRLDPVTGELSVRKELDRESPQMSRNAQGDGRFLLDITATDQATPISDRKSATVRVSITVRDTNDNSPQFQS---QNYETRLSEAARPGSNVIQVSATDQDLEYKGKVIY 864          

HSP 9 Score: 123.635 bits (309), Expect = 2.216e-28
Identity = 126/453 (27.81%), Postives = 195/453 (43.05%), Query Frame = 2
Query:  383 LSPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFD-----MPKDYVIGVKEDAIEGSK-ICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISG-LTLISRLDYESSMR--------KFTIPVIAVDNGIP---NLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNF--KLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEP--NNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQT-ITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSS-VEVTLEIEDENDCIPMFLSSAYHFKIKE 1669
            ++  D D G N ++ YS+ G D   F L        I  T    DRE +D Y+L+   TD G P  T    +++ I D+ND+ P FD         YVI V E     +K + DI  TD D +    V  + + D      F++  ++G L++   LD ES           +F + + A D   P     + +  +++ V D NDN PQ         S N+  +L E     S V  V+ TD D E  G V  N+ +   N K   E + R++N                       H +  V CK+      S ++T + I+++D NDN P F++  +   + EN   G+P+  + A+D D G N KI Y++    ++     N  TG +T     DRE   +      A D+  P    +  EV + ++DEND  P F  + Y  +I E
Sbjct:  622 IAAVDPDAGSNGQLTYSMSGGDS-RFTLNSATGRLQISPTG--LDRELKDSYDLIINVTDNGSPPNTNSTTVHVTILDVNDNTPAFDPNPAQSLATYVITVDEGPGTINKTLIDINATDPDADANGKVAYSLSGDEH--GFFRLDPVTGELSVRKELDRESPQMSRNAQGDGRFLLDITATDQATPISDRKSATVRVSITVRDTNDNSPQF-------QSQNYETRLSEAARPGSNVIQVSATDQDLEYKGKVIYNITDGDENRKCEVEKLVRHYN----------------------WHKKNCVLCKES---KCSVERTYVVIYVDDVNDNDPVFNQSKYAADVLENSPTGTPVLRVHASDRDQGANGKITYKLTNGNKDDAFSINNVTGEITVAGVIDREAVHTFVLTVQAEDQGEPSSRKTFAEVVITVKDENDNFPQFSFTGYEGEIAE 1037          

HSP 10 Score: 117.857 bits (294), Expect = 1.158e-26
Identity = 158/603 (26.20%), Postives = 276/603 (45.77%), Query Frame = 2
Query:  527 RDRYEL-VFIATD--KGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLIN-SNSDPEVKRHFQVSAISG-LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLME---NKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLR-EFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENI-MPGSPIF-TLIATDPDIGKNA---KIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITF-----------------------KAFALD-EFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYS--GWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSV-IVQIQLEDINDNSPKFS-QPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLA---NNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPS 2200
            +D YE  V++  D   G   + G    ++ + D ND+AP F   + Y+  + E+A  G+ I  I   D D  T   V    SN+       F +++++G LTL   LD+E + R + + VIA D G+P L + TT+ + V DI+D  P+ +         +F L E   N P  S V  V   D D  +N  +   +I  N+   F + S           N  ++T+    D E    +R+TV+  +   P  ++  T+ + + D NDN P+F +  +   ++E++ +PG  +   L  TD D  KN    +++Y +     +  +I +P++G +    + D E   + TF                       K  A + + +   +++  VTL + + ND  PMF  S+Y++ + E  +    +  + A D D  +   + +   G    +  +   +G I + +   LD +    YQ ++  KD G   +  ++  V + L+D+NDN P+F+  P    Y   I E L  GT++ +V ATD D  ENG++++ ++   +  +F I+  SG V   R LDR  +    L + A D+G  S
Sbjct:    6 QDNYEFTVYVEDDFNGGGLARRGSKFFFLIVDDYNDNAPVF-TEQPYMAKIAENARVGTTILKISAIDADSGTNSQVQYKFSNATATQTPFFSLNSVNGELTLGGPLDFEVA-RSYMLVVIAEDLGVPKLESRTTVIIEVTDISDMPPRFL--------QSFYLKEIEENTPIGSTVVTVEARDGDVGINNPILYEIISGNSDGVFTIDS-----------NTGVITVNGSIDAEKTDVFRITVKASEVPDPNSNTTVTVVVTVVDVNDNRPAFLQSVYIFDVREDVALPGRVVSDQLQVTDGD--KNPVFRRVLYHLVGADSDKFAI-DPTSGTLYINKTLDYEKQINFTFDWERGCGSGGGSGWDWTGRGEEKKVVATETDTSEKFSANASVTLTLINVNDNKPMFAKSSYNYTMDEEITPGTHIADITATDADLGTFGALTYELRGGQAAYFSVNADNGTISAAQ--ILDYDTLRQYQFSLVVKDGGGFYQEIAIATVTVTLQDVNDNDPEFTGMP----YTSDIAENLPAGTIVFQVTATDKDSGENGRLSFNISAGDDGGHFSIN-GSGLVTTARELDRETIATYTLTVSAYDHGVSS 577          

HSP 11 Score: 110.923 bits (276), Expect = 1.817e-24
Identity = 133/519 (25.63%), Postives = 217/519 (41.81%), Query Frame = 2
Query:  380 KLSPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDET--LITVLINSNSDPEVKRHFQVSAISGL-TLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRY-----FNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTIT---IWIEDENDNPPSFSKFFFQDRIKENIMP--GSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSA--------YHFKIKEGYSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDN 1873
            +++  D D   N+ + Y I   +     +  +     I  T    DRE+   Y L+  A D GIP       + I I D+ND+ P F     Y + ++E     +++  +  TD D+      T  I +    +V   F + A +GL T+ ++LDYE +   + + V A D G P LT +  + ++V D++DN P            + +L EN  +   V  V  TD D+E +       IE  N  +  LI         N  P+   N          RET  H R  +Q        L+ Q+++    I + D NDN P F    +   + E+  P   + I T+ A D D G++ +II+ I    +N +   +  TG++T     DRE  +  +    A D+  P L+SSV V + + D ND +P+  +            F +KE     V        D ++ + I +  T       +IL         + I LDRE  S + L V+A ++
Sbjct: 1524 RVATTDEDINDNARVRYYISSGNTSL--MFSVNETTGIISTTSTLDREQNASYTLIITAKDHGIPALESNTSVMITIEDVNDNKPLFSKSV-YNVTLRESVFLKTQVVQVIATDPDEGANGQFTYKITAGDTDDV---FYIDANTGLITIKAKLDYEKT-SLYNLTVSAQDLGTPPLTGACFVEIHVSDVDDNAP-----VFHKPRYSAELYENVTRGHHVITVNATDIDAEASHKRVYYRIESGNTDSMFLIGEQSGVITLNCTPSGCLN----------RET--HARYELQVAAISRVNLTEQKSLVPAVITVLDVNDNAPRFDSESYVRSVLEDTGPITDATILTVKAQDGDEGESGEIIFTIVSGNENGVFQMDNKTGVLTRTRPLDREDTSFYSLVVMAEDKGEPALSSSVTVNITVLDMNDNLPILQTPMDVLIPERRTTFSVKENLDAGVPVGVVAAQDLDTKNLIYYYITNTEEQKYFILNETSGELRTR-ITLDREDSSVHYLYVKASND 2017          
BLAST of protocadherin-1 vs. Ensembl Medaka
Match: celsr3 (cadherin EGF LAG seven-pass G-type receptor 3 [Source:NCBI gene;Acc:101169110])

HSP 1 Score: 231.491 bits (589), Expect = 2.653e-61
Identity = 188/626 (30.03%), Postives = 307/626 (49.04%), Query Frame = 2
Query:  377 IKLSPRDSDYGINSEIIYSIEGKDKGFFKL-LQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPK--KTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITV---LINSNSDPEVKRHFQVSAISG-LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTI-TVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPE-KYQNIISIPNPS-TGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGY--SGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSD---GNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNKY----FIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTP 2197
            ++L  +DSD   N+ I Y   G      ++  ++     +  T    DRE  + Y L   A+D+G     ++  +K++I + D ND+ P+F   K YV+ VKED    S+I  +  TD+D ++   V   +I+ NS    +  F + +++G + +++ LDYES  R++T+ V A DNG P L+ +T I +V V D+NDN P I + T   +S    ++E+ P  S +  +   D DS  N  ++  L    +   F +         NS   +  V+    DRE++ HY   V+ +D G+PPLS+  ++TI + D NDN P F +  +  R+ E+   G+ + T+ A D D+  N+ + YQI     +N  +I      G+++  +  D +          A D     L+ + +V + I D N   P+F S+ Y   + E       V  + A D+D   N+ I +    FL +++   + D   G I  +   +LD E Q TY L + AKDNG+P +S +  V++ + D+NDNSP+F  P    Y   ++E   P T + ++ ATD D + NG+V Y   N +     F I+  SG V   R LDR  +    L   A D G P
Sbjct: 1060 LQLRAKDSDSPSNANIRYRFVGDTAVMARVAFEIDPRSGLITTRGSVDRESNEHYTLHVEASDQGKDPGPRSATVKVFITVLDENDNVPQFS-EKRYVVAVKEDVRPHSEILRVSATDRDKDSNAAVHYNIISGNS----RGQFSIDSVTGEIQVVAPLDYESE-REYTLRVRAQDNGRPPLSNNTGIVSVQVTDVNDN-PPIFVSTPFQAS----VLESAPVGSSILHIQAIDTDSGDNARLEYRLTGTGSDTPFII---------NSATGWVTVS-SILDRESVEHYFFGVEARDYGMPPLSATASVTITVMDVNDNRPEFLQKEYYGRLNEDAAVGTSVVTVTAVDRDV--NSAVTYQITGGNTRNRFAISTAGGAGLLSLALPLDYKQERRYVLTVTASDR---TLHDTCQVHINITDANTHRPVFQSAHYSVSVNEDQPPGSTVVVISATDDDVGENARITY----FLEDNIPQFRIDPATGAITLQA--ELDYEDQMTYTLAITAKDNGIPQKSDTTYVEVNVNDVNDNSPQFLSPR---YQGTVSEDAPPFTSVLQISATDRDAHANGRVQYTFQNGEDGDGDFTIEPTSGIVRTVRRLDRESVPFYELTAYAVDRGVP 1650          

HSP 2 Score: 216.083 bits (549), Expect = 1.707e-56
Identity = 183/619 (29.56%), Postives = 276/619 (44.59%), Query Frame = 2
Query:  377 IKLSPRDSDYGINSEIIYSI----EGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEV--KRHFQVSAISGL-TLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITV--NVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTI-TIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGWVGKVEAYXXXXXXXXXIIFSFT-GFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANN-KYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTP 2197
            I +S  D D G    + YS+      +   +F   Q+  N  +  T ++ DRE  D +     ATD G P+ +G   + I + D NDH+P F+   +Y   ++E+  EG  I  ++  D D  +   +      D  V  +  F++   SGL T    +D ES+   +T+ V A D G      S T+ V   VLD NDN PQ      S+      + E+    S +  V+ TD D + N  V  N+I  N++  F + S              I  +   D E+   Y + V+ +D G PPLS+   I ++ + D NDNPP F    FQ  + E+   GS I  + A D D G NA++ Y++     +   I N +TG VT     DRE      F   A D   P L+++  VT+ + D ND  P FL   Y+ ++ E  +     V     D + NS + +  T G   N   I  + G       + LD + +  Y LTV A D    +   +  V I + D N + P F     + Y   + E   PG+ +  + ATDDD  EN ++TY L +N   F ID  +G + +   LD  + +   L I AKDNG P
Sbjct:  952 IIMSATDPDPGDPGRMSYSMAPLMNSRSSDYF---QIHPNTGLITTTQMLDREHMDLHHFRVTATDHGSPRLSGTTMVTITVSDRNDHSPIFEQ-SEYRETIRENVEEGYPILQLRAKDSDSPSNANIRYRFVGDTAVMARVAFEIDPRSGLITTRGSVDRESN-EHYTLHVEASDQGKDPGPRSATVKVFITVLDENDNVPQ-----FSEKRYVVAVKEDVRPHSEILRVSATDRDKDSNAAVHYNIISGNSRGQFSIDSV----------TGEIQVVAPLDYESEREYTLRVRAQDNGRPPLSNNTGIVSVQVTDVNDNPPIFVSTPFQASVLESAPVGSSILHIQAIDTDSGDNARLEYRLTGTGSDTPFIINSATGWVTVSSILDRESVEHYFFGVEARDYGMPPLSATASVTITVMDVNDNRPEFLQKEYYGRLNEDAAVGTSVVTVTAVDRDVNSAVTYQITGGNTRNRFAISTAGGAGLLSLALPLDYKQERRYVLTVTASDR---TLHDTCQVHINITDANTHRPVFQS---AHYSVSVNEDQPPGSTVVVISATDDDVGENARITYFLEDNIPQFRIDPATGAITLQAELDYEDQMTYTLAITAKDNGIP 1544          

HSP 3 Score: 158.688 bits (400), Expect = 1.323e-38
Identity = 129/418 (30.86%), Postives = 191/418 (45.69%), Query Frame = 2
Query:  401 DYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKD--DETLITVLINSNSDPEVKRHFQVSAISG-LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQ-----IPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIP 1630
            D  +NS + Y I G +      +       +       D ++  RY L   A+D+ +       +++I I D N H P F     Y + V ED   GS +  I  TD D  +   IT  +  N  P+    F++   +G +TL + LDYE  M  +T+ + A DNGIP  + +T + VNV D+NDN PQ +      + S     E+ P  + V  ++ TD D+  NG V          QN E     F   P S     + T+R  DRE++  Y +T    D+G+PP  +   I + + D NDN P F    F+  +KEN   GS +  + ATDPD G NA+I+YQ     IPE +Q  I      +G +T+L+  D E          A     PL+ S   V + + D+ND  P
Sbjct: 1387 DRDVNSAVTYQITGGNTRNRFAISTAGGAGLLSLALPLDYKQERRYVLTVTASDRTLHDTC---QVHINITDANTHRPVFQ-SAHYSVSVNEDQPPGSTVVVISATDDDVGENARITYFLEDNI-PQ----FRIDPATGAITLQAELDYEDQM-TYTLAITAKDNGIPQKSDTTYVEVNVNDVNDNSPQFLSPRYQGTVS-----EDAPPFTSVLQISATDRDAHANGRVQYTF------QNGEDGDGDFTIEPTSGI---VRTVRRLDRESVPFYELTAYAVDRGVPPQRTPVHIQVTVLDVNDNAPVFPADDFEVLVKENSAVGSVVSQITATDPDEGANAQIMYQIVEGNIPEIFQMDI-----FSGELTSLIDLDYEARNEYVIVVQATSA--PLV-SRATVRIRLVDQNDNRP 1772          

