kelch domain-containing protein 9

Overview
Namekelch domain-containing protein 9
Smed IDSMED30019390
Length (bp)1393
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of kelch domain-containing protein 9 (SMED30019390) t-SNE clustered cells

Violin plots show distribution of expression levels for kelch domain-containing protein 9 (SMED30019390) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of kelch domain-containing protein 9 (SMED30019390) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for kelch domain-containing protein 9 (SMED30019390) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019390

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30019390SMESG000074761.1 Contig2847newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30019390SMESG000074761.1 Contig2847uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30019390SMESG000061127.1 Contig2847newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30019390SMESG000061127.1 Contig2847uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
X1 cellSMED30019390SMESG000074761.1 SmedASXL_011109SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30019390SMESG000074761.1 SmedASXL_011109SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30019390SMESG000074761.1 dd_Smed_v4_7438_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30019390SMESG000074761.1 dd_Smed_v4_7438_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30019390SMESG000074761.1 dd_Smed_v4_7438_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30019390SMESG000074761.1 OX_Smed_1.0.21002ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of kelch domain-containing protein 9 vs. Ensembl Human
Match: KLHDC9 (kelch domain containing 9 [Source:HGNC Symbol;Acc:HGNC:28489])

HSP 1 Score: 78.5666 bits (192), Expect = 1.513e-15
Identity = 47/172 (27.33%), Postives = 73/172 (42.44%), Query Frame = 3
Query:  300 HVLVSVNEYLFVHGGIKVENSLKPTNEFFKIDMKTYHIDDLTTSDSPFLSQHASVVFNNRYIILVGGWDGHSRTSAVYIFDVLNFKWLNPPTVEGFPKGAGLSSHTANAGLKSSTGFPGILVFGREGSTRIQRRYGNAFKLICNANLTKFTYSDLPLNIDSRSGHCTSIIDS 815
            H    +    ++ GG+    + +P+++    D        L    SP  S H +   + R++ +VGGWDG  R + V   D     W       G    AGLSSHT             + V GREG    QRRYG+ + L  + +   + Y     +  SRSGHC +++ +
Sbjct:   31 HSCTELRGRFYLVGGLLAGGAREPSSDTVVFDPARGQAVRLGARGSPPRSHHDAAPVDGRWLCVVGGWDGSRRLATVTALDTERGVWEAWTGTPGDCPPAGLSSHTCTRISDRE-----LQVAGREGGIHTQRRYGSIYTLRLDPSARTYCYKQEGCHTASRSGHCAALLQT 197          
BLAST of kelch domain-containing protein 9 vs. Ensembl Human
Match: KLHDC9 (kelch domain containing 9 [Source:HGNC Symbol;Acc:HGNC:28489])

