Exocyst complex component

Overview
NameExocyst complex component
Smed IDSMED30019378
Length (bp)2994
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Exocyst complex component (SMED30019378) t-SNE clustered cells

Violin plots show distribution of expression levels for Exocyst complex component (SMED30019378) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Exocyst complex component (SMED30019378) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Exocyst complex component (SMED30019378) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019378

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30019378SMESG000065870.1 dd_Smed_v4_2186_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30019378SMESG000065870.1 dd_Smed_v4_2186_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30019378SMESG000065870.1 dd_Smed_v4_2186_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Exocyst complex component vs. Ensembl Human
Match: EXOC6B (exocyst complex component 6B [Source:HGNC Symbol;Acc:HGNC:17085])

HSP 1 Score: 414.461 bits (1064), Expect = 5.380e-130
Identity = 273/859 (31.78%), Postives = 435/859 (50.64%), Query Frame = 2
Query:  311 LISEIKSNSSGSIANIIRKLRQLETSSVNNDSSEILTKFMRHLDNEIELNNQDIEKFCNHFYQCFVDSIKELLKIQEEASELKSSFGSVQSSLMESVKKIKQDCNELSKCHLILANIDKAVENLQACLPVFDQYLKAAKSINEKRYYPALKTLNHLELNQMQRVRQFSFSDNLQNKIPGMREQIKAASKDEIKDFLENVRKHSVGLGMCAMKLMAHKTGMEVNFDSPTKRTMNGARMNKGDDSKRENPFVGMLDEPDSVNKEIQDLISLESYGNDNDDSSELELESTNVEDRVDFGPVYRCLHIHSVLGDRHEFEKCYRNQRKRQCTLLLTLSK--QESVRNYHEFLSGVVGFFVVEDYIRHSQISMVTRNYLDELWSQTMLRVGDFVSVNSDNINDIESLLKLKDSCVLFGKTMRSLGFNVAGFKDFYEVLKKQHQKLLGNEYSNKFKDIFEGEDYTAITVQDASEMELVIDLYPYFLSPDIDILPYPKSLSFSWMVPRINQAIRDHIKKCRKFSDNLELSQTELEDQLNHTTNVLFSQTLKHFLVKAVKDSERELNRLIQLAVNMDELESACIGLQNFISSLVG----TVYTNSYQXXXXXXXXXXXXXXXXXINPPRSRLHAFALFKELHSKIENCIYSAIDAKIDDMFDDNEYRQVNSHHSSTNNSLANSPSKKFNSISIDNNQMKPSDFITDVIAYLSITFESFTNLPARLAQTACLLSCKYIDKKL-KTFVNSEAR-ISERFLHQLSTDIKSLQDFTRKIPVAGVSADTLILVFEDLRQLTALVILSDWDTFIKNYRTNQNPYDRVLTSSAISLLEKTRHSDTGFSALIKSLKKNKQDKRD--EEILKQLKEL 2857
            ++ EI+S  +  I   +R +   E             +FM  L+  I  ++++IEK CN  YQ FVDSI ELLK++ EA +LK+        L    K++     EL +C L   NI   V+ L  CLPV + Y K    +  KR+YPALKTL HLE   + +V  + F   + + IP +RE+IK  S  ++KDFLE++RKHS  +G  AMK    +   + N D+     +   R+     SK++   +   +   +  K  QD       G  + +  E + E    +D VDF PVYRCLHI+SVLG R  FE  YR QR++Q  L+L       E++  Y ++ + +VGFFVVED+I H+   +V R Y+DELW   + +    +  +S   +D   +L LK+  VLF  T++  GF V    D    ++ Q+ + L  +++  F++I + ++Y+ I V      + V+  +P F   +++  P+PK   FS  VP++   I++ I  C KFS++L LS TE++D +  +TN+L ++TL + L   +K     L  L+Q+ +N   LE +C  L+ FI+++      TV+T                          ++L+    FK+     E  IY+ ++ KID      +Y  +          L N                K SD++ D+IA+L  TF  FT+LP ++AQTAC+ +CK++   L +  + +E R ++   L Q + D++  + F R  PV G   DTL L F DLRQL  L I  DW T++ +Y      Y RV   +A++LLEK + +    + +    +KN++DK+   + + KQL+ L
Sbjct:   21 ILREIESTDTACIGPTLRSVYDGEEHG----------RFMEKLETRIRNHDREIEKMCNFHYQGFVDSITELLKVRGEAQKLKNQVTDTNRKLQHEGKELVIAMEELKQCRLQQRNISATVDKLMLCLPVLEMYSKLRDQMKTKRHYPALKTLEHLEHTYLPQVSHYRFCKVMVDNIPKLREEIKDVSMSDLKDFLESIRKHSDKIGETAMK----QAQQQRNLDNI---VLQQPRIGSKRKSKKDAYIIFDTEIESTSPKSEQD------SGILDVEDEEDDEEVPGAQDLVDFSPVYRCLHIYSVLGARETFENYYRKQRRKQARLVLQPPSNMHETLDGYRKYFNQIVGFFVVEDHILHTTQGLVNRAYIDELWEMALSKTIAALRTHSSYCSDPNLVLDLKNLIVLFADTLQVYGFPVNQLFDMLLEIRDQYSETLLKKWAGIFRNILDSDNYSPIPVTSEEMYKKVVGQFP-FQDIELEKQPFPKKFPFSEFVPKVYNQIKEFIYACLKFSEDLHLSSTEVDDMIRKSTNLLLTRTLSNSLQNVIKRKNIGLTELVQIIINTTHLEKSCKYLEEFITNITNVLPETVHT--------------------------TKLYGTTTFKDARHAAEEEIYTNLNQKIDQFLQLADYDWMTG-------DLGN----------------KASDYLVDLIAFLRSTFAVFTHLPGKVAQTACMSACKHLATSLMQLLLEAEVRQLTLGALQQFNLDVRECEQFARSGPVPGFQEDTLQLAFIDLRQLLDLFIQWDWSTYLADYGQPNCKYLRVNPVTALTLLEKMKDTSRK-NNMFAQFRKNERDKQKLIDTVAKQLRGL 805          
BLAST of Exocyst complex component vs. Ensembl Human
Match: EXOC6 (exocyst complex component 6 [Source:HGNC Symbol;Acc:HGNC:23196])

HSP 1 Score: 413.69 bits (1062), Expect = 9.532e-130
Identity = 270/859 (31.43%), Postives = 436/859 (50.76%), Query Frame = 2
Query:  311 LISEIKSNSSGSIANIIRKLRQLETSSVNNDSSEILTKFMRHLDNEIELNNQDIEKFCNHFYQCFVDSIKELLKIQEEASELKSSFGSVQSSLMESVKKIKQDCNELSKCHLILANIDKAVENLQACLPVFDQYLKAAKSINEKRYYPALKTLNHLELNQMQRVRQFSFSDNLQNKIPGMREQIKAASKDEIKDFLENVRKHSVGLGMCAMKLMAHKTGMEVNFDSPTKRTMNGARMNKGDDSKRENPFVGMLDEPDSVNKEIQDLISLESYGNDNDDSSELELESTNVEDRVDFGPVYRCLHIHSVLGDRHEFEKCYRNQRKRQCTLLLTLSK--QESVRNYHEFLSGVVGFFVVEDYIRHSQISMVTRNYLDELWSQTMLRVGDFVSVNSDNINDIESLLKLKDSCVLFGKTMRSLGFNVAGFKDFYEVLKKQHQKLLGNEYSNKFKDIFEGEDYTAITVQDASEMELVIDLYPYFLSPDIDILPYPKSLSFSWMVPRINQAIRDHIKKCRKFSDNLELSQTELEDQLNHTTNVLFSQTLKHFLVKAVKDSERELNRLIQLAVNMDELESACIGLQNFISSLVG----TVYTNSYQXXXXXXXXXXXXXXXXXINPPRSRLHAFALFKELHSKIENCIYSAIDAKIDDMFDDNEYRQVNSHHSSTNNSLANSPSKKFNSISIDNNQMKPSDFITDVIAYLSITFESFTNLPARLAQTACLLSCKYIDKKL-KTFVNSEAR-ISERFLHQLSTDIKSLQDFTRKIPVAGVSADTLILVFEDLRQLTALVILSDWDTFIKNYRTNQNPYDRVLTSSAISLLEKTRHSDTGFSALIKSLKKNKQDKRD--EEILKQLKEL 2857
            ++ EI+S  +  +   +R        SV +D      KFM  LD  I  ++++IEK CN  +Q FVD+I ELLK++ +A +LK           ++ K++     ++ +C +   NI   VE LQ CLPV + Y K  + ++ KRYY ALKT+  LE      V Q+ F   +   +P +RE IK  S  ++KDFLE++RKHS  +G  AMK   H+    V+     K       M  G +         M    D + +E  + +   S   ++++  E+      V+D VDF PVYRCLHI+SVLGD   FE  YR QRK+Q  L+L       E+V  Y  + + +VGFFVVED+I H    +VTR Y DELW+  + ++   +  +S    D + +L+LK+  V+F  T++  GF V    D    ++ Q+ + L  +++  F+DIFE ++Y+ I V +  E ++VI  +P F  PD++   +PK    S  VP I   +++ I    KFS++L  S TE++D L  +TN+L ++TL   L+  ++     L  L+Q+ +N   LE AC  L++FI+++      TV+T                          +RL+  + FK+     E  IY+ ++ KID+     +Y    S                           + S ++ D+I +L   F+ FT+LP ++AQTAC+ +C+++   L +  ++SE + IS   + Q + D+   + F    PV G   DTL L F DLRQL  L ++ DW T++ +Y    + Y RV  ++A++LLEK + +    + +    +KN +DK+   E ++KQL+ L
Sbjct:   17 ILQEIESTDTACVGPTLR--------SVYDDQPNAHKKFMEKLDACIRNHDKEIEKMCNFHHQGFVDAITELLKVRTDAEKLKVQVTDTNRRFQDAGKEVIVHTEDIIRCRIQQRNITTVVEKLQLCLPVLEMYSKLKEQMSAKRYYSALKTMEQLENVYFPWVSQYRFCQLMIENLPKLREDIKEISMSDLKDFLESIRKHSDKIGETAMKQAQHQKTFSVSLQKQNK-------MKFGKN---------MYINRDRIPEERNETVLKHSLEEEDENEEEI----LTVQDLVDFSPVYRCLHIYSVLGDEETFENYYRKQRKKQARLVLQPQSNMHETVDGYRRYFTQIVGFFVVEDHILHVTQGLVTRAYTDELWNMALSKIIAVLRAHSSYCTDPDLVLELKNLTVIFADTLQGYGFPVNRLFDLLFEIRDQYNETLLKKWAGVFRDIFEEDNYSPIPVVNEEEYKIVISKFP-FQDPDLEKQSFPKKFPMSQSVPHIYIQVKEFIYASLKFSESLHRSSTEIDDMLRKSTNLLLTRTLSSCLLNLIRKPHIGLTELVQIIINTTHLEQACKYLEDFITNITNISQETVHT--------------------------TRLYGLSTFKDARHAAEGEIYTKLNQKIDEFVQLADYDWTMSEPDG-----------------------RASGYLMDLINFLRSIFQVFTHLPGKVAQTACMSACQHLSTSLMQMLLDSELKQISMGAVQQFNLDVIQCELFASSEPVPGFQGDTLQLAFIDLRQLLDLFMVWDWSTYLADYGQPASKYLRVNPNTALTLLEKMKDTSKK-NNIFAQFRKNDRDKQKLIETVVKQLRSL 796          
BLAST of Exocyst complex component vs. Ensembl Human
Match: EXOC6B (exocyst complex component 6B [Source:HGNC Symbol;Acc:HGNC:17085])

HSP 1 Score: 412.149 bits (1058), Expect = 4.296e-129
Identity = 274/862 (31.79%), Postives = 433/862 (50.23%), Query Frame = 2
Query:  311 LISEIKSNSSGSIANIIRKLRQLETSSVNNDSSEILTKFMRHLDNEIELNNQDIEKFCNHFYQCFVDSIKELLKIQEEASELKSSFGSVQSSLMESVKKIKQDCNELSKCHLILANIDKAVENLQACLPVFDQYLKAAKSINEKRYYPALKTLNHLELNQMQRVRQFSFSDNLQNKIPGMREQIKAASKDEIKDFLENVRKHSVGLGMCAMKLMAHKTGMEVNFDSPTKRTMNGARMNKGDDSKRENPFVGMLDEPDSVNKEIQDLISLESYGNDNDDSSELELESTNVEDRVDFGPVYRCLHIHSVLGDRHEFEKCYRNQRKRQCTLLLTLSK--QESVRNYHEFLSGVVGFFVVEDYIRHSQISMVTRNYLDELWSQTMLRVGDFVSVNSDNINDIESLLKLKDSCVLFGKTMRSLGFNVAGFKDFYEVLKKQHQKLLGNEYSNKFKDIFEGEDYTAITVQDASEMELVIDLYPYFLSPDIDILPYPKSLSFSWMVPRINQAIRDHIKKCRKFSDNLELSQTELEDQLNHTTNVLFSQTLKHFLVKAVKDSERELNRLIQLAVNMDELESACIGLQNFISSLVG----TVYTNSYQXXXXXXXXXXXXXXXXXINPPRSRLHAFALFKELHSKIENCIYSAIDAKIDDMFDDNEYRQVNSHHSSTNNSLANSPSKKFNSISIDNNQMKPSDFITDVIAYLSITFESFTNLPARLAQTACLLSCKYIDKKL-KTFVNSEAR-ISERFLHQLSTDIKSLQDFTRKIPVAGVSADTLILVFEDLRQLTALVILSDWDTFIKNYRTNQNPYDRVLTSSAISLLEKTRHSDTGFSA---LIKSLKKNKQDKRD--EEILKQLKEL 2857
            ++ EI+S  +  I   +R +   E             +FM  L+  I  ++++IEK CN  YQ FVDSI ELLK++ EA +LK+        L    K++     EL +C L   NI   V+ L  CLPV + Y K    +  KR+YPALKTL HLE   + +V  + F   + + IP +RE+IK  S  ++KDFLE++RKHS  +G  AMK    +   + N D+     +   R+     SK++   +   +   +  K  QD       G  + +  E + E    +D VDF PVYRCLHI+SVLG R  FE  YR QR++Q  L+L       E++  Y ++ + +VGFFVVED+I H+   +V R Y+DELW   + +    +  +S   +D   +L LK+  VLF  T++  GF V    D    ++ Q+ + L  +++  F++I + ++Y+ I V      + V+  +P F   +++  P+PK   FS  VP++   I++ I  C KFS++L LS TE++D +  +TN+L ++TL + L   +K     L  L+Q+ +N   LE +C  L+ FI+++      TV+T                          ++L+    FK+     E  IY+ ++ KID      +Y  +          L N                K SD++ D+IA+L  TF  FT+LP ++AQTAC+ +CK++   L +  + +E R ++   L Q + D++  + F R  PV G   DTL L F DLRQL  L I  DW T++ +Y      Y RV   +A++LLEK        S    +    +KN++DK+   + + KQL+ L
Sbjct:   21 ILREIESTDTACIGPTLRSVYDGEEHG----------RFMEKLETRIRNHDREIEKMCNFHYQGFVDSITELLKVRGEAQKLKNQVTDTNRKLQHEGKELVIAMEELKQCRLQQRNISATVDKLMLCLPVLEMYSKLRDQMKTKRHYPALKTLEHLEHTYLPQVSHYRFCKVMVDNIPKLREEIKDVSMSDLKDFLESIRKHSDKIGETAMK----QAQQQRNLDNI---VLQQPRIGSKRKSKKDAYIIFDTEIESTSPKSEQD------SGILDVEDEEDDEEVPGAQDLVDFSPVYRCLHIYSVLGARETFENYYRKQRRKQARLVLQPPSNMHETLDGYRKYFNQIVGFFVVEDHILHTTQGLVNRAYIDELWEMALSKTIAALRTHSSYCSDPNLVLDLKNLIVLFADTLQVYGFPVNQLFDMLLEIRDQYSETLLKKWAGIFRNILDSDNYSPIPVTSEEMYKKVVGQFP-FQDIELEKQPFPKKFPFSEFVPKVYNQIKEFIYACLKFSEDLHLSSTEVDDMIRKSTNLLLTRTLSNSLQNVIKRKNIGLTELVQIIINTTHLEKSCKYLEEFITNITNVLPETVHT--------------------------TKLYGTTTFKDARHAAEEEIYTNLNQKIDQFLQLADYDWMTG-------DLGN----------------KASDYLVDLIAFLRSTFAVFTHLPGKVAQTACMSACKHLATSLMQLLLEAEVRQLTLGALQQFNLDVRECEQFARSGPVPGFQEDTLQLAFIDLRQLLDLFIQWDWSTYLADYGQPNCKYLRVNPVTALTLLEKISREMKDTSRKNNMFAQFRKNERDKQKLIDTVAKQLRGL 809          
BLAST of Exocyst complex component vs. Ensembl Human
Match: EXOC6 (exocyst complex component 6 [Source:HGNC Symbol;Acc:HGNC:23196])

HSP 1 Score: 411.379 bits (1056), Expect = 5.471e-129
Identity = 271/865 (31.33%), Postives = 439/865 (50.75%), Query Frame = 2
Query:  293 NKNFSNLISEIKSNSSGSIANIIRKLRQLETSSVNNDSSEILTKFMRHLDNEIELNNQDIEKFCNHFYQCFVDSIKELLKIQEEASELKSSFGSVQSSLMESVKKIKQDCNELSKCHLILANIDKAVENLQACLPVFDQYLKAAKSINEKRYYPALKTLNHLELNQMQRVRQFSFSDNLQNKIPGMREQIKAASKDEIKDFLENVRKHSVGLGMCAMKLMAHKTGMEVNFDSPTKRTMNGARMNKGDDSKRENPFVGMLDEPDSVNKEIQDLISLESYGNDNDDSSELELESTNVEDRVDFGPVYRCLHIHSVLGDRHEFEKCYRNQRKRQCTLLLTLSK--QESVRNYHEFLSGVVGFFVVEDYIRHSQISMVTRNYLDELWSQTMLRVGDFVSVNSDNINDIESLLKLKDSCVLFGKTMRSLGFNVAGFKDFYEVLKKQHQKLLGNEYSNKFKDIFEGEDYTAITVQDASEMELVIDLYPYFLSPDIDILPYPKSLSFSWMVPRINQAIRDHIKKCRKFSDNLELSQTELEDQLNHTTNVLFSQTLKHFLVKAVKDSERELNRLIQLAVNMDELESACIGLQNFISSLVG----TVYTNSYQXXXXXXXXXXXXXXXXXINPPRSRLHAFALFKELHSKIENCIYSAIDAKIDDMFDDNEYRQVNSHHSSTNNSLANSPSKKFNSISIDNNQMKPSDFITDVIAYLSITFESFTNLPARLAQTACLLSCKYIDKKL-KTFVNSEAR-ISERFLHQLSTDIKSLQDFTRKIPVAGVSADTLILVFEDLRQLTALVILSDWDTFIKNYRTNQNPYDRVLTSSAISLLEKTRHSDTGFSALIKSLKKNKQDKRD--EEILKQLKEL 2857
            ++ + N+++EI+S      A +          SV +D      KFM  LD  I  ++++IEK CN  +Q FVD+I ELLK++ +A +LK           ++ K++     ++ +C +   NI   VE LQ CLPV + Y K  + ++ KRYY ALKT+  LE      V Q+ F   +   +P +RE IK  S  ++KDFLE++RKHS  +G  AMK   H+    V+     K       M  G +         M    D + +E  + +   S   ++++  E+      V+D VDF PVYRCLHI+SVLGD   FE  YR QRK+Q  L+L       E+V  Y  + + +VGFFVVED+I H    +VTR Y DELW+  + ++   +  +S    D + +L+LK+  V+F  T++  GF V    D    ++ Q+ + L  +++  F+DIFE ++Y+ I V +  E ++VI  +P F  PD++   +PK    S  VP I   +++ I    KFS++L  S TE++D L  +TN+L ++TL   L+  ++     L  L+Q+ +N   LE AC  L++FI+++      TV+T                          +RL+  + FK+     E  IY+ ++ KID+     +Y    S                           + S ++ D+I +L   F+ FT+LP ++AQTAC+ +C+++   L +  ++SE + IS   + Q + D+   + F    PV G   DTL L F DLRQL  L ++ DW T++ +Y    + Y RV  ++A++LLEK + +    + +    +KN +DK+   E ++KQL+ L
Sbjct:    7 DQTYENVLAEIQSFELPVEATL---------RSVYDDQPNAHKKFMEKLDACIRNHDKEIEKMCNFHHQGFVDAITELLKVRTDAEKLKVQVTDTNRRFQDAGKEVIVHTEDIIRCRIQQRNITTVVEKLQLCLPVLEMYSKLKEQMSAKRYYSALKTMEQLENVYFPWVSQYRFCQLMIENLPKLREDIKEISMSDLKDFLESIRKHSDKIGETAMKQAQHQKTFSVSLQKQNK-------MKFGKN---------MYINRDRIPEERNETVLKHSLEEEDENEEEI----LTVQDLVDFSPVYRCLHIYSVLGDEETFENYYRKQRKKQARLVLQPQSNMHETVDGYRRYFTQIVGFFVVEDHILHVTQGLVTRAYTDELWNMALSKIIAVLRAHSSYCTDPDLVLELKNLTVIFADTLQGYGFPVNRLFDLLFEIRDQYNETLLKKWAGVFRDIFEEDNYSPIPVVNEEEYKIVISKFP-FQDPDLEKQSFPKKFPMSQSVPHIYIQVKEFIYASLKFSESLHRSSTEIDDMLRKSTNLLLTRTLSSCLLNLIRKPHIGLTELVQIIINTTHLEQACKYLEDFITNITNISQETVHT--------------------------TRLYGLSTFKDARHAAEGEIYTKLNQKIDEFVQLADYDWTMSEPDG-----------------------RASGYLMDLINFLRSIFQVFTHLPGKVAQTACMSACQHLSTSLMQMLLDSELKQISMGAVQQFNLDVIQCELFASSEPVPGFQGDTLQLAFIDLRQLLDLFMVWDWSTYLADYGQPASKYLRVNPNTALTLLEKMKDTSKK-NNIFAQFRKNDRDKQKLIETVVKQLRSL 791          
BLAST of Exocyst complex component vs. Ensembl Human
Match: EXOC6 (exocyst complex component 6 [Source:HGNC Symbol;Acc:HGNC:23196])

HSP 1 Score: 411.379 bits (1056), Expect = 5.471e-129
Identity = 271/865 (31.33%), Postives = 439/865 (50.75%), Query Frame = 2
Query:  293 NKNFSNLISEIKSNSSGSIANIIRKLRQLETSSVNNDSSEILTKFMRHLDNEIELNNQDIEKFCNHFYQCFVDSIKELLKIQEEASELKSSFGSVQSSLMESVKKIKQDCNELSKCHLILANIDKAVENLQACLPVFDQYLKAAKSINEKRYYPALKTLNHLELNQMQRVRQFSFSDNLQNKIPGMREQIKAASKDEIKDFLENVRKHSVGLGMCAMKLMAHKTGMEVNFDSPTKRTMNGARMNKGDDSKRENPFVGMLDEPDSVNKEIQDLISLESYGNDNDDSSELELESTNVEDRVDFGPVYRCLHIHSVLGDRHEFEKCYRNQRKRQCTLLLTLSK--QESVRNYHEFLSGVVGFFVVEDYIRHSQISMVTRNYLDELWSQTMLRVGDFVSVNSDNINDIESLLKLKDSCVLFGKTMRSLGFNVAGFKDFYEVLKKQHQKLLGNEYSNKFKDIFEGEDYTAITVQDASEMELVIDLYPYFLSPDIDILPYPKSLSFSWMVPRINQAIRDHIKKCRKFSDNLELSQTELEDQLNHTTNVLFSQTLKHFLVKAVKDSERELNRLIQLAVNMDELESACIGLQNFISSLVG----TVYTNSYQXXXXXXXXXXXXXXXXXINPPRSRLHAFALFKELHSKIENCIYSAIDAKIDDMFDDNEYRQVNSHHSSTNNSLANSPSKKFNSISIDNNQMKPSDFITDVIAYLSITFESFTNLPARLAQTACLLSCKYIDKKL-KTFVNSEAR-ISERFLHQLSTDIKSLQDFTRKIPVAGVSADTLILVFEDLRQLTALVILSDWDTFIKNYRTNQNPYDRVLTSSAISLLEKTRHSDTGFSALIKSLKKNKQDKRD--EEILKQLKEL 2857
            ++ + N+++EI+S      A +          SV +D      KFM  LD  I  ++++IEK CN  +Q FVD+I ELLK++ +A +LK           ++ K++     ++ +C +   NI   VE LQ CLPV + Y K  + ++ KRYY ALKT+  LE      V Q+ F   +   +P +RE IK  S  ++KDFLE++RKHS  +G  AMK   H+    V+     K       M  G +         M    D + +E  + +   S   ++++  E+      V+D VDF PVYRCLHI+SVLGD   FE  YR QRK+Q  L+L       E+V  Y  + + +VGFFVVED+I H    +VTR Y DELW+  + ++   +  +S    D + +L+LK+  V+F  T++  GF V    D    ++ Q+ + L  +++  F+DIFE ++Y+ I V +  E ++VI  +P F  PD++   +PK    S  VP I   +++ I    KFS++L  S TE++D L  +TN+L ++TL   L+  ++     L  L+Q+ +N   LE AC  L++FI+++      TV+T                          +RL+  + FK+     E  IY+ ++ KID+     +Y    S                           + S ++ D+I +L   F+ FT+LP ++AQTAC+ +C+++   L +  ++SE + IS   + Q + D+   + F    PV G   DTL L F DLRQL  L ++ DW T++ +Y    + Y RV  ++A++LLEK + +    + +    +KN +DK+   E ++KQL+ L
Sbjct:    7 DQTYENVLAEIQSFELPVEATL---------RSVYDDQPNAHKKFMEKLDACIRNHDKEIEKMCNFHHQGFVDAITELLKVRTDAEKLKVQVTDTNRRFQDAGKEVIVHTEDIIRCRIQQRNITTVVEKLQLCLPVLEMYSKLKEQMSAKRYYSALKTMEQLENVYFPWVSQYRFCQLMIENLPKLREDIKEISMSDLKDFLESIRKHSDKIGETAMKQAQHQKTFSVSLQKQNK-------MKFGKN---------MYINRDRIPEERNETVLKHSLEEEDENEEEI----LTVQDLVDFSPVYRCLHIYSVLGDEETFENYYRKQRKKQARLVLQPQSNMHETVDGYRRYFTQIVGFFVVEDHILHVTQGLVTRAYTDELWNMALSKIIAVLRAHSSYCTDPDLVLELKNLTVIFADTLQGYGFPVNRLFDLLFEIRDQYNETLLKKWAGVFRDIFEEDNYSPIPVVNEEEYKIVISKFP-FQDPDLEKQSFPKKFPMSQSVPHIYIQVKEFIYASLKFSESLHRSSTEIDDMLRKSTNLLLTRTLSSCLLNLIRKPHIGLTELVQIIINTTHLEQACKYLEDFITNITNISQETVHT--------------------------TRLYGLSTFKDARHAAEGEIYTKLNQKIDEFVQLADYDWTMSEPDG-----------------------RASGYLMDLINFLRSIFQVFTHLPGKVAQTACMSACQHLSTSLMQMLLDSELKQISMGAVQQFNLDVIQCELFASSEPVPGFQGDTLQLAFIDLRQLLDLFMVWDWSTYLADYGQPASKYLRVNPNTALTLLEKMKDTSKK-NNIFAQFRKNDRDKQKLIETVVKQLRSL 791          
BLAST of Exocyst complex component vs. Ensembl Celegans
Match: sec-15 (Exocyst complex component 6 [Source:UniProtKB/Swiss-Prot;Acc:Q18286])