HSP 4 Score: 114.775 bits (286), Expect = 3.328e-25
Identity = 97/311 (31.19%), Postives = 155/311 (49.84%), Query Frame = 2
Query: 1313 PSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIP----EKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIK----EGYSGWVGKVEAYXXXXXXXXXIIFSFTG---FLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVP--SRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTY-LLANNK--YFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTP 2197
            P FS + +Q ++ EN    + +  + ATDPD G   ++ Y +      +  +   I +P+TG++T     DRE      F+  A D  +P L+ +  VT+ + D ND  P+F  S Y   I+    EGY   + ++ A D+DS SN++I + F G    +    + +     + + +G  +DRE    Y L VEA D G     RS++V V I + D NDN P+FS+     Y+  + E + P + I +V ATD D++ N  V Y +++ N    F ID  +GE+ +   LD        L + A+DNG P
Sbjct:  930 PHFSLYNYQVQVAENQPSSTSVIIMSATDPDPGDPGRMSYSMAPLMNSRSSDYFQI-HPNTGLITTTQMLDREHMDLHHFRVTATDHGSPRLSGTTMVTITVSDRNDHSPIFEQSEYRETIRENVEEGYP--ILQLRAKDSDSPSNANIRYRFVGDTAVMARVAFEIDPRSGLITTRG-SVDRESNEHYTLHVEASDQGKDPGPRSATVKVFITVLDENDNVPQFSE---KRYVVAVKEDVRPHSEILRVSATDRDKDSNAAVHYNIISGNSRGQFSIDSVTGEIQVVAPLDYESEREYTLRVRAQDNGRP 1233          
BLAST of protocadherin-1 vs. Ensembl Medaka
Match: celsr3 (cadherin EGF LAG seven-pass G-type receptor 3 [Source:NCBI gene;Acc:101169110])

HSP 1 Score: 231.491 bits (589), Expect = 2.654e-61
Identity = 188/626 (30.03%), Postives = 307/626 (49.04%), Query Frame = 2
Query:  377 IKLSPRDSDYGINSEIIYSIEGKDKGFFKL-LQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPK--KTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITV---LINSNSDPEVKRHFQVSAISG-LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTI-TVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPE-KYQNIISIPNPS-TGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGY--SGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSD---GNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNKY----FIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTP 2197
            ++L  +DSD   N+ I Y   G      ++  ++     +  T    DRE  + Y L   A+D+G     ++  +K++I + D ND+ P+F   K YV+ VKED    S+I  +  TD+D ++   V   +I+ NS    +  F + +++G + +++ LDYES  R++T+ V A DNG P L+ +T I +V V D+NDN P I + T   +S    ++E+ P  S +  +   D DS  N  ++  L    +   F +         NS   +  V+    DRE++ HY   V+ +D G+PPLS+  ++TI + D NDN P F +  +  R+ E+   G+ + T+ A D D+  N+ + YQI     +N  +I      G+++  +  D +          A D     L+ + +V + I D N   P+F S+ Y   + E       V  + A D+D   N+ I +    FL +++   + D   G I  +   +LD E Q TY L + AKDNG+P +S +  V++ + D+NDNSP+F  P    Y   ++E   P T + ++ ATD D + NG+V Y   N +     F I+  SG V   R LDR  +    L   A D G P
Sbjct: 1060 LQLRAKDSDSPSNANIRYRFVGDTAVMARVAFEIDPRSGLITTRGSVDRESNEHYTLHVEASDQGKDPGPRSATVKVFITVLDENDNVPQFS-EKRYVVAVKEDVRPHSEILRVSATDRDKDSNAAVHYNIISGNS----RGQFSIDSVTGEIQVVAPLDYESE-REYTLRVRAQDNGRPPLSNNTGIVSVQVTDVNDN-PPIFVSTPFQAS----VLESAPVGSSILHIQAIDTDSGDNARLEYRLTGTGSDTPFII---------NSATGWVTVS-SILDRESVEHYFFGVEARDYGMPPLSATASVTITVMDVNDNRPEFLQKEYYGRLNEDAAVGTSVVTVTAVDRDV--NSAVTYQITGGNTRNRFAISTAGGAGLLSLALPLDYKQERRYVLTVTASDR---TLHDTCQVHINITDANTHRPVFQSAHYSVSVNEDQPPGSTVVVISATDDDVGENARITY----FLEDNIPQFRIDPATGAITLQA--ELDYEDQMTYTLAITAKDNGIPQKSDTTYVEVNVNDVNDNSPQFLSPR---YQGTVSEDAPPFTSVLQISATDRDAHANGRVQYTFQNGEDGDGDFTIEPTSGIVRTVRRLDRESVPFYELTAYAVDRGVP 1650          

HSP 2 Score: 216.083 bits (549), Expect = 1.708e-56
Identity = 183/619 (29.56%), Postives = 276/619 (44.59%), Query Frame = 2
Query:  377 IKLSPRDSDYGINSEIIYSI----EGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEV--KRHFQVSAISGL-TLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITV--NVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTI-TIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGWVGKVEAYXXXXXXXXXIIFSFT-GFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANN-KYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTP 2197
            I +S  D D G    + YS+      +   +F   Q+  N  +  T ++ DRE  D +     ATD G P+ +G   + I + D NDH+P F+   +Y   ++E+  EG  I  ++  D D  +   +      D  V  +  F++   SGL T    +D ES+   +T+ V A D G      S T+ V   VLD NDN PQ      S+      + E+    S +  V+ TD D + N  V  N+I  N++  F + S              I  +   D E+   Y + V+ +D G PPLS+   I ++ + D NDNPP F    FQ  + E+   GS I  + A D D G NA++ Y++     +   I N +TG VT     DRE      F   A D   P L+++  VT+ + D ND  P FL   Y+ ++ E  +     V     D + NS + +  T G   N   I  + G       + LD + +  Y LTV A D    +   +  V I + D N + P F     + Y   + E   PG+ +  + ATDDD  EN ++TY L +N   F ID  +G + +   LD  + +   L I AKDNG P
Sbjct:  952 IIMSATDPDPGDPGRMSYSMAPLMNSRSSDYF---QIHPNTGLITTTQMLDREHMDLHHFRVTATDHGSPRLSGTTMVTITVSDRNDHSPIFEQ-SEYRETIRENVEEGYPILQLRAKDSDSPSNANIRYRFVGDTAVMARVAFEIDPRSGLITTRGSVDRESN-EHYTLHVEASDQGKDPGPRSATVKVFITVLDENDNVPQ-----FSEKRYVVAVKEDVRPHSEILRVSATDRDKDSNAAVHYNIISGNSRGQFSIDSV----------TGEIQVVAPLDYESEREYTLRVRAQDNGRPPLSNNTGIVSVQVTDVNDNPPIFVSTPFQASVLESAPVGSSILHIQAIDTDSGDNARLEYRLTGTGSDTPFIINSATGWVTVSSILDRESVEHYFFGVEARDYGMPPLSATASVTITVMDVNDNRPEFLQKEYYGRLNEDAAVGTSVVTVTAVDRDVNSAVTYQITGGNTRNRFAISTAGGAGLLSLALPLDYKQERRYVLTVTASDR---TLHDTCQVHINITDANTHRPVFQS---AHYSVSVNEDQPPGSTVVVISATDDDVGENARITYFLEDNIPQFRIDPATGAITLQAELDYEDQMTYTLAITAKDNGIP 1544          

HSP 3 Score: 158.688 bits (400), Expect = 1.323e-38
Identity = 129/418 (30.86%), Postives = 191/418 (45.69%), Query Frame = 2
Query:  401 DYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKD--DETLITVLINSNSDPEVKRHFQVSAISG-LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQ-----IPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIP 1630
            D  +NS + Y I G +      +       +       D ++  RY L   A+D+ +       +++I I D N H P F     Y + V ED   GS +  I  TD D  +   IT  +  N  P+    F++   +G +TL + LDYE  M  +T+ + A DNGIP  + +T + VNV D+NDN PQ +      + S     E+ P  + V  ++ TD D+  NG V          QN E     F   P S     + T+R  DRE++  Y +T    D+G+PP  +   I + + D NDN P F    F+  +KEN   GS +  + ATDPD G NA+I+YQ     IPE +Q  I      +G +T+L+  D E          A     PL+ S   V + + D+ND  P
Sbjct: 1387 DRDVNSAVTYQITGGNTRNRFAISTAGGAGLLSLALPLDYKQERRYVLTVTASDRTLHDTC---QVHINITDANTHRPVFQ-SAHYSVSVNEDQPPGSTVVVISATDDDVGENARITYFLEDNI-PQ----FRIDPATGAITLQAELDYEDQM-TYTLAITAKDNGIPQKSDTTYVEVNVNDVNDNSPQFLSPRYQGTVS-----EDAPPFTSVLQISATDRDAHANGRVQYTF------QNGEDGDGDFTIEPTSGI---VRTVRRLDRESVPFYELTAYAVDRGVPPQRTPVHIQVTVLDVNDNAPVFPADDFEVLVKENSAVGSVVSQITATDPDEGANAQIMYQIVEGNIPEIFQMDI-----FSGELTSLIDLDYEARNEYVIVVQATSA--PLV-SRATVRIRLVDQNDNRP 1772          

HSP 4 Score: 114.775 bits (286), Expect = 3.329e-25
Identity = 97/311 (31.19%), Postives = 155/311 (49.84%), Query Frame = 2
Query: 1313 PSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIP----EKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIK----EGYSGWVGKVEAYXXXXXXXXXIIFSFTG---FLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVP--SRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTY-LLANNK--YFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTP 2197
            P FS + +Q ++ EN    + +  + ATDPD G   ++ Y +      +  +   I +P+TG++T     DRE      F+  A D  +P L+ +  VT+ + D ND  P+F  S Y   I+    EGY   + ++ A D+DS SN++I + F G    +    + +     + + +G  +DRE    Y L VEA D G     RS++V V I + D NDN P+FS+     Y+  + E + P + I +V ATD D++ N  V Y +++ N    F ID  +GE+ +   LD        L + A+DNG P
Sbjct:  930 PHFSLYNYQVQVAENQPSSTSVIIMSATDPDPGDPGRMSYSMAPLMNSRSSDYFQI-HPNTGLITTTQMLDREHMDLHHFRVTATDHGSPRLSGTTMVTITVSDRNDHSPIFEQSEYRETIRENVEEGYP--ILQLRAKDSDSPSNANIRYRFVGDTAVMARVAFEIDPRSGLITTRG-SVDRESNEHYTLHVEASDQGKDPGPRSATVKVFITVLDENDNVPQFSE---KRYVVAVKEDVRPHSEILRVSATDRDKDSNAAVHYNIISGNSRGQFSIDSVTGEIQVVAPLDYESEREYTLRVRAQDNGRP 1233          
BLAST of protocadherin-1 vs. Ensembl Medaka
Match: pcdh18a (protocadherin 18 [Source:NCBI gene;Acc:101171130])

HSP 1 Score: 227.254 bits (578), Expect = 1.450e-60
Identity = 177/550 (32.18%), Postives = 283/550 (51.45%), Query Frame = 2
Query:  386 SPRDSDYGINSEIIYSIEGKDKGFFKL-LQMKNNKPIFK---TMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDD--ETLITVLINSNSDPEVKRHFQVSAISG-LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSN--FKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIP-----NPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPM--------FLSSAYHFKIKEGYSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSG 1969
            S  D D G NS   Y++   +  FFK+ +Q +++   +     ++  DRE R  YEL + A D+G+P +TG   + I + D ND++P F+    YVI + E+A  G+ + D+  TD D+     I    +S+  P++   F+++  SG +TL+ RLDYE+ ++ + I V A D G  ++     I V V+D+NDN P I I  +S   +     + E  P ++FVA+V V D DS +NG V+C L   +++ NF+L  +Y NN       Y I+T    DRE  S + +TV  +D+G+P LS+ +  T+ I DENDNPP F K  ++    EN  PG+ + ++ A+DPD+  N ++ Y I E + N   I      +PS G +  L +FDRE  + I+F   A D   P L S+  V L I DEND  P+        F +  + FK  E     V  V A D D+  N++++ S +G      ++++            L+       +L +  +D G  S S+  +++I L +  +N     QP+D G
Sbjct:  164 SATDPDVGENSLYTYALAPNN--FFKVDIQSRSDGVKYAELVVLRELDRELRSSYELQYSAYDRGVPPRTGSTLLKISVTDSNDNSPVFEK-SSYVINLPENATVGTLLIDLNATDADEGKNAKIVYSFSSHVSPKIMETFKINPDSGHITLMRRLDYET-IKSYDIDVQAQDMGPNSMPAHCKILVKVVDVNDNKPDISISLMSSQGNGDAAYISEASPLDTFVALVRVEDLDSGLNGEVECRL---HSQGNFKLQKKYENN-------YMILTNVSLDREKRSEFSLTVVAEDRGIPSLSTVKHFTVHITDENDNPPHFEKGRYEIFKSENNAPGAYLTSISASDPDLDANGQVSYTILENFINESPISTYVNIDPSNGAIYALRTFDREDVSRISFVVQAKDAGKPPLQSNATVVLNILDENDNPPVIVVPQLWNFTADVHVFKFTEA-GQLVTVVRATDRDTGVNAELLCSISGGNEEGFFLMEPR-TCEIHANASLENFPHEHAELKIVVRDQGSESLSAKAVLKITLYENREN---HVQPMDQG 694          

HSP 2 Score: 120.553 bits (301), Expect = 4.126e-27
Identity = 150/573 (26.18%), Postives = 251/573 (43.80%), Query Frame = 2
Query:  593 KIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKD--DETLITVLINSNSDPEVKRHFQVSAISGLTLISRLDYESSMR-KFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNL---IEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKEN---IMPGSPIFTLIA----TDPDIGKNAKII--------YQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYH-FKIKEGYSG-WVGKVEAYXXXXXXXXXIIFS-FTGFLH-----NHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQP-----LDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNK---YFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPS 2200
             I +++ D+ND+AP+F       I + E A  G++I     TD D  + +L T  +  N+  +V    +   +    L+   + +  +R  + +   A D G+P  T ST + ++V D NDN P         SS    L EN    + +  +  TDAD   N  +  +    + P   + F++        P+S     I  +R  D ETI  Y + VQ +D G   + +   I + + D NDN P  S      +   +   I   SP+ T +A     D D G N ++         +++ +KY+N       +  I+TN VS DRE  +  +    A D   P L++    T+ I DEND  P F    Y  FK +    G ++  + A D D ++N  + ++    F++      ++ I  S+G I++ +    DRE  S     V+AKD G P   S+  V + + D NDN P    P         ++ K TE    G L+T V ATD D   N ++   ++      +F+++ ++ E+  N +L+        L I+ +D G+ S
Sbjct:  126 HIEVEVLDINDNAPQFARAV-IPIEISESAAVGARIPLDSATDPDVGENSLYTYALAPNNFFKVDIQSRSDGVKYAELVVLRELDRELRSSYELQYSAYDRGVPPRTGSTLLKISVTDSNDNSP-----VFEKSSYVINLPENATVGTLLIDLNATDADEGKNAKIVYSFSSHVSPKIMETFKI-------NPDSG---HITLMRRLDYETIKSYDIDVQAQDMGPNSMPAHCKILVKVVDVNDNKPDISISLMSSQGNGDAAYISEASPLDTFVALVRVEDLDSGLNGEVECRLHSQGNFKLQKKYEN-------NYMILTN-VSLDREKRSEFSLTVVAEDRGIPSLSTVKHFTVHITDENDNPPHFEKGRYEIFKSENNAPGAYLTSISASDPDLDANGQVSYTILENFINESPISTYVNIDPSNGAIYALR--TFDREDVSRISFVVQAKDAGKPPLQSNATVVLNILDENDNPPVIVVPQLWNFTADVHVFKFTEA---GQLVTVVRATDRDTGVNAELLCSISGGNEEGFFLMEPRTCEIHANASLENFPHEHAELKIVVRDQGSES 669          