HSP 1 Score: 78.1814 bits (191), Expect = 3.634e-15
Identity = 50/196 (25.51%), Postives = 79/196 (40.31%), Query Frame = 3
Query:  231 REKNSPLQWEEIKELTGKVYSSHHVLVSVNEYLFVHGGIKVENSLKPTNEFFKIDMKTYHIDDLTTSDSPFLSQHASVVFNNRYIILVGGWDGHSRTSAVYIFDVLNFKWLNPPTVEGFPKGAGLSSHTANAGLKSSTGFPGILVFGREGSTRIQRRYGNAFKLICNANLTKFTYSDLPLNIDSRSGHCTSIIDSK 818
            R   S   W  +      +  + H    +    ++ GG+    + +P+++    D        L    SP  S H +   + R++ +VGGWDG  R + V   D     W       G    AGLSSHT             + V GREG    QRRYG+ + L  + +   + Y     +  SRSGHC +++ + 
Sbjct:    9 RAAGSGWAWRPVAR-DALLARAFHSCTELRGRFYLVGGLLAGGAREPSSDTVVFDPARGQAVRLGARGSPPRSHHDAAPVDGRWLCVVGGWDGSRRLATVTALDTERGVWEAWTGTPGDCPPAGLSSHTCTRISDRE-----LQVAGREGGIHTQRRYGSIYTLRLDPSARTYCYKQEGCHTASRSGHCAALLQTP 198          
BLAST of kelch domain-containing protein 9 vs. Ensembl Xenopus
Match: KLHDC9 (kelch domain containing 9 [Source:NCBI gene;Acc:100486977])

HSP 1 Score: 89.7373 bits (221), Expect = 4.298e-19
Identity = 63/230 (27.39%), Postives = 102/230 (44.35%), Query Frame = 3
Query:  300 HVLVSVNEYLFVHGGIKV-ENSLKPTNEFFKIDMKTYHIDDLTTSDSPFLSQHASVVFNNRYIILVGGWDGHSRTSAVYIFDVLNFKWL--------NPPTVEGFPKGAGLSSHTANAGLKSSTGFPGILVFGREGSTRIQRRYGNAFKLICNANLTKFTYSDLPLNIDSRSGHCTSII--DSK--------IFIVGGRDDKVIDTHVIKGLSSDKTCDVVSTLIQRASE 932
            H   ++ + L+++GG+K  E    P  +   +D +      ++       S H   +  +R++ + GGWDG  R S+V+ +D +  +W         NPP         GLSSHT             + V GREG +R QRRY + + L  N +   + Y +      SRSGH  +++  D+K        +++ GGRD   ID   I G  S +   V +T   R +E
Sbjct:   24 HTCTAIRDKLYIYGGVKSGEPKEPPLGDMVLLDPEQELAQAVSVESGFRRSHHDGALLGDRWLCVAGGWDGTRRVSSVFSYDSVEGEWALWAEGPTNNPPV--------GLSSHTCTKISDYE-----LRVIGREGGSRTQRRYASVYSLRVNPSTRTYWYKEEVSRTASRSGHSATLLPTDTKQGKKGGYSLYVFGGRDSAAID---IAGEWSKEKIHVSATPCPRLTE 237          
BLAST of kelch domain-containing protein 9 vs. Ensembl Xenopus
Match: KLHDC9 (kelch domain containing 9 [Source:NCBI gene;Acc:100486977])

HSP 1 Score: 89.7373 bits (221), Expect = 7.305e-19
Identity = 63/230 (27.39%), Postives = 102/230 (44.35%), Query Frame = 3
Query:  300 HVLVSVNEYLFVHGGIKV-ENSLKPTNEFFKIDMKTYHIDDLTTSDSPFLSQHASVVFNNRYIILVGGWDGHSRTSAVYIFDVLNFKWL--------NPPTVEGFPKGAGLSSHTANAGLKSSTGFPGILVFGREGSTRIQRRYGNAFKLICNANLTKFTYSDLPLNIDSRSGHCTSII--DSK--------IFIVGGRDDKVIDTHVIKGLSSDKTCDVVSTLIQRASE 932
            H   ++ + L+++GG+K  E    P  +   +D +      ++       S H   +  +R++ + GGWDG  R S+V+ +D +  +W         NPP         GLSSHT             + V GREG +R QRRY + + L  N +   + Y +      SRSGH  +++  D+K        +++ GGRD   ID   I G  S +   V +T   R +E