HSP 1 Score: 366.311 bits (939), Expect = 3.220e-112
Identity = 257/883 (29.11%), Postives = 438/883 (49.60%), Query Frame = 2
Query:  245 TMNEFSYMSYSNVSDFNKNFSNLISEIKSNSSGSIANIIRKLRQLETSSVNNDSSEILTKFMRHLDNEIELNNQDIEKFCNHFYQCFVDSIKELLKIQEEASELKSSFGSVQSSLMESVKKIKQDCNELSKCHLILANIDKAVENLQACLPVFDQYLKAAKSINEKRYYPALKTLNHLELNQMQRVRQFSFSDNLQNKIPGMREQIKAASKDEIKDFLENVRKHSVGLGMCAMKLMAHKTGMEVNFDSPTKRTMNGARMNKGDDSKRENPFVGMLDEPDSVNKEIQDLISLESYGNDNDDSSELELESTNVEDRVDFGPVYRCLHIHSVLGDRHEFEKCYRNQRKRQCTLLLTLS-KQESVRNYHEFLSGVVGFFVVEDYIRHSQISMVTRNYLDELWSQTMLRVGDFVSVNSDNINDIESLLKLKDSCVLFGKTMRSLGFNVAGFKDFYEVLKKQHQKLLGNEYSNKFKDIFEGEDYTAITVQDASEMELVIDLYPYFLSPDIDILPYPKSLSFSWMVPRINQAIRDHIKKCRKFSDNLELSQTELEDQLNHTTNVL---FSQTLKHFLVKAVKDSERELNRLIQLAVNMDELESACIGLQNFISSLVG---TVYTNSYQXXXXXXXXXXXXXXXXXINPPRSRLHAFALFKELHSKIENCIYSAIDAKIDDMFDDNEYRQVNSHHSSTNNSLANSPSKKFNSISIDNNQMKPSDFITDVIAYLSITFESFTNLPARLAQTACLLSCKYIDKKLKTFVNSEAR--ISERFLHQLSTDIKSLQDFTRKIPVAGVSADTLILVFEDLRQLTALVILSDWDTFIKNYRTNQNPYDRVLTSSAISLLEKT---RHSDTGFSALIKSLKKNKQDKRDEEILKQLKEL 2857
            T +E +  SY N  + +      + E+++  SGS+  ++R +   +T  V +        F R L   I   +++I+K C+  YQ FVD+++EL+K++E+  ++K    ++ + + +  +++ Q   E+ +   ++ N   A++ +  CLPV + Y K  + ++ ++YY ALKTL  LE   +  V ++ F+  L   +  +R +IK  +  E KDFLEN++K +  +G  A K  A +    V      K+    AR N        N  + +  +   V K +    +++    D+        E  + +D +DF PV+RC  I +VLG + EFE+ YR QRK QC L++  + K  + ++Y E+L  +VGFFVVED I  +Q ++ T    D+LW   ++++   +        D+  +LK+K   +LF  TM+S G+ VA   +  +  + Q+ ++L  EY  +F+   E ++YT ITV    E   +I  +P++    ++  P+P+   FS  V       ++++  C KF DNL+L+ + ++D +    NVL   ++  LK F+ K +      + +L+Q+ +N+  LE +C  L  FI+S       + T S+Q++ S                         +F+++ S++E  I   + +K+D++ D                 LAN          +     + S+FI+D+I +L  TF SFTNLP+ LA+  C  +CK+I + +  F+ S     IS   L Q S D+   + FT + PVAGV   TL + F DLRQL  LV+ SDW TF   Y  +   Y RV  S+AI +LEK        TGF  + K  +K   D     I++QLK L
Sbjct:   13 TGSETASTSYVNYVEMSAEQEYFLYELETTDSGSMGLVLRAI--YDTGDVQS--------FARALQQRISHYDKNIQKVCSFHYQSFVDAMQELMKLKEQCQDIKEETVAIDAEIQQISQRLCQKKQEIVRYRKLMKNAKTAMDQIAVCLPVLENYAKLQEQMSNRKYYQALKTLEELEHTHLALVEKYRFTQVLAKSMAPVRLEIKEKAYSEFKDFLENIKKVAGRIGKHASKDTAEQHSFGVTDAERAKKIQEEARKNAS------NVEIEVSADGSIVKKNMSPKRNMKMQVEDD--------EQVSAQDLIDFTPVHRCCQIFNVLGAKEEFEQYYRQQRKEQCDLVIEPTHKMNNFKHYVEYLDEIVGFFVVEDQILMTQSNLSTTVDKDKLWDNALMKIRQHLDARFGGSPDVLMMLKMKKVILLFILTMKSYGYAVAPLYELLQNFRDQYNEILVKEYCAQFERDLEKDNYTPITVNSEEEFRTIIRKFPFY-KRSMEQEPFPRRFPFSPFVTDAYTQAKNYLIGCLKFMDNLQLNTSAVDDTVRRCANVLLGRWAGVLKSFVHKRLS-----MIQLVQITINLGYLEKSCESLGAFITSKTSGEEAIGTTSHQVVLSEK-----------------------VFRDVRSEVEQQIDECMRSKVDEIID-----------------LANY------DWELPAAAGQASEFISDLINFLQTTFTSFTNLPSGLAKHVCTQTCKHISQSMSDFLLSPETKCISTGALDQFSLDVMQCEMFTTRCPVAGVDPQTLSMTFADLRQLLDLVMSSDWTTFNAEYGKDHAKYLRVKASTAIVVLEKMIEFERKSTGFFGIAKGDRKKLLDT----IVRQLKLL 815          
BLAST of Exocyst complex component vs. Ensembl Fly
Match: Sec15 (gene:FBgn0266674 transcript:FBtr0084034)

HSP 1 Score: 327.791 bits (839), Expect = 2.250e-98
Identity = 225/814 (27.64%), Postives = 397/814 (48.77%), Query Frame = 2
Query:  434 HLDNEIELNNQDIEKFCNHFYQCFVDSIKELLKIQEEASELKSSFGSVQSSLMESVKKIKQDCNELSKCHLILANIDKAVENLQACLPVFDQYLKAAKSINEKRYYPALKTLNHLELNQMQRVR--QFSFSDNLQNKIPGMREQIKAASKDEIKDFLENVRKHSVGLGMCAMKLMAHKTGMEVNFDSPTKRTMNGARMNKGDDSKRENPFVGMLDEPDSVNKEIQDLISLESYGNDNDDSSELELESTNVEDRVDFGPVYRCLHIHSVLGDRHEFEKCYRNQRKRQCTLLLTLSK--QESVRNYHEFLSGVVGFFVVEDYIRHSQISMVTRNYLDELWSQTMLRVGDFVSVNSDNINDIESLLKLKDSCVLFGKTMRSLGFNVAGFKDFYEVLKKQHQKLLGNEYSNKFKDIFEGEDYTAITVQDASEMELVIDLYPYFLSPDIDILPYPKSLSFSWMVPRINQAIRDHIKKCRKFSDNLELSQTELEDQLNHTTNVLFSQTLKHFLVKAVKDSERELNRLIQLAVNMDELESACIGLQNFISSLVGTVYTNSYQXXXXXXXXXXXXXXXXXINPPRSRLHAFALFKELHSKIENCIYSAIDAKIDDMFDDNEYRQVNSHHSSTNNSLANSPSKKFNSISIDNNQMKPSDFITDVIAYLSITFESFTNLPARLAQTACLLSCKYIDKKLKTFVNSE--ARISERFLHQLSTDIKSLQDFTRKIPVAGVSADTLILVFEDLRQLTALVILSDWDTFIKNYRTNQNPYDRVLTSSAISLLEKTRHSDTGFSALIKSLKKNKQDKRDEEILKQLKEL 2857
             L+  I  ++++IE+ CN +YQ F+DSI+ELL+++ +A +L +   S+ +SL +    + Q  N+L +   I +N+  A+E L++CLP  + Y+K  +    K+YY AL+TL  LE   + R++   + F+  +Q +IP ++E I+ +S  + ++FLEN+RK S  +G  A   + H   ++       KR +N                         + + +Q +   E+         + +  + + +D +DF P+YRCLHI+ VLG R  FEK YR QR+ Q  L+L       +++  Y  ++  +VGFFVVED+++++   +VT +YL++LWS ++ +  + +S++S +  D   LL++K+  +L   T +  G+ V    +    ++  + ++L   + + F++I + E +  + VQ+  E E +I+ +P F S  ++  P+PK   FS MVP +    ++ +  C KF++ L LS  E+   +    N+L +++    L    +     L +LIQ+ ++   LE A   L  F+  +  T  + S                      P +  H      E    +  C      +KID+ F+ + Y  +          L   P                S FITD+I+YL  TF+SF      +AQ AC  + ++I +K+ + +  E   +IS   L Q++ D+   + F    PV G+    L   F   RQL  L+IL +W T+  +Y   +N Y  V   S I +LEK R +D     +   ++KN + K  E +LKQLK +
Sbjct:   35 QLEQRIRSHDKEIERICNLYYQGFIDSIQELLQVRTQAQQLHNEVHSLDTSLRQISASLIQQGNDLVRARQIESNLASAIEALKSCLPALECYMKFTQQAKNKQYYQALRTLETLETEHLTRLKTHNYRFATQMQIQIPIIKENIRRSSASDFREFLENIRKFSPRIGELA---ITHTKQLQ-------KRDINAI-----------------------IAEHMQQMNGGEA--GGAGAGGDDDGANVSAQDLIDFSPIYRCLHIYMVLGQREYFEKDYRQQRRDQAKLVLQPPPNMHDNLEAYKTYICAIVGFFVVEDHVKNTAGDVVTSSYLEDLWSSSLTKFVNEISMSSSSCTDPNILLRIKNLIMLSINTFKCYGYTVNILWELLHNMRDHYNEVLLQRWVHVFREILDKEQFLPMVVQNTEEYECIIERFP-FHSEQLENAPFPKKFPFSRMVPEVYHQAKEFMYACMKFAEELTLSPNEVAAMVRKAANLLLTRSFSGCLSVVFRQPSITLTQLIQIIIDTQYLEKAGPFLDEFVCHMTNTERSVS--------------------QTPSAMFHVARQDAEKQVGLRIC------SKIDEFFELSAYDWL----------LVEPPGIA-------------SAFITDMISYLKSTFDSFAFKLPHIAQAACRRTFEHIAEKIYSIMYDEDVKQISTGALTQINLDLMQCEFFAASEPVPGLKEGELSKYFLRNRQLLDLLILEEWSTYFHDYGKQENRYHLVQPQSIIVILEKIREADK--KPIFSLVRKNDKKKLLETVLKQLKHI 761          
BLAST of Exocyst complex component vs. Ensembl Zebrafish
Match: exoc6b (exocyst complex component 6B [Source:ZFIN;Acc:ZDB-GENE-060929-132])

HSP 1 Score: 429.483 bits (1103), Expect = 4.784e-136
Identity = 275/866 (31.76%), Postives = 436/866 (50.35%), Query Frame = 2
Query:  311 LISEIKSNSSGSIANIIRKLRQLETSSVNNDSSEILTKFMRHLDNEIELNNQDIEKFCNHFYQCFVDSIKELLKIQEEASELKSSFGSVQSSLMESVKKIKQDCNELSKCHLILANIDKAVENLQACLPVFDQYLKAAKSINEKRYYPALKTLNHLELNQMQRVRQFSFSDNLQNKIPGMREQIKAASKDEIKDFLENVRKHSVGLGMCAMKLMAHKTGMEVNFDSPTKRTMNGARMNKGD------DSKRENPFVGMLDEPDSVNKEIQDLISLESYGNDNDDSSELELESTNVEDRVDFGPVYRCLHIHSVLGDRHEFEKCYRNQRKRQCTLLLTL--SKQESVRNYHEFLSGVVGFFVVEDYIRHSQISMVTRNYLDELWSQTMLRVGDFVSVNSDNINDIESLLKLKDSCVLFGKTMRSLGFNVAGFKDFYEVLKKQHQKLLGNEYSNKFKDIFEGEDYTAITVQDASEMELVIDLYPYFLSPDIDILPYPKSLSFSWMVPRINQAIRDHIKKCRKFSDNLELSQTELEDQLNHTTNVLFSQTLKHFLVKAVKDSERELNRLIQLAVNMDELESACIGLQNFISSLVGTVYTNSYQXXXXXXXXXXXXXXXXXINPP----RSRLHAFALFKELHSKIENCIYSAIDAKIDDMFDDNEYRQVNSHHSSTNNSLANSPSKKFNSISIDNNQMKPSDFITDVIAYLSITFESFTNLPARLAQTACLLSCKYIDKKLKTFVNSEA---RISERFLHQLSTDIKSLQDFTRKIPVAGVSADTLILVFEDLRQLTALVILSDWDTFIKNYRTNQNPYDRVLTSSAISLLEKTRHSDTGFSALIKSLKKNKQDKRD--EEILKQLKEL 2857
            ++ EI+S  +  I   +R        SV +     L  FM  L+  I  ++++IEK CNH +Q FVDSI ELLK++ EA +LK         L    K++    NEL +C +   NI   ++ L  CLPV + Y K  + +  KRYYPAL+TL  LE + + +   + F   +   IP +R  I+  S  ++KDFLE++RKHS  +G  AMK    +   + N  +  +R+ +G R+ K        D    NPF     E DS   ++ D               E E E     D VDF PVYRCLHI++VLG R  FE  YR QR++Q  L+L    +  E++  Y  + + +VGFFVVED+I H+   +V R Y++ELW   + +    +  +S    D + +L LK+  VLF  T++  GF V    D    ++ Q+ ++L  ++S  F+ I + ++Y+ I V    E + +   +P F  P++D +P+PK L FS  VP++   +++ I  C K+S++L LS TE++D +  +TN+L ++TL H L  A+K     L  L+Q+ +N   LE +C  L+ FIS++                             PP     ++L+  + FK+     E  IY+ ++ KID      +Y    +                           + SD+++D+IA+L  TF  FT+LP ++AQTAC+ +CK++   L   +  EA   ++S   L Q + D+K  + F R  PV G   DTL+L F DLRQL  L    DW T++ +Y      Y RV   +A++LLEK + +    + +    +KN++DK+   + ++KQL+ L
Sbjct:   13 ILREIESTDTNCIGPTLR--------SVYDGQEHGL--FMEKLEGRIRNHDREIEKMCNHHFQGFVDSITELLKVRGEAQKLKGQVTETNQKLQNDGKELLTSMNELRQCRVQQRNIATTIDKLTHCLPVLEMYSKLQEQMRAKRYYPALRTLEQLEESCLPQAGSYRFCTIMAENIPRLRTHIRDVSMSDLKDFLESIRKHSDKIGETAMKQAQVQIARD-NAVTSQQRSASGRRIRKEGYGSTEVDRTGNNPF----SEQDSGILDVDD---------------EQEEEVPGAHDLVDFSPVYRCLHIYTVLGARDTFENYYRKQRRKQARLVLQPHSNMHETLEGYRRYFNQIVGFFVVEDHILHTTQGLVNRAYVEELWELALSKTIAALRTHSSYCTDPDLVLDLKNLIVLFADTLQGYGFPVNQLFDMLLEMRDQYGEILLKKWSQSFRQILDQDNYSPIPVVSPEEYQRITGQFP-FQDPELDKMPFPKKLPFSEFVPKVYSQLKEFIYACLKYSEDLHLSSTEIDDMIRKSTNLLLTRTLSHCLQYAIKKKNVGLAELVQIIINTTHLEQSCHYLEEFISNITNV--------------------------PPDTINATKLYGTSTFKDARHAAEEEIYTNLNQKIDQFLQLADYDWTAAQGGG-----------------------QASDYLSDLIAFLCSTFAVFTHLPGKVAQTACMSACKHLSTSLLQ-LLLEADVRQVSMGALQQFNVDVKECERFARAGPVPGFQGDTLLLAFIDLRQLLDLFTQWDWSTYLADYGRPTCKYLRVNPHTALALLEKMKDTSRK-NNMFAQFRKNERDKQKLIDTVVKQLRNL 796          
BLAST of Exocyst complex component vs. Ensembl Zebrafish
Match: exoc6b (exocyst complex component 6B [Source:ZFIN;Acc:ZDB-GENE-060929-132])

HSP 1 Score: 428.328 bits (1100), Expect = 1.329e-135
Identity = 274/866 (31.64%), Postives = 437/866 (50.46%), Query Frame = 2
Query:  311 LISEIKSNSSGSIANIIRKLRQLETSSVNNDSSEILTKFMRHLDNEIELNNQDIEKFCNHFYQCFVDSIKELLKIQEEASELKSSFGSVQSSLMESVKKIKQDCNELSKCHLILANIDKAVENLQACLPVFDQYLKAAKSINEKRYYPALKTLNHLELNQMQRVRQFSFSDNLQNKIPGMREQIKAASKDEIKDFLENVRKHSVGLGMCAMKLMAHKTGMEVNFDSPTKRTMNGARMNKGD------DSKRENPFVGMLDEPDSVNKEIQDLISLESYGNDNDDSSELELESTNVEDRVDFGPVYRCLHIHSVLGDRHEFEKCYRNQRKRQCTLLLTL--SKQESVRNYHEFLSGVVGFFVVEDYIRHSQISMVTRNYLDELWSQTMLRVGDFVSVNSDNINDIESLLKLKDSCVLFGKTMRSLGFNVAGFKDFYEVLKKQHQKLLGNEYSNKFKDIFEGEDYTAITVQDASEMELVIDLYPYFLSPDIDILPYPKSLSFSWMVPRINQAIRDHIKKCRKFSDNLELSQTELEDQLNHTTNVLFSQTLKHFLVKAVKDSERELNRLIQLAVNMDELESACIGLQNFISSLVGTVYTNSYQXXXXXXXXXXXXXXXXXINPP----RSRLHAFALFKELHSKIENCIYSAIDAKIDDMFDDNEYRQVNSHHSSTNNSLANSPSKKFNSISIDNNQMKPSDFITDVIAYLSITFESFTNLPARLAQTACLLSCKYIDKKLKTFVNSEA---RISERFLHQLSTDIKSLQDFTRKIPVAGVSADTLILVFEDLRQLTALVILSDWDTFIKNYRTNQNPYDRVLTSSAISLLEKTRHSDTGFSALIKSLKKNKQDKRD--EEILKQLKEL 2857
            ++ EI+S  +  I   +R        SV +     L  FM  L+  I  ++++IEK CNH +Q FVDSI ELLK++ EA +LK         L    K++    NEL +C +   NI   ++ L  CLPV + Y K  + +  KRYYPAL+TL  LE + + +   + F   +   IP +R  I+  S  ++KDFLE++RKHS  +G  AMK    +   + N  +  +R+ +G R+ K        D    NPF     E DS   ++ D               E E E     D VDF PVYRCLHI++VLG R  FE  YR QR++Q  L+L    +  E++  Y  + + +VGFFVVED+I H+   +V R Y++ELW   + +    +  +S    D + +L LK+  VLF  T++  GF V    D    ++ Q+ ++L  ++++ F+ I + ++Y+ I V    E + +   +P F  P++D +P+PK L FS  VP++   +++ I  C K+S++L LS TE++D +  +TN+L ++TL H L  A+K     L  L+Q+ +N   LE +C  L+ FIS++                             PP     ++L+  + FK+     E  IY+ ++ KID      +Y    +                           + SD+++D+IA+L  TF  FT+LP ++AQTAC+ +CK++   L   +  EA   ++S   L Q + D+K  + F R  PV G   DTL+L F DLRQL  L    DW T++ +Y      Y RV   +A++LLEK + +    + +    +KN++DK+   + ++KQL+ L
Sbjct:   13 ILREIESTDTNCIGPTLR--------SVYDGQEHGL--FMEKLEGRIRNHDREIEKMCNHHFQGFVDSITELLKVRGEAQKLKGQVTETNQKLQNDGKELLTSMNELRQCRVQQRNIATTIDKLTHCLPVLEMYSKLQEQMRAKRYYPALRTLEQLEESCLPQAGSYRFCTIMAENIPRLRTHIRDVSMSDLKDFLESIRKHSDKIGETAMKQAQVQIARD-NAVTSQQRSASGRRIRKEGYGSTEVDRTGNNPF----SEQDSGILDVDD---------------EQEEEVPGAHDLVDFSPVYRCLHIYTVLGARDTFENYYRKQRRKQARLVLQPHSNMHETLEGYRRYFNQIVGFFVVEDHILHTTQGLVNRAYVEELWELALSKTIAALRTHSSYCTDPDLVLDLKNLIVLFADTLQGYGFPVNQLFDMLLEMRDQYGEILLKKWNHSFRQILDQDNYSPIPVVSPEEYQRITGQFP-FQDPELDKMPFPKKLPFSEFVPKVYSQLKEFIYACLKYSEDLHLSSTEIDDMIRKSTNLLLTRTLSHCLQYAIKKKNVGLAELVQIIINTTHLEQSCHYLEEFISNITNV--------------------------PPDTINATKLYGTSTFKDARHAAEEEIYTNLNQKIDQFLQLADYDWTAAQGGG-----------------------QASDYLSDLIAFLCSTFAVFTHLPGKVAQTACMSACKHLSTSLLQ-LLLEADVRQVSMGALQQFNVDVKECERFARAGPVPGFQGDTLLLAFIDLRQLLDLFTQWDWSTYLADYGRPTCKYLRVNPHTALALLEKMKDTSRK-NNMFAQFRKNERDKQKLIDTVVKQLRNL 796          
BLAST of Exocyst complex component vs. Ensembl Zebrafish
Match: exoc6 (exocyst complex component 6 [Source:ZFIN;Acc:ZDB-GENE-040426-2511])

HSP 1 Score: 415.616 bits (1067), Expect = 8.459e-131
Identity = 269/862 (31.21%), Postives = 444/862 (51.51%), Query Frame = 2
Query:  311 LISEIKSNSSGSIANIIRKLRQLETSSVNNDSSEILTKFMRHLDNEIELNNQDIEKFCNHFYQCFVDSIKELLKIQEEASELKSSFGSVQSSLMESVKKIKQDCNELSKCHLILANIDKAVENLQACLPVFDQYLKAAKSINEKRYYPALKTLNHLELNQMQRVRQFSFSDNLQNKIPGMREQIKAASKDEIKDFLENVRKHSVGLGMCAMK-LMAHKTGMEVNFDSPTKR--TMNGARMNKGDDSKRENPFVGMLDEPDSVNKEIQDLISLESYGNDNDDSSELELESTNVEDRVDFGPVYRCLHIHSVLGDRHEFEKCYRNQRKRQCTLLLTLSK--QESVRNYHEFLSGVVGFFVVEDYIRHSQISMVTRNYLDELWSQTMLRVGDFVSVNSDNINDIESLLKLKDSCVLFGKTMRSLGFNVAGFKDFYEVLKKQHQKLLGNEYSNKFKDIFEGEDYTAITVQDASEMELVIDLYPYFLSPDIDILPYPKSLSFSWMVPRINQAIRDHIKKCRKFSDNLELSQTELEDQLNHTTNVLFSQTLKHFLVKAVKDSERELNRLIQLAVNMDELESACIGLQNFISSLVG----TVYTNSYQXXXXXXXXXXXXXXXXXINPPRSRLHAFALFKELHSKIENCIYSAIDAKIDDMFDDNEYRQVNSHHSSTNNSLANSPSKKFNSISIDNNQMKPSDFITDVIAYLSITFESFTNLPARLAQTACLLSCKYIDKKL-KTFVNSEAR-ISERFLHQLSTDIKSLQDFTRKIPVAGVSADTLILVFEDLRQLTALVILSDWDTFIKNYRTNQNPYDRVLTSSAISLLEKTRHSDTGFSALIKSLKKNKQDKRD--EEILKQLKEL 2857
            ++ EI+S  +  +   +R        SV +D      +FM  LD  I  ++++IEK CN  +Q FVD+I ELLK++ +A +L          L ++ +++     E+ +C +   N+   VE LQ C+PV + Y K  + +  KRYY ALKT+  LE   + RV Q+ F   +   +P +RE+IK  S  ++KDFLE++RKHS  +G  AM+    H+T     F+S  ++  T++ A+   G + +      G+                      D  +  E++ E    +D VDF PVYRCLHI++VLGDR  FE  YR QRK+Q  L+L       E+V  Y ++ + +VGFFVVED+I H+   +VTR + DELW+  + ++   +  +S   ND + +L+LK+  V+F  T++  GF V    D    ++ Q+ + L  +++  F+DIFE ++Y+ I V    E + V+  +P F   +I+   +PK L  S  VP+I   +++ I    KFS++L  S TE++D L  +TN+L ++TL   L   +K     L  L+Q+ +N   LE AC  L++FI+++      TV+T                          +RL+  + FK+     E  IY+ ++ KID+     +Y             +A S               + S ++ D+I +L  TF+ FT+LP ++AQTAC+ +CK++   L +  +++E + IS   + Q + D+   + F    PV G   DTL L F DLRQL  L ++ DW T++ +Y    + Y RV  S+A++LLEK + +    + +    +KN +D++   E ++KQL+ L
Sbjct:   16 ILQEIESTDTACLGPTLR--------SVYDDQPNAHKRFMEKLDARIRNHDREIEKMCNFHHQGFVDAITELLKVRADAEKLMGQVSDTNRRLQDAGREVTAQTEEVIRCRVQQRNMATTVEKLQLCIPVLEMYSKLKEQLESKRYYSALKTMEQLENIYIPRVSQYRFCQIMAETLPKLREEIKEISMSDLKDFLESIRKHSDKIGETAMRQAQQHRT-----FNSAVQKQVTLSCAKPLYGLNGRTPLHHNGL--------------------STDTAEEEEIDEEVLTAQDLVDFSPVYRCLHIYTVLGDRETFENYYRKQRKKQARLVLQPQSNMHETVEGYRKYFNQIVGFFVVEDHILHATQGLVTRAFTDELWNMALSKIIAVLRTHSSYCNDPDLVLELKNLIVIFADTLQGYGFPVNRLFDLLFEVRDQYNETLLKKWALVFRDIFEQDNYSPIPVDTEEEYKAVVSRFP-FHDAEIEKQQFPKKLPMSQSVPQIYSQVKEFIYASLKFSESLHRSSTEIDDMLRKSTNLLLTRTLSSCLQNLIKKPHIGLTELVQIIINTTHLEHACKYLEDFITNITNVSPETVHT--------------------------TRLYGLSTFKDARHAAEGEIYTKLNQKIDEFIQLADYEW----------GMAESDG-------------RASGYLMDLINFLRSTFQVFTHLPGKVAQTACMSACKHLATSLMQMLLDTELKQISMGAIQQFNLDVIQCELFASSEPVPGFQGDTLQLAFIDLRQLLDLFMVWDWSTYLADYGQPTSKYLRVNPSTALALLEKMKDTSKK-NNIFSQFRKNDRDRQKLIETVVKQLRSL 793          
BLAST of Exocyst complex component vs. Ensembl Zebrafish
Match: exoc6b (exocyst complex component 6B [Source:ZFIN;Acc:ZDB-GENE-060929-132])

HSP 1 Score: 376.711 bits (966), Expect = 1.187e-116
Identity = 264/866 (30.48%), Postives = 409/866 (47.23%), Query Frame = 2
Query:  311 LISEIKSNSSGSIANIIRKLRQLETSSVNNDSSEILTKFMRHLDNEIELNNQDIEKFCNHFYQCFVDSIKELLKIQEEASELKSSFGSVQSSLMESVKKIKQDCNELSKCHLILANIDKAVENLQACLPVFDQYLKAAKSINEKRYYPALKTLNHLELNQMQRVRQFSFSDNLQNKIPGMREQIKAASKDEIKDFLENVRKHSVGLGMCAMKLMAHKTGMEVNFDSPTKRTMNGARMNKGD------DSKRENPFVGMLDEPDSVNKEIQDLISLESYGNDNDDSSELELESTNVEDRVDFGPVYRCLHIHSVLGDRHEFEKCYRNQRKRQCTLLLTLSK--QESVRNYHEFLSGVVGFFVVEDYIRHSQISMVTRNYLDELWSQTMLRVGDFVSVNSDNINDIESLLKLKDSCVLFGKTMRSLGFNVAGFKDFYEVLKKQHQKLLGNEYSNKFKDIFEGEDYTAITVQDASEMELVIDLYPYFLSPDIDILPYPKSLSFSWMVPRINQAIRDHIKKCRKFSDNLELSQTELEDQLNHTTNVLFSQTLKHFLVKAVKDSERELNRLIQLAVNMDELESACIGLQNFISSLVGTVYTNSYQXXXXXXXXXXXXXXXXXINPP----RSRLHAFALFKELHSKIENCIYSAIDAKIDDMFDDNEYRQVNSHHSSTNNSLANSPSKKFNSISIDNNQMKPSDFITDVIAYLSITFESFTNLPARLAQTACLLSCKYIDKKLKTFVNSEA---RISERFLHQLSTDIKSLQDFTRKIPVAGVSADTLILVFEDLRQLTALVILSDWDTFIKNYRTNQNPYDRVLTSSAISLLEKTRHSDTGFSALIKSLKKNKQDKRD--EEILKQLKEL 2857
            ++ EI+S  +  I   +R        SV +     L  FM  L+  I  ++++IEK CNH +Q FVDSI ELLK++ EA +LK         L    K++    NEL +C +   NI   ++ L  CLPV + Y K  + +  KRYYPAL+TL  LE + + +   + F   +   IP +R  I+  S  ++KDFLE++RKHS  +G  AMK    +   + N  +  +R+ +G R+ K        D    NPF     E DS   ++ D               E E E     D VDF PVYRCLHI++VLG R  FE  YR QR++Q  L+L       E++  Y  + + +VGFFVVED+I H+   +V R Y++ELW                               +   KT+ +L  +      F+             ++S     I   E+Y  IT Q           +P F  P++D +P+PK L FS  VP++   +++ I  C K+S++L LS TE++D +  +TN+L ++TL H L  A+K     L  L+Q+ +N   LE +C  L+ FIS++                             PP     ++L+  + FK+     E  IY+ ++ KID      +Y    +                           + SD+++D+IA+L  TF  FT+LP ++AQTAC+ +CK++   L   +  EA   ++S   L Q + D+K  + F R  PV G   DTL+L F DLRQL  L    DW T++ +Y      Y RV   +A++LLEK + +    + +    +KN++DK+   + ++KQL+ L
Sbjct:   13 ILREIESTDTNCIGPTLR--------SVYDGQEHGL--FMEKLEGRIRNHDREIEKMCNHHFQGFVDSITELLKVRGEAQKLKGQVTETNQKLQNDGKELLTSMNELRQCRVQQRNIATTIDKLTHCLPVLEMYSKLQEQMRAKRYYPALRTLEQLEESCLPQAGSYRFCTIMAENIPRLRTHIRDVSMSDLKDFLESIRKHSDKIGETAMKQAQVQIARD-NAVTSQQRSASGRRIRKEGYGSTEVDRTGNNPF----SEQDSGILDVDD---------------EQEEEVPGAHDLVDFSPVYRCLHIYTVLGARDTFENYYRKQRRKQARLVLQPHSNMHETLEGYRRYFNQIVGFFVVEDHILHTTQGLVNRAYVEELWE------------------------------LALSKTIAALRTHSVCLSFFFIF-----------DHSCNSCSIVSPEEYQRITGQ-----------FP-FQDPELDKMPFPKKLPFSEFVPKVYSQLKEFIYACLKYSEDLHLSSTEIDDMIRKSTNLLLTRTLSHCLQYAIKKKNVGLAELVQIIINTTHLEQSCHYLEEFISNITNV--------------------------PPDTINATKLYGTSTFKDARHAAEEEIYTNLNQKIDQFLQLADYDWTAAQGGG-----------------------QASDYLSDLIAFLCSTFAVFTHLPGKVAQTACMSACKHLSTSLLQ-LLLEADVRQVSMGALQQFNVDVKECERFARAGPVPGFQGDTLLLAFIDLRQLLDLFTQWDWSTYLADYGRPTCKYLRVNPHTALALLEKMKDTSRK-NNMFAQFRKNERDKQKLIDTVVKQLRNL 744          
BLAST of Exocyst complex component vs. Ensembl Zebrafish
Match: exoc6b (exocyst complex component 6B [Source:ZFIN;Acc:ZDB-GENE-060929-132])