HSP 3 Score: 112.464 bits (280), Expect = 1.097e-24
Identity = 116/439 (26.42%), Postives = 196/439 (44.65%), Query Frame = 2
Query:  371 LSIKLSPRDSDYGINSEIIYSIEGK-DKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIG------VKEDAIEGSKICDIKVTDKDD--ETLITVLINSNSDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLM--ENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNP-----PSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSS--VEVTLEIEDENDCIPM 1633
            L I L+  D+D G N++I+YS          +  ++  +      M+  D E    Y++   A D G        KI +K+ D+ND+ P+  +      G      + E +   + +  ++V D D      +   ++S  + ++++ ++ + +  LT +S LD E    +F++ V+A D GIP+L+T    TV++ D NDN P             +++   EN    +++  ++ +D D + NG V   ++E  N  N   IS Y N  P+   N  I  LR FDRE +S     VQ KD G PPL S  T+ + I DENDNP     P    F     + +    G  +  + ATD D G NA+++  I    +    +  P T  +    S +   +     K    D+ +  L++   +++TL    EN   PM
Sbjct:  268 LLIDLNATDADEGKNAKIVYSFSSHVSPKIMETFKINPDSGHITLMRRLDYETIKSYDIDVQAQDMGPNSMPAHCKILVKVVDVNDNKPDISISLMSSQGNGDAAYISEASPLDTFVALVRVEDLDSGLNGEVECRLHSQGNFKLQKKYENNYMI-LTNVS-LDREKR-SEFSLTVVAEDRGIPSLSTVKHFTVHITDENDNPPHF-------EKGRYEIFKSENNAPGAYLTSISASDPDLDANGQVSYTILE--NFINESPISTYVNIDPS---NGAIYALRTFDREDVSRISFVVQAKDAGKPPLQSNATVVLNILDENDNPPVIVVPQLWNFTADVHVFKFTEAGQLVTVVRATDRDTGVNAELLCSISGGNEEGFFLMEPRTCEIHANASLENFPHEHAELKIVVRDQGSESLSAKAVLKITLYENRENHVQPM 691          
BLAST of protocadherin-1 vs. Ensembl Medaka
Match: pcdh18a (protocadherin 18 [Source:NCBI gene;Acc:101171130])

HSP 1 Score: 226.868 bits (577), Expect = 2.047e-60
Identity = 177/550 (32.18%), Postives = 283/550 (51.45%), Query Frame = 2
Query:  386 SPRDSDYGINSEIIYSIEGKDKGFFKL-LQMKNNKPIFK---TMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDD--ETLITVLINSNSDPEVKRHFQVSAISG-LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSN--FKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIP-----NPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPM--------FLSSAYHFKIKEGYSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSG 1969
            S  D D G NS   Y++   +  FFK+ +Q +++   +     ++  DRE R  YEL + A D+G+P +TG   + I + D ND++P F+    YVI + E+A  G+ + D+  TD D+     I    +S+  P++   F+++  SG +TL+ RLDYE+ ++ + I V A D G  ++     I V V+D+NDN P I I  +S   +     + E  P ++FVA+V V D DS +NG V+C L   +++ NF+L  +Y NN       Y I+T    DRE  S + +TV  +D+G+P LS+ +  T+ I DENDNPP F K  ++    EN  PG+ + ++ A+DPD+  N ++ Y I E + N   I      +PS G +  L +FDRE  + I+F   A D   P L S+  V L I DEND  P+        F +  + FK  E     V  V A D D+  N++++ S +G      ++++            L+       +L +  +D G  S S+  +++I L +  +N     QP+D G
Sbjct:  158 SATDPDVGENSLYTYALAPNN--FFKVDIQSRSDGVKYAELVVLRELDRELRSSYELQYSAYDRGVPPRTGSTLLKISVTDSNDNSPVFEK-SSYVINLPENATVGTLLIDLNATDADEGKNAKIVYSFSSHVSPKIMETFKINPDSGHITLMRRLDYET-IKSYDIDVQAQDMGPNSMPAHCKILVKVVDVNDNKPDISISLMSSQGNGDAAYISEASPLDTFVALVRVEDLDSGLNGEVECRL---HSQGNFKLQKKYENN-------YMILTNVSLDREKRSEFSLTVVAEDRGIPSLSTVKHFTVHITDENDNPPHFEKGRYEIFKSENNAPGAYLTSISASDPDLDANGQVSYTILENFINESPISTYVNIDPSNGAIYALRTFDREDVSRISFVVQAKDAGKPPLQSNATVVLNILDENDNPPVIVVPQLWNFTADVHVFKFTEA-GQLVTVVRATDRDTGVNAELLCSISGGNEEGFFLMEPR-TCEIHANASLENFPHEHAELKIVVRDQGSESLSAKAVLKITLYENREN---HVQPMDQG 688          

HSP 2 Score: 119.783 bits (299), Expect = 6.470e-27
Identity = 150/573 (26.18%), Postives = 251/573 (43.80%), Query Frame = 2
Query:  593 KIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKD--DETLITVLINSNSDPEVKRHFQVSAISGLTLISRLDYESSMR-KFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNL---IEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKEN---IMPGSPIFTLIA----TDPDIGKNAKII--------YQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYH-FKIKEGYSG-WVGKVEAYXXXXXXXXXIIFS-FTGFLH-----NHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQP-----LDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNK---YFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPS 2200
             I +++ D+ND+AP+F       I + E A  G++I     TD D  + +L T  +  N+  +V    +   +    L+   + +  +R  + +   A D G+P  T ST + ++V D NDN P         SS    L EN    + +  +  TDAD   N  +  +    + P   + F++        P+S     I  +R  D ETI  Y + VQ +D G   + +   I + + D NDN P  S      +   +   I   SP+ T +A     D D G N ++         +++ +KY+N       +  I+TN VS DRE  +  +    A D   P L++    T+ I DEND  P F    Y  FK +    G ++  + A D D ++N  + ++    F++      ++ I  S+G I++ +    DRE  S     V+AKD G P   S+  V + + D NDN P    P         ++ K TE    G L+T V ATD D   N ++   ++      +F+++ ++ E+  N +L+        L I+ +D G+ S
Sbjct:  120 HIEVEVLDINDNAPQFARAV-IPIEISESAAVGARIPLDSATDPDVGENSLYTYALAPNNFFKVDIQSRSDGVKYAELVVLRELDRELRSSYELQYSAYDRGVPPRTGSTLLKISVTDSNDNSP-----VFEKSSYVINLPENATVGTLLIDLNATDADEGKNAKIVYSFSSHVSPKIMETFKI-------NPDSG---HITLMRRLDYETIKSYDIDVQAQDMGPNSMPAHCKILVKVVDVNDNKPDISISLMSSQGNGDAAYISEASPLDTFVALVRVEDLDSGLNGEVECRLHSQGNFKLQKKYEN-------NYMILTN-VSLDREKRSEFSLTVVAEDRGIPSLSTVKHFTVHITDENDNPPHFEKGRYEIFKSENNAPGAYLTSISASDPDLDANGQVSYTILENFINESPISTYVNIDPSNGAIYALR--TFDREDVSRISFVVQAKDAGKPPLQSNATVVLNILDENDNPPVIVVPQLWNFTADVHVFKFTEA---GQLVTVVRATDRDTGVNAELLCSISGGNEEGFFLMEPRTCEIHANASLENFPHEHAELKIVVRDQGSES 663          

HSP 3 Score: 112.079 bits (279), Expect = 1.628e-24
Identity = 116/439 (26.42%), Postives = 196/439 (44.65%), Query Frame = 2
Query:  371 LSIKLSPRDSDYGINSEIIYSIEGK-DKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIG------VKEDAIEGSKICDIKVTDKDD--ETLITVLINSNSDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLM--ENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNP-----PSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSS--VEVTLEIEDENDCIPM 1633
            L I L+  D+D G N++I+YS          +  ++  +      M+  D E    Y++   A D G        KI +K+ D+ND+ P+  +      G      + E +   + +  ++V D D      +   ++S  + ++++ ++ + +  LT +S LD E    +F++ V+A D GIP+L+T    TV++ D NDN P             +++   EN    +++  ++ +D D + NG V   ++E  N  N   IS Y N  P+   N  I  LR FDRE +S     VQ KD G PPL S  T+ + I DENDNP     P    F     + +    G  +  + ATD D G NA+++  I    +    +  P T  +    S +   +     K    D+ +  L++   +++TL    EN   PM
Sbjct:  262 LLIDLNATDADEGKNAKIVYSFSSHVSPKIMETFKINPDSGHITLMRRLDYETIKSYDIDVQAQDMGPNSMPAHCKILVKVVDVNDNKPDISISLMSSQGNGDAAYISEASPLDTFVALVRVEDLDSGLNGEVECRLHSQGNFKLQKKYENNYMI-LTNVS-LDREKR-SEFSLTVVAEDRGIPSLSTVKHFTVHITDENDNPPHF-------EKGRYEIFKSENNAPGAYLTSISASDPDLDANGQVSYTILE--NFINESPISTYVNIDPS---NGAIYALRTFDREDVSRISFVVQAKDAGKPPLQSNATVVLNILDENDNPPVIVVPQLWNFTADVHVFKFTEAGQLVTVVRATDRDTGVNAELLCSISGGNEEGFFLMEPRTCEIHANASLENFPHEHAELKIVVRDQGSESLSAKAVLKITLYENRENHVQPM 685          
BLAST of protocadherin-1 vs. Ensembl Medaka
Match: ENSORLT00000005325.2 (protocadherin-16 [Source:NCBI gene;Acc:101171352])

HSP 1 Score: 223.402 bits (568), Expect = 9.178e-59
Identity = 188/588 (31.97%), Postives = 292/588 (49.66%), Query Frame = 2
Query:  428 YSI-EGKDKGFFKLLQMKN-NKPIFKTM---KLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKD--DETLITVLINS-NSDPEVKRHFQVSAISGLTLISR-LDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGWVG--KVEAYXXXXXXXXXIIFSFT----GFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLL---ANNKYFIIDEKSGEVFINRTL 2137
            Y+I EG     FKL   ++ NK ++  +    L DRE+R  Y LV  A D G P++ G + + + + D+NDHAP F+  + + I + E   +GS I  +   D+D  D  L+   IN   SDPE  R+F +   SG+  ++R LDYE   R   + V A DN      T+  +T++V D NDN P + I  LS+  S  ++ E      +VA ++VTD D      V+ +L   + K  F L ++           Y I   +  DRE    Y + V   D G PPL ++ + TI + D NDNPP F +  ++  I E + PGS +  + A D D G N  + Y +  K +   SI +P TGI+T   + D E   + +    A D   P L+S+ +V + ++D ND  P+F S+ Y+  +KE         +V A D D  S   I ++ T    G +     I K  G + +   +  D  ++  Y LTV A D G    SS+V V++++ DINDN P F   L   Y   ++    PGT + KV A D D  ENG++TY      ++ +F +++ +G + ++R+L
Sbjct:  163 YAIKEGNVGHMFKLESKRSANKVLYLDLVVSGLLDREKRSSYSLVIEAFDGGSPRRVGFMTLEVTVTDINDHAPVFNQSRYHAI-ISESLPQGSSILQVFAADEDEGDNGLVLYEINRRQSDPE--RYFVIDLKSGVITLNRPLDYELK-RVHELVVQARDNASQPEVTNAFVTIHVRDFNDNQPTMTIIFLSEDGSP-RISEGAQPGQYVARISVTDPDYGEYANVNVSLEGGDGK--FALTTK-------DSIIYLIYVDQVLDREERDSYDLRVMATDSGTPPLRAESSFTIQVTDVNDNPPLFDQQAYRQTIPEVVYPGSFVLQVTARDKDQGPNGDVRYSL-LKGKKWFSI-DPITGIITTATALDFESEPAPSVTVIATDGGRPPLSSTAKVDIVVQDVNDNAPVFSSNFYNVSVKENTPAGTCFLEVSATDEDRGSFGTITYALTLKSGGTVQTPFTINKQTGQLCTASALDRDEGLEK-YDLTVTATDGG--GLSSAVGVRVKVMDINDNRPTFYPVL---YTVSLSTHSAPGTSVVKVTANDPDAGENGRITYRTVPGGSSPFFTLNKDTGVISLSRSL 728          

HSP 2 Score: 182.185 bits (461), Expect = 6.470e-46
Identity = 174/624 (27.88%), Postives = 272/624 (43.59%), Query Frame = 2
Query:  380 KLSPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEV-----KRHFQVSAISG-LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDR-ETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGY--SGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLL--------ANNKYFIIDEKSGEVFINRTLDRLELVPR-RLLIMAKDNGTP 2197
            ++S  D DYG  + +  S+EG D G F L    +   +    ++ DREERD Y+L  +ATD G P    E    I++ D+ND+ P FD  + Y   + E    GS +  +   DKD           N D        K+ F +  I+G +T  + LD+ES     ++ VIA D G P L+++  + + V D+NDN P       S +  N  + EN P  +    V+ TD D    G +   L   +              F  +K+  ++ T    DR E +  Y +TV   D G   LSS   + + + D NDN P+F    +   +  +  PG+ +  + A DPD G+N +I Y+      +     N  TG+++   S   + NT I+    A+D        +  V + I   +   P+F  + Y F + E       VG V A      S        +G    +  +  + G I     + LD E  S+  L ++A+    PS   S  V I + DINDN+P F        +      +  GT+I ++ ATD D   NG++++ L        +  + F ID  SGEV +  +L   + VPR  L ++AKD G P
Sbjct:  370 RISVTDPDYGEYANVNVSLEGGD-GKFALTTKDSIIYLIYVDQVLDREERDSYDLRVMATDSGTPPLRAESSFTIQVTDVNDNPPLFDQ-QAYRQTIPEVVYPGSFVLQVTARDKDQ--------GPNGDVRYSLLKGKKWFSIDPITGIITTATALDFESEPAP-SVTVIATDGGRPPLSSTAKVDIVVQDVNDNAP-----VFSSNFYNVSVKENTPAGTCFLEVSATDEDRGSFGTITYALTLKSG-------GTVQTPFTINKQTGQLCTASALDRDEGLEKYDLTVTATDGG--GLSSAVGVRVKVMDINDNRPTFYPVLYTVSLSTHSAPGTSVVKVTANDPDAGENGRITYRTVPGGSSPFFTLNKDTGVISLSRSLHSKANTVISMVITAVDGDGLTAPVNARVNVSIVGGSTSSPVFEQAQYFFTVSEDVLRGTAVGVVRAATKTGVSKGIYYSISSGDPDGYFTVDSTSGTI--RTALPLDHETCSSLDLEIQARYGSPPSYGISR-VHISISDINDNAPTFLPSSSESLLLPEVTKM--GTVIYRIQATDKDSGHNGQLSFDLISAGAAGSSGQRTFGIDRGSGEVRLIGSLS-YDSVPRYDLQVIAKDGGAP 962          