Sbjct:   86 HTCTAIRDKLYIYGGVKSGEPKEPPLGDMVLLDPEQELAQAVSVESGFRRSHHDGALLGDRWLCVAGGWDGTRRVSSVFSYDSVEGEWALWAEGPTNNPPV--------GLSSHTCTKISDYE-----LRVIGREGGSRTQRRYASVYSLRVNPSTRTYWYKEEVSRTASRSGHSATLLPTDTKQGKKGGYSLYVFGGRDSAAID---IAGEWSKEKIHVSATPCPRLTE 299          
BLAST of kelch domain-containing protein 9 vs. Ensembl Mouse
Match: Klhdc9 (kelch domain containing 9 [Source:MGI Symbol;Acc:MGI:1916124])

HSP 1 Score: 85.1149 bits (209), Expect = 1.329e-17
Identity = 56/199 (28.14%), Postives = 85/199 (42.71%), Query Frame = 3
Query:  225 VSREKNSPLQWEEIKE--LTGKVYSSHHVLVSVNEYLFVHGGIKVENSLKPTNEFFKIDMKTYHIDDLTTSDSPFLSQHASVVFNNRYIILVGGWDGHSRTSAVYIFDVLNFKWLNPPTVEGFPKGAGLSSHTANAGLKSSTGFPGILVFGREGSTRIQRRYGNAFKLICNANLTKFTYSDLPLNIDSRSGHCTSIIDS 815
            + R + S   W  +    L  + +   H    +    ++ GG+    +  P+N+    D        L    SP  S H + +   R++ +VGGWDG  R S V   D     W       G    AGLSSHT     + S G   + V GREG T  QRRYG+ + L  +     + Y +   +  SRSGHC +++ +
Sbjct:    7 LGRARGSTWTWRPVARDVLLARAF---HSCTELEGRFYLVGGLLEGGARVPSNDTVIFDPAVGQAVRLVARGSPLRSHHDAALVGGRWLCVVGGWDGSRRLSTVAALDTEREVWEAWAANPGNCPPAGLSSHTCT---RLSDGE--LRVSGREGGTHTQRRYGSIYTLKLDHRTRTYCYKEEGCHTTSRSGHCAALLPT 197          
BLAST of kelch domain-containing protein 9 vs. UniProt/SwissProt
Match: sp|Q3USL1|KLDC9_MOUSE (Kelch domain-containing protein 9 OS=Mus musculus OX=10090 GN=Klhdc9 PE=1 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 9.294e-17
Identity = 56/199 (28.14%), Postives = 85/199 (42.71%), Query Frame = 3
Query:  225 VSREKNSPLQWEEIKE--LTGKVYSSHHVLVSVNEYLFVHGGIKVENSLKPTNEFFKIDMKTYHIDDLTTSDSPFLSQHASVVFNNRYIILVGGWDGHSRTSAVYIFDVLNFKWLNPPTVEGFPKGAGLSSHTANAGLKSSTGFPGILVFGREGSTRIQRRYGNAFKLICNANLTKFTYSDLPLNIDSRSGHCTSIIDS 815
            + R + S   W  +    L  + +   H    +    ++ GG+    +  P+N+    D        L    SP  S H + +   R++ +VGGWDG  R S V   D     W       G    AGLSSHT     + S G   + V GREG T  QRRYG+ + L  +     + Y +   +  SRSGHC +++ +
Sbjct:    7 LGRARGSTWTWRPVARDVLLARAF---HSCTELEGRFYLVGGLLEGGARVPSNDTVIFDPAVGQAVRLVARGSPLRSHHDAALVGGRWLCVVGGWDGSRRLSTVAALDTEREVWEAWAANPGNCPPAGLSSHTCT---RLSDGE--LRVSGREGGTHTQRRYGSIYTLKLDHRTRTYCYKEEGCHTTSRSGHCAALLPT 197          
BLAST of kelch domain-containing protein 9 vs. UniProt/SwissProt
Match: sp|Q8NEP7|KLDC9_HUMAN (Kelch domain-containing protein 9 OS=Homo sapiens OX=9606 GN=KLHDC9 PE=1 SV=2)

HSP 1 Score: 78.1814 bits (191), Expect = 1.745e-14
Identity = 50/196 (25.51%), Postives = 79/196 (40.31%), Query Frame = 3
Query:  231 REKNSPLQWEEIKELTGKVYSSHHVLVSVNEYLFVHGGIKVENSLKPTNEFFKIDMKTYHIDDLTTSDSPFLSQHASVVFNNRYIILVGGWDGHSRTSAVYIFDVLNFKWLNPPTVEGFPKGAGLSSHTANAGLKSSTGFPGILVFGREGSTRIQRRYGNAFKLICNANLTKFTYSDLPLNIDSRSGHCTSIIDSK 818