HSP 1 Score: 134.42 bits (337), Expect = 8.836e-35
Identity = 77/221 (34.84%), Postives = 116/221 (52.49%), Query Frame = 2
Query:  284 SDFNKNFSNLISEIKSNSSGSIANIIRKLRQLETSSVNNDSSEILTKFMRHLDNEIELNNQDIEKFCNHFYQCFVDSIKELLKIQEEASELKSSFGSVQSSLMESVKKIKQDCNELSKCHLILANIDKAVENLQACLPVFDQYLKAAKSINEKRYYPALKTLNHLELNQMQRVRQFSFSDNLQNKIPGMREQIKAASKDEIKDFLENVRKHSVGLGMCAMK 946
            ++       ++ EI+S  +  I   +R        SV +     L  FM  L+  I  ++++IEK CNH +Q FVDSI ELLK++ EA +LK         L    K++    NEL +C +   NI   ++ L  CLPV + Y K  + +  KRYYPAL+TL  LE + + +   + F   +   IP +R  I+  S  ++KDFLE++RKHS  +G  AMK
Sbjct:    4 AEIAAEHERILREIESTDTNCIGPTLR--------SVYDGQEHGL--FMEKLEGRIRNHDREIEKMCNHHFQGFVDSITELLKVRGEAQKLKGQVTETNQKLQNDGKELLTSMNELRQCRVQQRNIATTIDKLTHCLPVLEMYSKLQEQMRAKRYYPALRTLEQLEESCLPQAGSYRFCTIMAENIPRLRTHIRDVSMSDLKDFLESIRKHSDKIGETAMK 214          
BLAST of Exocyst complex component vs. Ensembl Xenopus
Match: adam9 (ADAM metallopeptidase domain 9 [Source:Xenbase;Acc:XB-GENE-976453])

HSP 1 Score: 401.364 bits (1030), Expect = 2.860e-125
Identity = 270/861 (31.36%), Postives = 433/861 (50.29%), Query Frame = 2
Query:  311 LISEIKSNSSGSIANIIRKLRQLETSSVNNDSSEILTKFMRHLDNEIELNNQDIEKFCNHFYQCFVDSIKELLKIQEEASELKSSFGSVQSSLMESVKKIKQDCNELSKCHLILANIDKAVENLQACLPVFDQYLKAAKSINEKRYYPALKTLNHLELNQMQRVRQFSFSDNLQNKIPGMREQIKAASKDEIKDFLENVRKHSVGLGMCAMKLMAHKTGMEVNFDSPTKRTMNG--ARMNKGDDSKRENPFVGMLDEPDSVNKEIQDLISLESYGNDNDDSSELELESTNVEDRVDFGPVYRCLHIHSVLGDRHEFEKCYRNQRKRQCTLLLTLSK--QESVRNYHEFLSGVVGFFVVEDYIRHSQISMVTRNYLDELWSQTMLRVGDFVSVNSDNINDIESLLKLKDSCVLFGKTMRSLGFNVAGFKDFYEVLKKQHQKLLGNEYSNKFKDIFEGEDYTAITVQDASEMELVIDLYPYFLSPDIDILPYPKSLSFSWMVPRINQAIRDHIKKCRKFSDNLELSQTELEDQLNHTTNVLFSQTLKHFLVKAVKDSERELNRLIQLAVNMDELESACIGLQNFISSLVG----TVYTNSYQXXXXXXXXXXXXXXXXXINPPRSRLHAFALFKELHSKIENCIYSAIDAKIDDMFDDNEYRQVNSHHSSTNNSLANSPSKKFNSISIDNNQMKPSDFITDVIAYLSITFESFTNLPARLAQTACLLSCKYIDKKLKTFVNSE--ARISERFLHQLSTDIKSLQDFTRKIPVAGVSADTLILVFEDLRQLTALVILSDWDTFIKNYRTNQNPYDRVLTSSAISLLEKTRHSDTGFSALIKSLKKNKQDKRD--EEILKQLKEL 2857
            ++ EI+S  +  I   +R +   E              FM  L+  I+ ++++IEK CN  YQ FVDSI ELLK++ EA +LK+        L     ++     +L +C +   NI   V+ L  CLPV + Y K    +  KR+YPALKTL  LE   + +V  + F   + + IP +RE+IK  S  ++KDFLE++RKHS  +G  AMK             +  +RT++   +   KG  +KR          P+ VN      +S +  G  + +  E E E+   +D VDF PVYRCLHI++VLG R  FE  YR QR++Q  L+L       E++  Y ++   +VGFFVVED+I H+ + +V R Y+DELW   + +    +  +S   +D   +L LK+  V F  T++  GF V    D    ++ Q+ ++L  +++  F++I + ++Y+ I V D       I  +P F   +++   +PK   FS  VP++   I++ I  C KFS++L LS TE++D +  +TN+L ++TL + L   +K     L  L+Q+ +N   LE +C  L+ FI+++ G    TV+T                          ++L+    FK+     E  IY+ ++ KID      +Y  + +  S+                       + SD++ D++A+L+ TF  FT+LP ++AQTAC+ +CK++   L   +      +I+   L Q + D+K  + F R  PV G   DTL L F DLRQL  L I  DW T++ +Y      Y RV  ++A+ LLEK + S    + +    +KN++DK+   E + KQL+ L
Sbjct:   13 ILREIESTETACIGPTLRSVYDGEEHG----------HFMEKLELRIKNHDREIEKMCNFHYQGFVDSITELLKVRGEAEKLKNQVTDTNRRLQLEGAELLSSMKDLQQCRVQQRNIAATVDKLNMCLPVLEMYSKLQVQMKSKRHYPALKTLEQLEHTYLPQVSHYRFCQVMVDNIPKLREEIKDVSMSDLKDFLESIRKHSERIGETAMK------------QAQQQRTLDNILSVQGKGGLAKRHRK----CPSPE-VNG--TSPMSEQDSGILDVEDEEEEEEAPGTQDLVDFSPVYRCLHIYTVLGSRETFENYYRKQRRKQARLVLQPPSNMHETLDGYRKYFHQIVGFFVVEDHILHTTLGLVNRAYIDELWELALSKTMAALRTHSSYCSDPNLVLDLKNLIVHFADTLQGYGFPVNQLFDMLLEIRDQYSEILLKKWALLFRNILDADNYSPIPVSDEETYRKFIGQFP-FQDSELEKQQFPKKFPFSEFVPKVYCQIKEFIYACLKFSEDLHLSSTEVDDMIRKSTNLLLTRTLSNCLQNVIKRRNVGLTELVQIIINTTHLEVSCKYLEEFITNITGVLPETVHT--------------------------AKLYGLTTFKDARQAAEEEIYTNLNQKIDQFLQLADYDWLAADSST-----------------------QASDYLLDLVAFLNSTFAVFTHLPGKVAQTACMSACKHLSTSLTQLLLEAEVKQITMGALQQFNQDVKECERFARSGPVPGFQGDTLQLAFIDLRQLLDLFIKWDWSTYLADYGQPTCKYLRVNPTTALILLEKMKDSSRK-NNVFAQFRKNERDKQKLIETVAKQLRSL 793          
BLAST of Exocyst complex component vs. Ensembl Xenopus
Match: adam9 (ADAM metallopeptidase domain 9 [Source:Xenbase;Acc:XB-GENE-976453])

HSP 1 Score: 400.979 bits (1029), Expect = 4.319e-125
Identity = 270/861 (31.36%), Postives = 433/861 (50.29%), Query Frame = 2
Query:  311 LISEIKSNSSGSIANIIRKLRQLETSSVNNDSSEILTKFMRHLDNEIELNNQDIEKFCNHFYQCFVDSIKELLKIQEEASELKSSFGSVQSSLMESVKKIKQDCNELSKCHLILANIDKAVENLQACLPVFDQYLKAAKSINEKRYYPALKTLNHLELNQMQRVRQFSFSDNLQNKIPGMREQIKAASKDEIKDFLENVRKHSVGLGMCAMKLMAHKTGMEVNFDSPTKRTMNG--ARMNKGDDSKRENPFVGMLDEPDSVNKEIQDLISLESYGNDNDDSSELELESTNVEDRVDFGPVYRCLHIHSVLGDRHEFEKCYRNQRKRQCTLLLTLSK--QESVRNYHEFLSGVVGFFVVEDYIRHSQISMVTRNYLDELWSQTMLRVGDFVSVNSDNINDIESLLKLKDSCVLFGKTMRSLGFNVAGFKDFYEVLKKQHQKLLGNEYSNKFKDIFEGEDYTAITVQDASEMELVIDLYPYFLSPDIDILPYPKSLSFSWMVPRINQAIRDHIKKCRKFSDNLELSQTELEDQLNHTTNVLFSQTLKHFLVKAVKDSERELNRLIQLAVNMDELESACIGLQNFISSLVG----TVYTNSYQXXXXXXXXXXXXXXXXXINPPRSRLHAFALFKELHSKIENCIYSAIDAKIDDMFDDNEYRQVNSHHSSTNNSLANSPSKKFNSISIDNNQMKPSDFITDVIAYLSITFESFTNLPARLAQTACLLSCKYIDKKLKTFVNSE--ARISERFLHQLSTDIKSLQDFTRKIPVAGVSADTLILVFEDLRQLTALVILSDWDTFIKNYRTNQNPYDRVLTSSAISLLEKTRHSDTGFSALIKSLKKNKQDKRD--EEILKQLKEL 2857
            ++ EI+S  +  I   +R +   E              FM  L+  I+ ++++IEK CN  YQ FVDSI ELLK++ EA +LK+        L     ++     +L +C +   NI   V+ L  CLPV + Y K    +  KR+YPALKTL  LE   + +V  + F   + + IP +RE+IK  S  ++KDFLE++RKHS  +G  AMK             +  +RT++   +   KG  +KR          P+ VN      +S +  G  + +  E E E+   +D VDF PVYRCLHI++VLG R  FE  YR QR++Q  L+L       E++  Y ++   +VGFFVVED+I H+ + +V R Y+DELW   + +    +  +S   +D   +L LK+  V F  T++  GF V    D    ++ Q+ ++L  +++  F++I + ++Y+ I V D       I  +P F   +++   +PK   FS  VP++   I++ I  C KFS++L LS TE++D +  +TN+L ++TL + L   +K     L  L+Q+ +N   LE +C  L+ FI+++ G    TV+T                          ++L+    FK+     E  IY+ ++ KID      +Y  + +  S+                       + SD++ D++A+L+ TF  FT+LP ++AQTAC+ +CK++   L   +      +I+   L Q + D+K  + F R  PV G   DTL L F DLRQL  L I  DW T++ +Y      Y RV  ++A+ LLEK + S    + +    +KN++DK+   E + KQL+ L
Sbjct:   18 ILREIESTETACIGPTLRSVYDGEEHG----------HFMEKLELRIKNHDREIEKMCNFHYQGFVDSITELLKVRGEAEKLKNQVTDTNRRLQLEGAELLSSMKDLQQCRVQQRNIAATVDKLNMCLPVLEMYSKLQVQMKSKRHYPALKTLEQLEHTYLPQVSHYRFCQVMVDNIPKLREEIKDVSMSDLKDFLESIRKHSERIGETAMK------------QAQQQRTLDNILSVQGKGGLAKRHRK----CPSPE-VNG--TSPMSEQDSGILDVEDEEEEEEAPGTQDLVDFSPVYRCLHIYTVLGSRETFENYYRKQRRKQARLVLQPPSNMHETLDGYRKYFHQIVGFFVVEDHILHTTLGLVNRAYIDELWELALSKTMAALRTHSSYCSDPNLVLDLKNLIVHFADTLQGYGFPVNQLFDMLLEIRDQYSEILLKKWALLFRNILDADNYSPIPVSDEETYRKFIGQFP-FQDSELEKQQFPKKFPFSEFVPKVYCQIKEFIYACLKFSEDLHLSSTEVDDMIRKSTNLLLTRTLSNCLQNVIKRRNVGLTELVQIIINTTHLEVSCKYLEEFITNITGVLPETVHT--------------------------AKLYGLTTFKDARQAAEEEIYTNLNQKIDQFLQLADYDWLAADSST-----------------------QASDYLLDLVAFLNSTFAVFTHLPGKVAQTACMSACKHLSTSLTQLLLEAEVKQITMGALQQFNQDVKECERFARSGPVPGFQGDTLQLAFIDLRQLLDLFIKWDWSTYLADYGQPTCKYLRVNPTTALILLEKMKDSSRK-NNVFAQFRKNERDKQKLIETVAKQLRSL 798          
BLAST of Exocyst complex component vs. Ensembl Xenopus
Match: adam9 (ADAM metallopeptidase domain 9 [Source:Xenbase;Acc:XB-GENE-976453])

HSP 1 Score: 400.979 bits (1029), Expect = 4.765e-125
Identity = 270/861 (31.36%), Postives = 433/861 (50.29%), Query Frame = 2
Query:  311 LISEIKSNSSGSIANIIRKLRQLETSSVNNDSSEILTKFMRHLDNEIELNNQDIEKFCNHFYQCFVDSIKELLKIQEEASELKSSFGSVQSSLMESVKKIKQDCNELSKCHLILANIDKAVENLQACLPVFDQYLKAAKSINEKRYYPALKTLNHLELNQMQRVRQFSFSDNLQNKIPGMREQIKAASKDEIKDFLENVRKHSVGLGMCAMKLMAHKTGMEVNFDSPTKRTMNG--ARMNKGDDSKRENPFVGMLDEPDSVNKEIQDLISLESYGNDNDDSSELELESTNVEDRVDFGPVYRCLHIHSVLGDRHEFEKCYRNQRKRQCTLLLTLSK--QESVRNYHEFLSGVVGFFVVEDYIRHSQISMVTRNYLDELWSQTMLRVGDFVSVNSDNINDIESLLKLKDSCVLFGKTMRSLGFNVAGFKDFYEVLKKQHQKLLGNEYSNKFKDIFEGEDYTAITVQDASEMELVIDLYPYFLSPDIDILPYPKSLSFSWMVPRINQAIRDHIKKCRKFSDNLELSQTELEDQLNHTTNVLFSQTLKHFLVKAVKDSERELNRLIQLAVNMDELESACIGLQNFISSLVG----TVYTNSYQXXXXXXXXXXXXXXXXXINPPRSRLHAFALFKELHSKIENCIYSAIDAKIDDMFDDNEYRQVNSHHSSTNNSLANSPSKKFNSISIDNNQMKPSDFITDVIAYLSITFESFTNLPARLAQTACLLSCKYIDKKLKTFVNSE--ARISERFLHQLSTDIKSLQDFTRKIPVAGVSADTLILVFEDLRQLTALVILSDWDTFIKNYRTNQNPYDRVLTSSAISLLEKTRHSDTGFSALIKSLKKNKQDKRD--EEILKQLKEL 2857
            ++ EI+S  +  I   +R +   E              FM  L+  I+ ++++IEK CN  YQ FVDSI ELLK++ EA +LK+        L     ++     +L +C +   NI   V+ L  CLPV + Y K    +  KR+YPALKTL  LE   + +V  + F   + + IP +RE+IK  S  ++KDFLE++RKHS  +G  AMK             +  +RT++   +   KG  +KR          P+ VN      +S +  G  + +  E E E+   +D VDF PVYRCLHI++VLG R  FE  YR QR++Q  L+L       E++  Y ++   +VGFFVVED+I H+ + +V R Y+DELW   + +    +  +S   +D   +L LK+  V F  T++  GF V    D    ++ Q+ ++L  +++  F++I + ++Y+ I V D       I  +P F   +++   +PK   FS  VP++   I++ I  C KFS++L LS TE++D +  +TN+L ++TL + L   +K     L  L+Q+ +N   LE +C  L+ FI+++ G    TV+T                          ++L+    FK+     E  IY+ ++ KID      +Y  + +  S+                       + SD++ D++A+L+ TF  FT+LP ++AQTAC+ +CK++   L   +      +I+   L Q + D+K  + F R  PV G   DTL L F DLRQL  L I  DW T++ +Y      Y RV  ++A+ LLEK + S    + +    +KN++DK+   E + KQL+ L
Sbjct:   21 ILREIESTETACIGPTLRSVYDGEEHG----------HFMEKLELRIKNHDREIEKMCNFHYQGFVDSITELLKVRGEAEKLKNQVTDTNRRLQLEGAELLSSMKDLQQCRVQQRNIAATVDKLNMCLPVLEMYSKLQVQMKSKRHYPALKTLEQLEHTYLPQVSHYRFCQVMVDNIPKLREEIKDVSMSDLKDFLESIRKHSERIGETAMK------------QAQQQRTLDNILSVQGKGGLAKRHRK----CPSPE-VNG--TSPMSEQDSGILDVEDEEEEEEAPGTQDLVDFSPVYRCLHIYTVLGSRETFENYYRKQRRKQARLVLQPPSNMHETLDGYRKYFHQIVGFFVVEDHILHTTLGLVNRAYIDELWELALSKTMAALRTHSSYCSDPNLVLDLKNLIVHFADTLQGYGFPVNQLFDMLLEIRDQYSEILLKKWALLFRNILDADNYSPIPVSDEETYRKFIGQFP-FQDSELEKQQFPKKFPFSEFVPKVYCQIKEFIYACLKFSEDLHLSSTEVDDMIRKSTNLLLTRTLSNCLQNVIKRRNVGLTELVQIIINTTHLEVSCKYLEEFITNITGVLPETVHT--------------------------AKLYGLTTFKDARQAAEEEIYTNLNQKIDQFLQLADYDWLAADSST-----------------------QASDYLLDLVAFLNSTFAVFTHLPGKVAQTACMSACKHLSTSLTQLLLEAEVKQITMGALQQFNQDVKECERFARSGPVPGFQGDTLQLAFIDLRQLLDLFIKWDWSTYLADYGQPTCKYLRVNPTTALILLEKMKDSSRK-NNVFAQFRKNERDKQKLIETVAKQLRSL 801          
BLAST of Exocyst complex component vs. Ensembl Xenopus
Match: adam9 (ADAM metallopeptidase domain 9 [Source:Xenbase;Acc:XB-GENE-976453])

HSP 1 Score: 397.897 bits (1021), Expect = 4.228e-124
Identity = 272/861 (31.59%), Postives = 434/861 (50.41%), Query Frame = 2
Query:  311 LISEIKSNSSGSIANIIRKLRQLETSSVNNDSSEILTKFMRHLDNEIELNNQDIEKFCNHFYQCFVDSIKELLKIQEEASELKSSFGSVQSSLMESVKKIKQDCNELSKCHLILANIDKAVENLQACLPVFDQYLKAAKSINEKRYYPALKTLNHLELNQMQRVRQFSFSDNLQNKIPGMREQIKAASKDEIKDFLENVRKHSVGLGMCAMKLMAHKTGMEVNFDSPTKRTMNG--ARMNKGDDSKRENPFVGMLDEPDSVNKEIQDLISLESYGNDNDDSSELELESTNVEDRVDFGPVYRCLHIHSVLGDRHEFEKCYRNQRKRQCTLLLTLSK--QESVRNYHEFLSGVVGFFVVEDYIRHSQISMVTRNYLDELWSQTMLRVGDFVSVNSDNINDIESLLKLKDSCVLFGKTMRSLGFNVAGFKDFYEVLKKQHQKLLGNEYSNKFKDIFEGEDYTAITVQDASEMELVIDLYPYFLSPDIDILPYPKSLSFSWMVPRINQAIRDHIKKCRKFSDNLELSQTELEDQLNHTTNVLFSQTLKHFLVKAVKDSERELNRLIQLAVNMDELESACIGLQNFISSLVG----TVYTNSYQXXXXXXXXXXXXXXXXXINPPRSRLHAFALFKELHSKIENCIYSAIDAKIDDMFDDNEYRQVNSHHSSTNNSLANSPSKKFNSISIDNNQMKPSDFITDVIAYLSITFESFTNLPARLAQTACLLSCKYIDKKLKTFVNSE--ARISERFLHQLSTDIKSLQDFTRKIPVAGVSADTLILVFEDLRQLTALVILSDWDTFIKNYRTNQNPYDRVLTSSAISLLEKTRHSDTGFSALIKSLKKNKQDKRD--EEILKQLKEL 2857
            ++ EI+S  +  I   +R +   E              FM  L+  I+ ++++IEK CN  YQ FVDSI ELLK++ EA +LK         L+ S+K ++Q       C +   NI   V+ L  CLPV + Y K    +  KR+YPALKTL  LE   + +V  + F   + + IP +RE+IK  S  ++KDFLE++RKHS  +G  AMK             +  +RT++   +   KG  +KR          P+ VN      +S +  G  + +  E E E+   +D VDF PVYRCLHI++VLG R  FE  YR QR++Q  L+L       E++  Y ++   +VGFFVVED+I H+ + +V R Y+DELW   + +    +  +S   +D   +L LK+  V F  T++  GF V    D    ++ Q+ ++L  +++  F++I + ++Y+ I V D       I  +P F   +++   +PK   FS  VP++   I++ I  C KFS++L LS TE++D +  +TN+L ++TL + L   +K     L  L+Q+ +N   LE +C  L+ FI+++ G    TV+T                          ++L+    FK+     E  IY+ ++ KID      +Y  + +  S+                       + SD++ D++A+L+ TF  FT+LP ++AQTAC+ +CK++   L   +      +I+   L Q + D+K  + F R  PV G   DTL L F DLRQL  L I  DW T++ +Y      Y RV  ++A+ LLEK + S    + +    +KN++DK+   E + KQL+ L
Sbjct:   13 ILREIESTETACIGPTLRSVYDGEEHG----------HFMEKLELRIKNHDREIEKMCNFHYQGFVDSITELLKVRGEAEKLK---------LLSSMKDLQQ-------CRVQQRNIAATVDKLNMCLPVLEMYSKLQVQMKSKRHYPALKTLEQLEHTYLPQVSHYRFCQVMVDNIPKLREEIKDVSMSDLKDFLESIRKHSERIGETAMK------------QAQQQRTLDNILSVQGKGGLAKRHRK----CPSPE-VNG--TSPMSEQDSGILDVEDEEEEEEAPGTQDLVDFSPVYRCLHIYTVLGSRETFENYYRKQRRKQARLVLQPPSNMHETLDGYRKYFHQIVGFFVVEDHILHTTLGLVNRAYIDELWELALSKTMAALRTHSSYCSDPNLVLDLKNLIVHFADTLQGYGFPVNQLFDMLLEIRDQYSEILLKKWALLFRNILDADNYSPIPVSDEETYRKFIGQFP-FQDSELEKQQFPKKFPFSEFVPKVYCQIKEFIYACLKFSEDLHLSSTEVDDMIRKSTNLLLTRTLSNCLQNVIKRRNVGLTELVQIIINTTHLEVSCKYLEEFITNITGVLPETVHT--------------------------AKLYGLTTFKDARQAAEEEIYTNLNQKIDQFLQLADYDWLAADSST-----------------------QASDYLLDLVAFLNSTFAVFTHLPGKVAQTACMSACKHLSTSLTQLLLEAEVKQITMGALQQFNQDVKECERFARSGPVPGFQGDTLQLAFIDLRQLLDLFIKWDWSTYLADYGQPTCKYLRVNPTTALILLEKMKDSSRK-NNVFAQFRKNERDKQKLIETVAKQLRSL 777          
BLAST of Exocyst complex component vs. Ensembl Xenopus
Match: adam9 (ADAM metallopeptidase domain 9 [Source:Xenbase;Acc:XB-GENE-976453])

HSP 1 Score: 397.897 bits (1021), Expect = 7.882e-124
Identity = 270/864 (31.25%), Postives = 431/864 (49.88%), Query Frame = 2
Query:  311 LISEIKSNSSGSIANIIRKLRQLETSSVNNDSSEILTKFMRHLDNEIELNNQDIEKFCNHFYQCFVDSIKELLKIQEEASELKSSFGSVQSSLMESVKKIKQDCNELSKCHLILANIDKAVENLQACLPVFDQYLKAAKSINEKRYYPALKTLNHLELNQMQRVRQFSFSDNLQNKIPGMREQIKAASKDEIKDFLENVRKHSVGLGMCAMKLMAHKTGMEVNFDSPTKRTMNG--ARMNKGDDSKRENPFVGMLDEPDSVNKEIQDLISLESYGNDNDDSSELELESTNVEDRVDFGPVYRCLHIHSVLGDRHEFEKCYRNQRKRQCTLLLTLSK--QESVRNYHEFLSGVVGFFVVEDYIRHSQISMVTRNYLDELWSQTMLRVGDFVSVNSDNINDIESLLKLKDSCVLFGKTMRSLGFNVAGFKDFYEVLKKQHQKLLGNEYSNKFKDIFEGEDYTAITVQDASEMELVIDLYPYFLSPDIDILPYPKSLSFSWMVPRINQAIRDHIKKCRKFSDNLELSQTELEDQLNHTTNVLFSQTLKHFLVKAVKDSERELNRLIQLAVNMDELESACIGLQNFISSLVG----TVYTNSYQXXXXXXXXXXXXXXXXXINPPRSRLHAFALFKELHSKIENCIYSAIDAKIDDMFDDNEYRQVNSHHSSTNNSLANSPSKKFNSISIDNNQMKPSDFITDVIAYLSITFESFTNLPARLAQTACLLSCKYIDKKLKTFVNSE--ARISERFLHQLSTDIKSLQDFTRKIPVAGVSADTLILVFEDLRQLTALVILSDWDTFIKNYRTNQNPYDRVLTSSAISLLEKTRHSDTGFSA---LIKSLKKNKQDKRD--EEILKQLKEL 2857
            ++ EI+S  +  I   +R +   E              FM  L+  I+ ++++IEK CN  YQ FVDSI ELLK++ EA +LK+        L     ++     +L +C +   NI   V+ L  CLPV + Y K    +  KR+YPALKTL  LE   + +V  + F   + + IP +RE+IK  S  ++KDFLE++RKHS  +G  AMK             +  +RT++   +   KG  +KR          P+ VN      +S +  G  + +  E E E+   +D VDF PVYRCLHI++VLG R  FE  YR QR++Q  L+L       E++  Y ++   +VGFFVVED+I H+ + +V R Y+DELW   + +    +  +S   +D   +L LK+  V F  T++  GF V    D    ++ Q+ ++L  +++  F++I + ++Y+ I V D       I  +P F   +++   +PK   FS  VP++   I++ I  C KFS++L LS TE++D +  +TN+L ++TL + L   +K     L  L+Q+ +N   LE +C  L+ FI+++ G    TV+T                          ++L+    FK+     E  IY+ ++ KID      +Y  + +  S+                       + SD++ D++A+L+ TF  FT+LP ++AQTAC+ +CK++   L   +      +I+   L Q + D+K  + F R  PV G   DTL L F DLRQL  L I  DW T++ +Y      Y RV  ++A+ LLEK        S    +    +KN++DK+   E + KQL+ L
Sbjct:   13 ILREIESTETACIGPTLRSVYDGEEHG----------HFMEKLELRIKNHDREIEKMCNFHYQGFVDSITELLKVRGEAEKLKNQVTDTNRRLQLEGAELLSSMKDLQQCRVQQRNIAATVDKLNMCLPVLEMYSKLQVQMKSKRHYPALKTLEQLEHTYLPQVSHYRFCQVMVDNIPKLREEIKDVSMSDLKDFLESIRKHSERIGETAMK------------QAQQQRTLDNILSVQGKGGLAKRHRK----CPSPE-VNG--TSPMSEQDSGILDVEDEEEEEEAPGTQDLVDFSPVYRCLHIYTVLGSRETFENYYRKQRRKQARLVLQPPSNMHETLDGYRKYFHQIVGFFVVEDHILHTTLGLVNRAYIDELWELALSKTMAALRTHSSYCSDPNLVLDLKNLIVHFADTLQGYGFPVNQLFDMLLEIRDQYSEILLKKWALLFRNILDADNYSPIPVSDEETYRKFIGQFP-FQDSELEKQQFPKKFPFSEFVPKVYCQIKEFIYACLKFSEDLHLSSTEVDDMIRKSTNLLLTRTLSNCLQNVIKRRNVGLTELVQIIINTTHLEVSCKYLEEFITNITGVLPETVHT--------------------------AKLYGLTTFKDARQAAEEEIYTNLNQKIDQFLQLADYDWLAADSST-----------------------QASDYLLDLVAFLNSTFAVFTHLPGKVAQTACMSACKHLSTSLTQLLLEAEVKQITMGALQQFNQDVKECERFARSGPVPGFQGDTLQLAFIDLRQLLDLFIKWDWSTYLADYGQPTCKYLRVNPTTALILLEKIHRVMKDSSRKNNVFAQFRKNERDKQKLIETVAKQLRSL 797          
BLAST of Exocyst complex component vs. Ensembl Mouse
Match: Exoc6b (exocyst complex component 6B [Source:MGI Symbol;Acc:MGI:1923164])