HSP 3 Score: 181.03 bits (458), Expect = 1.694e-45
Identity = 175/610 (28.69%), Postives = 277/610 (45.41%), Query Frame = 2
Query:  407 GINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGI---PKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISG-LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKI----KEGYSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKD--NGVPSRSSSVIVQIQLEDINDNSPKFSQ-PLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANN-KYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPS 2200
            G NSE+ YSIE +      LL +     +    +  DRE      LV  ATD+ +    ++ G +   + ++D ND+ P F  P    I V ED   G  I  +   D D+     V     S     R F +S  +G L+++  LD E     F + ++A D+GIP L+TS  + V V+D+ND  P         +     +MENK   + V  VT TD D   NG +    +  +              F  +     I T +E D E  +HY +TV  +D GLPP  ++  + + ++D NDN P F+K ++   + EN  P   +  + ATDPD G   ++ Y+I     +     +  TG ++     DRE     T +  A+D  +P L+++  V +++ D ND  P+F  ++Y  ++    +EGY   V +V A D D   N  I++  +        + +  G I +     LDRE  ++Y   V A D    VP  SS+  V++ + D+NDN+P F Q PL      + ++ +     +  + A D D   NG V Y  A   K F I+  +GE+     L  L    R L++ A D G+P+
Sbjct: 1449 GPNSELRYSIEHQWPQTSDLLALDPLSGVLTIRQQLDRESTPFLYLVVRATDQAVDLSQRRWGSVTARLFVKDENDNPPVFSSPS--AISVMEDQPVGFVILHVMAHDADEGENGRVSYRIQSGNNAGR-FSLSPNTGSLSILKALDREEQ-EVFNLTIVAEDHGIPQLSTSQVLCVQVIDVNDEAPM-----FQQAEFGTHVMENKGPGTTVLKVTATDRDQGSNGHITYGGVTEDG-------------FVINPLTGVITTTKELDAELQNHYVLTVYARDGGLPPNFAKAVVRVEVQDVNDNAPVFAKMWYGLEVPEN-QPAVELCFVKATDPDSGPGGELEYKIAAGDPDGDFQLHSRTGALSTSHGLDREKKPKYTLEVVAVDRGSPALSATATVEVKVLDVNDNSPVFSKNSYTVEVLENAEEGYQ--VLQVSATDVDEGLNGKILYFLSQEADGAFAVDEDTGRITT--AAPLDREKLASYNFRVFAVDLSPSVPINSSAQ-VKVTILDVNDNAPFFIQDPLIIEVSSRRSQRV-----LATMKAEDKDFGANGSVFYRFATPVKGFSINSLTGEIQATEPLGSLTQAQRTLIVEAMDQGSPA 2025          

HSP 4 Score: 168.703 bits (426), Expect = 1.019e-41
Identity = 180/621 (28.99%), Postives = 277/621 (44.61%), Query Frame = 2
Query:  407 GINSEIIYSI-EGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISGL----------TLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISI-PNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEG-YSGWVGKV-EAYXXXXXXXX-XIIFSFTGFLHNHLWILKSDGNIFSEKGIQ----------LDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANN---KYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKD 2185
            G    I YS+  G  K  FK+      +   ++    D EE  R  LV  A        T  +   + ++D+ND+ P F + ++YV  +KE   +G ++  I+V  +D        ++   + +V    Q S++SGL          T  + +D E    +  + V A D G P L    T+TV ++D NDN P I +          ++ EN    + + +VT  D DS    +    L++P     F  I RY            +      D E  + Y VTVQ  D       ++  ITI +ED NDN P F+   +Q  + E+  PGS + T+ ATD D G+N ++ Y++    Q    I P+  T  + +   FD E   S+     A D  +P L+S   V + I D ND  P+F  S Y   + E  + G    + EA+DND +  +    F+       +++ ++S       +G Q          LD E +S Y LTV   D GVP RSSSV   I + D+NDN P FS+P    Y   ++E  V GT I ++ ATD D   N +V Y +++      F ID+ +G + + R LDR       ++I A D
Sbjct: 2075 GTRQGISYSLFSGNKKHLFKI-SSSTGEIWVESSNGLDFEETPRLRLVVKAE---TVSSTSFMAFNLVLQDVNDNLPRFQL-QNYVAFMKE--AQGYEMPIIQVVAED--------VDQGQNGQVTYSIQSSSMSGLFKIDPVTGSITTTAIMDREI-FTQTKLVVTATDRGSPRLAGLATLTVIIIDQNDNSPTIPL------PQEIRIPENTLIGTEITLVTGNDVDSS-PALSYSLLLDPTALGKFG-IHRYTGG---------VSITGPLDFEEKTWYTVTVQATDS---QHQTEANITIVVEDINDNAPLFTHDLYQISLPEHTPPGSAVITVTATDRDSGENGRVNYRVMSSTQEGFYIDPSNGTLFINHRAEFDPE-RPSVNIVIEASDGGSPALSSLTTVQVHISDINDNAPVFHQSEYRAMVSEDTFPGSTLLIFEAFDNDLSRENCGFDFAIANGNEGNVFQIESSVRFLEGRGFQTVGTLLLAEGLDFETKSLYNLTVVVSDRGVPQRSSSVAALITIGDVNDNPPVFSRP---EYTVALSEGAVSGTEIIRLTATDPDSTPNAEVQYTISSGDEMNLFSIDQWTGALRLQRALDREHQSTHVVIIQATD 2655          

HSP 5 Score: 162.54 bits (410), Expect = 7.313e-40
Identity = 162/622 (26.05%), Postives = 288/622 (46.30%), Query Frame = 2
Query:  380 KLSPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPK---DYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISG-LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSE--MNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKD-QGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPD-IGKNAKIIYQIPEKY---QNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLN---SSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGWV-GKVEAYXXXXXXXXXIIFSF-TGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTP 2197
            ++S  D D G+N+ + Y +   DK F    Q+ +      T    DRE++  Y+L  +  D G P ++     +I + D NDHAP F   +   + +  V+E    G+ +  +   D D+    TV   S S   V+R F ++  +G L   S L + +   ++T  + A D+G P L+++  I + V+  + + P+  + +++       ++E     S +  V   D      + G V   +++  ++    ++ R   +         +  +RE D E  S Y + V+  D     P S    + I ++D ND+ P FS+      I EN  PG+ I+   A D D  G N+++ Y I  ++    +++++ +P +G++T     DRE    +     A D+   L      SV   L ++DEND  P+F S +    +++   G+V   V A+D D   N  + +   +G       +  + G++   K   LDRE Q  + LT+ A+D+G+P  S+S ++ +Q+ D+ND +P F Q   + +   + E   PGT + KV ATD D+  NG +TY       F+I+  +G +   + LD        L + A+D G P
Sbjct: 1119 RVSATDRDAGLNARLTYRLLHADKHF----QINSQTGEISTRLALDREQQSSYQLFVVVQDGGTPPRSATGTAHISVLDENDHAPTFTHVRPDTERMFEVREGLPSGTMVGSVAAKDPDEGENGTVYY-SLSGSRVER-FSLNPNTGELKTASPLRW-AERAEYTFTLTAADHGTPGLSSTCQIRIQVISSSRSIPKPNVLSMT-----LNVVEGTAPGSIIGSVGQVDKPESNVLEGQVTYLVVDGTDRDGTFMVDRLRGD---------VYLVRELDYEKGSSYTLHVEVSDFSKAFPNSYLVKLEINVQDSNDHAPQFSEDPVTIVIPENKEPGASIYAFQAGDQDGSGPNSELRYSIEHQWPQTSDLLAL-DPLSGVLTIRQQLDRESTPFLYLVVRATDQAVDLSQRRWGSVTARLFVKDENDNPPVFSSPSAISVMEDQPVGFVILHVMAHDADEGENGRVSYRIQSGNNAGRFSLSPNTGSLSILKA--LDREEQEVFNLTIVAEDHGIPQLSTSQVLCVQVIDVNDEAPMFQQ---AEFGTHVMENKGPGTTVLKVTATDRDQGSNGHITYGGVTEDGFVINPLTGVITTTKELDAELQNHYVLTVYARDGGLP 1713          

HSP 6 Score: 161.77 bits (408), Expect = 1.364e-39
Identity = 175/597 (29.31%), Postives = 255/597 (42.71%), Query Frame = 2
Query:  467 LQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLIT---VLINSNSDPEVKRHFQVSAISGLTL---ISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTL-REFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQD----RIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVS--FDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKE-GYSG-WVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLL------ANNKYFIIDEKSGEVFINRTLDRLE-LVPRRLLIMAKDNG 2191
            L +     I  T +  DREERD Y  + + T  GI      I++ I + D+NDHAPEF   K  ++ + E  + G++      TD D + L T    +   N     K   + SA   L L   +S L        +++ + A D G P      T+ V V DIND+ P       + S  +  + E+ P+ S +  V   D D   NG+V   L E N +Q+     RYF     S     ++TL R  D E    + + VQ +D    P  +   +TI + D NDN P+ +  F  +    RI E   PG  +  +  TDPD G+ A +   + E      ++    + I    V    DRE   S   +  A D   P L +    T+++ D ND  P+F   AY   I E  Y G +V +V A D D   N D+ +S    L    W               LD E +    +TV A D G P  SS+  V I ++D+NDN+P FS      Y   + E    GT   +V ATD+D    G +TY L           F I++++G++     LDR E L    L + A D G
Sbjct:   75 LDIDETTGIITTKRRLDREERDHYSFIAV-TMTGI-----TIEVSITVNDINDHAPEFP-KKKALLKIPEHTVVGTRFSLDPATDADKDQLTTQGYAIKEGNVGHMFKLESKRSANKVLYLDLVVSGLLDREKRSSYSLVIEAFDGGSPRRVGFMTLEVTVTDINDHAP-----VFNQSRYHAIISESLPQGSSILQVFAADEDEGDNGLV---LYEINRRQSDP--ERYFVIDLKSG----VITLNRPLDYELKRVHELVVQARDNASQPEVTNAFVTIHVRDFNDNQPTMTIIFLSEDGSPRISEGAQPGQYVARISVTDPDYGEYANVNVSL-EGGDGKFALTTKDSIIYLIYVDQVLDREERDSYDLRVMATDSGTPPLRAESSFTIQVTDVNDNPPLFDQQAYRQTIPEVVYPGSFVLQVTARDKDQGPNGDVRYS---LLKGKKWFSIDPITGIITTATALDFESEPAPSVTVIATDGGRPPLSSTAKVDIVVQDVNDNAPVFSSNF---YNVSVKENTPAGTCFLEVSATDEDRGSFGTITYALTLKSGGTVQTPFTINKQTGQLCTASALDRDEGLEKYDLTVTATDGG 643          

HSP 7 Score: 158.688 bits (400), Expect = 1.265e-38
Identity = 168/610 (27.54%), Postives = 276/610 (45.25%), Query Frame = 2
Query:  395 DSDYGINSEIIYSIE-GKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISG-LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPL--LNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGWV-GKVEAYXXXXXXXXXIIFSFT----GFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNK--YFIIDEKSGEVFINRT--LDRLELVPR-RLLIMAK 2182
            D+D G N  + Y I+ G + G F L     N      +K  DREE++ + L  +A D GIP+ +    + +++ D+ND AP F    ++   V E+   G+ +  +  TD+D  +   +     ++      F ++ ++G +T    LD E     + + V A D G+P       + V V D+NDN P       +      ++ EN+P    +  V  TD DS   G ++  +   +   +F+L SR             + T    DRE    Y + V   D+G P LS+  T+ + + D NDN P FSK  +   + EN   G  +  + ATD D G N KI+Y + ++     ++ +  TG +T     DRE   S  F+ FA+D  +P   +NSS +V + I D ND  P F+      ++    S  V   ++A D D  +N  + + F     GF  N L      G I + + +    + Q T  L VEA D G P++S+  +V + ++++  N  +FS+   +     I E    GT + +  A   D    G    L + NK   F I   +GE+++  +  LD  E  PR RL++ A+
Sbjct: 1554 DADEGENGRVSYRIQSGNNAGRFSL---SPNTGSLSILKALDREEQEVFNLTIVAEDHGIPQLSTSQVLCVQVIDVNDEAPMFQQ-AEFGTHVMENKGPGTTVLKVTATDRDQGSNGHITYGGVTED----GFVINPLTGVITTTKELDAELQ-NHYVLTVYARDGGLPPNFAKAVVRVEVQDVNDNAP-----VFAKMWYGLEVPENQPAVE-LCFVKATDPDSGPGGELEYKIAAGDPDGDFQLHSR----------TGALSTSHGLDREKKPKYTLEVVAVDRGSPALSATATVEVKVLDVNDNSPVFSKNSYTVEVLENAEEGYQVLQVSATDVDEGLNGKILYFLSQEADGAFAV-DEDTGRITTAAPLDREKLASYNFRVFAVD-LSPSVPINSSAQVKVTILDVNDNAPFFIQDPLIIEVSSRRSQRVLATMKAEDKDFGANGSVFYRFATPVKGFSINSL-----TGEIQATEPLGSLTQAQRT--LIVEAMDQGSPAQSAHGVVVVYVKEVEYNGIRFSK---NARDVSIQENASKGTAVAQAQAEYPDGTRQGISYSLFSGNKKHLFKISSSTGEIWVESSNGLD-FEETPRLRLVVKAE 2125          

HSP 8 Score: 147.132 bits (370), Expect = 4.825e-35
Identity = 166/621 (26.73%), Postives = 269/621 (43.32%), Query Frame = 2
Query:  377 IKLSPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEF-DMPKDYVIGVKEDAIEGSKICDIKVTDKDDE---TLITVLINSNSDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLP-PLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSP---IFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGWVGKVEAYXXXXXXXXXIIFSFTGFLHN--HLW-ILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNKY---FIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTP 2197
            +K++  D D G N  I Y    +D GF     +     +  T K  D E ++ Y L   A D G+P    +  + ++++D+ND+AP F  M     +   + A+E   +C +K TD D      L   +   + D + + H +  A+S    + R        K+T+ V+AVD G P L+ + T+ V VLD+NDN P       S +S   +++EN  +   V  V+ TD D  +NG           K  + L       F   +   RI T    DRE ++ Y   V   D     P++S   + + I D NDN P    FF QD +   +        + T+ A D D G N  + Y+     +   SI N  TG +              T    A+D+ +P  ++   V + +++       F  +A    I+E  S      +A     +     I S++ F  N  HL+ I  S G I+ E    LD E     +L V+A+     S +S +   + L+D+NDN P+F       +MK+     +P   I +V+A D D+ +NG+VTY + ++     F ID  +G +     +DR      +L++ A D G+P
Sbjct: 1653 LKVTATDRDQGSNGHITYGGVTED-GFV----INPLTGVITTTKELDAELQNHYVLTVYARDGGLPPNFAKAVVRVEVQDVNDNAPVFAKMWYGLEVPENQPAVE---LCFVKATDPDSGPGGELEYKIAAGDPDGDFQLHSRTGALSTSHGLDR----EKKPKYTLEVVAVDRGSPALSATATVEVKVLDVNDNSP-----VFSKNSYTVEVLENAEEGYQVLQVSATDVDEGLNG-----------KILYFLSQEADGAFAVDEDTGRITTAAPLDREKLASYNFRVFAVDLSPSVPINSSAQVKVTILDVNDNAP----FFIQDPLIIEVSSRRSQRVLATMKAEDKDFGANGSVFYRFATPVKGF-SI-NSLTGEIQATEPLGSLTQAQRTLIVEAMDQGSPAQSAHGVVVVYVKEVEYNGIRFSKNARDVSIQENASKGTAVAQAQAEYPDGTRQGI-SYSLFSGNKKHLFKISSSTGEIWVESSNGLDFEETPRLRLVVKAE---TVSSTSFMAFNLVLQDVNDNLPRFQLQNYVAFMKEAQGYEMP---IIQVVAEDVDQGQNGQVTYSIQSSSMSGLFKIDPVTGSITTTAIMDREIFTQTKLVVTATDRGSP 2232          