            R   S   W  +      +  + H    +    ++ GG+    + +P+++    D        L    SP  S H +   + R++ +VGGWDG  R + V   D     W       G    AGLSSHT             + V GREG    QRRYG+ + L  + +   + Y     +  SRSGHC +++ + 
Sbjct:    9 RAAGSGWAWRPVAR-DALLARAFHSCTELRGRFYLVGGLLAGGAREPSSDTVVFDPARGQAVRLGARGSPPRSHHDAAPVDGRWLCVVGGWDGSRRLATVTALDTERGVWEAWTGTPGDCPPAGLSSHTCTRISDRE-----LQVAGREGGIHTQRRYGSIYTLRLDPSARTYCYKQEGCHTASRSGHCAALLQTP 198          
BLAST of kelch domain-containing protein 9 vs. TrEMBL
Match: V4BAM3 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_235620 PE=4 SV=1)

HSP 1 Score: 195.282 bits (495), Expect = 1.183e-54
Identity = 118/333 (35.44%), Postives = 185/333 (55.56%), Query Frame = 3
Query:  249 LQWEEIKELTGKVYSSHHVLVSVNEYLFVHGGIKVENSLKPTNEFFKIDMKTYHIDDLTTSDSPFLSQHASVVFNNRYIILVGGWDGHSRTSAVYIFDVLNFKWLNPPTVEGFPKGAGLSSHTANAGLKSSTGFPGILVFGREGSTRIQRRYGNAFKLICNANLTKFTYSDLPLNIDSRSGHCTSIIDSKIFIVGGRDDKVIDTHVIKGLSSDKTCDVVSTLIQRASEFQ-FEKCPLVGRRKAGRRGHCLIPGKHGFVVSGGSSFIEASHVADCAGFLYVMSSNCDEYFFLGSLYNTRTDGAYSISHNQEAIYHGGID-FHGKIRSEFLKLKL 1241
            + WE +  L   +  + HV   VN  +++HGGI+++ S  P N+ +K+D+++   + + + DSP LS HA +V ++RY+I++GGWDG SR S VY++D +  KW  PPT  GFP+  GLSSHT N   + S G   IL+ GR+GS R+QRR+GNA+ L+     + F YS+   ++ SRSGH TSII +K+FI+GGR DK++D +            V+  L+  A + +   K P      +GR+ H  +P   G  + GG +F       +  G +Y+M+      F+     +    G   + +  + + HGGI   +  IR E  +LKL
Sbjct:   11 VDWEVLIPLGPTL--AFHVGCVVNNSVYLHGGIEIKGSNSPCNKLYKLDLESLIWNQIVSPDSPVLSHHACLVRDDRYMIIIGGWDGKSRGSRVYVYDTVENKWSEPPTT-GFPEDGGLSSHTVN---ELSDG--KILIVGRDGSLRMQRRHGNAY-LMAGDQTSGFKYSEFSNSVTSRSGHTTSIIGTKVFIIGGRSDKLVDVYTGYSNKYTHANSVIENLVSAAGKLKALHKFP------SGRKHHISLPVPGGLFLHGGETF--DGKCREPVGDMYLMTVKPVGNFYKLGTSSVGRSGHVCLVYKDKVLLHGGISGKNSSIRCETFELKL 326          
BLAST of kelch domain-containing protein 9 vs. TrEMBL
Match: A0A1S3JH55 (kelch domain-containing protein 9 OS=Lingula unguis OX=7574 GN=LOC106173034 PE=4 SV=2)

HSP 1 Score: 179.104 bits (453), Expect = 1.752e-48
Identity = 115/320 (35.94%), Postives = 173/320 (54.06%), Query Frame = 3
Query:  297 HHVLVSVNEYLFVHGGIKVENSLKPTNEFFKIDMKTYHIDDLTTSDSPFLSQHASVVFNNRYIILVGGWDGHSRTSAVYIFDVLNFKWLNPPTVEGFPKGAGLSSHTANAGLKSSTGFPGILVFGREGSTRIQRRYGNAFKLICNANLTKFTYSDLPLNIDSRSGHCTSIIDSKIFIVGGRDDKVIDTHV----IKGLSSDKTCDVVSTLIQRASEFQFEKCPLVGRRKAGRRGHCLIPGKHGFV-VSGGSSFIEASHVADCAGFLYVMSSNCDEYFFLGSLYNTRTDGAYSISHNQEAIYHGGIDFHGKIRSEFLKLKL 1241
            HHV   V   L+VHGG+  +    P N+ ++ +  +    ++    SPFLS HA+V+  NRY +L+GGW G  R + V++FD    KW+  PTV GFP+GAGLSSHTA   LK ++    IL+ GREGSTR+QR++GNAF L  + +   F Y++  + + SRSGH  +I+ S++ I+GGR DK++D H     I G  S  +  ++S L  R+ + Q    P+  +   GR+ H +  G HG + + GG +F   S       FL  + S+  E+F LG + +   +G            HGG      +  +  KL L