HSP 1 Score: 415.616 bits (1067), Expect = 1.195e-130
Identity = 273/859 (31.78%), Postives = 436/859 (50.76%), Query Frame = 2
Query:  311 LISEIKSNSSGSIANIIRKLRQLETSSVNNDSSEILTKFMRHLDNEIELNNQDIEKFCNHFYQCFVDSIKELLKIQEEASELKSSFGSVQSSLMESVKKIKQDCNELSKCHLILANIDKAVENLQACLPVFDQYLKAAKSINEKRYYPALKTLNHLELNQMQRVRQFSFSDNLQNKIPGMREQIKAASKDEIKDFLENVRKHSVGLGMCAMKLMAHKTGMEVNFDSPTKRTMNGARMNKGDDSKRENPFVGMLDEPDSVNKEIQDLISLESYGNDNDDSSELELESTNVEDRVDFGPVYRCLHIHSVLGDRHEFEKCYRNQRKRQCTLLLTLSK--QESVRNYHEFLSGVVGFFVVEDYIRHSQISMVTRNYLDELWSQTMLRVGDFVSVNSDNINDIESLLKLKDSCVLFGKTMRSLGFNVAGFKDFYEVLKKQHQKLLGNEYSNKFKDIFEGEDYTAITVQDASEMELVIDLYPYFLSPDIDILPYPKSLSFSWMVPRINQAIRDHIKKCRKFSDNLELSQTELEDQLNHTTNVLFSQTLKHFLVKAVKDSERELNRLIQLAVNMDELESACIGLQNFISSLVG----TVYTNSYQXXXXXXXXXXXXXXXXXINPPRSRLHAFALFKELHSKIENCIYSAIDAKIDDMFDDNEYRQVNSHHSSTNNSLANSPSKKFNSISIDNNQMKPSDFITDVIAYLSITFESFTNLPARLAQTACLLSCKYIDKKL-KTFVNSEAR-ISERFLHQLSTDIKSLQDFTRKIPVAGVSADTLILVFEDLRQLTALVILSDWDTFIKNYRTNQNPYDRVLTSSAISLLEKTRHSDTGFSALIKSLKKNKQDKRD--EEILKQLKEL 2857
            ++ EI+S  +  I   +R +   E             +FM  L+  I  ++++IEK CN  YQ FVDSI ELLK++ EA +LK+        L    K++     EL +C L   NI   V+ L  CLPV + Y K    +  KR+YPALKTL HLE   + +V  + F   + + IP +RE+IK  S  ++KDFLE++RKHS  +G  AMK    +   + N D+     +   R+     SK++   +   +   +  K  QD       G  + +  E + E    +D VDF PVYRCLHI+SVLG R  FE  YR QR++Q  L+L       E++  Y ++ + +VGFFVVED+I H+   +V R Y+DELW   + +    +  +S   +D   +L LK+  VLF  T++  GF V    D    ++ Q+ + L  +++  F++I + ++Y+ I V      + V+  +P F   +++  P+PK   FS  VP++   I++ I  C KFS++L LS TE++D +  +TN+L ++TL + L   +K     L  L+Q+ +N   LE +C  L+ FI+++      TV+T                          ++L+    FK+     E  IY+ ++ KID      +Y  +                       +DN   K SD++ D+IA+L  TF  FT+LP ++AQTAC+ +CK++   L +  + +E R ++   L Q + D++  + F R  PV G   DTL L F DLRQL  L I  DW T++ +Y      Y RV   +A++LLEK + +    + +    +KN++DK+   + + KQL+ L
Sbjct:   20 ILREIESTDTACIGPTLRSVYDGEEHG----------RFMEKLETRIRNHDREIEKMCNFHYQGFVDSITELLKVRGEAQKLKNQVTDTNRKLQHEGKELVIAMEELKQCRLQQRNISATVDKLMLCLPVLEMYSKLRDQMKTKRHYPALKTLEHLEHTYLPQVSHYRFCKVMVDNIPKLREEIKDVSMSDLKDFLESIRKHSDKIGETAMK----QAQQQRNLDNI---VLQQPRIGSKRKSKKDVYTIFDAEVESTSPKSEQD------SGILDVEDEEDDEEVPGAQDLVDFSPVYRCLHIYSVLGARETFENYYRKQRRKQARLVLQPPSNMHETLDGYRKYFNQIVGFFVVEDHILHTTQGLVNRAYIDELWEMALSKTIAALRTHSSYCSDPNLVLDLKNLIVLFADTLQVYGFPVNQLFDMLLEIRDQYSETLLKKWAGVFRNILDSDNYSPIPVTSEETYKKVVGQFP-FQDIELEKQPFPKKFPFSEFVPKVYNQIKEFIYACLKFSEDLHLSSTEVDDMIRKSTNLLLTRTLSNSLQNVIKRKNIGLTELVQIIINTTHLEKSCKYLEEFITNITNVLPETVHT--------------------------TKLYGTTTFKDARHAAEEEIYTNLNQKIDQFLQLADYDWMTG--------------------DLDN---KASDYLVDLIAFLRSTFAVFTHLPGKVAQTACMSACKHLATSLMQLLLEAEVRQLTLGALQQFNLDVRECEQFARSGPVPGFQEDTLQLAFIDLRQLLDLFIQWDWSTYLADYGQPNCKYLRVNPVTALTLLEKMKDTSRK-NNMFAQFRKNERDKQKLIDTVAKQLRGL 804          
BLAST of Exocyst complex component vs. Ensembl Mouse
Match: Exoc6 (exocyst complex component 6 [Source:MGI Symbol;Acc:MGI:1351611])

HSP 1 Score: 407.142 bits (1045), Expect = 1.597e-127
Identity = 267/859 (31.08%), Postives = 436/859 (50.76%), Query Frame = 2
Query:  311 LISEIKSNSSGSIANIIRKLRQLETSSVNNDSSEILTKFMRHLDNEIELNNQDIEKFCNHFYQCFVDSIKELLKIQEEASELKSSFGSVQSSLMESVKKIKQDCNELSKCHLILANIDKAVENLQACLPVFDQYLKAAKSINEKRYYPALKTLNHLELNQMQRVRQFSFSDNLQNKIPGMREQIKAASKDEIKDFLENVRKHSVGLGMCAMKLMAHKTGMEVNFDSPTKRTMNGARMNKGDDSKRENPFVGMLDEPDSVNKEIQDLISLESYGNDNDDSSELELESTNVEDRVDFGPVYRCLHIHSVLGDRHEFEKCYRNQRKRQCTLLLTL--SKQESVRNYHEFLSGVVGFFVVEDYIRHSQISMVTRNYLDELWSQTMLRVGDFVSVNSDNINDIESLLKLKDSCVLFGKTMRSLGFNVAGFKDFYEVLKKQHQKLLGNEYSNKFKDIFEGEDYTAITVQDASEMELVIDLYPYFLSPDIDILPYPKSLSFSWMVPRINQAIRDHIKKCRKFSDNLELSQTELEDQLNHTTNVLFSQTLKHFLVKAVKDSERELNRLIQLAVNMDELESACIGLQNFISSLVG----TVYTNSYQXXXXXXXXXXXXXXXXXINPPRSRLHAFALFKELHSKIENCIYSAIDAKIDDMFDDNEYRQVNSHHSSTNNSLANSPSKKFNSISIDNNQMKPSDFITDVIAYLSITFESFTNLPARLAQTACLLSCKYIDKKL-KTFVNSEAR-ISERFLHQLSTDIKSLQDFTRKIPVAGVSADTLILVFEDLRQLTALVILSDWDTFIKNYRTNQNPYDRVLTSSAISLLEKTRHSDTGFSALIKSLKKNKQDKRD--EEILKQLKEL 2857
            ++ EI+S  +  +   +R        SV +D      KFM  LD  I  ++++IEK CN  +Q FVD+I ELLK++ +A +LK           ++ K++     ++ +C +   NI   VE LQ CLPV + Y K  + ++ KRYY ALKT+  LE     RV Q+ F   +   +P +RE IK  S  ++KDFLE++RKHS  +G  AMK    +    V       +  N  R  K            M    D + +E  D+I   +   + ++  E+      V+D VDF PVYRCLHI+S LGD   FE  YR QRK+Q  L+L    S  E+V  Y  + + +VGFFVVED+I H    +VTR Y +ELW+  + ++   +  +S    D + +L+LK+  V+F  T++  GF V    D    ++ Q+ + L  +++  F+DIFE ++Y+ I +    E ++VI  +P F  PD++   +PK    S  VP I   +++ I    KFS++L  S TE++D L  +TN+L ++ L   L+  ++     L  L+Q+ +N   LE AC  L++FI+++      TV+T                          +RL+  + FK+     E  IY+ ++ KID+     +Y          + ++A S               + S ++ D+I +L   F+ FT+LP ++AQTAC+ +C+++   L +  ++SE + IS   + Q + D+   + F    PV G   DTL L F DLRQL  L ++ DW T++ +Y    + Y RV   +A++LLEK + +    + +    +KN +D++   E +++QL+ L
Sbjct:   17 ILQEIESTDTACVGPTLR--------SVYDDQPNAHKKFMEKLDACIRNHDKEIEKMCNFHHQGFVDAITELLKVRADAEKLKVQVTDTNRRFQDAGKEVIIQTEDIIRCRIQQRNITTVVEKLQLCLPVLEMYSKLKEQMSMKRYYSALKTMEQLENVYFPRVSQYRFCQLMMETLPKLREDIKDISMSDLKDFLESIRKHSDKIGEAAMKQAQQQKSFSVAL-----QKQNNMRFGK-----------NMHVNNDRILEEKSDVIPKHALEEEAENDEEV----LTVQDLVDFSPVYRCLHIYSALGDEETFENYYRKQRKKQARLVLQPQSSVHETVDGYRRYFTQIVGFFVVEDHILHVTQGLVTRVYTEELWNMALSKIIAVLRAHSSYCTDPDLVLELKNLIVIFADTLQGYGFPVNRLFDLLFEIRDQYNETLLKKWAGIFRDIFEEDNYSPIPIGSEEEYKVVISRFP-FQDPDLEKQSFPKKFPMSQSVPLIYIQVKEFIYASLKFSESLHRSSTEIDDMLRKSTNLLLTRILSSCLLNLIRKPHIGLTELVQIIINTTHLEQACKYLEDFITNITNISQETVHT--------------------------TRLYGLSTFKDARHAAEGEIYTKLNQKIDEFVQLADY----------DWTMAESDG-------------RASGYLMDLINFLRSIFQVFTHLPGKVAQTACMSACQHLSTSLMQMLLDSELKQISMGAVQQFNLDVIQCELFASSEPVPGFQGDTLQLAFIDLRQLLDLFMVWDWSTYLADYGQPASKYLRVNPHAALTLLEKMKDTSKK-NNIFAQFRKNDRDRQKLIETVVRQLRGL 796          
BLAST of Exocyst complex component vs. Ensembl Mouse
Match: Exoc6 (exocyst complex component 6 [Source:MGI Symbol;Acc:MGI:1351611])

HSP 1 Score: 404.831 bits (1039), Expect = 1.748e-126
Identity = 269/867 (31.03%), Postives = 439/867 (50.63%), Query Frame = 2
Query:  287 DFNKNFSNLISEIKSNSSGSIANIIRKLRQLETSSVNNDSSEILTKFMRHLDNEIELNNQDIEKFCNHFYQCFVDSIKELLKIQEEASELKSSFGSVQSSLMESVKKIKQDCNELSKCHLILANIDKAVENLQACLPVFDQYLKAAKSINEKRYYPALKTLNHLELNQMQRVRQFSFSDNLQNKIPGMREQIKAASKDEIKDFLENVRKHSVGLGMCAMKLMAHKTGMEVNFDSPTKRTMNGARMNKGDDSKRENPFVGMLDEPDSVNKEIQDLISLESYGNDNDDSSELELESTNVEDRVDFGPVYRCLHIHSVLGDRHEFEKCYRNQRKRQCTLLLTL--SKQESVRNYHEFLSGVVGFFVVEDYIRHSQISMVTRNYLDELWSQTMLRVGDFVSVNSDNINDIESLLKLKDSCVLFGKTMRSLGFNVAGFKDFYEVLKKQHQKLLGNEYSNKFKDIFEGEDYTAITVQDASEMELVIDLYPYFLSPDIDILPYPKSLSFSWMVPRINQAIRDHIKKCRKFSDNLELSQTELEDQLNHTTNVLFSQTLKHFLVKAVKDSERELNRLIQLAVNMDELESACIGLQNFISSLVG----TVYTNSYQXXXXXXXXXXXXXXXXXINPPRSRLHAFALFKELHSKIENCIYSAIDAKIDDMFDDNEYRQVNSHHSSTNNSLANSPSKKFNSISIDNNQMKPSDFITDVIAYLSITFESFTNLPARLAQTACLLSCKYIDKKL-KTFVNSEAR-ISERFLHQLSTDIKSLQDFTRKIPVAGVSADTLILVFEDLRQLTALVILSDWDTFIKNYRTNQNPYDRVLTSSAISLLEKTRHSDTGFSALIKSLKKNKQDKRD--EEILKQLKEL 2857
            D  + + N+++EI+S      A +          SV +D      KFM  LD  I  ++++IEK CN  +Q FVD+I ELLK++ +A +LK           ++ K++     ++ +C +   NI   VE LQ CLPV + Y K  + ++ KRYY ALKT+  LE     RV Q+ F   +   +P +RE IK  S  ++KDFLE++RKHS  +G  AMK    +    V       +  N  R  K            M    D + +E  D+I   +   + ++  E+      V+D VDF PVYRCLHI+S LGD   FE  YR QRK+Q  L+L    S  E+V  Y  + + +VGFFVVED+I H    +VTR Y +ELW+  + ++   +  +S    D + +L+LK+  V+F  T++  GF V    D    ++ Q+ + L  +++  F+DIFE ++Y+ I +    E ++VI  +P F  PD++   +PK    S  VP I   +++ I    KFS++L  S TE++D L  +TN+L ++ L   L+  ++     L  L+Q+ +N   LE AC  L++FI+++      TV+T                          +RL+  + FK+     E  IY+ ++ KID+     +Y          + ++A S               + S ++ D+I +L   F+ FT+LP ++AQTAC+ +C+++   L +  ++SE + IS   + Q + D+   + F    PV G   DTL L F DLRQL  L ++ DW T++ +Y    + Y RV   +A++LLEK + +    + +    +KN +D++   E +++QL+ L
Sbjct:   17 DTEQAYENVLAEIQSFELPIEATL---------RSVYDDQPNAHKKFMEKLDACIRNHDKEIEKMCNFHHQGFVDAITELLKVRADAEKLKVQVTDTNRRFQDAGKEVIIQTEDIIRCRIQQRNITTVVEKLQLCLPVLEMYSKLKEQMSMKRYYSALKTMEQLENVYFPRVSQYRFCQLMMETLPKLREDIKDISMSDLKDFLESIRKHSDKIGEAAMKQAQQQKSFSVAL-----QKQNNMRFGK-----------NMHVNNDRILEEKSDVIPKHALEEEAENDEEV----LTVQDLVDFSPVYRCLHIYSALGDEETFENYYRKQRKKQARLVLQPQSSVHETVDGYRRYFTQIVGFFVVEDHILHVTQGLVTRVYTEELWNMALSKIIAVLRAHSSYCTDPDLVLELKNLIVIFADTLQGYGFPVNRLFDLLFEIRDQYNETLLKKWAGIFRDIFEEDNYSPIPIGSEEEYKVVISRFP-FQDPDLEKQSFPKKFPMSQSVPLIYIQVKEFIYASLKFSESLHRSSTEIDDMLRKSTNLLLTRILSSCLLNLIRKPHIGLTELVQIIINTTHLEQACKYLEDFITNITNISQETVHT--------------------------TRLYGLSTFKDARHAAEGEIYTKLNQKIDEFVQLADY----------DWTMAESDG-------------RASGYLMDLINFLRSIFQVFTHLPGKVAQTACMSACQHLSTSLMQMLLDSELKQISMGAVQQFNLDVIQCELFASSEPVPGFQGDTLQLAFIDLRQLLDLFMVWDWSTYLADYGQPASKYLRVNPHAALTLLEKMKDTSKK-NNIFAQFRKNDRDRQKLIETVVRQLRGL 803          
BLAST of Exocyst complex component vs. Ensembl Mouse
Match: Exoc6 (exocyst complex component 6 [Source:MGI Symbol;Acc:MGI:1351611])

HSP 1 Score: 403.29 bits (1035), Expect = 4.570e-126
Identity = 267/859 (31.08%), Postives = 437/859 (50.87%), Query Frame = 2
Query:  311 LISEIKSNSSGSIANIIRKLRQLETSSVNNDSSEILTKFMRHLDNEIELNNQDIEKFCNHFYQCFVDSIKELLKIQEEASELKSSFGSVQSSLMESVKKIKQDCNELSKCHLILANIDKAVENLQACLPVFDQYLKAAKSINEKRYYPALKTLNHLELNQMQRVRQFSFSDNLQNKIPGMREQIKAASKDEIKDFLENVRKHSVGLGMCAMKLMAHKTGMEVNFDSPTKRTMNGARMNKGDDSKRENPFVGMLDEPDSVNKEIQDLISLESYGNDNDDSSELELESTNVEDRVDFGPVYRCLHIHSVLGDRHEFEKCYRNQRKRQCTLLLTL--SKQESVRNYHEFLSGVVGFFVVEDYIRHSQISMVTRNYLDELWSQTMLRVGDFVSVNSDNINDIESLLKLKDSCVLFGKTMRSLGFNVAGFKDFYEVLKKQHQKLLGNEYSNKFKDIFEGEDYTAITVQDASEMELVIDLYPYFLSPDIDILPYPKSLSFSWMVPRINQAIRDHIKKCRKFSDNLELSQTELEDQLNHTTNVLFSQTLKHFLVKAVKDSERELNRLIQLAVNMDELESACIGLQNFISSLVG----TVYTNSYQXXXXXXXXXXXXXXXXXINPPRSRLHAFALFKELHSKIENCIYSAIDAKIDDMFDDNEYRQVNSHHSSTNNSLANSPSKKFNSISIDNNQMKPSDFITDVIAYLSITFESFTNLPARLAQTACLLSCKYIDKKL-KTFVNSEAR-ISERFLHQLSTDIKSLQDFTRKIPVAGVSADTLILVFEDLRQLTALVILSDWDTFIKNYRTNQNPYDRVLTSSAISLLEKTRHSDTGFSALIKSLKKNKQDKRD--EEILKQLKEL 2857
            ++ EI+S  +  +   +R        SV +D      KFM  LD  I  ++++IEK CN  +Q FVD+I ELLK++ +A +LK +         ++ K++     ++ +C +   NI   VE LQ CLPV + Y K  + ++ KRYY ALKT+  LE     RV Q+ F   +   +P +RE IK  S  ++KDFLE++RKHS  +G  AMK    +    V       +  N  R  K            M    D + +E  D+I   +   + ++  E+      V+D VDF PVYRCLHI+S LGD   FE  YR QRK+Q  L+L    S  E+V  Y  + + +VGFFVVED+I H    +VTR Y +ELW+  + ++   +  +S    D + +L+LK+  V+F  T++  GF V    D    ++ Q+ + L  +++  F+DIFE ++Y+ I +    E ++VI  +P F  PD++   +PK    S  VP I   +++ I    KFS++L  S TE++D L  +TN+L ++ L   L+  ++     L  L+Q+ +N   LE AC  L++FI+++      TV+T                          +RL+  + FK+     E  IY+ ++ KID+     +Y          + ++A S               + S ++ D+I +L   F+ FT+LP ++AQTAC+ +C+++   L +  ++SE + IS   + Q + D+   + F    PV G   DTL L F DLRQL  L ++ DW T++ +Y    + Y RV   +A++LLEK + +    + +    +KN +D++   E +++QL+ L
Sbjct:   17 ILQEIESTDTACVGPTLR--------SVYDDQPNAHKKFMEKLDACIRNHDKEIEKMCNFHHQGFVDAITELLKVRADAEKLKVT--DTNRRFQDAGKEVIIQTEDIIRCRIQQRNITTVVEKLQLCLPVLEMYSKLKEQMSMKRYYSALKTMEQLENVYFPRVSQYRFCQLMMETLPKLREDIKDISMSDLKDFLESIRKHSDKIGEAAMKQAQQQKSFSVAL-----QKQNNMRFGK-----------NMHVNNDRILEEKSDVIPKHALEEEAENDEEV----LTVQDLVDFSPVYRCLHIYSALGDEETFENYYRKQRKKQARLVLQPQSSVHETVDGYRRYFTQIVGFFVVEDHILHVTQGLVTRVYTEELWNMALSKIIAVLRAHSSYCTDPDLVLELKNLIVIFADTLQGYGFPVNRLFDLLFEIRDQYNETLLKKWAGIFRDIFEEDNYSPIPIGSEEEYKVVISRFP-FQDPDLEKQSFPKKFPMSQSVPLIYIQVKEFIYASLKFSESLHRSSTEIDDMLRKSTNLLLTRILSSCLLNLIRKPHIGLTELVQIIINTTHLEQACKYLEDFITNITNISQETVHT--------------------------TRLYGLSTFKDARHAAEGEIYTKLNQKIDEFVQLADY----------DWTMAESDG-------------RASGYLMDLINFLRSIFQVFTHLPGKVAQTACMSACQHLSTSLMQMLLDSELKQISMGAVQQFNLDVIQCELFASSEPVPGFQGDTLQLAFIDLRQLLDLFMVWDWSTYLADYGQPASKYLRVNPHAALTLLEKMKDTSKK-NNIFAQFRKNDRDRQKLIETVVRQLRGL 794          
BLAST of Exocyst complex component vs. UniProt/SwissProt
Match: sp|A6H5Z3|EXC6B_MOUSE (Exocyst complex component 6B OS=Mus musculus OX=10090 GN=Exoc6b PE=1 SV=1)

HSP 1 Score: 415.616 bits (1067), Expect = 8.357e-130
Identity = 273/859 (31.78%), Postives = 436/859 (50.76%), Query Frame = 2
Query:  311 LISEIKSNSSGSIANIIRKLRQLETSSVNNDSSEILTKFMRHLDNEIELNNQDIEKFCNHFYQCFVDSIKELLKIQEEASELKSSFGSVQSSLMESVKKIKQDCNELSKCHLILANIDKAVENLQACLPVFDQYLKAAKSINEKRYYPALKTLNHLELNQMQRVRQFSFSDNLQNKIPGMREQIKAASKDEIKDFLENVRKHSVGLGMCAMKLMAHKTGMEVNFDSPTKRTMNGARMNKGDDSKRENPFVGMLDEPDSVNKEIQDLISLESYGNDNDDSSELELESTNVEDRVDFGPVYRCLHIHSVLGDRHEFEKCYRNQRKRQCTLLLTLSK--QESVRNYHEFLSGVVGFFVVEDYIRHSQISMVTRNYLDELWSQTMLRVGDFVSVNSDNINDIESLLKLKDSCVLFGKTMRSLGFNVAGFKDFYEVLKKQHQKLLGNEYSNKFKDIFEGEDYTAITVQDASEMELVIDLYPYFLSPDIDILPYPKSLSFSWMVPRINQAIRDHIKKCRKFSDNLELSQTELEDQLNHTTNVLFSQTLKHFLVKAVKDSERELNRLIQLAVNMDELESACIGLQNFISSLVG----TVYTNSYQXXXXXXXXXXXXXXXXXINPPRSRLHAFALFKELHSKIENCIYSAIDAKIDDMFDDNEYRQVNSHHSSTNNSLANSPSKKFNSISIDNNQMKPSDFITDVIAYLSITFESFTNLPARLAQTACLLSCKYIDKKL-KTFVNSEAR-ISERFLHQLSTDIKSLQDFTRKIPVAGVSADTLILVFEDLRQLTALVILSDWDTFIKNYRTNQNPYDRVLTSSAISLLEKTRHSDTGFSALIKSLKKNKQDKRD--EEILKQLKEL 2857
            ++ EI+S  +  I   +R +   E             +FM  L+  I  ++++IEK CN  YQ FVDSI ELLK++ EA +LK+        L    K++     EL +C L   NI   V+ L  CLPV + Y K    +  KR+YPALKTL HLE   + +V  + F   + + IP +RE+IK  S  ++KDFLE++RKHS  +G  AMK    +   + N D+     +   R+     SK++   +   +   +  K  QD       G  + +  E + E    +D VDF PVYRCLHI+SVLG R  FE  YR QR++Q  L+L       E++  Y ++ + +VGFFVVED+I H+   +V R Y+DELW   + +    +  +S   +D   +L LK+  VLF  T++  GF V    D    ++ Q+ + L  +++  F++I + ++Y+ I V      + V+  +P F   +++  P+PK   FS  VP++   I++ I  C KFS++L LS TE++D +  +TN+L ++TL + L   +K     L  L+Q+ +N   LE +C  L+ FI+++      TV+T                          ++L+    FK+     E  IY+ ++ KID      +Y  +                       +DN   K SD++ D+IA+L  TF  FT+LP ++AQTAC+ +CK++   L +  + +E R ++   L Q + D++  + F R  PV G   DTL L F DLRQL  L I  DW T++ +Y      Y RV   +A++LLEK + +    + +    +KN++DK+   + + KQL+ L
Sbjct:   20 ILREIESTDTACIGPTLRSVYDGEEHG----------RFMEKLETRIRNHDREIEKMCNFHYQGFVDSITELLKVRGEAQKLKNQVTDTNRKLQHEGKELVIAMEELKQCRLQQRNISATVDKLMLCLPVLEMYSKLRDQMKTKRHYPALKTLEHLEHTYLPQVSHYRFCKVMVDNIPKLREEIKDVSMSDLKDFLESIRKHSDKIGETAMK----QAQQQRNLDNI---VLQQPRIGSKRKSKKDVYTIFDAEVESTSPKSEQD------SGILDVEDEEDDEEVPGAQDLVDFSPVYRCLHIYSVLGARETFENYYRKQRRKQARLVLQPPSNMHETLDGYRKYFNQIVGFFVVEDHILHTTQGLVNRAYIDELWEMALSKTIAALRTHSSYCSDPNLVLDLKNLIVLFADTLQVYGFPVNQLFDMLLEIRDQYSETLLKKWAGVFRNILDSDNYSPIPVTSEETYKKVVGQFP-FQDIELEKQPFPKKFPFSEFVPKVYNQIKEFIYACLKFSEDLHLSSTEVDDMIRKSTNLLLTRTLSNSLQNVIKRKNIGLTELVQIIINTTHLEKSCKYLEEFITNITNVLPETVHT--------------------------TKLYGTTTFKDARHAAEEEIYTNLNQKIDQFLQLADYDWMTG--------------------DLDN---KASDYLVDLIAFLRSTFAVFTHLPGKVAQTACMSACKHLATSLMQLLLEAEVRQLTLGALQQFNLDVRECEQFARSGPVPGFQEDTLQLAFIDLRQLLDLFIQWDWSTYLADYGQPNCKYLRVNPVTALTLLEKMKDTSRK-NNMFAQFRKNERDKQKLIDTVAKQLRGL 804          
BLAST of Exocyst complex component vs. UniProt/SwissProt
Match: sp|Q9Y2D4|EXC6B_HUMAN (Exocyst complex component 6B OS=Homo sapiens OX=9606 GN=EXOC6B PE=1 SV=3)