HSP 9 Score: 123.635 bits (309), Expect = 6.882e-28
Identity = 147/560 (26.25%), Postives = 242/560 (43.21%), Query Frame = 2
Query:  512 FDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISGLTLIS-RLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDAD-SEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTL---REFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQ-NIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGY---------------SGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTY-LLANNKYFIIDEKSGEVFI 2125
             D EE+  Y +   ATD    +   E  I I + D+ND+AP F     Y I + E    GS +  +  TD+D        +N       +  F +   +G   I+ R +++       I + A D G P L++ TT+ V++ DINDN P         S     + E+    S + +    D D S  N   D  +   N    F++ S     F   +    + TL      D ET S Y +TV   D+G+P  SS     I I D NDNPP FS+  +   + E  + G+ I  L ATDPD   NA++ Y I    + N+ SI +  TG +    + DRE  ++      A D       + V V ++++D ND  P F        I+E                 +G  G+++ Y          +   +G   +   I ++ G + S+  I  D E  +++     A D+G  + S++V VQ+ +   ++  P F+    + +  ++ E    G  I +V+A D+D   +G V Y LL ++ YF +++ +G +F+
Sbjct: 2315 LDFEEKTWYTVTVQATDS---QHQTEANITIVVEDINDNAPLFTHDL-YQISLPEHTPPGSAVITVTATDRDSGE--NGRVNYRVMSSTQEGFYIDPSNGTLFINHRAEFDPERPSVNIVIEASDGGSPALSSLTTVQVHISDINDNAP-----VFHQSEYRAMVSEDTFPGSTLLIFEAFDNDLSRENCGFDFAIANGNEGNVFQIESSV--RFLEGRGFQTVGTLLLAEGLDFETKSLYNLTVVVSDRGVPQRSSSVAALITIGDVNDNPPVFSRPEYTVALSEGAVSGTEIIRLTATDPDSTPNAEVQYTISSGDEMNLFSI-DQWTGALRLQRALDREHQSTHVVIIQATDGQGYF--ALVPVIVDVKDVNDNHPYFPVETLTATIQENLPANSPVTVLHAIDHDTGVFGQLKYY----------MMERSGSGRDSFVIEQNSGEVRSK--IPFDFEKINSFNFVAVAVDSG--NHSATVTVQVFVTGEDEYDPLFTS---TDFAFEVPEGAKKGQSIGQVLARDEDGGVDGIVLYSLLPSSPYFDVNKTTGVIFL 2841          

HSP 10 Score: 115.931 bits (289), Expect = 1.396e-25
Identity = 156/620 (25.16%), Postives = 264/620 (42.58%), Query Frame = 2
Query:  377 IKLSPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATD--KGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGWVGKVEAYXXXXXXXXXIIFSFTGFLH----NHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTY--LLANNKYFIIDEKSGEVFINRTLDRLELVPRR----LLIMAKDNGTPS 2200
            +++S  D D G+N +I+Y +  +  G F +     +     T    DRE+   Y     A D    +P  +   ++ + I D+ND+AP F   +D +I           +  +K  DKD     +V     +     + F +++++G    +      +  + T+ V A+D G P  +    + V V ++  N  +      S ++ +  + EN  K + VA       D    GI   +L   N K  F++ S        S     + +    D E     R+ V+ +       +S     + ++D NDN P F    +   +KE      PI  ++A D D G+N ++ Y I     + +   +P TG +T     DRE+ T       A D  +P L     +T+ I D+ND  P  +      +I E  +  +G        ++ +S    S++  L         I +  G + S  G  LD E ++ Y +TV+A D+   + ++  IV   +EDINDN+P F+  L   Y   + E   PG+ +  V ATD D  ENG+V Y  + +  + F ID  +G +FIN    R E  P R    ++I A D G+P+
Sbjct: 1859 LQVSATDVDEGLNGKILYFLSQEADGAFAV---DEDTGRITTAAPLDREKLASYNFRVFAVDLSPSVPINSSA-QVKVTILDVNDNAPFF--IQDPLIIEVSSRRSQRVLATMKAEDKDFGANGSVFYRFATP---VKGFSINSLTGEIQATEPLGSLTQAQRTLIVEAMDQGSPAQSAHGVVVVYVKEVEYNGIR-----FSKNARDVSIQENASKGTAVAQAQAEYPDGTRQGI-SYSLFSGNKKHLFKISS--------STGEIWVESSNGLDFEETPRLRLVVKAETVSS---TSFMAFNLVLQDVNDNLPRFQLQNYVAFMKEAQGYEMPIIQVVAEDVDQGQNGQVTYSIQSSSMSGLFKIDPVTGSITTTAIMDREIFTQTKLVVTATDRGSPRLAGLATLTVIIIDQNDNSPT-IPLPQEIRIPE--NTLIGTEITLVTGNDVDSSPALSYSLLLDPTALGKFGIHRYTGGV-SITG-PLDFEEKTWYTVTVQATDSQHQTEANITIV---VEDINDNAPLFTHDL---YQISLPEHTPPGSAVITVTATDRDSGENGRVNYRVMSSTQEGFYIDPSNGTLFINH---RAEFDPERPSVNIVIEASDGGSPA 2438          

HSP 11 Score: 109.768 bits (273), Expect = 1.230e-23
Identity = 150/631 (23.77%), Postives = 256/631 (40.57%), Query Frame = 2
Query:  377 IKLSPRDSDYGINSEIIY-SIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISGLTLIS-RLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKII------------YQI-PEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPL-LNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGWVG--KVEAYXXXXXXXXXIIFSFTGFLH--NHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFS--QPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNKY--FIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTP 2197
            +K++  D D G N  I Y ++ G    FF L     +  +    +    +      +V  A D          ++ + I   +  +P F+  + Y   V ED + G+ +  ++   K   +       S+ DP+   +F V + SG    +  LD+E+      + + A     P+   S  + +++ DINDN P  +  +           E     + +  +  TD DS  NG +  +LI           S     F   + +  +  +     +++  Y + V  KD G P LSS  T+ + I+ ++   P+F    ++  ++EN    +P+ T       + + A               Y++ P+       I  P +G +    S DRE          A    +      S  V + + DEND  P          ++E      G  +V A D D+  N+ + +     LH   H  I    G I +   + LDRE QS+YQL V  +D G P RS++    I + D ND++P F+  +P D+  M ++ E L  GT++  V A D DE ENG V Y L+ ++   F ++  +GE+     L   E       + A D+GTP
Sbjct:  685 VKVTANDPDAGENGRITYRTVPGGSSPFFTL---NKDTGVISLSRSLHSKANTVISMVITAVDGDGLTAPVNARVNVSIVGGSTSSPVFEQAQ-YFFTVSEDVLRGTAVGVVRAATKTGVSKGIYYSISSGDPD--GYFTVDSTSGTIRTALPLDHETC-SSLDLEIQARYGSPPSYGISR-VHISISDINDNAPTFLPSSSESLLLP----EVTKMGTVIYRIQATDKDSGHNGQLSFDLISAGAAG-----SSGQRTFGIDRGSGEVRLIGSLSYDSVPRYDLQVIAKDGGAPQLSSTFTLVVHIQAQDAQGPNFDTLTYRVELREN----APLNTRFLQVRALNREASGNGGSSSSISSSISYRLRPDGDAAGFGI-MPDSGWLFVRSSLDREAKDMYLLTVLATSRHSGTGRTGSATVRVTVTDENDNSPRLSQERVFLAVRENLVAGTGFGRVSATDRDAGLNARLTYRL---LHADKHFQINSQTGEISTR--LALDREQQSSYQLFVVVQDGGTPPRSATGTAHISVLDENDHAPTFTHVRP-DTERMFEVREGLPSGTMVGSVAAKDPDEGENGTVYYSLSGSRVERFSLNPNTGELKTASPLRWAERAEYTFTLTAADHGTP 1287          

HSP 12 Score: 99.3673 bits (246), Expect = 1.526e-20
Identity = 142/593 (23.95%), Postives = 247/593 (41.65%), Query Frame = 2
Query:  368 RLSIKLSPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDM-PKDYVIGVKEDAIEGSKICDIKVT--DKDDETLITVLINSNSDPEVKRH-FQVSAISGLTLISR---LDYESSMR-KFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQI-----------PEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGY--SGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDD-ENENGKVTYLLAN 2080
            R+   +   D D+G N  + Y      KGF  +  +       + +    + +R    L+  A D+G P ++    + + ++++  +   F    +D  + ++E+A +G+ +   +    D   + +   L + N     K+H F++S+ +G   +     LD+E + R +  +    V +     T+     + + D+NDN P+     L +  +  K  E +  E  +  V   D D   NG V  ++   +       +S  F   P +     I T    DRE  +  ++ V   D+G P L+   T+T+ I D+NDN P+      + RI EN + G+ I TL+ T  D+  +  + Y +             +Y   +SI  P           D E  T  T    A D  +    +   +T+ +ED ND  P+F    Y   + E       V  V A D DS  N  + +          +I  S+G +F     + D E + +  + +EA D G P+ SS   VQ+ + DINDN+P F Q   S Y   ++E   PG+ +    A D+D   EN    + +AN
Sbjct: 1960 RVLATMKAEDKDFGANGSVFYRFATPVKGF-SINSLTGEIQATEPLGSLTQAQR---TLIVEAMDQGSPAQSAHGVVVVYVKEVEYNGIRFSKNARD--VSIQENASKGTAVAQAQAEYPDGTRQGISYSLFSGN-----KKHLFKISSSTGEIWVESSNGLDFEETPRLRLVVKAETVSS-----TSFMAFNLVLQDVNDNLPRF---QLQNYVAFMK--EAQGYEMPIIQVVAEDVDQGQNGQVTYSIQSSS-------MSGLFKIDPVTGS---ITTTAIMDREIFTQTKLVVTATDRGSPRLAGLATLTVIIIDQNDNSPTIP-LPQEIRIPENTLIGTEI-TLV-TGNDVDSSPALSYSLLLDPTALGKFGIHRYTGGVSITGP----------LDFEEKTWYTVTVQATDSQH---QTEANITIVVEDINDNAPLFTHDLYQISLPEHTPPGSAVITVTATDRDSGENGRVNYRVMSSTQEGFYIDPSNGTLFINHRAEFDPE-RPSVNIVIEASDGGSPALSSLTTVQVHISDINDNAPVFHQ---SEYRAMVSEDTFPGSTLLIFEAFDNDLSRENCGFDFAIAN 2501          

HSP 13 Score: 88.9669 bits (219), Expect = 2.506e-17
Identity = 78/256 (30.47%), Postives = 126/256 (49.22%), Query Frame = 2
Query: 1472 NPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGWVGKV----EAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGN----IFSEKGIQ--LDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLAN-----NKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGT 2194
            + +TGI+T     DRE     +F A  +         ++EV++ + D ND  P F       KI E     VG       A D D +  +   ++       H++ L+S  +    ++ +  +   LDRE +S+Y L +EA D G P R   + +++ + DIND++P F+Q   S Y   I+E+L  G+ I +V A D+DE +NG V Y +        +YF+ID KSG + +NR LD        L++ A+DN +
Sbjct:   78 DETTGIITTKRRLDREERDHYSFIAVTMTGI------TIEVSITVNDINDHAPEFPKKKALLKIPEHTV--VGTRFSLDPATDADKDQLTTQGYAIKEGNVGHMFKLESKRSANKVLYLDLVVSGLLDREKRSSYSLVIEAFDGGSPRRVGFMTLEVTVTDINDHAPVFNQ---SRYHAIISESLPQGSSILQVFAADEDEGDNGLVLYEINRRQSDPERYFVIDLKSGVITLNRPLDYELKRVHELVVQARDNAS 322          

HSP 14 Score: 85.1149 bits (209), Expect = 3.617e-16
Identity = 109/434 (25.12%), Postives = 191/434 (44.01%), Query Frame = 2
Query:  377 IKLSPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETL--ITVLINSNSDPEVKRHFQVSAISG-LTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQI--VIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLR---EFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSF--SKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQI----PEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMF 1636
            ++++ RD D G N ++ YS+  K K +F +  +     I  T    D E      +  IATD G P  +   K+ I ++D+ND+AP F     Y + VKE+   G+   ++  TD+D  +   IT  +   S   V+  F ++  +G L   S LD +  + K+ + V A D G   L+++  + V V+DINDN P    V+ T+S S+       + P  S V  VT  D D+  NG +    +   +   F L            ++  +++L         T+    +T    D    P++++  + + I   + + P F  +++FF   + E+++ G+ +  + A     G +  I Y I    P+ Y  + S    ++G +   +  D E  +S+  +  A     P    S  V + I D ND  P F
Sbjct:  475 LQVTARDKDQGPNGDVRYSLL-KGKKWFSIDPITG---IITTATALDFESEPAPSVTVIATDGGRPPLSSTAKVDIVVQDVNDNAPVFS-SNFYNVSVKENTPAGTCFLEVSATDEDRGSFGTITYALTLKSGGTVQTPFTINKQTGQLCTASALDRDEGLEKYDLTVTATDGG--GLSSAVGVRVKVMDINDNRPTFYPVLYTVSLST------HSAPGTS-VVKVTANDPDAGENGRITYRTVPGGSSPFFTL-----------NKDTGVISLSRSLHSKANTVISMVITAVDGDGLTAPVNAR--VNVSIVGGSTSSPVFEQAQYFFT--VSEDVLRGTAVGVVRAAT-KTGVSKGIYYSISSGDPDGYFTVDS----TSGTIRTALPLDHETCSSLDLEIQARYGSPPSYGIS-RVHISISDINDNAPTF 873          

HSP 15 Score: 72.7886 bits (177), Expect = 2.218e-12
Identity = 92/360 (25.56%), Postives = 154/360 (42.78%), Query Frame = 2
Query: 1175 IVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPE-KYQNIISIPNPSTG--------IVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGY--SGWVGKVEAYXXXXXXXXXIIFSFTGFLHN---HLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQP-LDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLL--ANNKYFIIDEKS--GEVFINRTLDRLELVPRRLLIMAKDNGTP 2197
            I T R  DRE   HY          +  ++ + +IT+   D ND+ P F K     +I E+ + G+      ATD D  +     Y I E    ++  + +  +         +V+ L+  DRE  +S +    A D  +P     + + + + D ND  P+F  S YH  I E       + +V A D D   N  +++       +   +  I    G I   +   LD E++  ++L V+A+DN      ++  V I + D NDN P  +   L      +I+E   PG  + ++  TD D  E   V   L   + K+ +  + S    +++++ LDR E     L +MA D+GTP
Sbjct:   84 ITTKRRLDREERDHYSFIAVT----MTGITIEVSITV--NDINDHAPEFPKKKALLKIPEHTVVGTRFSLDPATDADKDQLTTQGYAIKEGNVGHMFKLESKRSANKVLYLDLVVSGLL--DREKRSSYSLVIEAFDGGSPRRVGFMTLEVTVTDINDHAPVFNQSRYHAIISESLPQGSSILQVFAADEDEGDNGLVLYEINRRQSDPERYFVIDLKSGVITLNR--PLDYELKRVHELVVQARDNASQPEVTNAFVTIHVRDFNDNQPTMTIIFLSEDGSPRISEGAQPGQYVARISVTDPDYGEYANVNVSLEGGDGKFALTTKDSIIYLIYVDQVLDREERDSYDLRVMATDSGTP 433          
BLAST of protocadherin-1 vs. Planmine SMEST
Match: SMESG000033799.1 (SMESG000033799.1)