Sbjct:   24 HHVACLVGGNLYVHGGVDKKGGTTPCNKLYQFNFISSTWREILKEGSPFLSHHAAVLSENRYFVLIGGWTGKKRCADVHVFDTQEEKWMPQPTVTGFPEGAGLSSHTAVV-LKDAS----ILIIGREGSTRLQRKFGNAFLLTGSVHKGAFHYTEHTMGLASRSGHTCNILGSRLIIIGGRSDKLVDQHQGFREIPGGPSAPS--ILSDLSVRSQKLQ----PMA-KLPCGRKHH-IAAGGHGCIFIHGGDTFDGKSREPVGEMFLVRLESHV-EWFKLG-VSSLGREGHVCCVDKDTIFIHGGSGARNIVYGDLHKLTL 328          
BLAST of kelch domain-containing protein 9 vs. TrEMBL
Match: A0A2C9KXW2 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106055898 PE=4 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 3.939e-42
Identity = 109/336 (32.44%), Postives = 169/336 (50.30%), Query Frame = 3
Query:  249 LQWEEIKELTGKVYSSHHVLVSVNEYLFVHGGIK-VENSLKPTNEFFKIDMKTYHIDDLTTSDSPFLSQHASVVFNNRYIILVGGWDGHSRTSAVYIFDVLNFKWLNPPTVEGFPKGAGLSSHTANAGLKSSTGFPGILVFGREGSTRIQRRYGNAFKLICNANLTKFTYSDLPLNIDSRSGHCTSIIDSKIFIVGGRDDKVIDTHVIKGLSSDKTC---DVVSTLIQRASEFQFEKCPLVGRRKAGRRGHCLIPGKHGFVVSGGSSFIEASHVADCAGFLYVMSSNCDEYFFLGSLYNTRTDGAYSISHNQEAIYHGGIDFHGKIRSEFLKLKLV 1244
            + WE +  L     ++ H    V + L+ HGGIK   +S  P+ +FFK+++ T   + +    SP LS HA+VV  NRY  L+GGW+G  R +++Y++D +  KW+   T +GFP GAGLSSHTA     + T    +LV GREGS R QR++GN + L  +    +F Y+    NI SRSGH  ++I + ++I+GGR D + +  V      + +C   D +   I  + +   EK P       GR+ H         ++ GG +F   +H      FL  +     +++ L S    R+  A  +  N+  I HGG      I S   +LK+ 
Sbjct:    8 VTWEPVAPLGPN--AAFHACALVGKTLYFHGGIKDASSSSVPSKQFFKLNLDTLLWEKVAAPGSPALSHHAAVVLENRYFTLIGGWNGKKRLASIYVYDTVENKWME-MTHQGFPSGAGLSSHTA-----TLTTNGKVLVIGREGSLRTQRKHGNMYILSGSVASNQFIYTSYTNNIISRSGHTVNLIGNNLYILGGRSDMLFEKFVGIDYKKNSSCMLLDSIGKEINSSHQQHLEKLP------CGRKHHISAATNDFILMHGGETFDGKAHAPVGDLFLITLKP-ITKFYQLHSSQLCRSGHACIVLPNRIFI-HGGRSGKNVINSGLYELKIT 327          
BLAST of kelch domain-containing protein 9 vs. TrEMBL
Match: A0A2T7PF01 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_07421 PE=4 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 1.985e-41
Identity = 102/274 (37.23%), Postives = 151/274 (55.11%), Query Frame = 3
Query:  225 VSREKNSPLQWEEIKELTGKVYSSHHVLVSVNEYLFVHGGIKVENSLKPTNEFFKIDMKTYHIDDLTTSDSPFLSQHASVVFNNRYIILVGGWDGHSRTSAVYIFDVLNFKWLNPPTVEGFPKGAGLSSHTANAGLKSSTGFPGILVFGREGSTRIQRRYGNAFKLICNANLTKFTYSDLPLNIDSRSGHCTSIIDSKIFIVGGRDDKVIDTHVIKGLSS--DKTCDVVSTLIQRASEFQFEKCPLVGRRKAGRRGHCLIPGKHGFVVSGGSSF 1040
            V   K+  ++WE +      V  + H    +   LF+HGG+  ++S  P++   K+D+KT    +L    SP LS H +V    RYIIL+GGW+G  RT  V+++DV   +W++  TV GFP GAGLSSHTA+     S+G   ILV GREGS R QRR+GN + L    +  KF Y++    + SRSGH  S + SK+ I+GGR D +++  V++G  S  + TC V+S L +      F     + +   GR+ H  + G     + GG +F