HSP 1 Score: 414.461 bits (1064), Expect = 2.584e-129
Identity = 273/859 (31.78%), Postives = 435/859 (50.64%), Query Frame = 2
Query:  311 LISEIKSNSSGSIANIIRKLRQLETSSVNNDSSEILTKFMRHLDNEIELNNQDIEKFCNHFYQCFVDSIKELLKIQEEASELKSSFGSVQSSLMESVKKIKQDCNELSKCHLILANIDKAVENLQACLPVFDQYLKAAKSINEKRYYPALKTLNHLELNQMQRVRQFSFSDNLQNKIPGMREQIKAASKDEIKDFLENVRKHSVGLGMCAMKLMAHKTGMEVNFDSPTKRTMNGARMNKGDDSKRENPFVGMLDEPDSVNKEIQDLISLESYGNDNDDSSELELESTNVEDRVDFGPVYRCLHIHSVLGDRHEFEKCYRNQRKRQCTLLLTLSK--QESVRNYHEFLSGVVGFFVVEDYIRHSQISMVTRNYLDELWSQTMLRVGDFVSVNSDNINDIESLLKLKDSCVLFGKTMRSLGFNVAGFKDFYEVLKKQHQKLLGNEYSNKFKDIFEGEDYTAITVQDASEMELVIDLYPYFLSPDIDILPYPKSLSFSWMVPRINQAIRDHIKKCRKFSDNLELSQTELEDQLNHTTNVLFSQTLKHFLVKAVKDSERELNRLIQLAVNMDELESACIGLQNFISSLVG----TVYTNSYQXXXXXXXXXXXXXXXXXINPPRSRLHAFALFKELHSKIENCIYSAIDAKIDDMFDDNEYRQVNSHHSSTNNSLANSPSKKFNSISIDNNQMKPSDFITDVIAYLSITFESFTNLPARLAQTACLLSCKYIDKKL-KTFVNSEAR-ISERFLHQLSTDIKSLQDFTRKIPVAGVSADTLILVFEDLRQLTALVILSDWDTFIKNYRTNQNPYDRVLTSSAISLLEKTRHSDTGFSALIKSLKKNKQDKRD--EEILKQLKEL 2857
            ++ EI+S  +  I   +R +   E             +FM  L+  I  ++++IEK CN  YQ FVDSI ELLK++ EA +LK+        L    K++     EL +C L   NI   V+ L  CLPV + Y K    +  KR+YPALKTL HLE   + +V  + F   + + IP +RE+IK  S  ++KDFLE++RKHS  +G  AMK    +   + N D+     +   R+     SK++   +   +   +  K  QD       G  + +  E + E    +D VDF PVYRCLHI+SVLG R  FE  YR QR++Q  L+L       E++  Y ++ + +VGFFVVED+I H+   +V R Y+DELW   + +    +  +S   +D   +L LK+  VLF  T++  GF V    D    ++ Q+ + L  +++  F++I + ++Y+ I V      + V+  +P F   +++  P+PK   FS  VP++   I++ I  C KFS++L LS TE++D +  +TN+L ++TL + L   +K     L  L+Q+ +N   LE +C  L+ FI+++      TV+T                          ++L+    FK+     E  IY+ ++ KID      +Y  +          L N                K SD++ D+IA+L  TF  FT+LP ++AQTAC+ +CK++   L +  + +E R ++   L Q + D++  + F R  PV G   DTL L F DLRQL  L I  DW T++ +Y      Y RV   +A++LLEK + +    + +    +KN++DK+   + + KQL+ L
Sbjct:   21 ILREIESTDTACIGPTLRSVYDGEEHG----------RFMEKLETRIRNHDREIEKMCNFHYQGFVDSITELLKVRGEAQKLKNQVTDTNRKLQHEGKELVIAMEELKQCRLQQRNISATVDKLMLCLPVLEMYSKLRDQMKTKRHYPALKTLEHLEHTYLPQVSHYRFCKVMVDNIPKLREEIKDVSMSDLKDFLESIRKHSDKIGETAMK----QAQQQRNLDNI---VLQQPRIGSKRKSKKDAYIIFDTEIESTSPKSEQD------SGILDVEDEEDDEEVPGAQDLVDFSPVYRCLHIYSVLGARETFENYYRKQRRKQARLVLQPPSNMHETLDGYRKYFNQIVGFFVVEDHILHTTQGLVNRAYIDELWEMALSKTIAALRTHSSYCSDPNLVLDLKNLIVLFADTLQVYGFPVNQLFDMLLEIRDQYSETLLKKWAGIFRNILDSDNYSPIPVTSEEMYKKVVGQFP-FQDIELEKQPFPKKFPFSEFVPKVYNQIKEFIYACLKFSEDLHLSSTEVDDMIRKSTNLLLTRTLSNSLQNVIKRKNIGLTELVQIIINTTHLEKSCKYLEEFITNITNVLPETVHT--------------------------TKLYGTTTFKDARHAAEEEIYTNLNQKIDQFLQLADYDWMTG-------DLGN----------------KASDYLVDLIAFLRSTFAVFTHLPGKVAQTACMSACKHLATSLMQLLLEAEVRQLTLGALQQFNLDVRECEQFARSGPVPGFQEDTLQLAFIDLRQLLDLFIQWDWSTYLADYGQPNCKYLRVNPVTALTLLEKMKDTSRK-NNMFAQFRKNERDKQKLIDTVAKQLRGL 805          
BLAST of Exocyst complex component vs. UniProt/SwissProt
Match: sp|Q8TAG9|EXOC6_HUMAN (Exocyst complex component 6 OS=Homo sapiens OX=9606 GN=EXOC6 PE=1 SV=3)

HSP 1 Score: 413.69 bits (1062), Expect = 4.577e-129
Identity = 270/859 (31.43%), Postives = 436/859 (50.76%), Query Frame = 2
Query:  311 LISEIKSNSSGSIANIIRKLRQLETSSVNNDSSEILTKFMRHLDNEIELNNQDIEKFCNHFYQCFVDSIKELLKIQEEASELKSSFGSVQSSLMESVKKIKQDCNELSKCHLILANIDKAVENLQACLPVFDQYLKAAKSINEKRYYPALKTLNHLELNQMQRVRQFSFSDNLQNKIPGMREQIKAASKDEIKDFLENVRKHSVGLGMCAMKLMAHKTGMEVNFDSPTKRTMNGARMNKGDDSKRENPFVGMLDEPDSVNKEIQDLISLESYGNDNDDSSELELESTNVEDRVDFGPVYRCLHIHSVLGDRHEFEKCYRNQRKRQCTLLLTLSK--QESVRNYHEFLSGVVGFFVVEDYIRHSQISMVTRNYLDELWSQTMLRVGDFVSVNSDNINDIESLLKLKDSCVLFGKTMRSLGFNVAGFKDFYEVLKKQHQKLLGNEYSNKFKDIFEGEDYTAITVQDASEMELVIDLYPYFLSPDIDILPYPKSLSFSWMVPRINQAIRDHIKKCRKFSDNLELSQTELEDQLNHTTNVLFSQTLKHFLVKAVKDSERELNRLIQLAVNMDELESACIGLQNFISSLVG----TVYTNSYQXXXXXXXXXXXXXXXXXINPPRSRLHAFALFKELHSKIENCIYSAIDAKIDDMFDDNEYRQVNSHHSSTNNSLANSPSKKFNSISIDNNQMKPSDFITDVIAYLSITFESFTNLPARLAQTACLLSCKYIDKKL-KTFVNSEAR-ISERFLHQLSTDIKSLQDFTRKIPVAGVSADTLILVFEDLRQLTALVILSDWDTFIKNYRTNQNPYDRVLTSSAISLLEKTRHSDTGFSALIKSLKKNKQDKRD--EEILKQLKEL 2857
            ++ EI+S  +  +   +R        SV +D      KFM  LD  I  ++++IEK CN  +Q FVD+I ELLK++ +A +LK           ++ K++     ++ +C +   NI   VE LQ CLPV + Y K  + ++ KRYY ALKT+  LE      V Q+ F   +   +P +RE IK  S  ++KDFLE++RKHS  +G  AMK   H+    V+     K       M  G +         M    D + +E  + +   S   ++++  E+      V+D VDF PVYRCLHI+SVLGD   FE  YR QRK+Q  L+L       E+V  Y  + + +VGFFVVED+I H    +VTR Y DELW+  + ++   +  +S    D + +L+LK+  V+F  T++  GF V    D    ++ Q+ + L  +++  F+DIFE ++Y+ I V +  E ++VI  +P F  PD++   +PK    S  VP I   +++ I    KFS++L  S TE++D L  +TN+L ++TL   L+  ++     L  L+Q+ +N   LE AC  L++FI+++      TV+T                          +RL+  + FK+     E  IY+ ++ KID+     +Y    S                           + S ++ D+I +L   F+ FT+LP ++AQTAC+ +C+++   L +  ++SE + IS   + Q + D+   + F    PV G   DTL L F DLRQL  L ++ DW T++ +Y    + Y RV  ++A++LLEK + +    + +    +KN +DK+   E ++KQL+ L
Sbjct:   17 ILQEIESTDTACVGPTLR--------SVYDDQPNAHKKFMEKLDACIRNHDKEIEKMCNFHHQGFVDAITELLKVRTDAEKLKVQVTDTNRRFQDAGKEVIVHTEDIIRCRIQQRNITTVVEKLQLCLPVLEMYSKLKEQMSAKRYYSALKTMEQLENVYFPWVSQYRFCQLMIENLPKLREDIKEISMSDLKDFLESIRKHSDKIGETAMKQAQHQKTFSVSLQKQNK-------MKFGKN---------MYINRDRIPEERNETVLKHSLEEEDENEEEI----LTVQDLVDFSPVYRCLHIYSVLGDEETFENYYRKQRKKQARLVLQPQSNMHETVDGYRRYFTQIVGFFVVEDHILHVTQGLVTRAYTDELWNMALSKIIAVLRAHSSYCTDPDLVLELKNLTVIFADTLQGYGFPVNRLFDLLFEIRDQYNETLLKKWAGVFRDIFEEDNYSPIPVVNEEEYKIVISKFP-FQDPDLEKQSFPKKFPMSQSVPHIYIQVKEFIYASLKFSESLHRSSTEIDDMLRKSTNLLLTRTLSSCLLNLIRKPHIGLTELVQIIINTTHLEQACKYLEDFITNITNISQETVHT--------------------------TRLYGLSTFKDARHAAEGEIYTKLNQKIDEFVQLADYDWTMSEPDG-----------------------RASGYLMDLINFLRSIFQVFTHLPGKVAQTACMSACQHLSTSLMQMLLDSELKQISMGAVQQFNLDVIQCELFASSEPVPGFQGDTLQLAFIDLRQLLDLFMVWDWSTYLADYGQPASKYLRVNPNTALTLLEKMKDTSKK-NNIFAQFRKNDRDKQKLIETVVKQLRSL 796          
BLAST of Exocyst complex component vs. UniProt/SwissProt
Match: sp|E2R766|EXOC6_CANLF (Exocyst complex component 6 OS=Canis lupus familiaris OX=9615 GN=EXOC6 PE=3 SV=1)

HSP 1 Score: 406.757 bits (1044), Expect = 1.604e-126
Identity = 271/863 (31.40%), Postives = 428/863 (49.59%), Query Frame = 2
Query:  311 LISEIKSNSSGSIANIIRKLRQLETSSVNNDSSEILTKFMRHLDNEIELNNQDIEKFCNHFYQCFVDSIKELLKIQEEASELKSSFGSVQSSLMESVKKIKQDCNELSKCHLILANIDKAVENLQACLPVFDQYLKAAKSINEKRYYPALKTLNHLELNQMQRVRQFSFSDNLQNKIPGMREQIKAASKDEIKDFLENVRKHSVGLGMCAMKLMAHKTGMEVNFDSPTKRTMNGARMNKGDDSKRENPFVGMLDEPDSVNKEIQDLISLESYGNDNDDSSELELEST----NVEDRVDFGPVYRCLHIHSVLGDRHEFEKCYRNQRKRQCTLLLTLSK--QESVRNYHEFLSGVVGFFVVEDYIRHSQISMVTRNYLDELWSQTMLRVGDFVSVNSDNINDIESLLKLKDSCVLFGKTMRSLGFNVAGFKDFYEVLKKQHQKLLGNEYSNKFKDIFEGEDYTAITVQDASEMELVIDLYPYFLSPDIDILPYPKSLSFSWMVPRINQAIRDHIKKCRKFSDNLELSQTELEDQLNHTTNVLFSQTLKHFLVKAVKDSERELNRLIQLAVNMDELESACIGLQNFISSLVG----TVYTNSYQXXXXXXXXXXXXXXXXXINPPRSRLHAFALFKELHSKIENCIYSAIDAKIDDMFDDNEYRQVNSHHSSTNNSLANSPSKKFNSISIDNNQMKPSDFITDVIAYLSITFESFTNLPARLAQTACLLSCKYIDKKL-KTFVNSEAR-ISERFLHQLSTDIKSLQDFTRKIPVAGVSADTLILVFEDLRQLTALVILSDWDTFIKNYRTNQNPYDRVLTSSAISLLEKTRHSDTGFSALIKSLKKNKQDKRD--EEILKQLKEL 2857
            ++ EI+S  +  +   +R        SV +D      KFM  LD  I  ++++IEK CN  +Q FVD+I ELLK++ +A +LK           ++ K++     ++ +C +   NI   VENLQ   PV + Y K  + +  KRYY ALKT+  LE     RV Q+ F   +   +P +RE IK  S  ++KDFLE++RKHS  +G  AMK    +    V       +  N  +  K                    N  I D I  E   N+     E E E+      V+D VDF PVYRCLHI+SVLGD   FE  YR QRK+Q  L+L       E+V  Y  + + +VGFFVVED+I H    +VTR Y DELW+  + ++   +  +S    D + +L+LK+  V+F  T++  GF V    D    ++ Q+ + L  +++  F+DIFE ++Y+ I + +  E + VI  +P F  PD +   +PK    S  VP I   +++ I    KFS++L  S TE++D L  +TN+L ++TL   L+  ++     L  L+Q+ +N   LE AC  L++FI+++      TV+T                          +RL+  + FK+     E  IY+ ++ KID+     +Y    S                           + S ++ D+I +L   F+ FT+LP ++AQTAC+ +C+++   L +  ++SE + IS   + Q + D+   + F    PV G   DTL L F DLRQL  L ++ DW T++ +Y    + Y RV  ++A++LLEK + +    + +    +KN +DK+   E ++KQL+ L
Sbjct:   17 ILQEIESTDTACVGPTLR--------SVYDDQPNAHKKFMEKLDACIRNHDKEIEKMCNFHHQGFVDAITELLKVRTDAEKLKVQVTDTNRRFQDAGKEVIIQTEDIIRCRIQQRNITTVVENLQYAFPVLEMYSKLKEQMTAKRYYSALKTMEQLENVYFPRVSQYRFCQLMIENLPKLREDIKEISMSDLKDFLESIRKHSDKIGETAMKQAQQQKTFSVAL-----QKQNNVKFGK--------------------NMYINDRIPEERKENELKQGFEEEDENEEEILTVQDLVDFSPVYRCLHIYSVLGDEETFENYYRKQRKKQARLVLQPQSNMHETVDGYRRYFTQIVGFFVVEDHILHVTQGLVTRAYTDELWNMALSKIIAVLRAHSSYCTDPDLVLELKNLIVIFADTLQGYGFPVNRLFDLLFEIRDQYNETLLKKWAGVFRDIFEEDNYSPIPIVNEEEYKAVISKFP-FQDPDFEKQSFPKKFPMSQSVPHIYIQVKEFIYASLKFSESLHRSSTEIDDMLRKSTNLLLTRTLSSCLLNLIRKPHIGLTELVQIIINTTHLEQACKYLEDFITNITNISQETVHT--------------------------TRLYGLSTFKDARHAAEGEIYTKLNQKIDEFVQLADYDWTMSEPDG-----------------------RASGYLMDLINFLRSIFQVFTHLPGKVAQTACMSACQHLSTSLMQMLLDSELKQISMGAVQQFNLDVIQCELFASSEPVPGFQGDTLQLAFIDLRQLLDLFMVWDWSTYLADYGQPASKYLRVNPNTALTLLEKMKDTSKK-NNIFAQFRKNDRDKQKLIETVVKQLRSL 795          
BLAST of Exocyst complex component vs. UniProt/SwissProt
Match: sp|O54923|EXOC6_RAT (Exocyst complex component 6 OS=Rattus norvegicus OX=10116 GN=Exoc6 PE=1 SV=2)

HSP 1 Score: 405.601 bits (1041), Expect = 3.972e-126
Identity = 265/859 (30.85%), Postives = 436/859 (50.76%), Query Frame = 2
Query:  311 LISEIKSNSSGSIANIIRKLRQLETSSVNNDSSEILTKFMRHLDNEIELNNQDIEKFCNHFYQCFVDSIKELLKIQEEASELKSSFGSVQSSLMESVKKIKQDCNELSKCHLILANIDKAVENLQACLPVFDQYLKAAKSINEKRYYPALKTLNHLELNQMQRVRQFSFSDNLQNKIPGMREQIKAASKDEIKDFLENVRKHSVGLGMCAMKLMAHKTGMEVNFDSPTKRTMNGARMNKGDDSKRENPFVGMLDEPDSVNKEIQDLISLESYGNDNDDSSELELESTNVEDRVDFGPVYRCLHIHSVLGDRHEFEKCYRNQRKRQCTLLLTL--SKQESVRNYHEFLSGVVGFFVVEDYIRHSQISMVTRNYLDELWSQTMLRVGDFVSVNSDNINDIESLLKLKDSCVLFGKTMRSLGFNVAGFKDFYEVLKKQHQKLLGNEYSNKFKDIFEGEDYTAITVQDASEMELVIDLYPYFLSPDIDILPYPKSLSFSWMVPRINQAIRDHIKKCRKFSDNLELSQTELEDQLNHTTNVLFSQTLKHFLVKAVKDSERELNRLIQLAVNMDELESACIGLQNFISSLVG----TVYTNSYQXXXXXXXXXXXXXXXXXINPPRSRLHAFALFKELHSKIENCIYSAIDAKIDDMFDDNEYRQVNSHHSSTNNSLANSPSKKFNSISIDNNQMKPSDFITDVIAYLSITFESFTNLPARLAQTACLLSCKYIDKKL-KTFVNSEAR-ISERFLHQLSTDIKSLQDFTRKIPVAGVSADTLILVFEDLRQLTALVILSDWDTFIKNYRTNQNPYDRVLTSSAISLLEKTRHSDTGFSALIKSLKKNKQDKRD--EEILKQLKEL 2857
            ++ EI+S  +  +   +R        SV +       KFM  LD  I  ++++IEK CN  +Q FVD+I ELLK++ +A +LK           ++ K++ +   ++ +C +   NI   VE LQ CLPV + Y K  + ++ +RYY ALKT+  LE     RV Q+ F   + + +P +RE IK  S  ++KDFLE++RKHS  +G  AMK    +    +     T     G  M+  +D   E               E  D+I   +   + ++  E+      V+D VDF PVYRC HI+S LGD   FE  YR QRK+Q  L+L    S  E+V  Y  + + +VGFFVVED+I H    +VTR Y DELW+  + ++   +  +S    D + +L+LK+  V+F  T++  GF+V    D    ++ Q+ + L  +++  F+DIFE ++Y+ I +    E ++VI  +P F  PD++   +PK    S  VP I   +++ I    KFS++L  S TE++D L  +TN+L ++ L   L+  ++     L  L+Q+ +N   LE AC  L++FI+++      TV+T                          +RL+  + FK+     E  IY+ ++ KID+     +Y          + ++A S               + S ++ D+I +L   F+ FT+LP ++AQTAC+ +C+++   L +  ++SE + IS   + Q + D+   + F    PV G   DTL L F DLRQL  L ++ DW T++ +Y    + Y RV   +A++LLEK + +    + +    +KN +D++   E ++KQL+ L
Sbjct:   17 ILQEIESTDTACVGPTLR--------SVYDGQPNAHKKFMEKLDACIRNHDKEIEKMCNFHHQGFVDAITELLKVRADAEKLKVQVTDTNRRFQDAGKEVIEQTEDIIRCRIQQRNITTVVEKLQLCLPVLEMYSKLKEQMSMQRYYSALKTMEQLENVYFPRVSQYRFCQLMMDTLPKLREDIKDISMSDLKDFLESIRKHSDKIGETAMKQAQQQKSFSIAVQKQTNMRF-GKNMHVNNDRTLE---------------EKSDIILKHTLEEEAENDEEV----LTVQDLVDFSPVYRCSHIYSALGDEETFENYYRKQRKKQARLVLQPQSSVHETVDGYRRYFTQIVGFFVVEDHILHVTQGLVTRAYTDELWNMALSKIIAVLRAHSSYCTDPDLVLELKNLIVIFADTLQGYGFSVNRLFDLLFEIRDQYNETLLKKWAGIFRDIFEEDNYSPIPIGSEEEYKMVISKFP-FQDPDLEKQSFPKKFPMSQSVPLIYIQVKEFIYASLKFSESLHRSSTEIDDMLRKSTNLLLTRILSSCLLNLIRKPHIGLTELVQIIINTTHLEQACKYLEDFITNITNISQETVHT--------------------------TRLYGLSTFKDARHAAEGEIYTKLNQKIDEFVQLADY----------DWTMAESDG-------------RASGYLMDLINFLRSIFQVFTHLPGKVAQTACMSACQHLSTSLMQMLLDSELKQISMGAVQQFNLDVIQCELFASSEPVPGFQGDTLQLAFIDLRQLLDLFMVWDWSTYLADYGQPASKYLRVNPHAALTLLEKMKDTSKK-NNIFAQFRKNDRDRQKLIETVVKQLRGL 796          
BLAST of Exocyst complex component vs. TrEMBL
Match: G7Y9K1 (Exocyst complex component OS=Clonorchis sinensis OX=79923 GN=CLF_103320 PE=3 SV=1)

HSP 1 Score: 561.607 bits (1446), Expect = 0.000e+0
Identity = 323/897 (36.01%), Postives = 510/897 (56.86%), Query Frame = 2
Query:  299 NFSNLISEIKSNSSGSIANIIRKLRQLETSS----VNNDSSEILTKFMRHLDNEIELNNQDIEKFCNHFYQCFVDSIKELLKIQEEASELKSSFGSVQSSLMESVKKIKQDCNELSKCHLILANIDKAVENLQACLPVFDQYLKAAKSINEKRYYPALKTLNHLELNQMQRVRQFSFSDNLQNKIPGMREQIKAASKDEIKDFLENVRKHSVGLGMCAMKLMAHKTGMEVNFDSPTKRTMNGARMNKGDDSKRENPFVG-MLDEPDS---------------VNKEIQDLISLESYGNDNDDSSELELEST-------NVEDRVDFGPVYRCLHIHSVLGDRHEFEKCYRNQRKRQC--TLLLTLSKQESVRNYHEFLSGVVGFFVVEDYIRHSQISMVT--RNYLDELWSQTMLRVGDFVSVNSDNINDIESLLKLKDSCVLFGKTMRSLGFNVAGFKDFYEVLKKQHQKLLGNEYSNKFKDIFEGEDYTAITVQDASEMELVIDLYPYFLSPDIDILPYPKSLSFSWMVPRINQAIRDHIKKCRKFSDNLELSQTELEDQLNHTTNVLFSQTLKHFLVKAVKDSERELNRLIQLAVNMDELESACIGLQNFISSLVGTVYTNSY---------QXXXXXXXXXXXXXXXXXINPPRSRLHAFALFKELHSKIENCIYSAIDAKIDDMFDDNEYRQVNSHHSSTNNSLANSPSKKFNSISIDNNQMKPSDFITDVIAYLSITFESFTNLPARLAQTACLLSCKYIDKKL-KTFVNSE-ARISERFLHQLSTDIKSLQDFTRKIPVAGVSADTLILVFEDLRQLTALVILSDWDTFIKNYRTNQNPYDRVLTSSAISLLEKTRHSDTGFSALIKSLKKNKQDKRD--EEILKQLKEL 2857
            +F+ L+ EI+S SSGSIAN+IRKLR+ E ++    V   + E++  F+  LD      N +IEK C H YQ F D+ ++LL IQ ++S ++S   ++   L  +V      C  LS C + L  I++ +E LQ  LP+ +QY +  +SI+E R++ AL+TL  LE NQ+ RVR ++FS+ +  +IP MR +IK AS  ++ DFLE++RKHSV LG  AMK  A  +GM+          + G+      +S + N   G  +D P                 + KE+ +L  + +   D D        S+        +ED VDFGPVYRCLHIH++L +R EFE+ Y  QR++QC  +L LT+++Q S+R Y EF  G+ GFF ++DY+RH+     T  + YLDELWS T  R+ +F  +NSD     + L++LKD   LF +TM SLGF  AG  +    +++++ +LL  ++  KF+ I   +D+T I + ++ EM  ++ LYP  L+ ++D LPYP+ L +SWMVPRI + +RD+I  C +F  +++LS +ELED +N  TN LF   L   LV +++ SER L RLIQ   N++ELE+ C  L   + +L+ T   N               ++  +++  +     NPPRSRLH  +L K++ S +E+ IY  ++  ++      E+  + S++ ++   L  S     ++ +++   + P++ I D+  +LS TF++F N+P ++AQTAC+  CK I   L +  +N +   +SE  + Q+S D+   ++F R  PV GV    L L+F DLRQL  L    DW  FI +Y    NPYDRV  + AI LLE+ R ++     ++  L K  +D+R   +++L+QL+++
Sbjct:   10 DFTLLLGEIESGSSGSIANVIRKLREHEVAAYKAGVGGPTGELVASFISALDERANERNIEIEKMCAHHYQGFADATRDLLSIQNDSSTMQSDIQALDIKLEAAVDAYNSSCAALSNCKVTLEIIEQCIEALQLTLPILEQYSRVEQSISEGRFHNALRTLEDLERNQLDRVRSYAFSEVMSYRIPIMRAEIKNASLAQLTDFLEHIRKHSVRLGAIAMKESADISGMD-------SEELLGSIGGGSKESSKTNDLEGQTVDSPTGSGRSKQNSGDATAVVLEKELDELRLVAADCCDEDGGVTCSTTSSKCIPAHLRMEDLVDFGPVYRCLHIHTMLNERPEFERYYCAQRRKQCQLSLSLTMNQQTSLRKYAEFFGGICGFFFIDDYLRHTVPGSSTSFQTYLDELWSATTERLVEFARLNSDACESADELIRLKDYSTLFIRTMTSLGFPAAGLSEMIAWIQRKYHRLLAGQWREKFEIILSQDDFTPIKIANSDEMNKLVKLYPPGLTAELDALPYPRQLCYSWMVPRIYKTVRDYIDLCGRFCAHVDLSCSELEDTVNRVTNSLFIDCLNVVLVSSIRQSERILPRLIQFCTNLEELETVCGHLDAHLQTLIPTAAVNEVVDTSSRNLIPSRHTNQETDLAPNLITGANPPRSRLHGASLLKDIRSLVESLIYDHLNNCVE------EFIGMISYNQASTGELNGSSYPVASNGAVNEMSLNPNEHIVDMTTWLSTTFQAFANIPPKVAQTACISVCKCIAAALYRLLLNPQFCELSELSILQMSADLGQCENFVRTQPVPGVDRQMLWLIFADLRQLLDLFRRGDWAVFISSYGKPDNPYDRVSPTVAIRLLERARETEKKRGGILGGLFKGDRDRRKKVDDVLRQLRDI 893          
BLAST of Exocyst complex component vs. TrEMBL
Match: A0A4S2LF99 (Exocyst complex component OS=Opisthorchis felineus OX=147828 GN=CRM22_007547 PE=3 SV=1)

HSP 1 Score: 555.058 bits (1429), Expect = 1.147e-179
Identity = 318/878 (36.22%), Postives = 495/878 (56.38%), Query Frame = 2
Query:  299 NFSNLISEIKSNSSGSIANIIRKLRQLETSS----VNNDSSEILTKFMRHLDNEIELNNQDIEKFCNHFYQCFVDSIKELLKIQEEASELKSSFGSVQSSLMESVKKIKQDCNELSKCHLILANIDKAVENLQACLPVFDQYLKAAKSINEKRYYPALKTLNHLELNQMQRVRQFSFSDNLQNKIPGMREQIKAASKDEIKDFLENVRKHSVGLGMCAMKLMAHKTGMEVNFDSPTKRTMNGARMNKGDDSKRENPFVGMLDEPDSVNKEIQD-----------------LISLESYGNDN-----DDSSELELESTNVEDRVDFGPVYRCLHIHSVLGDRHEFEKCYRNQRKRQC--TLLLTLSKQESVRNYHEFLSGVVGFFVVEDYIRHS--QISMVTRNYLDELWSQTMLRVGDFVSVNSDNINDIESLLKLKDSCVLFGKTMRSLGFNVAGFKDFYEVLKKQHQKLLGNEYSNKFKDIFEGEDYTAITVQDASEMELVIDLYPYFLSPDIDILPYPKSLSFSWMVPRINQAIRDHIKKCRKFSDNLELSQTELEDQLNHTTNVLFSQTLKHFLVKAVKDSERELNRLIQLAVNMDELESACIGLQNFISSLVGTVYTNSY---------QXXXXXXXXXXXXXXXXXINPPRSRLHAFALFKELHSKIENCIYSAIDAKIDDMFDDNEYRQVNSHHSSTNNSLANSPSKKFNSISIDNNQMKPSDFITDVIAYLSITFESFTNLPARLAQTACLLSCKYIDKKL-KTFVNSE-ARISERFLHQLSTDIKSLQDFTRKIPVAGVSADTLILVFEDLRQLTALVILSDWDTFIKNYRTNQNPYDRVLTSSAISLLEKTRHSDTGFSALIKSLKKN 2809
            +F+ L+ EI+S SSGSIAN+IRKLR+ E ++    V   + E++  F+  LD      N +IEK C H YQ F D+ ++LL IQ ++S ++S   ++ + L  +V      C+ LS C + L  I++ +E LQ  LP+ +QY +  +SI+E R++ AL+TL  LE NQ+ RVR ++FS+ +  +IP MR +IK AS  ++ DFLE++RKHSV LG  AMK  A  +GM+      ++  +        + SK  +P    +D P    +  Q+                 L++ + Y  D        SS+       +ED VDFGPVYRCLHIH++L +R EFE+ Y  QR++QC  +L LT+++Q ++R Y EF  G+ GFF ++DY+RH+    S   + YLDELWS T  R+ +F  +NSD     + L++LKD   LF +TM SLGF  AG  +    +++++ +LL  ++  KF+ I   +D+T I + ++ EM  ++ LYP  L+ ++D LPYP+ L +SWMVPRI + +RD+I  C +F  +++LS +ELED +N  TN LF   L   LV +++ SER L RLIQ   N++ELE+ C  L   + +L+ T   N               ++  +++  +     NPPRSRLH  +L K++ S +E+ IY  ++  +++      Y Q     +ST     +S     N  +++   + P++ I D+  +LS TF++F N+P ++AQTAC+  CK I   L +  +N +   +SE  + Q+S D+   ++F R  PV GV    L L+F DLRQL  L    DW  FI +Y    NPYDRV  + AI LLE+ R ++     ++  L K 
Sbjct:   10 DFTLLLGEIESGSSGSIANVIRKLREHEVAAYKAGVGGPTGELVASFISALDERANERNIEIEKMCAHHYQGFADATRDLLSIQNDSSTMQSEIQALDAKLEAAVDAYNSSCSALSNCKVTLEIIEQCIEALQLTLPILEQYSRVEQSISEGRFHNALRTLEDLERNQLDRVRSYAFSEVMSYRIPIMRAEIKNASLAQLTDFLEHIRKHSVRLGAIAMKESADISGMD------SEELLGSIGGGSKESSKMNDPESQTVDSPTESGRSKQNSGDATAVVLEKELDELRLVAADCYDEDGAVTGSTTSSKCIPAHLRMEDLVDFGPVYRCLHIHTMLNERPEFERYYCAQRRKQCQLSLSLTMNQQTNLRKYAEFFGGICGFFFIDDYLRHTVPGSSASFQTYLDELWSATTERLVEFARLNSDACETADELIRLKDYSTLFIRTMTSLGFPAAGLSEMIAWIQRKYHRLLAGQWREKFEVILSQDDFTPIKIANSDEMNKLVKLYPPGLTAELDALPYPRQLCYSWMVPRIYKTVRDYIDLCGRFCAHVDLSCSELEDTVNRVTNSLFIDCLNVVLVSSIRQSERILPRLIQFCTNLEELETVCGHLDAHLQTLIPTAAVNEVVDSSSRNLIPSRHTNQETDLAPNLITGANPPRSRLHGASLLKDIRSLVESLIYDHLNNCVEEFIGMVSYNQ-----ASTGELNGSSHPVALNG-AVNEMSLNPNEHIVDMTTWLSTTFQAFANIPPKVAQTACISVCKCIAAALYRLLLNPQFCELSELSIMQMSADLGQCENFVRTQPVPGVDRQMLWLIFADLRQLLDLFRREDWAVFISSYGKPDNPYDRVSPTVAIRLLERARETEKKRGGILGGLFKG 875          
BLAST of Exocyst complex component vs. TrEMBL
Match: A0A1S8X9C2 (Exocyst complex component OS=Opisthorchis viverrini OX=6198 GN=X801_00804 PE=3 SV=1)