HSP 1 Score: 1694.48 bits (4387), Expect = 0.000e+0
Identity = 897/899 (99.78%), Postives = 899/899 (100.00%), Query Frame = 2
Query:  392 RDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPSXXXXXXXXXXXXNEDEDKQTSVINEKVDQEKTYQEARRKNNIDNYDGFKWNSKEVLISLTVGSVMLIISCGGLLLIYIWYQTRSPGEMAKRNETELVLTEQVAXXXXXXXXXXXXCIQCLCLNSKNRSIKEFLSKTDDXXXXXXXXXXXXXXXXXXRTEKSDESNIQQNSNFPLMWKYDNKYNELYPFQQLPESNFFFKSCSNKQMNIYEPPLKQMKSKSPMISMRNYSTVQIPSYNINNDXXXXXXXXXXXLIYNHSKYETTHPQTDRPNPASIQTNYPISCFAIPNPKINNSFV 3088
            RDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIP+IAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGWVGKVEAYDNDSNSNSDIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPSFTTTATLQLLFQNEDEDKQTSVINEKVDQEKTYQEARRKNNIDNYDGFKWNSKEVLISLTVGSVMLIISCGGLLLIYIWYQTRSPGEMAKRNET+LVLTEQVASSPVDEEPEESSCIQCLCLNSKNRSIKEFLSKTDDSSSQQQKQGISQSYIKQQRTEKSDESNIQQNSNFPLMWKYDNKYNELYPFQQLPESNFFFKSCSNKQMNIYEPPLKQMKSKSPMISMRNYSTVQIPSYNINNDASSTATAASSALIYNHSKYETTHPQTDRPNPASIQTNYPISCFAIPNPKINNSFV
Sbjct:  150 RDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPIIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGWVGKVEAYDNDSNSNSDIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPSFTTTATLQLLFQNEDEDKQTSVINEKVDQEKTYQEARRKNNIDNYDGFKWNSKEVLISLTVGSVMLIISCGGLLLIYIWYQTRSPGEMAKRNETDLVLTEQVASSPVDEEPEESSCIQCLCLNSKNRSIKEFLSKTDDSSSQQQKQGISQSYIKQQRTEKSDESNIQQNSNFPLMWKYDNKYNELYPFQQLPESNFFFKSCSNKQMNIYEPPLKQMKSKSPMISMRNYSTVQIPSYNINNDASSTATAASSALIYNHSKYETTHPQTDRPNPASIQTNYPISCFAIPNPKINNSFV 1048          

HSP 2 Score: 162.155 bits (409), Expect = 3.154e-40
Identity = 101/121 (83.47%), Postives = 103/121 (85.12%), Query Frame = 1
Query:   43 INFLRFSTVKENQLALVXXXXXXXXXXXXXXCRTKEHAPINSVVCSISNRFSTERKPNLYLISYRNLFKINPHNQIVVINSIDRESLNPVDCVPGPDDSAPPYCRLVLEIVNKTKPKRLRL 405
            INFLRFSTVKENQLALVLLSILIISTNTSNICRTKEHAPINSVVCSISNRFSTERKPNLYLISYRNLFKINPHNQIVVINSIDRESLNPVD                LEIVNKTKPK  ++
Sbjct:    3 INFLRFSTVKENQLALVLLSILIISTNTSNICRTKEHAPINSVVCSISNRFSTERKPNLYLISYRNLFKINPHNQIVVINSIDRESLNPVD---------------FLEIVNKTKPKDFQI 108          

HSP 3 Score: 76.2554 bits (186), Expect = 1.232e-13
Identity = 53/186 (28.49%), Postives = 95/186 (51.08%), Query Frame = 2
Query:  380 KLSPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKD--YVIGVKEDAIEGSKICDIKVTDKD--DETLITVLINSNSDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITV 925
            K+   D+D   NS+II+S  G       +L+   N    K ++L DRE +  Y+L   A D G+P ++  + + I++ D+ND++P+F  P D  Y+  + E  + G+ I  +  TD D  +   +T L+ +N      ++F +   SG   I+R      +    + ++A DNG P+ TT+ T+ +
Sbjct:  583 KVEAYDNDSNSNSDIIFSFTGFLHNHLWILKSDGNIFSEKGIQL-DREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANN------KYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPSFTTTATLQL 761          

HSP 4 Score: 70.4774 bits (171), Expect = 7.217e-12
Identity = 104/387 (26.87%), Postives = 161/387 (41.60%), Query Frame = 2
Query: 1109 KQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEK---YQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMF-LSSAYHFKIK----EGYSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQ-STYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPK--FSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLL--ANNKY-----------FIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTP 2197
            K N  LIS Y N F  +  N +IV +   DRE+++     ++  ++  P       + I IED NDN P F K  +   I ENI  G      +A D D G N++IIY I  K   +  ++ + N +  I   +  FDRE          A D+  P     +++ ++I D ND  P F +   Y   +K    EG      KV   D+++     I  +    +  H  +    G     +   LD E     + + + A DNG+P+ ++S  + + + DINDN P+       DS    K+ E     + +  V  TD D   NG V   L   NNK            F   +++  +   R  DR  +   R+ +  KD G P
Sbjct:   58 KPNLYLIS-YRNLFKINPHN-QIVVINSIDRESLNPVDF-LEIVNKTKPKDFQIFQLPIDIEDINDNSPIFDKLSYNIEIDENIQSGHIQQLPVARDSDYGINSEIIYSIEGKDKGFFKLLQMKN-NKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISGLTLISR---LDYESSMRKFTIPIIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLP 437          
BLAST of protocadherin-1 vs. Planmine SMEST
Match: SMESG000033799.1 (SMESG000033799.1)

HSP 1 Score: 1693.71 bits (4385), Expect = 0.000e+0
Identity = 897/899 (99.78%), Postives = 899/899 (100.00%), Query Frame = 2
Query:  392 RDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPSXXXXXXXXXXXXNEDEDKQTSVINEKVDQEKTYQEARRKNNIDNYDGFKWNSKEVLISLTVGSVMLIISCGGLLLIYIWYQTRSPGEMAKRNETELVLTEQVAXXXXXXXXXXXXCIQCLCLNSKNRSIKEFLSKTDDXXXXXXXXXXXXXXXXXXRTEKSDESNIQQNSNFPLMWKYDNKYNELYPFQQLPESNFFFKSCSNKQMNIYEPPLKQMKSKSPMISMRNYSTVQIPSYNINNDXXXXXXXXXXXLIYNHSKYETTHPQTDRPNPASIQTNYPISCFAIPNPKINNSFV 3088
            RDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIP+IAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGWVGKVEAYDNDSNSNSDIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPSFTTTATLQLLFQNEDEDKQTSVINEKVDQEKTYQEARRKNNIDNYDGFKWNSKEVLISLTVGSVMLIISCGGLLLIYIWYQTRSPGEMAKRNET+LVLTEQVASSPVDEEPEESSCIQCLCLNSKNRSIKEFLSKTDDSSSQQQKQGISQSYIKQQRTEKSDESNIQQNSNFPLMWKYDNKYNELYPFQQLPESNFFFKSCSNKQMNIYEPPLKQMKSKSPMISMRNYSTVQIPSYNINNDASSTATAASSALIYNHSKYETTHPQTDRPNPASIQTNYPISCFAIPNPKINNSFV
Sbjct:  148 RDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPIIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGWVGKVEAYDNDSNSNSDIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPSFTTTATLQLLFQNEDEDKQTSVINEKVDQEKTYQEARRKNNIDNYDGFKWNSKEVLISLTVGSVMLIISCGGLLLIYIWYQTRSPGEMAKRNETDLVLTEQVASSPVDEEPEESSCIQCLCLNSKNRSIKEFLSKTDDSSSQQQKQGISQSYIKQQRTEKSDESNIQQNSNFPLMWKYDNKYNELYPFQQLPESNFFFKSCSNKQMNIYEPPLKQMKSKSPMISMRNYSTVQIPSYNINNDASSTATAASSALIYNHSKYETTHPQTDRPNPASIQTNYPISCFAIPNPKINNSFV 1046          

HSP 2 Score: 161.384 bits (407), Expect = 5.146e-40
Identity = 100/121 (82.64%), Postives = 102/121 (84.30%), Query Frame = 1
Query:   43 INFLRFSTVKENQLALVXXXXXXXXXXXXXXCRTKEHAPINSVVCSISNRFSTERKPNLYLISYRNLFKINPHNQIVVINSIDRESLNPVDCVPGPDDSAPPYCRLVLEIVNKTKPKRLRL 405
            INFLRFSTVKENQLALVLLSILIISTNTSNICRTKEHAPINSVVCSISNRFSTERKPNLYLISYRNLFKINPHNQIVVINSIDRESLNPVDC                 IVNKTKPK  ++
Sbjct:    3 INFLRFSTVKENQLALVLLSILIISTNTSNICRTKEHAPINSVVCSISNRFSTERKPNLYLISYRNLFKINPHNQIVVINSIDRESLNPVDC-----------------IVNKTKPKDFQI 106          

HSP 3 Score: 76.2554 bits (186), Expect = 1.200e-13
Identity = 53/186 (28.49%), Postives = 95/186 (51.08%), Query Frame = 2
Query:  380 KLSPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKD--YVIGVKEDAIEGSKICDIKVTDKD--DETLITVLINSNSDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITV 925
            K+   D+D   NS+II+S  G       +L+   N    K ++L DRE +  Y+L   A D G+P ++  + + I++ D+ND++P+F  P D  Y+  + E  + G+ I  +  TD D  +   +T L+ +N      ++F +   SG   I+R      +    + ++A DNG P+ TT+ T+ +
Sbjct:  581 KVEAYDNDSNSNSDIIFSFTGFLHNHLWILKSDGNIFSEKGIQL-DREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANN------KYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPSFTTTATLQL 759          

HSP 4 Score: 72.7886 bits (177), Expect = 1.296e-12
Identity = 107/388 (27.58%), Postives = 160/388 (41.24%), Query Frame = 2
Query: 1109 KQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQ-TITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEK---YQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMF-LSSAYHFKIK----EGYSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQ-STYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPK--FSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLL--ANNKY-----------FIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTP 2197
            K N  LIS Y N F  +  N +IV +   DRE+++     V C      P   Q   + I IED NDN P F K  +   I ENI  G      +A D D G N++IIY I  K   +  ++ + N +  I   +  FDRE          A D+  P     +++ ++I D ND  P F +   Y   +K    EG      KV   D+++     I  +    +  H  +    G     +   LD E     + + + A DNG+P+ ++S  + + + DINDN P+       DS    K+ E     + +  V  TD D   NG V   L   NNK            F   +++  +   R  DR  +   R+ +  KD G P
Sbjct:   58 KPNLYLIS-YRNLFKINPHN-QIVVINSIDRESLN----PVDCIVNKTKPKDFQIFQLPIDIEDINDNSPIFDKLSYNIEIDENIQSGHIQQLPVARDSDYGINSEIIYSIEGKDKGFFKLLQMKN-NKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISGLTLISR---LDYESSMRKFTIPIIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLP 435          
BLAST of protocadherin-1 vs. Planmine SMEST
Match: SMESG000033799.1 (SMESG000033799.1)

HSP 1 Score: 1692.94 bits (4383), Expect = 0.000e+0
Identity = 897/899 (99.78%), Postives = 899/899 (100.00%), Query Frame = 2
Query:  392 RDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPSXXXXXXXXXXXXNEDEDKQTSVINEKVDQEKTYQEARRKNNIDNYDGFKWNSKEVLISLTVGSVMLIISCGGLLLIYIWYQTRSPGEMAKRNETELVLTEQVAXXXXXXXXXXXXCIQCLCLNSKNRSIKEFLSKTDDXXXXXXXXXXXXXXXXXXRTEKSDESNIQQNSNFPLMWKYDNKYNELYPFQQLPESNFFFKSCSNKQMNIYEPPLKQMKSKSPMISMRNYSTVQIPSYNINNDXXXXXXXXXXXLIYNHSKYETTHPQTDRPNPASIQTNYPISCFAIPNPKINNSFV 3088
            RDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIP+IAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGWVGKVEAYDNDSNSNSDIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPSFTTTATLQLLFQNEDEDKQTSVINEKVDQEKTYQEARRKNNIDNYDGFKWNSKEVLISLTVGSVMLIISCGGLLLIYIWYQTRSPGEMAKRNET+LVLTEQVASSPVDEEPEESSCIQCLCLNSKNRSIKEFLSKTDDSSSQQQKQGISQSYIKQQRTEKSDESNIQQNSNFPLMWKYDNKYNELYPFQQLPESNFFFKSCSNKQMNIYEPPLKQMKSKSPMISMRNYSTVQIPSYNINNDASSTATAASSALIYNHSKYETTHPQTDRPNPASIQTNYPISCFAIPNPKINNSFV
Sbjct:  164 RDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPIIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGWVGKVEAYDNDSNSNSDIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPSFTTTATLQLLFQNEDEDKQTSVINEKVDQEKTYQEARRKNNIDNYDGFKWNSKEVLISLTVGSVMLIISCGGLLLIYIWYQTRSPGEMAKRNETDLVLTEQVASSPVDEEPEESSCIQCLCLNSKNRSIKEFLSKTDDSSSQQQKQGISQSYIKQQRTEKSDESNIQQNSNFPLMWKYDNKYNELYPFQQLPESNFFFKSCSNKQMNIYEPPLKQMKSKSPMISMRNYSTVQIPSYNINNDASSTATAASSALIYNHSKYETTHPQTDRPNPASIQTNYPISCFAIPNPKINNSFV 1062          

HSP 2 Score: 161.77 bits (408), Expect = 4.125e-40
Identity = 100/122 (81.97%), Postives = 103/122 (84.43%), Query Frame = 1
Query:   40 KINFLRFSTVKENQLALVXXXXXXXXXXXXXXCRTKEHAPINSVVCSISNRFSTERKPNLYLISYRNLFKINPHNQIVVINSIDRESLNPVDCVPGPDDSAPPYCRLVLEIVNKTKPKRLRL 405
            +INFLRFSTVKENQLALVLLSILIISTNTSNICRTKEHAPINSVVCSISNRFSTERKPNLYLISYRNLFKINPHNQIVVINSIDRESLNPVDC                 IVNKTKPK  ++
Sbjct:   18 QINFLRFSTVKENQLALVLLSILIISTNTSNICRTKEHAPINSVVCSISNRFSTERKPNLYLISYRNLFKINPHNQIVVINSIDRESLNPVDC-----------------IVNKTKPKDFQI 122          

HSP 3 Score: 75.485 bits (184), Expect = 1.655e-13
Identity = 53/186 (28.49%), Postives = 95/186 (51.08%), Query Frame = 2
Query:  380 KLSPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKD--YVIGVKEDAIEGSKICDIKVTDKD--DETLITVLINSNSDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITV 925
            K+   D+D   NS+II+S  G       +L+   N    K ++L DRE +  Y+L   A D G+P ++  + + I++ D+ND++P+F  P D  Y+  + E  + G+ I  +  TD D  +   +T L+ +N      ++F +   SG   I+R      +    + ++A DNG P+ TT+ T+ +
Sbjct:  597 KVEAYDNDSNSNSDIIFSFTGFLHNHLWILKSDGNIFSEKGIQL-DREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANN------KYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPSFTTTATLQL 775          

HSP 4 Score: 72.4034 bits (176), Expect = 1.863e-12
Identity = 107/388 (27.58%), Postives = 160/388 (41.24%), Query Frame = 2
Query: 1109 KQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQ-TITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEK---YQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMF-LSSAYHFKIK----EGYSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQ-STYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPK--FSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLL--ANNKY-----------FIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTP 2197
            K N  LIS Y N F  +  N +IV +   DRE+++     V C      P   Q   + I IED NDN P F K  +   I ENI  G      +A D D G N++IIY I  K   +  ++ + N +  I   +  FDRE          A D+  P     +++ ++I D ND  P F +   Y   +K    EG      KV   D+++     I  +    +  H  +    G     +   LD E     + + + A DNG+P+ ++S  + + + DINDN P+       DS    K+ E     + +  V  TD D   NG V   L   NNK            F   +++  +   R  DR  +   R+ +  KD G P
Sbjct:   74 KPNLYLIS-YRNLFKINPHN-QIVVINSIDRESLN----PVDCIVNKTKPKDFQIFQLPIDIEDINDNSPIFDKLSYNIEIDENIQSGHIQQLPVARDSDYGINSEIIYSIEGKDKGFFKLLQMKN-NKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISGLTLISR---LDYESSMRKFTIPIIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLP 451          
BLAST of protocadherin-1 vs. Planmine SMEST
Match: SMESG000033799.1 (SMESG000033799.1)