Sbjct:   13 VQEGKSVTVEWEPLAPAGPCV--AFHAACIIRGSLFIHGGVTEKDSKLPSSGLHKLDLKTCQWTELRAPGSPTLSHHTAVPLEERYIILIGGWNGRVRTPEVHVYDVKENQWVHVTTV-GFPDGAGLSSHTASC---LSSG--DILVIGREGSLRTQRRHGNVYLLSGKISSGKFCYTEYSSAVSSRSGHSASFVGSKLCIIGGRSDNLLE--VMQGFKSPPESTCKVMSALAEAVKAKCFRS---LTKMPCGRKNHSAVSGSGVLFIHGGETF 273          
BLAST of kelch domain-containing protein 9 vs. TrEMBL
Match: A0A2C9KXS1 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106055898 PE=4 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 2.549e-41
Identity = 109/336 (32.44%), Postives = 168/336 (50.00%), Query Frame = 3
Query:  249 LQWEEIKELTGKVYSSHHVLVSVNEYLFVHGGIK-VENSLKPTNEFFKIDMKTYHIDDLTTSDSPFLSQHASVVFNNRYIILVGGWDGHSRTSAVYIFDVLNFKWLNPPTVEGFPKGAGLSSHTANAGLKSSTGFPGILVFGREGSTRIQRRYGNAFKLICNANLTKFTYSDLPLNIDSRSGHCTSIIDSKIFIVGGRDDKVIDTHVIKGLSSDKTC---DVVSTLIQRASEFQFEKCPLVGRRKAGRRGHCLIPGKHGFVVSGGSSFIEASHVADCAGFLYVMSSNCDEYFFLGSLYNTRTDGAYSISHNQEAIYHGGIDFHGKIRSEFLKLKLV 1244
            + WE +  L     ++ H    V + L+ HGGIK   +S  P+ +FFK+++ T   + +    SP LS HA+VV  NRY  L+GGW+G  R +++Y++D +  KW+   T +GFP GAGLSSHTA       T    +LV GREGS R QR++GN + L  +    +F Y+    NI SRSGH  ++I + ++I+GGR D + +  V      + +C   D +   I  + +   EK P       GR+ H         ++ GG +F   +H      FL  +     +++ L S    R+  A  +  N+  I HGG      I S   +LK+ 
Sbjct:   77 VTWEPVAPLGPN--AAFHACALVGKTLYFHGGIKDASSSSVPSKQFFKLNLDTLLWEKVAAPGSPALSHHAAVVLENRYFTLIGGWNGKKRLASIYVYDTVENKWME-MTHQGFPSGAGLSSHTATL-----TTNGKVLVIGREGSLRTQRKHGNMYILSGSVASNQFIYTSYTNNIISRSGHTVNLIGNNLYILGGRSDMLFEKFVGIDYKKNSSCMLLDSIGKEINSSHQQHLEKLP------CGRKHHISAATNDFILMHGGETFDGKAHAPVGDLFLITLKP-ITKFYQLHSSQLCRSGHACIVLPNRIFI-HGGRSGKNVINSGLYELKIT 396          
BLAST of kelch domain-containing protein 9 vs. Ensembl Nematostella
Match: EDO48031 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKQ9])

HSP 1 Score: 85.1149 bits (209), Expect = 2.852e-18
Identity = 61/205 (29.76%), Postives = 91/205 (44.39%), Query Frame = 3
Query:  300 HVLVSVNEYLFVHGGIKVENSL--------KPTNEFFKIDMKTYHIDDLTTSDS-----------PFLSQHASVVFNNRYIILVGGWDGHSRTSAVYIFDVLNFKWLNPPTVEGFPKGAGLSSHTANAGLKSSTGFPGILVFGREGSTRIQRRYGNAFKLICNANLTKFTYSDLPLNIDSRSGHCTSIIDSK------IFIVGGR 839
            H   SV  +L+V GGI  + S+           N + K++     I     + S           P LS H +    +RYI+++GGW+G  RT+ V+ +D +   W         P   GLSSHTA      S     IL+ GREG   +QRR+  AF L    +     Y + P +  SRSGH  +++  +      +F+ GGR
Sbjct:   19 HTCSSVQGFLYVFGGITDDRSVLNDMHRFDPSNNSWLKLECGLPRITPSRPAISHQFPRGKLCGPPSLSHHTATTIRDRYIVIIGGWNGRKRTAEVFCYDTVEQIWRQISVSGDVP--VGLSSHTACLVSTKS-----ILIIGREGGVHMQRRFSGAFML----DFETGKYREAPFHAASRSGHTANLVYIRGSKKHYVFVFGGR 212          