HSP 1 Score: 554.673 bits (1428), Expect = 2.132e-179
Identity = 317/878 (36.10%), Postives = 495/878 (56.38%), Query Frame = 2
Query:  299 NFSNLISEIKSNSSGSIANIIRKLRQLETSS----VNNDSSEILTKFMRHLDNEIELNNQDIEKFCNHFYQCFVDSIKELLKIQEEASELKSSFGSVQSSLMESVKKIKQDCNELSKCHLILANIDKAVENLQACLPVFDQYLKAAKSINEKRYYPALKTLNHLELNQMQRVRQFSFSDNLQNKIPGMREQIKAASKDEIKDFLENVRKHSVGLGMCAMKLMAHKTGMEVNFDSPTKRTMNGARMNKGDDSKRENPFVGMLDEPDSVNKEIQD-----------------LISLESYGNDND-----DSSELELESTNVEDRVDFGPVYRCLHIHSVLGDRHEFEKCYRNQRKRQC--TLLLTLSKQESVRNYHEFLSGVVGFFVVEDYIRHSQISMVT--RNYLDELWSQTMLRVGDFVSVNSDNINDIESLLKLKDSCVLFGKTMRSLGFNVAGFKDFYEVLKKQHQKLLGNEYSNKFKDIFEGEDYTAITVQDASEMELVIDLYPYFLSPDIDILPYPKSLSFSWMVPRINQAIRDHIKKCRKFSDNLELSQTELEDQLNHTTNVLFSQTLKHFLVKAVKDSERELNRLIQLAVNMDELESACIGLQNFISSLVGTVYTNSY---------QXXXXXXXXXXXXXXXXXINPPRSRLHAFALFKELHSKIENCIYSAIDAKIDDMFDDNEYRQVNSHHSSTNNSLANSPSKKFNSISIDNNQMKPSDFITDVIAYLSITFESFTNLPARLAQTACLLSCKYIDKKL-KTFVNSE-ARISERFLHQLSTDIKSLQDFTRKIPVAGVSADTLILVFEDLRQLTALVILSDWDTFIKNYRTNQNPYDRVLTSSAISLLEKTRHSDTGFSALIKSLKKN 2809
            +F+ L+ EI+S SSGSIAN+IRKLR+ E ++    V   + E++  F+  LD      N +IEK C H YQ F ++ ++LL IQ ++S ++S   ++ + L  +V      C+ LS C + L  I++ +E LQ  LP+ +QY +  +SI+E R++ AL+TL  LE NQ+ RVR ++FS+ +  +IP MR +IK AS  ++ DFLE++RKHSV LG  AMK  A  +GM+      ++  +        + SK  +P    LD      +  Q+                 L++ + Y  D        SS+       +ED VDFGPVYRCLHIH++L +R EFE+ Y  QR++QC  +L LT+++Q ++R Y EF  G+ GFF ++DY+RH+     T  + YLDELW  T  R+ +F  +NSD     + L++LKD   LF +TM SLGF  AG  +    +++++ +LL  ++  KF+ I   +D+T I + ++ EM  +++LYP  L+ ++D LPYP+ L +SWMVPRI + +RD+I  C +F  +++LS +ELED +N  TN LF   L   LV +++ SER L RLIQ   N++ELE+ C  L   + +L+ T   N               ++  +++  +     NPPRSRLH  +L K++ S +E+ IY  ++  +++      Y Q     +ST     +S     N  ++    +KP++ I D+  +LS TF++F N+P ++AQTAC+  CK I   L +  +N +   +SE  + Q+S D+   ++F R  PV GV    L L+F DLRQL  L    DW  FI +Y    NPYDRV ++ AI LLE+ R ++     ++  L K 
Sbjct:   10 DFTLLLGEIESGSSGSIANVIRKLREHEVAAYKAGVGGPTGELVASFISALDERANERNIEIEKMCAHHYQGFAEATRDLLSIQNDSSTMQSDIQALNTKLEAAVDAYNSSCSALSNCKVTLEIIEQCIEALQLTLPILEQYSRVEQSISEGRFHNALRTLEDLERNQLDRVRSYAFSEVMSYRIPIMRAEIKNASLAQLTDFLEHIRKHSVRLGAIAMKESADISGMD------SEELLGSIGGGSKESSKMNDPESQTLDSLTGSGRSKQNSGDAAAVVLEKELDELRLVAADCYDEDGTVTGSTTSSKCIPAHLRMEDLVDFGPVYRCLHIHTMLNERPEFERYYCAQRRKQCQLSLSLTMNQQTNLRKYAEFFGGICGFFFIDDYLRHTVPGSSTSFQTYLDELWGATTERLVEFARLNSDACESADELIRLKDYSTLFIRTMTSLGFPAAGLSEMIAWIQRKYHRLLAGQWREKFEVILSQDDFTPIKIANSDEMNKLVNLYPPGLTAELDALPYPRQLCYSWMVPRIYKTVRDYIDLCGRFCAHVDLSCSELEDTVNRVTNSLFIDCLNVVLVSSIRQSERMLPRLIQFCTNLEELETVCGHLDAHLQTLIPTAAVNEVVDSSSRNLIPSRHTNQETDLAPNLITGANPPRSRLHGASLLKDIRSLVESLIYDHLNNCVEEFIGMVSYNQ-----ASTGELNGSSYPVALNG-AVSETSLKPNEHIVDMTTWLSTTFQAFANIPPKVAQTACISVCKCIAAALYRLLLNPQFCELSELSIMQMSADLSQCENFVRTQPVPGVDRQMLWLIFADLRQLLDLFRREDWAVFISSYGKPDNPYDRVSSTVAIRLLERARETEKKRGGILGGLFKG 875          
BLAST of Exocyst complex component vs. TrEMBL
Match: A0A3Q0KP40 (Exocyst complex component OS=Schistosoma mansoni OX=6183 PE=3 SV=1)

HSP 1 Score: 554.288 bits (1427), Expect = 6.497e-179
Identity = 330/922 (35.79%), Postives = 532/922 (57.70%), Query Frame = 2
Query:  320 EIKSNSSGSIANIIRKLRQLETSS----VNNDSSEILTKFMRHLDNEIELNNQDIEKFCNHFYQCFVDSIKELLKIQEEASELKSSFGSVQSSLMESVKKIKQDCNELSKCHLILANIDKAVENLQACLPVFDQYLKAAKSINEKRYYPALKTLNHLELNQMQRVRQFSFSDNLQNKIPGMREQIKAASKDEIKDFLENVRKHSVGLGMCAMKLMAHKTGMEVNFDSPTKRTMNGARMNKGDDSKRENP------------FVGMLDEPDSVNKEIQDLISLES----YGNDNDDSSELEL------------ESTN-----VEDRVDFGPVYRCLHIHSVLGDRHEFEKCYRNQRKRQCTLLLTLSKQESV--RNYHEFLSGVVGFFVVEDYIRH--SQISMVTRNYLDELWSQTMLRVGDFVSVNSDNINDIESLLKLKDSCVLFGKTMRSLGFNVAGFKDFYEVLKKQHQKLLGNEYSNKFKDIFEGEDYTAITVQDASEMELVIDLYPYFLSPDIDILPYPKSLSFSWMVPRINQAIRDHIKKCRKFSDNLELSQTELEDQLNHTTNVLFSQTLKHFLVKAVKDSERELNRLIQLAVNMDELESACIGLQNFI--------SSLV-------GTVYTNSYQXXXXXXXXXXXXXXXXXINPPRSRLHAFALFKELHSKIENCIYSAIDAKID--------DMFDDNEYRQVNSHHSSTNNSLANSPSKKFNSISIDNNQMKPSDFITDVIAYLSITFESFTNLPARLAQTACLLSCKYIDKKL-KTFVNSEAR-ISERFLHQLSTDIKSLQDFTRKIPVAGVSADTLILVFEDLRQLTALVILSDWDTFIKNYRTN-------QNPYDRVLTSSAISLLEKTRHSDTGFSALIKSLKKNKQDKRD--EEILKQLKELH 2860
            EI+S SSGS+AN+IRKLR+ E ++    +   + E+L  F+  LD     +N +IEK C++ YQ FVDS +ELL IQ+ A +L++   ++   L  +V K  + C++L+ C L L ++++ +E +Q  LP+ +QY +  +SI + RYY ALK L  LE +Q+  +R F+FS+ + ++IP  R +IK AS DE+ DFLE +RK+S+ LG  AM+  A  +G++      T   +NG +  + D SK+ N              V +    DS++ E++ L  + +      N NDD  E E+            +S N     VED VDFGPVYRCLHIHSVL +R EFE+ Y  QR++QC L+L+LS  + V  RNY EF SG+ GFFVV+D+IRH  S  S+  + YLDELW  T+ R+ DFV +N+ + +    L+KLKD  ++F +TM++LGF + G  +   ++++ + +LL +++ +KF+ I   ++Y  I + +  ++   +++YP   + +   LP+PK L FSW+VP+I + +R++I  C +F +N++L+ TELED +N  TN LFSQ L   L   V+ S R+L RL+Q  +N+DELE+ C  L N++        SS+        G +  N  +  + +++  +        NPPRSRL   +L K++   +E+ I + +   +         D  DDN   Q+N++ +  + ++       + +    N ++KP++ I  + ++L   F+SF+NLP ++AQTAC+  CK+I + L      S+ R +SE  L QLS D+   + F R  PV G+   TL L+F DLRQL  L    DW+++I  +R N        + YDRV  S AI LLE+ R SD   +  +++++K ++ ++   E+I++QL+EL+
Sbjct:   17 EIESGSSGSLANVIRKLRESELAAFKARIGGPTGELLANFIASLDLRASEHNAEIEKTCSYHYQSFVDSTRELLDIQQNAEKLENDLQALNVELEVTVNKFSESCDKLAACKLTLDHVNQCIEAIQISLPILEQYSRIEQSIADGRYYHALKNLEDLEHSQLDLIRPFAFSEIIIHRIPKTRTRIKNASLDELTDFLEYIRKNSIVLGAFAMREAAQLSGIDSEALCDT-LVVNGYKETQ-DVSKKSNKESQQVASKSTVHKVSVNTNTDSLDNELEMLTQIVTNTNRSCNTNDDHGETEITIRTQINVNDNDKSCNRTYSKVEDLVDFGPVYRCLHIHSVLNERAEFERHYCTQRRKQCQLILSLSPNQQVEMRNYGEFFSGICGFFVVDDFIRHTLSGSSVFYQTYLDELWVHTVNRLIDFVHINAKSCDSPNDLIKLKDYLIIFERTMQNLGFPITGLNETIGIVQRYYHRLLASQWKSKFETIIAEDNYETIKISNPEQLTKFLEMYPPGDTVEFSELPFPKQLCFSWIVPKIYRTVREYINLCYRFCENMDLAYTELEDTINRATNFLFSQCLNTVLTSGVRSSLRQLPRLMQFCINLDELETVCGHLDNYLQYTLLDEASSITSGRLKDFGLIRDNQREDSDMTASVTLNSGA----NPPRSRLQGASLLKDIRVLVEDQICNHLKDSVTKFINLSNYDDIDDNNSGQINNNTNKNDQTVDGRNGVSYTA----NTKIKPTENIVHLTSWLKSVFDSFSNLPPKIAQTACMSVCKHIARLLYDVLFGSQVRSLSETGLQQLSIDLSLCESFARSQPVPGLDRTTLWLIFADLRQLLDLYHKDDWNSYIA-FRKNVIGSGKYGSAYDRVPPSVAIKLLERLRDSDKKRTGFLQAMRKEERGRKKKLEDIIRQLRELN 927          
BLAST of Exocyst complex component vs. TrEMBL
Match: A0A0R3U6G1 (Exocyst complex component OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS2360 PE=3 SV=2)

HSP 1 Score: 551.206 bits (1419), Expect = 6.591e-178
Identity = 331/916 (36.14%), Postives = 516/916 (56.33%), Query Frame = 2
Query:  299 NFSNLISEIKSNSSGSIANIIRKLRQLETSSV----NNDSSEILTKFMRHLDNEIELNNQDIEKFCNHFYQCFVDSIKELLKIQEEASELKSSFGSVQSSLMESVKKIKQDCNELSKCHLILANIDKAVENLQACLPVFDQYLKAAKSINEKRYYPALKTLNHLELNQMQRVRQFSFSDNLQNKIPGMREQIKAASKDEIKDFLENVRKHSVGLGMCAMKLMAHKTGME----VNFDSPTKRT-MNGARMNKGDDSKRENPFVGMLDEPDSVNKEIQDLISL--------------------ESYGNDNDDSSELELESTNVEDRVDFGPVYRCLHIHSVLGDRHEFEKCYRNQRKRQCTLL--LTLSKQESVRNYHEFLSGVVGFFVVEDYIRHSQISMVT--RNYLDELWSQTMLRVGDFVSVNSDNINDIESLLKLKDSCVLFGKTMRSLGFNVAGFKDFYEVLKKQHQKLLGNEYSNKFKDIFEGEDYTAITVQDASEMELVIDLYPYFLSPDIDILPYPKSLSFSWMVPRINQAIRDHIKKCRKF--SDNLELSQTELEDQLNHTTNVLFSQTLKHFLVKAVKDSERELNRLIQLAVNMDELESACIGLQNFI-----------SSLVGTVYTNSYQX--------XXXXXXXXXXXXXXXXINPPRSRLHAFALFKELHSKIENCIYSAIDAKIDDMFDDNEYRQV---NSHHSSTNNSLANSPSKKFNSISIDNNQMKPSDFITDVIAYLSITFESFTNLPARLAQTACLLSCKYIDKKLKTFVNSE--ARISERFLHQLSTDIKSLQDFTRKIPVAGVSADTLILVFEDLRQLTALVILSDWDTFIKNY-RTNQNPYDRVLTSSAISLLEKTRHSDTGFSALIKSLKKNKQDKRD--EEILKQLKELH 2860
            +FS L+ E++S SSGS AN+IRKLR+ E ++        + E++  F+  LD  +     DIEK C+H Y+ FV+S++EL+ +QE+A +L+ +   ++S++  SV+++      L+  H  L  ID+ +  L+  LPV DQY K  KSI + RYY ALKTL HLE  Q++ ++ +SFS  L  +IP +R +IKAAS  ++ DFLE +RKHS  LG  AM+  A KTGM     V+  S  +R  +   R     D   + P + +   P    K I    S                     ES G ++ D+        N+E  ++FGP+YRCLHIHSV G+R EFE+ Y  QR++QC L+  L+ S+Q S+RNY EF S VVGFF+V+DY+RH+     +  ++YL +LW+  + R+   VS N+ +      LL LK  CVLF +TM +LGFN  G  +  E ++KQ  +LL   + ++F +I + ++YTAIT++ ASEM  ++  YPY  +P+    P+P++L+FS MVP +  AIRD+I    +F  + ++ L+ TELED LN  TNVLF+  L   L K ++ +E  L RLIQL +N+ ELESAC  LQ+++            SLV ++      +         + S    ++      + P RS L+  +LF++  ++ E  IY+ +++++D+      Y  +       +++ + L ++P             +KPS+++TD++A+L  TF +FT+LP ++A TAC   CK+I K L+  +       +SE  L  +  D+     F R  PV G+    L+L+F +LRQL  LV   DW  +  NY +   NPYDRV  ++A+SLLE  R ++   S+ I S+KK +++KR   E+++KQLK+L 
Sbjct:   10 DFSPLLDELESGSSGSCANVIRKLREYEVAAYEAGQGGPTGELIASFIARLDERVADRELDIEKTCSHNYESFVESVQELVLVQEKAEQLQRNLREIRSNIETSVQRLNDSSEALATNHATLNRIDQCIAALRISLPVLDQYEKVEKSIADGRYYHALKTLEHLEHYQLKSIQSYSFSQLLSKRIPELRSEIKAASLAQLTDFLEEIRKHSTRLGAIAMRQTAEKTGMSEDAIVDAGSSEQRNEITTFRERTSSDC--DEPDIAVPPPPPIRRKHIVPESSYTNALEAELEELALAAKRFENESGGGNSPDT------KNNIEALINFGPIYRCLHIHSVSGERSEFEQYYFTQRRKQCQLILSLSPSQQSSLRNYSEFFSRVVGFFLVDDYLRHTMPGAASYYQSYLSDLWTTVVPRLTQLVSRNASDCKTTSELLSLKHYCVLFERTMANLGFNTTGLNEMLEAIRKQFSQLLIARWRDQFNEILKTDNYTAITLEKASEMSPLLASYPYCQTPEFTSQPFPRTLAFSPMVPSVYAAIRDYIDASAQFIVAPSVGLAWTELEDALNRATNVLFTDCLSDLLDKTIQAAEANLLRLIQLTINLSELESACEHLQSYLHEKARPKFFSSPSLVTSLNAKCQSVNIDEDGDCEDGSDVFALMAAQPDDVQPSRSHLYGVSLFRDCRARTETQIYTNLNSRVDEFCSLASYDGIFGGPGEGTASLDYLVDTPPAL--------TAIKPSEYMTDMMAWLGSTFAAFTHLPPKVAHTACFSVCKHIVKLLQRILMGPDVKMVSEPALTHILVDLAECDKFARSDPVPGIDKSILLLIFHELRQLLELVRKDDWKVYFANYGKPTGNPYDRVTPAAAVSLLECIREAEKKKSSFIGSMKKVEREKRKRLEDLIKQLKDLQ 909          
BLAST of Exocyst complex component vs. Ensembl Cavefish
Match: exoc6 (exocyst complex component 6 [Source:NCBI gene;Acc:103043746])

HSP 1 Score: 424.476 bits (1090), Expect = 7.139e-134
Identity = 272/863 (31.52%), Postives = 438/863 (50.75%), Query Frame = 2
Query:  311 LISEIKSNSSGSIANIIRKLRQLETSSVNNDSSEILTKFMRHLDNEIELNNQDIEKFCNHFYQCFVDSIKELLKIQEEASELKSSFGSVQSSLMESVKKIKQDCNELSKCHLILANIDKAVENLQACLPVFDQYLKAAKSINEKRYYPALKTLNHLELNQMQRVRQFSFSDNLQNKIPGMREQIKAASKDEIKDFLENVRKHSVGLGMCAMK-LMAHKTGMEVNFDSPTKRTMNGARMNKGDDSKRENPFVGMLDEPDSVNKEIQDLISLESYGNDNDDSSELELESTNVEDRVDFGPVYRCLHIHSVLGDRHEFEKCYRNQRKRQCTLLLTLSK--QESVRNYHEFLSGVVGFFVVEDYIRHSQISMVTRNYLDELWSQTMLRVGDFVSVNSDNINDIESLLKLKDSCVLFGKTMRSLGFNVAGFKDFYEVLKKQHQKLLGNEYSNKFKDIFEGEDYTAITVQDASEMELVIDLYPYFLSPDIDILPYPKSLSFSWMVPRINQAIRDHIKKCRKFSDNLELSQTELEDQLNHTTNVLFSQTLKHFLVKAVKDSERELNRLIQLAVNMDELESACIGLQNFISSLVG----TVYTNSYQXXXXXXXXXXXXXXXXXINPPRSRLHAFALFKELHSKIENCIYSAIDAKIDDMFDDNEYRQVNSHHSSTNNSLANSPSKKFNSISIDNNQMKPSDFITDVIAYLSITFESFTNLPARLAQTACLLSCKYIDKKL-KTFVNSEAR-ISERFLHQLSTDIKSLQDFTRKIPVAGVSADTLILVFEDLRQLTALVILSDWDTFIKNYRTNQNPYDRVLTSSAISLLEKTRHSDTGFSA---LIKSLKKNKQDKRD--EEILKQLKEL 2857
            ++ EI+S  +  +   +R        SV +D      +FM  LD  I  ++++IEK CN  +Q FVD+I ELLK++ +A +L          L ++ +++     E+ +C +   N+   VE LQ C+PV + Y K  + +  KRYY ALKT+  LE   + RV Q+ F   +   +P +RE+IK  S  ++KDFLE++RKHS  +G  AM+    H+T +       +           G  + + N  V                      G D  D  E + E    +D VDF PVYRCLHI++VLGDR  FE  YR QRK+Q  L+L       E+V  Y ++ + +VGFFVVED+I H+   +VTR + DELW+  + ++   +  +S   ND + +L+LK+  V+F  T++  GF+V    D    ++ Q+ + L  +++  F++IFE ++Y+ I V+   E + VI  +P F   +I+  P+PK L  S  VP+I   +++ I    KFS++L  S TE++D L  +TN+L ++TL   L   +K     L  L+Q+ +N   LE AC  L++FI+++      TV+T                          SRL+  + FK+     E  IY+ ++ KID+     +Y                    ++N    D    + S ++ D+I +L  TF+ FT+LP ++AQTAC+ +CK++   L +  +++E + IS   + Q + D+   + F    PV G   DTL L F DLRQL  L ++ DW T++ +Y    + Y RV  S+A++LLEK        S    +    +KN +DK+   E ++KQL+ L
Sbjct:   45 ILQEIESTDTACVGPTLR--------SVYDDQPNAHKRFMEKLDARIRNHDREIEKMCNFHHQGFVDAITELLKVRADAEKLMGQVTDTNRRLQDAGREVTAQTEEVIRCRIQQRNMATTVEKLQLCIPVLEMYSKLKEQLESKRYYAALKTMEQLENIYIPRVSQYRFCQIMAETLPKLREEIKEISMSDLKDFLESIRKHSDKIGETAMRQAQQHRTFISAVQKQASLGCAKPLYSLNGRTTLQHNGLV----------------------GEDAADEEEGDDEVLTAQDLVDFSPVYRCLHIYTVLGDRETFENYYRKQRKKQARLVLQPQSNMHETVEGYRKYFNQIVGFFVVEDHILHATQGLVTRAFTDELWNMALSKIIAVLRTHSSYCNDPDLVLELKNLIVIFADTLQGYGFSVNRLFDLLFEIRDQYNETLLKKWALVFREIFEEDNYSPIPVETEEEYKSVISRFP-FHDAEIEKQPFPKKLPMSQSVPQIYIQVKEFIYASLKFSESLHRSSTEIDDMLRKSTNLLLTRTLSGCLQNLIKKPHIGLTELVQIIINTTHLEQACKYLEDFITNITNVSPETVHT--------------------------SRLYGLSTFKDARHAAEGEIYTKLNQKIDEFIQLADY--------------------EWNMGESDG---RASGYLMDLINFLRSTFQVFTHLPGKVAQTACMSACKHLATSLMQMLLDTELKQISMGAIQQFNLDVIQCELFASSEPVPGFQGDTLQLAFIDLRQLLDLFMVWDWSTYLADYGQPTSKYLRVNPSTALALLEKVNRGMKDTSKKNNIFSQFRKNDRDKQKLIETVVKQLRSL 827          
BLAST of Exocyst complex component vs. Ensembl Cavefish
Match: exoc6 (exocyst complex component 6 [Source:NCBI gene;Acc:103043746])

HSP 1 Score: 417.927 bits (1073), Expect = 2.717e-131
Identity = 271/870 (31.15%), Postives = 440/870 (50.57%), Query Frame = 2
Query:  311 LISEIKSNSSGSIANIIRKLRQLETSSVNNDSSEILTKFMRHLDNEIELNNQDIEKFCNHFYQCFVDSIKELLKIQEEASELKSSFGSVQSSLMESVKKIKQDCNELSKCHLILANIDKAVENLQACLPVFDQYLKAAKSINEKRYYPALKTLNHLELNQMQRVRQFSFSDNLQNKIPGMREQIKAASKDEIKDFLENVRKHSVGLGMCAMK-LMAHKTGMEVNFDSPTKRTMNGARMNKGDDSKRENPFVGMLDEPDSVNKEIQDLISLESYGNDNDDSSELELESTNVEDRVDFGPVYRCLHIHSVLGDRHEFEKCYRNQRKRQCTLLLTLSK--QESVRNYHEFLSGVVGFFVVEDYIRHSQISMVTRNYLDELWSQTMLRVGDFVSVNSDNINDIESLLKLKDSCVLFGKTMRSLGFNVAGFKDFYEVLKKQHQKLLGNEYSNKFKDIFEGEDYTAITVQDASEMELVIDLYPYFLSPDIDILPYPKSLSFSWMVPRINQAIRDHIKKCRKFSDNLELSQTELEDQLNHTTNVLFSQTLKHFLVKAVKDSERELNRLIQLAVNMDELESACIGLQNFISSLVG----TVYTNSYQXXXXXXXXXXXXXXXXXINPPRSRLHAFALFKELHSKIENCIYSAIDAKIDDMFDDNEYRQVNSHHSSTNNSLANSPSKKFNSISIDNNQMKPSDFITDVIAYLSITFESFTNLP----------ARLAQTACLLSCKYIDKKL-KTFVNSEAR-ISERFLHQLSTDIKSLQDFTRKIPVAGVSADTLILVFEDLRQLTALVILSDWDTFIKNYRTNQNPYDRVLTSSAISLLEKTRHSDTGFSALIKSLKKNKQDKRD--EEILKQLKEL 2857
            ++ EI+S  +  +   +R        SV +D      +FM  LD  I  ++++IEK CN  +Q FVD+I ELLK++ +A +L          L ++ +++     E+ +C +   N+   VE LQ C+PV + Y K  + +  KRYY ALKT+  LE   + RV Q+ F   +   +P +RE+IK  S  ++KDFLE++RKHS  +G  AM+    H+T +       +           G  + + N  V                      G D  D  E + E    +D VDF PVYRCLHI++VLGDR  FE  YR QRK+Q  L+L       E+V  Y ++ + +VGFFVVED+I H+   +VTR + DELW+  + ++   +  +S   ND + +L+LK+  V+F  T++  GF+V    D    ++ Q+ + L  +++  F++IFE ++Y+ I V+   E + VI  +P F   +I+  P+PK L  S  VP+I   +++ I    KFS++L  S TE++D L  +TN+L ++TL   L   +K     L  L+Q+ +N   LE AC  L++FI+++      TV+T                          SRL+  + FK+     E  IY+ ++ KID+     +Y                    ++N    D    + S ++ D+I +L  TF+ FT+LP           ++AQTAC+ +CK++   L +  +++E + IS   + Q + D+   + F    PV G   DTL L F DLRQL  L ++ DW T++ +Y    + Y RV  S+A++LLEK + +    + +    +KN +DK+   E ++KQL+ L
Sbjct:   45 ILQEIESTDTACVGPTLR--------SVYDDQPNAHKRFMEKLDARIRNHDREIEKMCNFHHQGFVDAITELLKVRADAEKLMGQVTDTNRRLQDAGREVTAQTEEVIRCRIQQRNMATTVEKLQLCIPVLEMYSKLKEQLESKRYYAALKTMEQLENIYIPRVSQYRFCQIMAETLPKLREEIKEISMSDLKDFLESIRKHSDKIGETAMRQAQQHRTFISAVQKQASLGCAKPLYSLNGRTTLQHNGLV----------------------GEDAADEEEGDDEVLTAQDLVDFSPVYRCLHIYTVLGDRETFENYYRKQRKKQARLVLQPQSNMHETVEGYRKYFNQIVGFFVVEDHILHATQGLVTRAFTDELWNMALSKIIAVLRTHSSYCNDPDLVLELKNLIVIFADTLQGYGFSVNRLFDLLFEIRDQYNETLLKKWALVFREIFEEDNYSPIPVETEEEYKSVISRFP-FHDAEIEKQPFPKKLPMSQSVPQIYIQVKEFIYASLKFSESLHRSSTEIDDMLRKSTNLLLTRTLSGCLQNLIKKPHIGLTELVQIIINTTHLEQACKYLEDFITNITNVSPETVHT--------------------------SRLYGLSTFKDARHAAEGEIYTKLNQKIDEFIQLADY--------------------EWNMGESDG---RASGYLMDLINFLRSTFQVFTHLPNNNNDHAAMSGKVAQTACMSACKHLATSLMQMLLDTELKQISMGAIQQFNLDVIQCELFASSEPVPGFQGDTLQLAFIDLRQLLDLFMVWDWSTYLADYGQPTSKYLRVNPSTALALLEKMKDTSKK-NNIFSQFRKNDRDKQKLIETVVKQLRSL 833          
BLAST of Exocyst complex component vs. Ensembl Cavefish
Match: exoc6 (exocyst complex component 6 [Source:NCBI gene;Acc:103043746])