HSP 1 Score: 1692.55 bits (4382), Expect = 0.000e+0
Identity = 897/899 (99.78%), Postives = 899/899 (100.00%), Query Frame = 2
Query:  392 RDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPSXXXXXXXXXXXXNEDEDKQTSVINEKVDQEKTYQEARRKNNIDNYDGFKWNSKEVLISLTVGSVMLIISCGGLLLIYIWYQTRSPGEMAKRNETELVLTEQVAXXXXXXXXXXXXCIQCLCLNSKNRSIKEFLSKTDDXXXXXXXXXXXXXXXXXXRTEKSDESNIQQNSNFPLMWKYDNKYNELYPFQQLPESNFFFKSCSNKQMNIYEPPLKQMKSKSPMISMRNYSTVQIPSYNINNDXXXXXXXXXXXLIYNHSKYETTHPQTDRPNPASIQTNYPISCFAIPNPKINNSFV 3088
            RDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIP+IAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGWVGKVEAYDNDSNSNSDIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPSFTTTATLQLLFQNEDEDKQTSVINEKVDQEKTYQEARRKNNIDNYDGFKWNSKEVLISLTVGSVMLIISCGGLLLIYIWYQTRSPGEMAKRNET+LVLTEQVASSPVDEEPEESSCIQCLCLNSKNRSIKEFLSKTDDSSSQQQKQGISQSYIKQQRTEKSDESNIQQNSNFPLMWKYDNKYNELYPFQQLPESNFFFKSCSNKQMNIYEPPLKQMKSKSPMISMRNYSTVQIPSYNINNDASSTATAASSALIYNHSKYETTHPQTDRPNPASIQTNYPISCFAIPNPKINNSFV
Sbjct:  167 RDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPIIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGWVGKVEAYDNDSNSNSDIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPSFTTTATLQLLFQNEDEDKQTSVINEKVDQEKTYQEARRKNNIDNYDGFKWNSKEVLISLTVGSVMLIISCGGLLLIYIWYQTRSPGEMAKRNETDLVLTEQVASSPVDEEPEESSCIQCLCLNSKNRSIKEFLSKTDDSSSQQQKQGISQSYIKQQRTEKSDESNIQQNSNFPLMWKYDNKYNELYPFQQLPESNFFFKSCSNKQMNIYEPPLKQMKSKSPMISMRNYSTVQIPSYNINNDASSTATAASSALIYNHSKYETTHPQTDRPNPASIQTNYPISCFAIPNPKINNSFV 1065          

HSP 2 Score: 165.622 bits (418), Expect = 2.646e-41
Identity = 102/126 (80.95%), Postives = 106/126 (84.13%), Query Frame = 1
Query:   28 ISMSKINFLRFSTVKENQLALVXXXXXXXXXXXXXXCRTKEHAPINSVVCSISNRFSTERKPNLYLISYRNLFKINPHNQIVVINSIDRESLNPVDCVPGPDDSAPPYCRLVLEIVNKTKPKRLRL 405
            + + KINFLRFSTVKENQLALVLLSILIISTNTSNICRTKEHAPINSVVCSISNRFSTERKPNLYLISYRNLFKINPHNQIVVINSIDRESLNPVD                LEIVNKTKPK  ++
Sbjct:   15 VGLHKINFLRFSTVKENQLALVLLSILIISTNTSNICRTKEHAPINSVVCSISNRFSTERKPNLYLISYRNLFKINPHNQIVVINSIDRESLNPVD---------------FLEIVNKTKPKDFQI 125          

HSP 3 Score: 75.8702 bits (185), Expect = 1.317e-13
Identity = 53/186 (28.49%), Postives = 95/186 (51.08%), Query Frame = 2
Query:  380 KLSPRDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKD--YVIGVKEDAIEGSKICDIKVTDKD--DETLITVLINSNSDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITV 925
            K+   D+D   NS+II+S  G       +L+   N    K ++L DRE +  Y+L   A D G+P ++  + + I++ D+ND++P+F  P D  Y+  + E  + G+ I  +  TD D  +   +T L+ +N      ++F +   SG   I+R      +    + ++A DNG P+ TT+ T+ +
Sbjct:  600 KVEAYDNDSNSNSDIIFSFTGFLHNHLWILKSDGNIFSEKGIQL-DREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANN------KYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPSFTTTATLQL 778          

HSP 4 Score: 70.0922 bits (170), Expect = 8.752e-12
Identity = 104/387 (26.87%), Postives = 161/387 (41.60%), Query Frame = 2
Query: 1109 KQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEK---YQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMF-LSSAYHFKIK----EGYSGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQ-STYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPK--FSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLL--ANNKY-----------FIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTP 2197
            K N  LIS Y N F  +  N +IV +   DRE+++     ++  ++  P       + I IED NDN P F K  +   I ENI  G      +A D D G N++IIY I  K   +  ++ + N +  I   +  FDRE          A D+  P     +++ ++I D ND  P F +   Y   +K    EG      KV   D+++     I  +    +  H  +    G     +   LD E     + + + A DNG+P+ ++S  + + + DINDN P+       DS    K+ E     + +  V  TD D   NG V   L   NNK            F   +++  +   R  DR  +   R+ +  KD G P
Sbjct:   75 KPNLYLIS-YRNLFKINPHN-QIVVINSIDRESLNPVDF-LEIVNKTKPKDFQIFQLPIDIEDINDNSPIFDKLSYNIEIDENIQSGHIQQLPVARDSDYGINSEIIYSIEGKDKGFFKLLQMKN-NKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISGLTLISR---LDYESSMRKFTIPIIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLP 454          
BLAST of protocadherin-1 vs. Planmine SMEST
Match: SMESG000014472.1 (SMESG000014472.1)

HSP 1 Score: 331.257 bits (848), Expect = 1.481e-96
Identity = 238/691 (34.44%), Postives = 378/691 (54.70%), Query Frame = 2
Query:  392 RDSDYGINSEIIYSIE-GKDKGFFKLLQMKNNKPIFKTMKL-----FDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTL--REFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQI-PEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGWVGKVEAYXXXXXXXXXIIFSFTGFLHN--HLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNKYFIIDEKSGEVFINRTLDRLELVPRRLLIMAKDNGTPSXXXXXXXXXXXXNEDEDKQTSVINEKVDQEKTYQEARRKNNIDNYDGFKWNSKEVLISLTVGSVMLIISCGGLLLIY 2431
            RD D G N  ++Y+I+       F L+    N+    ++KL     FDRE  + ++L+ IA D G P  T  + I I I D+NDHAP+F+    Y     E  ++G  I  +  TDKD  + +T++++ ++  ++   F V+    ++    L Y SS   + IP+IAVD+G P LT ++T+ V+V DINDN P I I + S+ ++   L EN    S++A VTV+D D   NG V+C L   +N   F L S    NF N +R+Y++VT     FDRE   H+++ + C D G+P L++ + IT+ ++DENDNPP F +      I EN+  G+ +  L A D DIG NA+I Y + PE  +N     +P +G++T  VSFDRE+ +    KA A D     +NSS+ + + I DEND  P FL + + F IKE   G +G+VEA D D   N+ + +    FL N   L+ +  +G+IF  +   LDRE    Y + + A+D+G    +SS  V+I ++DINDNSP F +P    ++    ET + GT I    A D+D  EN K+ Y + +   F I+   G +++N++L    ++P +++I A+D+G    TTT++L L F    + K    +N+K++ + +                   S+++++SL +G V+LI +C  +L+ Y
Sbjct:  147 RDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQ-SSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIAS-SNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKL---DNNYLFNLES--IQNFEN-RRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNI--DPFSGMITTRVSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRT-FSFHIKENLEGVLGRVEAVDKDIGQNAQMDY----FLFNPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHGNRPLTSSTTVEIIIDDINDNSPTFIEPKPGQHLNLSIET-IQGTKIFTAKAIDNDTGENAKIVYTIQSQTIFYINTSDGSIYLNKSLQDEHILPDKIIISARDSGIIPKTTTSSLHLNFIRSGKSKPPP-MNKKIEPKSSL------------------SRDLVLSLGIGLVLLIFTCLLMLVTY 802          

HSP 2 Score: 106.686 bits (265), Expect = 4.877e-23
Identity = 147/561 (26.20%), Postives = 247/561 (44.03%), Query Frame = 2
Query:  602 IKIRDLNDHAPEFD-MPKDYVIGVKEDA---IE------------GSKICDIKVTDKDDE-TLITVLINSNSDPEVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTITVNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPP----SFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQ-NIISIPNPSTGIVTNLV-----SFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGY--SGWVGKVEAYXXXXXXXXXIIFSFTGFLHNHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNKYFIIDEKSGEVFIN--RTLDRLELVPRRLLIMAKDNG 2191
            I + D+ND+ P FD +  ++ I     A   +E            GS +  IK +   ++  LI+   N   D  +K          L ++   D E    +F + +IA D G P LT+S TI +++ D+ND+ PQ      + SS  F   E+  +   +  V  TD D  ++  V   +    + Q  +  S  F+   ++K     V+   FD      YR+ +   D G P L++  T+ + + D NDN P    + S    +  + EN    S I  +  +D D G N ++  ++   Y  N+ SI N        LV     SFDRE+           D   P L ++  +T+ ++DEND  P+F        I E       V +++A D D   N+ I +  +     +  I    G I +   +  DREVQS Y++   A D+ +   +SS+ + + + D NDN PKF +   S ++K+  E      ++ +V A D D  +N ++ Y L N        ++G++F++  R LDR  +    + I A+D+G
Sbjct:  110 ILVADINDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLK----------LKILQSFDREID-EEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQ-----FNQSSYRFNTPESIVQGQAIGQVFATDKD--ISSRVTIMMSPSASSQIMDKFSVAFDGVISTKVALVYVS-SSFD------YRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNNYLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPSLTTTRPITVVVKDENDNPPIFYRQHESVSILENLPIGTKVTRLKAIDKDIGVNAQIKYMLSPECLENFNIDPFSGMITTR--VSFDREVQSEYKVKATAYDHLILRMNSSITIHVTILDENDNPPKFLRTF-SFHIKENLE-----GVLGRVEAVDKDIGQNAQMDYFLFNPSPLFEISRNGDIFVSQKRYLDRERVDRYSIEIGARDHG 637          