The following BLAST results are available for this feature:
BLAST of kelch domain-containing protein 9 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
KLHDC91.513e-1527.33kelch domain containing 9 [Source:HGNC Symbol;Acc:... [more]
KLHDC93.634e-1525.51kelch domain containing 9 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of kelch domain-containing protein 9 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of kelch domain-containing protein 9 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of kelch domain-containing protein 9 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of kelch domain-containing protein 9 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
KLHDC94.298e-1927.39kelch domain containing 9 [Source:NCBI gene;Acc:10... [more]
KLHDC97.305e-1927.39kelch domain containing 9 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of kelch domain-containing protein 9 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Klhdc91.329e-1728.14kelch domain containing 9 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of kelch domain-containing protein 9 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q3USL1|KLDC9_MOUSE9.294e-1728.14Kelch domain-containing protein 9 OS=Mus musculus ... [more]
sp|Q8NEP7|KLDC9_HUMAN1.745e-1425.51Kelch domain-containing protein 9 OS=Homo sapiens ... [more]
back to top
BLAST of kelch domain-containing protein 9 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V4BAM31.183e-5435.44Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A1S3JH551.752e-4835.94kelch domain-containing protein 9 OS=Lingula ungui... [more]
A0A2C9KXW23.939e-4232.44Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A2T7PF011.985e-4137.23Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A2C9KXS12.549e-4132.44Uncharacterized protein OS=Biomphalaria glabrata O... [more]
back to top
BLAST of kelch domain-containing protein 9 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of kelch domain-containing protein 9 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of kelch domain-containing protein 9 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of kelch domain-containing protein 9 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO480312.852e-1829.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of kelch domain-containing protein 9 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of kelch domain-containing protein 9 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019390 ID=SMED30019390|Name=kelch domain-containing protein 9|organism=Schmidtea mediterranea sexual|type=transcript|length=1393bp