HSP 1 Score: 416.387 bits (1069), Expect = 1.215e-130
Identity = 272/873 (31.16%), Postives = 438/873 (50.17%), Query Frame = 2
Query:  311 LISEIKSNSSGSIANIIRKLRQLETSSVNNDSSEILTKFMRHLDNEIELNNQDIEKFCNHFYQCFVDSIKELLKIQEEASELKSSFGSVQSSLMESVKKIKQDCNELSKCHLILANIDKAVENLQACLPVFDQYLKAAKSINEKRYYPALKTLNHLELNQMQRVRQFSFSDNLQNKIPGMREQIKAASKDEIKDFLENVRKHSVGLGMCAMK-LMAHKTGMEVNFDSPTKRTMNGARMNKGDDSKRENPFVGMLDEPDSVNKEIQDLISLESYGNDNDDSSELELESTNVEDRVDFGPVYRCLHIHSVLGDRHEFEKCYRNQRKRQCTLLLTLSK--QESVRNYHEFLSGVVGFFVVEDYIRHSQISMVTRNYLDELWSQTMLRVGDFVSVNSDNINDIESLLKLKDSCVLFGKTMRSLGFNVAGFKDFYEVLKKQHQKLLGNEYSNKFKDIFEGEDYTAITVQDASEMELVIDLYPYFLSPDIDILPYPKSLSFSWMVPRINQAIRDHIKKCRKFSDNLELSQTELEDQLNHTTNVLFSQTLKHFLVKAVKDSERELNRLIQLAVNMDELESACIGLQNFISSLVG----TVYTNSYQXXXXXXXXXXXXXXXXXINPPRSRLHAFALFKELHSKIENCIYSAIDAKIDDMFDDNEYRQVNSHHSSTNNSLANSPSKKFNSISIDNNQMKPSDFITDVIAYLSITFESFTNLP----------ARLAQTACLLSCKYIDKKL-KTFVNSEAR-ISERFLHQLSTDIKSLQDFTRKIPVAGVSADTLILVFEDLRQLTALVILSDWDTFIKNYRTNQNPYDRVLTSSAISLLEKTRHSDTGFSA---LIKSLKKNKQDKRD--EEILKQLKEL 2857
            ++ EI+S  +  +   +R        SV +D      +FM  LD  I  ++++IEK CN  +Q FVD+I ELLK++ +A +L          L ++ +++     E+ +C +   N+   VE LQ C+PV + Y K  + +  KRYY ALKT+  LE   + RV Q+ F   +   +P +RE+IK  S  ++KDFLE++RKHS  +G  AM+    H+T +       +           G  + + N  V                      G D  D  E + E    +D VDF PVYRCLHI++VLGDR  FE  YR QRK+Q  L+L       E+V  Y ++ + +VGFFVVED+I H+   +VTR + DELW+  + ++   +  +S   ND + +L+LK+  V+F  T++  GF+V    D    ++ Q+ + L  +++  F++IFE ++Y+ I V+   E + VI  +P F   +I+  P+PK L  S  VP+I   +++ I    KFS++L  S TE++D L  +TN+L ++TL   L   +K     L  L+Q+ +N   LE AC  L++FI+++      TV+T                          SRL+  + FK+     E  IY+ ++ KID+     +Y                    ++N    D    + S ++ D+I +L  TF+ FT+LP           ++AQTAC+ +CK++   L +  +++E + IS   + Q + D+   + F    PV G   DTL L F DLRQL  L ++ DW T++ +Y    + Y RV  S+A++LLEK        S    +    +KN +DK+   E ++KQL+ L
Sbjct:   45 ILQEIESTDTACVGPTLR--------SVYDDQPNAHKRFMEKLDARIRNHDREIEKMCNFHHQGFVDAITELLKVRADAEKLMGQVTDTNRRLQDAGREVTAQTEEVIRCRIQQRNMATTVEKLQLCIPVLEMYSKLKEQLESKRYYAALKTMEQLENIYIPRVSQYRFCQIMAETLPKLREEIKEISMSDLKDFLESIRKHSDKIGETAMRQAQQHRTFISAVQKQASLGCAKPLYSLNGRTTLQHNGLV----------------------GEDAADEEEGDDEVLTAQDLVDFSPVYRCLHIYTVLGDRETFENYYRKQRKKQARLVLQPQSNMHETVEGYRKYFNQIVGFFVVEDHILHATQGLVTRAFTDELWNMALSKIIAVLRTHSSYCNDPDLVLELKNLIVIFADTLQGYGFSVNRLFDLLFEIRDQYNETLLKKWALVFREIFEEDNYSPIPVETEEEYKSVISRFP-FHDAEIEKQPFPKKLPMSQSVPQIYIQVKEFIYASLKFSESLHRSSTEIDDMLRKSTNLLLTRTLSGCLQNLIKKPHIGLTELVQIIINTTHLEQACKYLEDFITNITNVSPETVHT--------------------------SRLYGLSTFKDARHAAEGEIYTKLNQKIDEFIQLADY--------------------EWNMGESDG---RASGYLMDLINFLRSTFQVFTHLPNNNNDHAAMSGKVAQTACMSACKHLATSLMQMLLDTELKQISMGAIQQFNLDVIQCELFASSEPVPGFQGDTLQLAFIDLRQLLDLFMVWDWSTYLADYGQPTSKYLRVNPSTALALLEKVNRGMKDTSKKNNIFSQFRKNDRDKQKLIETVVKQLRSL 837          
BLAST of Exocyst complex component vs. Ensembl Cavefish
Match: exoc6 (exocyst complex component 6 [Source:NCBI gene;Acc:103043746])

HSP 1 Score: 412.149 bits (1058), Expect = 1.782e-129
Identity = 268/860 (31.16%), Postives = 439/860 (51.05%), Query Frame = 2
Query:  311 LISEIKSNSSGSIANIIRKLRQLETSSVNNDSSEILTKFMRHLDNEIELNNQDIEKFCNHFYQCFVDSIKELLKIQEEASELKSSFGSVQSSLMESVKKIKQDCNELSKCHLILANIDKAVENLQACLPVFDQYLKAAKSINEKRYYPALKTLNHLELNQMQRVRQFSFSDNLQNKIPGMREQIKAASKDEIKDFLENVRKHSVGLGMCAMK-LMAHKTGMEVNFDSPTKRTMNGARMNKGDDSKRENPFVGMLDEPDSVNKEIQDLISLESYGNDNDDSSELELESTNVEDRVDFGPVYRCLHIHSVLGDRHEFEKCYRNQRKRQCTLLLTLSK--QESVRNYHEFLSGVVGFFVVEDYIRHSQISMVTRNYLDELWSQTMLRVGDFVSVNSDNINDIESLLKLKDSCVLFGKTMRSLGFNVAGFKDFYEVLKKQHQKLLGNEYSNKFKDIFEGEDYTAITVQDASEMELVIDLYPYFLSPDIDILPYPKSLSFSWMVPRINQAIRDHIKKCRKFSDNLELSQTELEDQLNHTTNVLFSQTLKHFLVKAVKDSERELNRLIQLAVNMDELESACIGLQNFISSLVG----TVYTNSYQXXXXXXXXXXXXXXXXXINPPRSRLHAFALFKELHSKIENCIYSAIDAKIDDMFDDNEYRQVNSHHSSTNNSLANSPSKKFNSISIDNNQMKPSDFITDVIAYLSITFESFTNLPARLAQTACLLSCKYIDKKL-KTFVNSEAR-ISERFLHQLSTDIKSLQDFTRKIPVAGVSADTLILVFEDLRQLTALVILSDWDTFIKNYRTNQNPYDRVLTSSAISLLEKTRHSDTGFSALIKSLKKNKQDKRD--EEILKQLKEL 2857
            ++ EI+S  +  +   +R        SV +D      +FM  LD  I  ++++IEK CN  +Q FVD+I ELLK++ +A +L          L ++ +++     E+ +C +   N+   VE LQ C+P   + +K ++  +  RYY ALKT+  LE   + RV Q+ F   +   +P +RE+IK  S  ++KDFLE++RKHS  +G  AM+    H+T +       +           G  + + N  V                      G D  D  E + E    +D VDF PVYRCLHI++VLGDR  FE  YR QRK+Q  L+L       E+V  Y ++ + +VGFFVVED+I H+   +VTR + DELW+  + ++   +  +S   ND + +L+LK+  V+F  T++  GF+V    D    ++ Q+ + L  +++  F++IFE ++Y+ I V+   E + VI  +P F   +I+  P+PK L  S  VP+I   +++ I    KFS++L  S TE++D L  +TN+L ++TL   L   +K     L  L+Q+ +N   LE AC  L++FI+++      TV+T                          SRL+  + FK+     E  IY+ ++ KID+     +Y                    ++N    D    + S ++ D+I +L  TF+ FT+LP ++AQTAC+ +CK++   L +  +++E + IS   + Q + D+   + F    PV G   DTL L F DLRQL  L ++ DW T++ +Y    + Y RV  S+A++LLEK + +    + +    +KN +DK+   E ++KQL+ L
Sbjct:   16 ILQEIESTDTACVGPTLR--------SVYDDQPNAHKRFMEKLDARIRNHDREIEKMCNFHHQGFVDAITELLKVRADAEKLMGQVTDTNRRLQDAGREVTAQTEEVIRCRIQQRNMATTVEKLQLCIPGKPRKVKVSEG-SFCRYYAALKTMEQLENIYIPRVSQYRFCQIMAETLPKLREEIKEISMSDLKDFLESIRKHSDKIGETAMRQAQQHRTFISAVQKQASLGCAKPLYSLNGRTTLQHNGLV----------------------GEDAADEEEGDDEVLTAQDLVDFSPVYRCLHIYTVLGDRETFENYYRKQRKKQARLVLQPQSNMHETVEGYRKYFNQIVGFFVVEDHILHATQGLVTRAFTDELWNMALSKIIAVLRTHSSYCNDPDLVLELKNLIVIFADTLQGYGFSVNRLFDLLFEIRDQYNETLLKKWALVFREIFEEDNYSPIPVETEEEYKSVISRFP-FHDAEIEKQPFPKKLPMSQSVPQIYIQVKEFIYASLKFSESLHRSSTEIDDMLRKSTNLLLTRTLSGCLQNLIKKPHIGLTELVQIIINTTHLEQACKYLEDFITNITNVSPETVHT--------------------------SRLYGLSTFKDARHAAEGEIYTKLNQKIDEFIQLADY--------------------EWNMGESDG---RASGYLMDLINFLRSTFQVFTHLPGKVAQTACMSACKHLATSLMQMLLDTELKQISMGAIQQFNLDVIQCELFASSEPVPGFQGDTLQLAFIDLRQLLDLFMVWDWSTYLADYGQPTSKYLRVNPSTALALLEKMKDTSKK-NNIFSQFRKNDRDKQKLIETVVKQLRSL 793          
BLAST of Exocyst complex component vs. Ensembl Cavefish
Match: exoc6b (exocyst complex component 6B [Source:NCBI gene;Acc:103032136])

HSP 1 Score: 409.453 bits (1051), Expect = 1.657e-128
Identity = 270/872 (30.96%), Postives = 435/872 (49.89%), Query Frame = 2
Query:  311 LISEIKSNSSGSIANIIRKLRQLETSSVNNDSSEILTKFMRHLDNEIELNNQDIEKFCNHFYQCFVDSIKELLKIQEEASELKSSFGSVQSSLMESVKKIKQDCNELSKCHLILANIDKAVENLQACLPVFDQYLKAAKSINEKRYYPALKTLNHLELNQMQRVRQFSFSDNLQNKIPGMREQIKAASKDEIKDFLENVRKHSVGLGMCAMKLMAHKTGMEVNFDSPTKRTMNGARMNKGDDSKRENPFVGMLDEPDSVNKEIQDLISLESYG---NDNDDSSELELEST------NVEDRVDFGPVYRCLHIHSVLGDRHEFEKCYRNQRKRQCTLLLTL--SKQESVRNYHEFLSGVVGFFVVEDYIRHSQISMVTRNYLDELWSQTMLRVGDFVSVNSDNINDIESLLKLKDSCVLFGKTMRSLGFNVAGFKDFYEVLKKQHQKLLGNEYSNKFKDIFEGEDYTAITVQDASEMELVIDLYPYFLSPDIDILPYPKSLSFSWMVPRINQAIRDHIKKCRKFSDNLELSQTELEDQLNHTTNVLFSQTLKHFLVKAVKDSERELNRLIQLAVNMDELESACIGLQNFISSLVGTVYTNSYQXXXXXXXXXXXXXXXXXINPP----RSRLHAFALFKELHSKIENCIYSAIDAKIDDMFDDNEYRQVNSHHSSTNNSLANSPSKKFNSISIDNNQMKPSDFITDVIAYLSITFESFTNLPARLAQTACLLSCKYIDKKLKTFVNSEA---RISERFLHQLSTDIKSLQDFTRKIPVAGVSADTLILVFEDLRQLTALVILSDWDTFIKNYRTNQNPYDRVLTSSAISLLEKTRHSDTGFSA---LIKSLKKNKQDKRD--EEILKQLKEL 2857
            ++ EI+S  +  I   +R        SV +     L  FM  L+  I  ++++IEK CNH +Q FVDSI ELLK++ EA +LK         L    K++ +  +EL +C L   NI   ++ L  CLPV + Y +  + +  KRYYPAL TL  LE + + R   + F   +   IP +R  I+  S  ++KDFLE++RKHS  +G  AMK    ++  + +  +  +RT +G R+                       +E+     +ES G   N   DS  L++E           D VDF PVYRCLHI++VLG R  FE  YR QR++Q  L+L    +  E++  Y  + + +VGFFVVED+I H+   +V R Y++ELW   + +    +  +S    D + +L LK+  VLF  T++  GF V    D    ++ Q+ ++L  +++  F+ I + ++Y+ I V    E   +   +P F  P+++ + +PK L FS  VP++   +++ I  C K+S++L LS TE++D +  +TN+L ++TL H L  A+K     L  L+Q+ +N   LE +C  L+ FIS++                             PP     ++L+  + FK+     E  IY+ ++ KID      +Y  + +                           + SD+++D+IA+L  TF  FT+LP ++AQTAC+ +CK++   L   +  EA   ++S   L Q + D+K  + F R  PV G   DTL+L F DLRQL  L    DW T++ +Y      Y RV   +A++LLEK   +    S    +    +KN++DK+   + ++KQL+ L
Sbjct:   13 ILREIESTDTNCIGPTLR--------SVYDGQEHGL--FMDKLEGRIRNHDREIEKMCNHHFQGFVDSITELLKVRGEAQKLKGQVTETNQKLQSDGKELLKSMDELRQCRLQQRNIATTIDKLTHCLPVLEMYSRLQEQMRAKRYYPALCTLEQLEQSCLPRAGGYRFCAIMAENIPVLRTHIRDVSMSDLKDFLESIRKHSDKIGETAMKQAQVQSSRDSDI-THQQRTGSGKRL----------------------RREVGSGTMVESSGGSPNSEQDSGILDVEDEEDDEVPGAHDLVDFSPVYRCLHIYTVLGSRDTFESYYRKQRRKQARLVLQPHSNMHETLEGYRRYFNQIVGFFVVEDHILHTTQGLVNRAYVEELWEVALSKTIAALRTHSSYCTDPDLILDLKNLIVLFADTLQGYGFPVNQLFDMLLEMRDQYGEILLKKWNLSFRQIIDQDNYSPIPVSTEEEYRRISGQFP-FQDPELEKMSFPKKLPFSEFVPKVYSQLKEFIYACLKYSEDLHLSSTEIDDMIRKSTNLLLTRTLSHCLQYAIKKKNVGLAELVQIIINTTHLEMSCHYLEEFISNITNV--------------------------PPDGVNATKLYGTSTFKDARHSAEEEIYTNLNLKIDQFLQLADYDWMAAQGGG-----------------------QASDYLSDLIAFLCSTFSVFTHLPGKVAQTACMSACKHLSTSLLQ-LLLEADVRQVSMGALQQFNVDVKECERFARAGPVPGFQGDTLLLAFIDLRQLLDLFTQWDWSTYLADYGRPTCKYLRVNPHTALALLEKISRAMKDTSRKNNMFAQFRKNERDKQKLIDTVVKQLRNL 800          
BLAST of Exocyst complex component vs. Ensembl Sea Lamprey
Match: exoc6b (exocyst complex component 6B [Source:ZFIN;Acc:ZDB-GENE-060929-132])

HSP 1 Score: 163.31 bits (412), Expect = 6.364e-45
Identity = 82/234 (35.04%), Postives = 137/234 (58.55%), Query Frame = 2
Query: 1172 NVEDRVDFGPVYRCLHIHSVLGDRHEFEKCYRNQRKRQCTLLLTLSK--QESVRNYHEFLSGVVGFFVVEDYIRHSQISMVTRNYLDELWSQTMLRVGDFVSVNSDNINDIESLLKLKDSCVLFGKTMRSLGFNVAGFKDFYEVLKKQHQKLLGNEYSNKFKDIFEGEDYTAITVQDASEMELVIDLYPYFLSPDIDILPYPKSLSFSWMVPRINQAIRDHIKKCRKFSDNLEL 1867
            N +D VDF PVYRCLHI++VLG R  FE  YRNQR++Q  L+L       E++  Y ++ + +VGFFVVED+I H+   +V R Y+DELW   + R+   +  +S    +   +L LK   VLF  T++  GF++    D    ++ Q+ ++L  +++ +F+ IFE ++++ I V +  E   ++  +P  +  +++   +PK + FS  VP I   +++ I  C KFS++L L
Sbjct:   67 NAQDLVDFSPVYRCLHIYTVLGARDTFENYYRNQRRQQARLVLQAQSNMHETLEGYKKYFNQIVGFFVVEDHILHTTQGLVNRAYMDELWDMALSRIIAVLRTHSSYCTNPNLVLDLKHLIVLFADTVQGYGFSMNQLFDLLLEIRDQYCEILLKKWAAEFRAIFERDNFSPIPVNNDEEYRKIVSQFP-LMDAELEKQTFPKKIPFSQFVPSIYTQVKEFIYACLKFSEDLHL 299          
BLAST of Exocyst complex component vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005958.1 (pep scaffold:Pmarinus_7.0:GL480787:1115:18513:-1 gene:ENSPMAG00000005386.1 transcript:ENSPMAT00000005958.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 147.132 bits (370), Expect = 1.257e-38
Identity = 103/418 (24.64%), Postives = 187/418 (44.74%), Query Frame = 2
Query: 1307 SKQESVRNYHEFLSGVVGFFVVEDYIRHSQISMVTRNYLDELWSQTMLRVGDFVSVNSDNINDIESLLKLKDSCVLFGKTMRSLGFNVAGFKDFYEVLKKQHQKLLGNEYSNKFKDIFEGEDYTAITVQDASEMELVIDLYPYFLSPDIDILPYPKSLSFSWMVPRINQAIRDHIKKCRKFSDNLELSQTELEDQLNHTTNVLFSQTLKHFLVKAVKDSERELNRLIQLAVNMDELESACIGLQNFISSLVGTVYTNSYQXXXXXXXXXXXXXXXXXINPPRSRLHAFALFKELHSKIENCIYSAIDAKIDDMFDDNEYRQVNSHHSSTNNSLANSPSKKFNSISIDNNQMKPSDFITDVIAYLSITFESFTNLPARLAQTACLLSCKY--IDKKLKTFVNSEARISERFLHQLSTDI 2554
            S  +++ +Y ++ + +VGFFVVE+ +      +V R +L ELW   + RV   V   +   ++ E L  LK+  + +  TM+ LG  V          + Q+ + L  +++  F+ I +G+ Y+ + +    E   ++  +P    P +  + +P SL FS  +P I   +++ +K C +FS++L LS TEL+D L  +TN L ++ L   L++          +L+QL+VN+ ELE +   L +FIS L G   + ++                       + L+A   F++     E  + S +  K+D+     EY       +                        + S ++ D++ +L   F  F+ LP  +A+ AC+  CK+            S +R+S   L QLS D+
Sbjct:    4 SSTQTLDSYRKYFNQIVGFFVVEERVLCCTRGLVERLHLLELWDSALTRVLAAVRTLATCCSEPELLRGLKELLISYADTMQGLGVPVQQLLSLLHDFRAQYGEALHAKWATAFQTILDGDSYSPVNLASEEECARLVIAFPLSSIPTVSSV-FPASLPFSPAIPAIYTQVQEFVKACLQFSEDLHLSTTELDDMLRRSTNQLLTRALAGSLMELATRPSLGPLQLVQLSVNIGELEQSLPSLTDFISGLTGMATSATHN----------------------TLLYASDTFRDARRLAEESVESRLVGKVDEFVSLAEYAWAGEEPTG-----------------------RASSYLLDLLTFLRSIFSLFSCLPRAVAKAACMACCKHLAASLLSLLLGASGSRLSAGALQQLSLDL 375          
BLAST of Exocyst complex component vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010427.1 (pep scaffold:Pmarinus_7.0:GL476649:196476:219160:-1 gene:ENSPMAG00000009443.1 transcript:ENSPMAT00000010427.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 137.502 bits (345), Expect = 6.705e-37
Identity = 76/213 (35.68%), Postives = 122/213 (57.28%), Query Frame = 2
Query:  308 NLISEIKSNSSGSIANIIRKLRQLETSSVNNDSSEILTKFMRHLDNEIELNNQDIEKFCNHFYQCFVDSIKELLKIQEEASELKSSFGSVQSSLMESVKKIKQDCNELSKCHLILANIDKAVENLQACLPVFDQYLKAAKSINEKRYYPALKTLNHLELNQMQRVRQFSFSDNLQNKIPGMREQIKAASKDEIKDFLENVRKHSVGLGMCAMK 946
             ++ EI+S  +  I   +R        SV + +     +F+  L+  I+ ++++IEK CN  YQ FVDSI ELLK++ EA ++K    +    L E+ K++  +  EL++C +   NI   V+ L  CLPV + Y K  + +  KRYYPALK L+ LE   +  V Q+ FS  + + +P +R++I+  S  ++ DFLE++RKHS  +G  AMK
Sbjct:   12 RILREIESTDTACIGPTLR--------SVYDGAEH--QRFLEKLEARIKSHDREIEKMCNFHYQGFVDSITELLKVRSEAGKVKCQVVATNKQLQEAGKELVTEMEELTRCRVQQRNIATTVDKLNLCLPVLEMYSKLKEQMKAKRYYPALKMLDVLEQEYLPLVSQYRFSRLMLDTLPRLRQEIRDVSMSDLNDFLESIRKHSDKIGQMAMK 214          
BLAST of Exocyst complex component vs. Ensembl Sea Lamprey
Match: exoc6 (exocyst complex component 6 [Source:ZFIN;Acc:ZDB-GENE-040426-2511])

HSP 1 Score: 109.768 bits (273), Expect = 5.721e-27
Identity = 83/301 (27.57%), Postives = 145/301 (48.17%), Query Frame = 2
Query: 1979 RLIQLAVNMDELESACIGLQNFISSLVG----TVYTNSYQXXXXXXXXXXXXXXXXXINPPRSRLHAFALFKELHSKIENCIYSAIDAKIDDMFDDNEYRQVNSHHSSTNNSLANSPSKKFNSISIDNNQMKPSDFITDVIAYLSITFESFTNLPARLAQTACLLSCKYIDKK-LKTFVNSEAR-ISERFLHQLSTDIKSLQDFTRKIPVAGVSADTLILVFEDLRQLTALVILSDWDTFIKNYRTNQNPYDRVLTSSAISLLEKTRHSDTGFSALIKSLKKNKQDKRD--EEILKQLKEL 2857
            +L+Q+ +N   LE +C  L++FI+++      TV+T                          ++L+  + FK+     E  IY+ +  KID+     +Y           + +   P+               SD++ D+I +L  TF  FT+LP ++AQTAC+ + K++  + L+  ++ E + ++   + Q + D+   + F    PV G+  DTL L F DLRQL  L ++ DW T++ +Y    N Y RV  ++A+ LLEK +   T  S +    +KN++DK+   E + KQL+ L
Sbjct:    1 QLVQIIINTTHLEQSCKYLEDFITNITNVSPETVHT--------------------------TKLYGTSTFKDARHTAEEEIYTKLHQKIDEFLQLADY-----------DWMLPEPNG------------HASDYLMDLINFLRSTFAVFTHLPGKVAQTACMSASKHLASRLLQQILDVEVKQVTMGAIQQFNLDLVQCELFASSEPVPGLQGDTLQLAFIDLRQLLDLFMVWDWSTYLADYGHPNNKYLRVNPNTALILLEKMK-DHTRKSNIFAQFRKNERDKQKLIETVAKQLRSL 251          
BLAST of Exocyst complex component vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000848.1 (pep scaffold:Pmarinus_7.0:GL477081:172551:184963:-1 gene:ENSPMAG00000000777.1 transcript:ENSPMAT00000000848.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 93.9745 bits (232), Expect = 8.329e-22
Identity = 54/172 (31.40%), Postives = 90/172 (52.33%), Query Frame = 2
Query:  422 KFMRHLDNEIELNNQDIEKFCNHFYQCFVDSIKELLKIQEEASELKSSFGSVQSSLMESVKKIKQDCNELSK--CHLILANIDKAVENLQACLPVFDQYLKAAKSINEKRYYPALKTLNHLELNQMQRVRQFSFSDNLQNKIPGMREQIKAASKDEIKDFLENVRKHSVGLG 931
            + M  LD  I  +++DIEK CN  YQ FVD I ELL ++  A +LK         + E+ ++   +CNE +K  C         A + L  CLPV + Y K  + +  KR+YPAL+TL  LE + +  + ++ F   +++    +R  ++  +   ++DFLE  ++ +  LG
Sbjct:   14 ELMSRLDVRIRGHDRDIEKLCNFHYQGFVDCITELLSVRAHALKLKDHVVESNQKMQEAGREKDNECNERNKSSCAQQALVTSIAEKRLAHCLPVLETYAKLQQQMEAKRFYPALRTLQQLE-SCLPALPRYRFCAAVRDGAAALRGTVRGHAAARLRDFLERAQEQAEALG 184          
BLAST of Exocyst complex component vs. Ensembl Nematostella
Match: EDO30699 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T027])

HSP 1 Score: 100.138 bits (248), Expect = 2.717e-24
Identity = 57/167 (34.13%), Postives = 101/167 (60.48%), Query Frame = 2
Query: 2375 ITDVIAYLSITFESFTNLPARLAQTACLLSCKYIDKKLKTFV--NSEARISERFLHQLSTDIKSLQDFTRKIPVAGVSADTLILVFEDLRQLTALVILSDWDTFIKNYRTNQNPYDRVLTSSAISLLEKTRHSDT--GFSALIKSLKKNKQDKRD--EEILKQLKEL 2857
            + D++AYL  TF +F  LP  +AQTACL SCK++   ++T +  +   +++E  L+  + D++  ++F    PV G+S  TL + F +LRQL  L++  DW T++K++ +  + Y+RV    A  LLEK   S+   GF     +++K++++K+   E I+K+L+ L
Sbjct:    1 MVDLLAYLRSTFLNFAVLPGNVAQTACLSSCKHLAGSMRTLLLDDDVKQMNEHGLNWFNQDLRECEEFANSSPVEGISDGTLQMTFLELRQLVDLLLGCDWSTYLKDHGSTTSKYNRVNPQIAARLLEKLMESEKKRGF-----TIRKSEREKKKLMETIIKKLRAL 162          
BLAST of Exocyst complex component vs. Ensembl Medaka
Match: exoc6b (exocyst complex component 6B [Source:NCBI gene;Acc:101175047])