HSP 3 Score: 97.8265 bits (242), Expect = 2.662e-20
Identity = 97/331 (29.31%), Postives = 149/331 (45.02%), Query Frame = 2
Query: 1277 ITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQI-PEKYQNIISIPNPSTGIVTN-------LVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGY--SGWVGKVEAYXXXXXXXXXIIFSFTGFLH-NHLWILKSDGNIFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKI-TETLVPGTLITKVMATDDDENENGKVTYLLANNKYFIIDEKSGEVFINRTLDRLELVP-----------RRLLIMAKDNGTPS 2200
            + I + D NDN PSF +  F  +I EN    + +   +A DPD G N  ++Y I P    N   + +PST    +       L SFDRE++        A D  NP L SS+ + ++I D ND  P F  S+Y F   E       +G+V A D D +S   I+ S +        + +  DG + S K   +       Y++ + A D+G P+ +++  V + + DINDN P       +   + + TE     + I KV  +D D   NG+V   L NN  ++ + +S + F NR   +L   P            +L I+  D G PS
Sbjct:  108 LPILVADINDNVPSFDRLTFNFKIAENSPAHNEVELPLARDPDRGNNGSVVYAIKPSAVSNKFVLISPSTNQGHDSSLKLKILQSFDREIDEEFQLILIAKDLGNPPLTSSLTIKIDITDVNDHAPQFNQSSYRFNTPESIVQGQAIGQVFATDKDISSRVTIMMSPSASSQIMDKFSVAFDG-VISTKVALVYVSSSFDYRIPIIAVDSGNPTLTATSTVLVHVTDINDNRPIIEIASSNQNNRLVLTENCQSNSYIAKVTVSDKDHGNNGQVECKLDNN--YLFNLESIQNFENRRHYKLVTAPTSSFDREVKDHHQLNIICSDMGVPS 435          
The following BLAST results are available for this feature:
BLAST of protocadherin-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PCDH11X1.022e-5628.86protocadherin 11 X-linked [Source:HGNC Symbol;Acc:... [more]
PCDH11X1.094e-5628.86protocadherin 11 X-linked [Source:HGNC Symbol;Acc:... [more]
PCDH11X1.250e-5628.86protocadherin 11 X-linked [Source:HGNC Symbol;Acc:... [more]
PCDH11X1.260e-5628.86protocadherin 11 X-linked [Source:HGNC Symbol;Acc:... [more]
PCDH11X1.506e-5628.86protocadherin 11 X-linked [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of protocadherin-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fmi-11.023e-4830.30FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
fmi-11.168e-3829.39FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
cdh-18.711e-3728.21CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4... [more]
hmr-11.276e-2726.61Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Pr... [more]
hmr-11.276e-2726.61Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Pr... [more]
back to top
BLAST of protocadherin-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stan7.234e-6029.86gene:FBgn0024836 transcript:FBtr0304900[more]
stan8.250e-6029.86gene:FBgn0024836 transcript:FBtr0304899[more]
stan8.250e-6029.86gene:FBgn0024836 transcript:FBtr0300578[more]
stan8.254e-6029.86gene:FBgn0024836 transcript:FBtr0303223[more]
stan8.254e-6029.86gene:FBgn0024836 transcript:FBtr0088214[more]
back to top
BLAST of protocadherin-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LO018022.14.102e-6132.46FAT atypical cadherin 4 [Source:NCBI gene;Acc:1018... [more]
LO018022.15.202e-6132.46FAT atypical cadherin 4 [Source:NCBI gene;Acc:1018... [more]
pcdh2aa151.206e-5631.53protocadherin 2 alpha a 15 [Source:ZFIN;Acc:ZDB-GE... [more]
pcdh2aa151.471e-5631.53protocadherin 2 alpha a 15 [Source:ZFIN;Acc:ZDB-GE... [more]
pcdh18a4.811e-5634.57protocadherin 18a [Source:ZFIN;Acc:ZDB-GENE-000607... [more]
back to top
BLAST of protocadherin-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000047798.12.207e-5830.42protocadherin 11 X-linked [Source:NCBI gene;Acc:10... [more]
ENSXETT00000047801.12.553e-5830.42protocadherin 11 X-linked [Source:NCBI gene;Acc:10... [more]
ENSXETT00000047804.12.708e-5830.42protocadherin 11 X-linked [Source:NCBI gene;Acc:10... [more]
ENSXETT00000027070.13.642e-5730.91pep primary_assembly:Xenopus_tropicalis_v9.1:3:190... [more]
FAT42.150e-5630.68FAT atypical cadherin 4 [Source:NCBI gene;Acc:1001... [more]
back to top
BLAST of protocadherin-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pcdh11x1.876e-5831.07protocadherin 11 X-linked [Source:MGI Symbol;Acc:M... [more]
Pcdh11x2.447e-5831.07protocadherin 11 X-linked [Source:MGI Symbol;Acc:M... [more]
Pcdh11x3.369e-5831.07protocadherin 11 X-linked [Source:MGI Symbol;Acc:M... [more]
Pcdh11x3.730e-5831.07protocadherin 11 X-linked [Source:MGI Symbol;Acc:M... [more]
Pcdh11x4.007e-5831.07protocadherin 11 X-linked [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of protocadherin-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9V5N8|STAN_DROME8.274e-5929.86Protocadherin-like wing polarity protein stan OS=D... [more]
sp|Q6KEQ9|PC11X_PIG2.594e-5630.16Protocadherin-11 X-linked OS=Sus scrofa OX=9823 GN... [more]
sp|Q9BZA7|PC11X_HUMAN4.908e-5628.86Protocadherin-11 X-linked OS=Homo sapiens OX=9606 ... [more]
sp|Q6WYY1|PC11X_PANPA6.007e-5629.19Protocadherin-11 X-linked OS=Pan paniscus OX=9597 ... [more]
sp|Q71M42|PC11X_PANTR6.444e-5629.19Protocadherin-11 X-linked OS=Pan troglodytes OX=95... [more]
back to top
BLAST of protocadherin-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0S7FQV39.130e-7835.84PCD18 (Fragment) OS=Poeciliopsis prolifica OX=1881... [more]
A0A0S7FTZ28.205e-7635.84FAT4 (Fragment) OS=Poeciliopsis prolifica OX=18813... [more]
G5AQQ62.268e-7131.04Protocadherin gamma-A11 (Fragment) OS=Heterocephal... [more]
K1QH309.118e-7031.28Protocadherin-11 X-linked OS=Crassostrea gigas OX=... [more]
A0A210QG072.539e-6932.92Protocadherin-11 X-linked OS=Mizuhopecten yessoens... [more]
back to top
BLAST of protocadherin-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh18a8.098e-5936.19protocadherin 18a [Source:ZFIN;Acc:ZDB-GENE-000607... [more]
pcdh18a1.052e-5836.19protocadherin 18a [Source:ZFIN;Acc:ZDB-GENE-000607... [more]
dchs1b1.769e-5832.35dachsous cadherin-related 1b [Source:ZFIN;Acc:ZDB-... [more]
pcdh1a1.941e-5830.65protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
pcdh1a4.793e-5830.65protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
back to top
BLAST of protocadherin-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008517.11.720e-6031.46pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 ... [more]
si:ch211-199f5.11.492e-5129.17protocadherin 8 [Source:HGNC Symbol;Acc:HGNC:8660][more]
pcdh119.714e-5029.26protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
ENSPMAT00000010725.12.336e-4527.23pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 ... [more]
ENSPMAT00000006996.18.158e-4427.34pep scaffold:Pmarinus_7.0:GL476780:2096:143714:1 g... [more]
back to top
BLAST of protocadherin-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of protocadherin-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO461891.093e-6430.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354122.574e-5832.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO348152.853e-5229.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO417671.190e-4828.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO303642.119e-4827.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of protocadherin-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
celsr32.653e-6130.03cadherin EGF LAG seven-pass G-type receptor 3 [Sou... [more]
celsr32.654e-6130.03cadherin EGF LAG seven-pass G-type receptor 3 [Sou... [more]
pcdh18a1.450e-6032.18protocadherin 18 [Source:NCBI gene;Acc:101171130][more]
pcdh18a2.047e-6032.18protocadherin 18 [Source:NCBI gene;Acc:101171130][more]
ENSORLT00000005325.29.178e-5931.97protocadherin-16 [Source:NCBI gene;Acc:101171352][more]
back to top
BLAST of protocadherin-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000033799.13.154e-4099.78SMESG000033799.1[more]
SMESG000033799.15.146e-4099.78SMESG000033799.1[more]
SMESG000033799.14.125e-4099.78SMESG000033799.1[more]
SMESG000033799.12.646e-4199.78SMESG000033799.1[more]
SMESG000014472.11.481e-9634.44SMESG000014472.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019393 ID=SMED30019393|Name=protocadherin-1|organism=Schmidtea mediterranea sexual|type=transcript|length=3254bp
TCTTCCGATCTCATTAATTCAAATTTCATTTCCATGTCAAAAATAAATTT
TCTGAGATTTTCAACAGTTAAAGAAAATCAATTGGCATTAGTGCTATTGT
CGATATTGATTATATCTACGAATACATCAAATATTTGCAGAACAAAGGAG
CACGCTCCAATCAATAGTGTCGTTTGTTCAATTTCCAATCGATTTTCAAC
TGAAAGAAAACCAAATCTTTATTTGATTTCCTACAGAAATTTATTCAAAA
TAAATCCCCACAATCAAATTGTTGTGATAAACTCAATAGACAGGGAGTCC
CTAAATCCTGTCGATTGTGTACCGGGTCCAGATGATAGTGCTCCCCCATA
CTGTCGATTAGTTTTGGAGATTGTCAATAAAACTAAGCCCAAGAGACTCA
GATTACGGGATAAATTCAGAAATTATTTATTCTATAGAAGGAAAAGACAA
AGGGTTTTTTAAATTGCTTCAAATGAAAAACAATAAACCAATTTTTAAAA
CAATGAAGTTATTCGATCGAGAAGAAAGAGACAGATACGAATTAGTCTTC
ATTGCCACGGATAAAGGGATTCCTAAGAAAACTGGAGAAATCAAGATATA
CATAAAAATTAGAGATTTGAATGATCATGCTCCTGAATTCGACATGCCAA
AAGATTACGTAATTGGGGTAAAAGAAGATGCAATAGAAGGATCAAAAATA
TGCGATATAAAAGTCACAGATAAAGACGATGAAACATTGATAACCGTTTT
AATAAACTCCAATTCCGACCCTGAAGTAAAGCGACATTTTCAAGTAAGTG
CAATATCTGGACTGACATTAATCTCTCGACTTGACTATGAATCTTCAATG
AGAAAATTTACGATCCCCGTAATTGCTGTTGACAACGGAATTCCAAATTT
GACAACATCAACAACTATTACTGTCAATGTTTTAGACATTAATGACAACT
TTCCCCAAATTGTTATTGATACACTTTCTGATTCCAGTTCTAATTTCAAA
TTAATGGAAAATAAGCCAAAAGAATCTTTTGTTGCAATGGTAACCGTCAC
CGATGCAGATTCGGAAATGAATGGAATTGTTGACTGTAACTTAATTGAAC
CAAATAATAAACAAAACTTTGAGTTAATATCCAGATACTTTAATAATTTT
CCAAATTCCAAAAGAAATTACCGGATTGTTACTCTTCGAGAATTTGACAG
AGAAACCATTTCTCACTATCGAGTTACGGTCCAATGCAAAGATCAAGGAC
TACCTCCTCTCAGTTCACAACAAACAATTACGATCTGGATCGAAGATGAA
AATGATAATCCACCTTCATTTTCCAAATTTTTCTTTCAAGATCGAATAAA
AGAAAATATAATGCCAGGAAGCCCAATATTTACTCTTATTGCAACGGATC
CTGATATTGGGAAAAATGCAAAGATTATTTACCAAATTCCAGAAAAGTAT
CAGAATATAATATCCATTCCTAATCCTTCAACTGGCATCGTTACTAATTT
GGTTTCGTTTGATAGAGAAATGAACACATCCATAACCTTCAAAGCTTTTG
CACTTGATGAATTTAATCCTCTTTTGAATAGTAGCGTTGAGGTTACTTTA
GAAATTGAAGACGAAAATGATTGTATTCCAATGTTTTTGTCTAGTGCTTA
TCATTTCAAAATAAAAGAAGGATACAGTGGTTGGGTGGGAAAGGTTGAAG
CATACGACAATGATTCCAATAGTAACAGTGATATAATATTTTCATTTACT
GGTTTCCTGCACAATCATTTGTGGATTTTAAAGTCAGATGGAAATATCTT
TTCCGAAAAAGGTATTCAGTTAGATAGAGAGGTACAAAGTACTTATCAAT
TAACTGTTGAAGCCAAAGACAACGGAGTCCCATCGAGAAGTTCATCAGTT
ATCGTTCAGATTCAACTGGAAGATATAAATGATAATTCACCAAAGTTTTC
ACAGCCTTTAGACTCAGGTTATATGAAAAAGATTACAGAAACTTTAGTTC
CAGGGACATTGATAACAAAAGTCATGGCAACAGATGATGATGAAAACGAA
AATGGAAAAGTAACTTATCTTTTAGCGAATAATAAGTATTTTATTATCGA
TGAAAAATCTGGAGAAGTATTCATTAATAGAACTCTAGACCGCTTAGAGT
TAGTTCCAAGACGTTTATTGATAATGGCTAAAGACAACGGTACTCCAAGT
TTCACAACAACTGCTACTCTACAACTTTTATTTCAAAATGAAGATGAAGA
TAAACAGACATCGGTTATCAATGAAAAAGTAGATCAAGAAAAAACCTACC
AAGAAGCGAGGAGAAAAAATAACATTGACAACTATGATGGATTTAAATGG
AACTCTAAAGAAGTATTAATCAGTCTCACAGTCGGAAGTGTGATGCTGAT
TATAAGTTGCGGAGGTTTACTCTTGATTTATATTTGGTATCAAACGAGAT
CTCCAGGAGAAATGGCAAAAAGAAACGAAACCGAATTGGTTTTAACAGAA
CAAGTTGCCTCCTCACCAGTCGACGAAGAACCCGAAGAGTCTTCATGCAT
TCAGTGTTTGTGTTTAAATTCTAAAAATAGATCAATAAAAGAATTCCTTT
CTAAAACGGACGATTCCTCAAGTCAACAGCAAAAGCAAGGCATTTCCCAG
TCATACATCAAGCAACAGAGAACGGAGAAATCTGACGAAAGCAATATTCA
ACAAAATTCCAATTTTCCTCTCATGTGGAAATATGACAACAAATATAACG
AATTGTATCCATTTCAACAATTACCCGAGTCGAATTTCTTTTTTAAATCC
TGCTCAAATAAACAAATGAATATATATGAGCCACCATTAAAACAAATGAA
ATCTAAATCTCCAATGATTAGCATGCGCAATTATTCCACCGTCCAAATCC
CATCCTATAATATTAATAATGATGCTTCGTCTACAGCAACGGCAGCATCG
TCCGCCCTCATTTATAATCACTCGAAATACGAAACGACCCACCCACAGAC
GGACCGACCGAATCCAGCATCAATCCAAACAAATTACCCTATTTCGTGTT
TTGCTATTCCAAATCCAAAAATCAACAACAGTTTTGTTTGAAATATTCCC
AGTGTTTTAATGGGAAATTTGTAAATGGATTTTGATAATTTTTGTTACTG
TTTTTGAAATGTTTGCGATGGAAATGAAAAGAAATTCTCTAGTAAATTTG
TTAACATATTTTTGCAATTTATTGTTTGTTTATTTGTTTGCCTTTATATT
TATG
back to top

protein sequence of SMED30019393-orf-1

>SMED30019393-orf-1 ID=SMED30019393-orf-1|Name=SMED30019393-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=154bp
SSDLINSNFISMSKINFLRFSTVKENQLALVLLSILIISTNTSNICRTKE
HAPINSVVCSISNRFSTERKPNLYLISYRNLFKINPHNQIVVINSIDRES
LNPVDCVPGPDDSAPPYCRLVLEIVNKTKPKRLRLRDKFRNYLFYRRKRQ
RVF*
back to top

protein sequence of SMED30019393-orf-2

>SMED30019393-orf-2 ID=SMED30019393-orf-2|Name=SMED30019393-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=873bp
MKNNKPIFKTMKLFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLN
DHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDETLITVLINSNSDP
EVKRHFQVSAISGLTLISRLDYESSMRKFTIPVIAVDNGIPNLTTSTTIT
VNVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMN
GIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYR
VTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGS
PIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREM
NTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEG
YSGWVGKVEAYDNDSNSNSDIIFSFTGFLHNHLWILKSDGNIFSEKGIQL
DREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGY
MKKITETLVPGTLITKVMATDDDENENGKVTYLLANNKYFIIDEKSGEVF
INRTLDRLELVPRRLLIMAKDNGTPSFTTTATLQLLFQNEDEDKQTSVIN
EKVDQEKTYQEARRKNNIDNYDGFKWNSKEVLISLTVGSVMLIISCGGLL
LIYIWYQTRSPGEMAKRNETELVLTEQVASSPVDEEPEESSCIQCLCLNS
KNRSIKEFLSKTDDSSSQQQKQGISQSYIKQQRTEKSDESNIQQNSNFPL
MWKYDNKYNELYPFQQLPESNFFFKSCSNKQMNIYEPPLKQMKSKSPMIS
MRNYSTVQIPSYNINNDASSTATAASSALIYNHSKYETTHPQTDRPNPAS
IQTNYPISCFAIPNPKINNSFV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR002126Cadherin-like_dom
IPR020894Cadherin_CS
IPR015919Cadherin-like_sf
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005886plasma membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0007156homophilic cell adhesion via plasma membrane adhesion molecules
GO:0007155cell adhesion
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002126Cadherin-likePRINTSPR00205CADHERINcoord: 474..491
score: 40.92
coord: 336..362
score: 27.64
coord: 262..281
score: 42.93
coord: 248..260
score: 32.46
coord: 168..197
score: 26.41
coord: 281..294
score: 27.63
IPR002126Cadherin-likeSMARTSM00112CA_2coord: 305..386
e-value: 1.5E-12
score: 57.7
coord: 2..54
e-value: 0.6
score: 6.1
coord: 517..595
e-value: 5.9E-10
score: 49.1
coord: 408..490
e-value: 8.6E-19
score: 78.4
coord: 190..281
e-value: 1.7E-19
score: 80.8
coord: 79..161
e-value: 2.8E-15
score: 66.8
IPR002126Cadherin-likePFAMPF00028Cadherincoord: 62..154
e-value: 1.5E-10
score: 41.4
coord: 291..378
e-value: 4.5E-8
score: 33.4
coord: 174..274
e-value: 1.5E-13
score: 51.0
coord: 393..482
e-value: 6.3E-12
score: 45.8
coord: 503..584
e-value: 7.2E-11
score: 42.4
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 279..383
e-value: 2.2E-20
score: 75.2
coord: 384..487
e-value: 2.2E-21
score: 78.4
coord: 54..160
e-value: 3.9E-19
score: 71.2
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 161..278
e-value: 3.3E-24
score: 87.5
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 2..53
e-value: 2.9E-11
score: 45.6
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 488..587
e-value: 1.3E-20
score: 75.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 709..731
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 709..742
NoneNo IPR availablePANTHERPTHR24028FAMILY NOT NAMEDcoord: 6..383
coord: 362..726
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 1..56
score: 14.649
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 169..283
score: 20.788
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 58..163
score: 20.854
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 405..492
score: 17.719
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 284..388
score: 18.902
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 496..599
score: 17.96
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 174..279
e-value: 1.52923E-23
score: 93.5321
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 291..383
e-value: 1.33188E-19
score: 82.3613
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 9..52
e-value: 4.11452E-9
score: 52.701
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 393..488
e-value: 2.30792E-21
score: 87.3689
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 62..159
e-value: 3.07436E-19
score: 81.2057
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 500..585
e-value: 3.98738E-20
score: 83.9021
NoneNo IPR availableTMHMMTMhelixcoord: 634..656
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 151..161
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 480..490
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 271..281
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 480..590
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 4..56
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 44..166
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 277..380
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 156..275
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 377..499