ATAAAATTTCTTGAATTAAACTTACGTCTAAATATAAATTAAATAAATAT
AGTCTAAGTCCAGGGTACAATCATTTTGTTAGTTGAAATTGTAAACCAAT
TATTTCTCGTTTATAAATTCATAAGCAAGTTATTTTTAGTATGATTTATT
GTTTATTTGTTGCTATGTAAATGAATCAAAATAATTTTGAAGTTTCAGAC
AGTAATTTTAGAAGATTTTCTATCGTATCCAGAGAAAAAAATTCACCTTT
GCAATGGGAAGAAATAAAGGAGTTAACTGGTAAAGTTTATTCATCACATC
ATGTTCTAGTATCTGTAAATGAATATTTATTTGTTCATGGAGGAATTAAA
GTAGAAAATTCATTGAAACCAACAAATGAATTCTTTAAAATTGATATGAA
AACTTATCATATTGATGATTTGACTACATCTGATTCACCATTTCTGAGTC
AGCATGCTTCAGTAGTATTCAACAACAGGTATATTATTCTAGTAGGCGGG
TGGGATGGTCATTCTCGGACAAGTGCCGTATATATTTTCGATGTTCTGAA
TTTTAAGTGGCTTAATCCACCTACAGTAGAAGGTTTTCCAAAAGGGGCTG
GTCTGTCATCACATACTGCTAATGCAGGTTTAAAGTCATCAACTGGATTT
CCAGGTATATTAGTATTTGGGCGTGAAGGAAGCACTCGAATTCAACGACG
CTATGGAAATGCATTCAAATTGATATGCAACGCAAATCTTACAAAATTTA
CTTATTCTGATCTTCCTTTAAATATTGATTCCCGAAGTGGACATTGTACA
TCAATTATAGATTCTAAAATATTCATAGTTGGCGGAAGAGATGACAAAGT
AATCGACACTCATGTAATTAAAGGATTAAGTTCTGATAAAACTTGCGATG
TTGTATCAACGTTGATTCAGCGAGCATCGGAATTTCAATTCGAAAAATGC
CCTCTTGTTGGTCGCAGAAAAGCTGGAAGGAGAGGACATTGTTTAATTCC
CGGTAAGCATGGATTTGTAGTTTCAGGGGGATCTTCATTTATTGAAGCAA
GCCATGTTGCAGATTGCGCTGGCTTTTTATATGTCATGTCTTCAAATTGT
GACGAATATTTTTTTCTTGGTTCTTTGTATAATACAAGAACGGATGGTGC
CTATTCAATTTCTCATAATCAAGAAGCAATTTATCATGGGGGCATTGATT
TTCATGGGAAAATAAGGTCTGAGTTTTTGAAATTAAAATTAGTTATTTGA
AGTTCTGTTTTTACTAATTGTAGGCAAACTTATTATAAATAAAAAGCGTT
TTTTAAATTAGAACTCAAGATAATCTTAAGAAATGCCATGTAAAGGGTTA
AATTGAAAATTTAAATGCGTTTGTTTAAATTGAGCAATTCGAA
back to top

protein sequence of SMED30019390-orf-1

>SMED30019390-orf-1 ID=SMED30019390-orf-1|Name=SMED30019390-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=360bp
MNQNNFEVSDSNFRRFSIVSREKNSPLQWEEIKELTGKVYSSHHVLVSVN
EYLFVHGGIKVENSLKPTNEFFKIDMKTYHIDDLTTSDSPFLSQHASVVF
NNRYIILVGGWDGHSRTSAVYIFDVLNFKWLNPPTVEGFPKGAGLSSHTA
NAGLKSSTGFPGILVFGREGSTRIQRRYGNAFKLICNANLTKFTYSDLPL
NIDSRSGHCTSIIDSKIFIVGGRDDKVIDTHVIKGLSSDKTCDVVSTLIQ
RASEFQFEKCPLVGRRKAGRRGHCLIPGKHGFVVSGGSSFIEASHVADCA
GFLYVMSSNCDEYFFLGSLYNTRTDGAYSISHNQEAIYHGGIDFHGKIRS
EFLKLKLVI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0000418head
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR042941KLDC9
IPR006652Kelch_1
IPR015915Kelch-typ_b-propeller
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR015915Kelch-type beta propellerGENE3DG3DSA:2.120.10.80coord: 7..246
e-value: 2.7E-14
score: 54.8
IPR015915Kelch-type beta propellerSUPERFAMILYSSF117281Kelch motifcoord: 27..333
IPR006652Kelch repeat type 1PFAMPF01344Kelch_1coord: 95..130
e-value: 1.1E-5
score: 24.9
IPR042941Kelch domain-containing protein 9PANTHERPTHR47196FAMILY NOT NAMEDcoord: 22..215