HSP 1 Score: 421.394 bits (1082), Expect = 2.592e-132
Identity = 271/869 (31.19%), Postives = 441/869 (50.75%), Query Frame = 2
Query:  311 LISEIKSNSSGSIANIIRKLRQLETSSVNNDSSEILTKFMRHLDNEIELNNQDIEKFCNHFYQCFVDSIKELLKIQEEASELKSSFGSVQSSLMESVKKIKQDCNELSKCHLILANIDKAVENLQACLPVFDQYLKAAKSINEKRYYPALKTLNHLELNQMQRVRQFSFSDNLQNKIPGMREQIKAASKDEIKDFLENVRKHSVGLGMCAMKLMAHKTGMEVNFDSPTKRTMNGARMNKGDDSKRENPFVGMLDEPDSVNKEIQDLISLESYGNDNDDSSELELESTNVEDRVDFGPVYRCLHIHSVLGDRHEFEKCYRNQRKRQCTLLLTL--SKQESVRNYHEFLSGVVGFFVVEDYIRHSQISMVTRNYLDELWSQTMLRVGDFVSVNSDNINDIESLLKLKDSCVLFGKTMRSLGFNVAGFKDFYEVLKKQHQKLLGNEYSNKFKDIFEGEDYTAITVQDASEMELVIDLYPYFLSPDIDILPYPKSLSFSWMVPRINQAIRDHIKKCRKFSDNLELSQTELEDQLNHTTNVLFSQTLKHFLVKAVKDSERELNRLIQLAVNMDELESACIGLQNFISSLVGTVYTNSYQXXXXXXXXXXXXXXXXXINPP----RSRLHAFALFKELHSKIENCIYSAIDAKIDDMFDDNEYRQVNSHHSSTNNSLANSPSKKFNSISIDNNQMKPSDFITDVIAYLSITFESFTN----------LPARLAQTACLLSCKYIDKKL-KTFVNSEAR-ISERFLHQLSTDIKSLQDFTRKIPVAGVSADTLILVFEDLRQLTALVILSDWDTFIKNYRTNQNPYDRVLTSSAISLLEKTRHSDTGFSALIKSLKKNKQDKRD--EEILKQLKEL 2857
            ++ EI+S  +  I   +R        SV +     L  FM  LD  I  +++DIE+ CNH +Q FVDSI ELLK++ EA +LKS        L    K++     EL +C +   NI   ++ L  CLPV + Y +  + ++ KRYYPAL TL  LE   + R  Q+ F   +   IP +R  I+  +  +++DFLE++RKHS  +G  A+K    +  ++ +  S   RT+ G R  K   +         L E DS              G  + +  + + + +  ++ VDF PVYRCLHI++VLG R  FE  YR QR++Q  L+L    +  E++  Y  + + +VGFFVVED++ H+   +V R Y++ELW   + ++   +  +S   +D   +L LK+  VLF  T++  GF V+   D    +++Q+ ++L   ++  F+ + + ++Y+ I V    E      L+P    P+++ LP+PK L FS  VP++   +++ I  C K+S++L LS TE++D +  +TN+L ++TL + L  A+K     L  L+Q+ +N   LE +C  L+ FIS++                             PP     ++L+  + FK+     E  IY+ ++ KID      +Y           + +A+ P+            +  SD++ D+IA+L+ TF  FTN          LP ++AQTAC+ +CK+I   L +  +N E R IS   LHQL+ D+K  + F R  PVAG   DTL+L F DLRQL  L    DW T++ +Y      Y RV    +++LLEK + +    + +    +K  +D++   + I+KQL+ L
Sbjct:   64 ILREIESTDTNCIGPTLR--------SVYDGQEHGL--FMEKLDARIRNHDRDIERMCNHHFQGFVDSITELLKVRGEAQKLKSQVTETNQRLQNDGKELITSMEELKQCRVQQRNIANTIDKLTHCLPVLEMYSRLQEQMSAKRYYPALCTLEQLEQTCLPRAGQYRFCSIMAENIPKLRTHIRDTAMSQLRDFLESIRKHSDKIGQTAVKQAQLQRSLDGSL-SMQPRTLIGRRGRKEAMAAATESDGSPLSEQDS--------------GILDVEDEDDDDDVSGAQELVDFSPVYRCLHIYTVLGLRDVFENYYRKQRRKQARLVLQPHSNMHETLEGYRRYFNQIVGFFVVEDHVLHTTRGLVNRAYVEELWELALSKIVAALRTHSSYCDDPNLVLDLKNLMVLFADTLQGYGFPVSQLFDMLLEMREQYGEILLKRWNITFRQVLDQDNYSPIPVSTEEEYRHYTSLFP-MQDPELEKLPFPKKLPFSEFVPKVYSQLKEFIYACLKYSEDLHLSSTEVDDMIRKSTNLLLTRTLSNCLQYAIKKKNVGLAELVQVIINTTHLEQSCHFLEEFISNITNV--------------------------PPDTVNATKLYGTSTFKDARHAAEAEIYTNLNTKIDQFLQLADY-----------DWMASPPA---------GGSLSASDYLIDLIAFLNSTFSVFTNLPGTAIDHATLPGKVAQTACMSACKHISTSLMELLLNPEVRQISIGALHQLNADVKECESFARAGPVAGFQGDTLLLAFSDLRQLLDLFTQWDWSTYLVDYGKPTCKYLRVNPHISLALLEKMKETSRK-NNVFAQFRKTDRDRQKLIDTIIKQLRNL 859          
BLAST of Exocyst complex component vs. Ensembl Medaka
Match: exoc6 (exocyst complex component 6 [Source:NCBI gene;Acc:101169149])

HSP 1 Score: 417.927 bits (1073), Expect = 1.710e-131
Identity = 265/864 (30.67%), Postives = 442/864 (51.16%), Query Frame = 2
Query:  296 KNFSNLISEIKSNSSGSIANIIRKLRQLETSSVNNDSSEILTKFMRHLDNEIELNNQDIEKFCNHFYQCFVDSIKELLKIQEEASELKSSFGSVQSSLMESVKKIKQDCNELSKCHLILANIDKAVENLQACLPVFDQYLKAAKSINEKRYYPALKTLNHLELNQMQRVRQFSFSDNLQNKIPGMREQIKAASKDEIKDFLENVRKHSVGLGMCAMKLMAHKTGMEVNFDSPTKRTMNGARMNKGDDSKRENPFVGMLDEPDSVNKEIQDLISLESYGNDNDDSSELELESTNVEDRVDFGPVYRCLHIHSVLGDRHEFEKCYRNQRKRQCTLLLT--LSKQESVRNYHEFLSGVVGFFVVEDYIRHSQISMVTRNYLDELWSQTMLRVGDFVSVNSDNINDIESLLKLKDSCVLFGKTMRSLGFNVAGFKDFYEVLKKQHQKLLGNEYSNKFKDIFEGEDYTAITVQDASEMELVIDLYPYFLSPDIDILPYPKSLSFSWMVPRINQAIRDHIKKCRKFSDNLELSQTELEDQLNHTTNVLFSQTLKHFLVKAVKDSERELNRLIQLAVNMDELESACIGLQNFISSLVG----TVYTNSYQXXXXXXXXXXXXXXXXXINPPRSRLHAFALFKELHSKIENCIYSAIDAKIDDMFDDNEYRQVNSHHSSTNNSLANSPSKKFNSISIDNNQMKPSDFITDVIAYLSITFESFTNLPARLAQTACLLSCKYIDKKL-KTFVNSEAR-ISERFLHQLSTDIKSLQDFTRKIPVAGVSADTLILVFEDLRQLTALVILSDWDTFIKNYRTNQNPYDRVLTSSAISLLEKTRHSDTGFSALIKSLKKNKQDKRD--EEILKQLKEL 2857
            K F N+ +E++S     +   +R        S+ +D      +FM  LD  I  ++++IEK CN  +Q FVD+I ELLK++ +A +L          L E+ K++     E+ +C +   N+   VE LQ C+PV + Y K  + +  KRYY ALKT+  LE   + RV Q+ F   +   +P +RE+IK  S  ++KDFLE++RKHS  +G  A++             +   RT       +        P   +     S    + + + ++    D +D+ +   E    +D VDF PVYRCLHI++VLGDR  FE  YR QRK+Q  L+L    +  E+V  Y  + + +VGFFVVED++ H+   +VTR + DELW+  + ++   +  +S   +D + +L+LK+  V+F  T++  GF V+   D    ++ Q+ + L  +++  F++IFE ++Y+ I V+   E ++V+  +P F   +I+   +PK L  S  VP+I   +++ I    KFS++L  S TE++D L  +TN+L ++TL   L   +K     L  L+Q+ +N   LE AC  L+ FI+++      TV+T                          +RL+  + FK+     E  IY+ ++ KID+     +Y             +A S  +              S ++ D+I +L  TF+ FT+LP ++AQTAC+ +CK++   L +  ++SE + IS   + Q + D+   + F    PV G   DTL L F DLRQL  L ++ DW T++ +Y    + Y RV  ++A++LLEK + +    + +    +KN +DK+   E ++KQL+ L
Sbjct:   26 KIFGNIFAELES-VDLPLGTTLR--------SIYDDQPNAHKRFMEKLDTRIRNHDREIEKMCNFHHQGFVDAITELLKVRADAEKLMGQVTDTNRRLQEAGKEVTAQTEEVIRCRIQQRNMATTVEKLQLCIPVLEMYSKLKEQLTSKRYYAALKTMEQLEKVYIPRVSQYRFCQIMAENLPKLREEIKDVSMSDLKDFLESIRKHSDKVGETAIR------------QAQQHRTFISTVAKQAGLDHYTKPLFSLKGRAHS---HMPNGLLMDDGAGDEEDADD---EILTAQDLVDFSPVYRCLHIYTVLGDRETFENYYRKQRKKQARLVLQPQANMHETVEGYRRYFNQIVGFFVVEDHVLHATQGLVTRAFTDELWNMALSKIIAVLRTHSSYCDDPDLVLELKNLIVIFADTLQGYGFPVSRLFDLLFEVRDQYNETLLKKWALVFREIFETDNYSPIPVETEEEYKVVVSRFP-FHDAEIEKQSFPKKLPMSQSVPQIYSQVKEFIYASLKFSESLHRSSTEIDDMLRKSTNLLLTRTLSSCLQNLIKKPHIGLTELVQIIINTTHLEQACRYLEEFITNITNVSPETVHT--------------------------TRLYGLSTFKDARHAAEGEIYTKLNQKIDEFIQLADYEWC----------MAESDGRA-------------SGYLMDLINFLRSTFQVFTHLPGKVAQTACMSACKHLSTSLMQMLLDSELKQISMGAIQQFNLDVMQCELFASSEPVPGFQGDTLQLAFIDLRQLLDLFMVWDWSTYLADYGQPNSKYLRVNPATALALLEKMKDTSKK-NNIFSQFRKNDRDKQKLVETVVKQLRSL 811          
BLAST of Exocyst complex component vs. Ensembl Medaka
Match: exoc6b (exocyst complex component 6B [Source:NCBI gene;Acc:101175047])

HSP 1 Score: 418.313 bits (1074), Expect = 4.111e-131
Identity = 272/872 (31.19%), Postives = 440/872 (50.46%), Query Frame = 2
Query:  311 LISEIKSNSSGSIANIIRKLRQLETSSVNNDSSEILTKFMRHLDNEIELNNQDIEKFCNHFYQCFVDSIKELLKIQEEASELKSSFGSVQSSLMESVKKIKQDCNELSKCHLILANIDKAVENLQACLPVFDQYLKAAKSINEKRYYPALKTLNHLELNQMQRVRQFSFSDNLQNKIPGMREQIKAASKDEIKDFLENVRKHSVGLGMCAMKLMAHKTGMEVNFDSPTKRTMNGARMNKGDDSKRENPFVGMLDEPDSVNKEIQDLISLESYGNDNDDSSELELESTNVEDRVDFGPVYRCLHIHSVLGDRHEFEKCYRNQRKRQCTLLLTL--SKQESVRNYHEFLSGVVGFFVVEDYIRHSQISMVTRNYLDELWSQTMLRVGDFVSVNSDNINDIESLLKLKDSCVLFGKTMRSLGFNVAGFKDFYEVLKKQHQKLLGNEYSNKFKDIFEGEDYTAITVQDASEMELVIDLYPYFLSPDIDILPYPKSLSFSWMVPRINQAIRDHIKKCRKFSDNLELSQTELEDQLNHTTNVLFSQTLKHFLVKAVKDSERELNRLIQLAVNMDELESACIGLQNFISSLVGTVYTNSYQXXXXXXXXXXXXXXXXXINPP----RSRLHAFALFKELHSKIENCIYSAIDAKIDDMFDDNEYRQVNSHHSSTNNSLANSPSKKFNSISIDNNQMKPSDFITDVIAYLSITFESFTN----------LPARLAQTACLLSCKYIDKKL-KTFVNSEAR-ISERFLHQLSTDIKSLQDFTRKIPVAGVSADTLILVFEDLRQLTALVILSDWDTFIKNYRTNQNPYDRVLTSSAISLLEKTRHSDTGFSA---LIKSLKKNKQDKRD--EEILKQLKEL 2857
            ++ EI+S  +  I   +R        SV +     L  FM  LD  I  +++DIE+ CNH +Q FVDSI ELLK++ EA +LKS        L    K++     EL +C +   NI   ++ L  CLPV + Y +  + ++ KRYYPAL TL  LE   + R  Q+ F   +   IP +R  I+  +  +++DFLE++RKHS  +G  A+K    +  ++ +  S   RT+ G R  K   +         L E DS              G  + +  + + + +  ++ VDF PVYRCLHI++VLG R  FE  YR QR++Q  L+L    +  E++  Y  + + +VGFFVVED++ H+   +V R Y++ELW   + ++   +  +S   +D   +L LK+  VLF  T++  GF V+   D    +++Q+ ++L   ++  F+ + + ++Y+ I V    E      L+P    P+++ LP+PK L FS  VP++   +++ I  C K+S++L LS TE++D +  +TN+L ++TL + L  A+K     L  L+Q+ +N   LE +C  L+ FIS++                             PP     ++L+  + FK+     E  IY+ ++ KID      +Y           + +A+ P+            +  SD++ D+IA+L+ TF  FTN          LP ++AQTAC+ +CK+I   L +  +N E R IS   LHQL+ D+K  + F R  PVAG   DTL+L F DLRQL  L    DW T++ +Y      Y RV    +++LLEK +      S    +    +K  +D++   + I+KQL+ L
Sbjct:   64 ILREIESTDTNCIGPTLR--------SVYDGQEHGL--FMEKLDARIRNHDRDIERMCNHHFQGFVDSITELLKVRGEAQKLKSQVTETNQRLQNDGKELITSMEELKQCRVQQRNIANTIDKLTHCLPVLEMYSRLQEQMSAKRYYPALCTLEQLEQTCLPRAGQYRFCSIMAENIPKLRTHIRDTAMSQLRDFLESIRKHSDKIGQTAVKQAQLQRSLDGSL-SMQPRTLIGRRGRKEAMAAATESDGSPLSEQDS--------------GILDVEDEDDDDDVSGAQELVDFSPVYRCLHIYTVLGLRDVFENYYRKQRRKQARLVLQPHSNMHETLEGYRRYFNQIVGFFVVEDHVLHTTRGLVNRAYVEELWELALSKIVAALRTHSSYCDDPNLVLDLKNLMVLFADTLQGYGFPVSQLFDMLLEMREQYGEILLKRWNITFRQVLDQDNYSPIPVSTEEEYRHYTSLFP-MQDPELEKLPFPKKLPFSEFVPKVYSQLKEFIYACLKYSEDLHLSSTEVDDMIRKSTNLLLTRTLSNCLQYAIKKKNVGLAELVQVIINTTHLEQSCHFLEEFISNITNV--------------------------PPDTVNATKLYGTSTFKDARHAAEAEIYTNLNTKIDQFLQLADY-----------DWMASPPA---------GGSLSASDYLIDLIAFLNSTFSVFTNLPGTAIDHATLPGKVAQTACMSACKHISTSLMELLLNPEVRQISIGALHQLNADVKECESFARAGPVAGFQGDTLLLAFSDLRQLLDLFTQWDWSTYLVDYGKPTCKYLRVNPHISLALLEKLQKPMKETSRKNNVFAQFRKTDRDRQKLIDTIIKQLRNL 863          
BLAST of Exocyst complex component vs. Ensembl Medaka
Match: exoc6 (exocyst complex component 6 [Source:NCBI gene;Acc:101169149])

HSP 1 Score: 412.535 bits (1059), Expect = 1.789e-129
Identity = 265/887 (29.88%), Postives = 444/887 (50.06%), Query Frame = 2
Query:  266 MSYSNVSDFNKNFSNLISEIKSNSSGSIANIIRKLRQLETSSVNNDSSEILTKFMRHLDNEIELNNQDIEKFCNHFYQCFVDSIKELLKIQEEASELKSSFGSVQSSLMESVKKIKQDCNELSKCHLILANIDKAVENLQACLPVFDQYLKAAKSINEKRYYPALKTLNHLELNQMQRVRQFSFSDNLQNKIPGMREQIKAASKDEIKDFLENVRKHSVGLGMCAMKLMAHKTGMEVNFDSPTKRTMNGARMNKGDDSKRENPFVGMLDEPDSVNKEIQDLISLESYGNDNDDSSELELESTNVEDRVDFGPVYRCLHIHSVLGDRHEFEKCYRNQRKRQCTLLLT--LSKQESVRNYHEFLSGVVGFFVVEDYIRHSQISMVTRNYLDELWSQTMLRVGDFVSVNSDNINDIESLLKLKDSCVLFGKTMRSLGFNVAGFKDFYEVLKKQHQKLLGNEYSNKFKDIFEGEDYTAITVQDASEMELVIDLYPYFLSPDIDILPYPKSLSFSWMVPRINQAIRDHIKKCRKFSDNLELSQTELEDQLNHTTNVLFSQTLKHFLVKAVKDSERELNRLIQLAVNMDELESACIGLQNFISSLVG----TVYTNSYQXXXXXXXXXXXXXXXXXINPPRSRLHAFALFKELHSKIENCIYSAIDAKIDDMFDDNEYRQVNSHHSSTNNSLANSPSKKFNSISIDNNQMKPSDFITDVIAYLSITFESFTNLP----------ARLAQTACLLSCKYIDKKL-KTFVNSEAR-ISERFLHQLSTDIKSLQDFTRKIPVAGVSADTLILVFEDLRQLTALVILSDWDTFIKNYRTNQNPYDRVLTSSAISLLEKTRHSDTGFSA---LIKSLKKNKQDKRD--EEILKQLKEL 2857
            M+ +++ +       ++ EI+S  +  +   +R        S+ +D      +FM  LD  I  ++++IEK CN  +Q FVD+I ELLK++ +A +L          L E+ K++     E+ +C +   N+   VE LQ C+PV + Y K  + +  KRYY ALKT+  LE   + RV Q+ F   +   +P +RE+IK  S  ++KDFLE++RKHS  +G  A++             +   RT       +        P   +     S    + + + ++    D +D+ +   E    +D VDF PVYRCLHI++VLGDR  FE  YR QRK+Q  L+L    +  E+V  Y  + + +VGFFVVED++ H+   +VTR + DELW+  + ++   +  +S   +D + +L+LK+  V+F  T++  GF V+   D    ++ Q+ + L  +++  F++IFE ++Y+ I V+   E ++V+  +P F   +I+   +PK L  S  VP+I   +++ I    KFS++L  S TE++D L  +TN+L ++TL   L   +K     L  L+Q+ +N   LE AC  L+ FI+++      TV+T                          +RL+  + FK+     E  IY+ ++ KID+     +Y             +A S               + S ++ D+I +L  TF+ FT+LP           ++AQTAC+ +CK++   L +  ++SE + IS   + Q + D+   + F    PV G   DTL L F DLRQL  L ++ DW T++ +Y    + Y RV  ++A++LLEK        S    +    +KN +DK+   E ++KQL+ L
Sbjct:    1 MAEADIPECITEHERILQEIESTDTACVGPTLR--------SIYDDQPNAHKRFMEKLDTRIRNHDREIEKMCNFHHQGFVDAITELLKVRADAEKLMGQVTDTNRRLQEAGKEVTAQTEEVIRCRIQQRNMATTVEKLQLCIPVLEMYSKLKEQLTSKRYYAALKTMEQLEKVYIPRVSQYRFCQIMAENLPKLREEIKDVSMSDLKDFLESIRKHSDKVGETAIR------------QAQQHRTFISTVAKQAGLDHYTKPLFSLKGRAHS---HMPNGLLMDDGAGDEEDADD---EILTAQDLVDFSPVYRCLHIYTVLGDRETFENYYRKQRKKQARLVLQPQANMHETVEGYRRYFNQIVGFFVVEDHVLHATQGLVTRAFTDELWNMALSKIIAVLRTHSSYCDDPDLVLELKNLIVIFADTLQGYGFPVSRLFDLLFEVRDQYNETLLKKWALVFREIFETDNYSPIPVETEEEYKVVVSRFP-FHDAEIEKQSFPKKLPMSQSVPQIYSQVKEFIYASLKFSESLHRSSTEIDDMLRKSTNLLLTRTLSSCLQNLIKKPHIGLTELVQIIINTTHLEQACRYLEEFITNITNVSPETVHT--------------------------TRLYGLSTFKDARHAAEGEIYTKLNQKIDEFIQLADYEWC----------MAESDG-------------RASGYLMDLINFLRSTFQVFTHLPKNNNDHASMSGKVAQTACMSACKHLSTSLMQMLLDSELKQISMGAIQQFNLDVMQCELFASSEPVPGFQGDTLQLAFIDLRQLLDLFMVWDWSTYLADYGQPNSKYLRVNPATALALLEKVYRGMKDTSKKNNIFSQFRKNDRDKQKLVETVVKQLRSL 811          
BLAST of Exocyst complex component vs. Ensembl Medaka
Match: exoc6 (exocyst complex component 6 [Source:NCBI gene;Acc:101169149])

HSP 1 Score: 410.609 bits (1054), Expect = 1.141e-128
Identity = 265/874 (30.32%), Postives = 442/874 (50.57%), Query Frame = 2
Query:  296 KNFSNLISEIKSNSSGSIANIIRKLRQLETSSVNNDSSEILTKFMRHLDNEIELNNQDIEKFCNHFYQCFVDSIKELLKIQEEASELKSSFGSVQSSLMESVKKIKQDCNELSKCHLILANIDKAVENLQACLPVFDQYLKAAKSINEKRYYPALKTLNHLELNQMQRVRQFSFSDNLQNKIPGMREQIKAASKDEIKDFLENVRKHSVGLGMCAMKLMAHKTGMEVNFDSPTKRTMNGARMNKGDDSKRENPFVGMLDEPDSVNKEIQDLISLESYGNDNDDSSELELESTNVEDRVDFGPVYRCLHIHSVLGDRHEFEKCYRNQRKRQCTLLLT--LSKQESVRNYHEFLSGVVGFFVVEDYIRHSQISMVTRNYLDELWSQTMLRVGDFVSVNSDNINDIESLLKLKDSCVLFGKTMRSLGFNVAGFKDFYEVLKKQHQKLLGNEYSNKFKDIFEGEDYTAITVQDASEMELVIDLYPYFLSPDIDILPYPKSLSFSWMVPRINQAIRDHIKKCRKFSDNLELSQTELEDQLNHTTNVLFSQTLKHFLVKAVKDSERELNRLIQLAVNMDELESACIGLQNFISSLVG----TVYTNSYQXXXXXXXXXXXXXXXXXINPPRSRLHAFALFKELHSKIENCIYSAIDAKIDDMFDDNEYRQVNSHHSSTNNSLANSPSKKFNSISIDNNQMKPSDFITDVIAYLSITFESFTNLP----------ARLAQTACLLSCKYIDKKL-KTFVNSEAR-ISERFLHQLSTDIKSLQDFTRKIPVAGVSADTLILVFEDLRQLTALVILSDWDTFIKNYRTNQNPYDRVLTSSAISLLEKTRHSDTGFSALIKSLKKNKQDKRD--EEILKQLKEL 2857
            K F N+ +E++S     +   +R        S+ +D      +FM  LD  I  ++++IEK CN  +Q FVD+I ELLK++ +A +L          L E+ K++     E+ +C +   N+   VE LQ C+PV + Y K  + +  KRYY ALKT+  LE   + RV Q+ F   +   +P +RE+IK  S  ++KDFLE++RKHS  +G  A++             +   RT       +        P   +     S    + + + ++    D +D+ +   E    +D VDF PVYRCLHI++VLGDR  FE  YR QRK+Q  L+L    +  E+V  Y  + + +VGFFVVED++ H+   +VTR + DELW+  + ++   +  +S   +D + +L+LK+  V+F  T++  GF V+   D    ++ Q+ + L  +++  F++IFE ++Y+ I V+   E ++V+  +P F   +I+   +PK L  S  VP+I   +++ I    KFS++L  S TE++D L  +TN+L ++TL   L   +K     L  L+Q+ +N   LE AC  L+ FI+++      TV+T                          +RL+  + FK+     E  IY+ ++ KID+     +Y             +A S  +              S ++ D+I +L  TF+ FT+LP           ++AQTAC+ +CK++   L +  ++SE + IS   + Q + D+   + F    PV G   DTL L F DLRQL  L ++ DW T++ +Y    + Y RV  ++A++LLEK + +    + +    +KN +DK+   E ++KQL+ L
Sbjct:   26 KIFGNIFAELES-VDLPLGTTLR--------SIYDDQPNAHKRFMEKLDTRIRNHDREIEKMCNFHHQGFVDAITELLKVRADAEKLMGQVTDTNRRLQEAGKEVTAQTEEVIRCRIQQRNMATTVEKLQLCIPVLEMYSKLKEQLTSKRYYAALKTMEQLEKVYIPRVSQYRFCQIMAENLPKLREEIKDVSMSDLKDFLESIRKHSDKVGETAIR------------QAQQHRTFISTVAKQAGLDHYTKPLFSLKGRAHS---HMPNGLLMDDGAGDEEDADD---EILTAQDLVDFSPVYRCLHIYTVLGDRETFENYYRKQRKKQARLVLQPQANMHETVEGYRRYFNQIVGFFVVEDHVLHATQGLVTRAFTDELWNMALSKIIAVLRTHSSYCDDPDLVLELKNLIVIFADTLQGYGFPVSRLFDLLFEVRDQYNETLLKKWALVFREIFETDNYSPIPVETEEEYKVVVSRFP-FHDAEIEKQSFPKKLPMSQSVPQIYSQVKEFIYASLKFSESLHRSSTEIDDMLRKSTNLLLTRTLSSCLQNLIKKPHIGLTELVQIIINTTHLEQACRYLEEFITNITNVSPETVHT--------------------------TRLYGLSTFKDARHAAEGEIYTKLNQKIDEFIQLADYEWC----------MAESDGRA-------------SGYLMDLINFLRSTFQVFTHLPKNNNDHASMSGKVAQTACMSACKHLSTSLMQMLLDSELKQISMGAIQQFNLDVMQCELFASSEPVPGFQGDTLQLAFIDLRQLLDLFMVWDWSTYLADYGQPNSKYLRVNPATALALLEKMKDTSKK-NNIFSQFRKNDRDKQKLVETVVKQLRSL 821          
BLAST of Exocyst complex component vs. Planmine SMEST
Match: SMESG000065870.1 (SMESG000065870.1)

HSP 1 Score: 1743.4 bits (4514), Expect = 0.000e+0
Identity = 866/871 (99.43%), Postives = 867/871 (99.54%), Query Frame = 2
Query:  248 MNEFSYMSYSNVSDFNKNFSNLISEIKSNSSGSIANIIRKLRQLETSSVNNDSSEILTKFMRHLDNEIELNNQDIEKFCNHFYQCFVDSIKELLKIQEEASELKSSFGSVQSSLMESVKKIKQDCNELSKCHLILANIDKAVENLQACLPVFDQYLKAAKSINEKRYYPALKTLNHLELNQMQRVRQFSFSDNLQNKIPGMREQIKAASKDEIKDFLENVRKHSVGLGMCAMKLMAHKTGMEVNFDSPTKRTMNGARMNKGDDSKRENPFVGMLDEPDSVNKEIQDLISLESYGNDNDDSSELELESTNVEDRVDFGPVYRCLHIHSVLGDRHEFEKCYRNQRKRQCTLLLTLSKQESVRNYHEFLSGVVGFFVVEDYIRHSQISMVTRNYLDELWSQTMLRVGDFVSVNSDNINDIESLLKLKDSCVLFGKTMRSLGFNVAGFKDFYEVLKKQHQKLLGNEYSNKFKDIFEGEDYTAITVQDASEMELVIDLYPYFLSPDIDILPYPKSLSFSWMVPRINQAIRDHIKKCRKFSDNLELSQTELEDQLNHTTNVLFSQTLKHFLVKAVKDSERELNRLIQLAVNMDELESACIGLQNFISSLVGTVYTNSYQXXXXXXXXXXXXXXXXXINPPRSRLHAFALFKELHSKIENCIYSAIDAKIDDMFDDNEYRQVNSHHSSTNNSLANSPSKKFNSISIDNNQMKPSDFITDVIAYLSITFESFTNLPARLAQTACLLSCKYIDKKLKTFVNSEARISERFLHQLSTDIKSLQDFTRKIPVAGVSADTLILVFEDLRQLTALVILSDWDTFIKNYRTNQNPYDRVLTSSAISLLEKTRHSDTGFSALIKSLKKNKQDKRDEEILKQLKELH 2860
            MNEFSYMSYSNVSDFNKNFSNLISEIKSNSSGSIANIIRKLRQLETSSVNNDSSEILTKFMRHLDNEIELNNQDIEKFCNHFYQCFVDSIKELLKIQEEASELKSSFGSVQSSLMESVKKIKQDCNELSKCHLILANIDKAVENLQACLPVFDQYLKAAKSINEKRYYPALKTLNHLELNQMQRVRQFSFSDNLQNKIPGMREQIKAASKDEIKDFLENVRKHSVGLGMCAMK MAHKTGMEVNFDSPTKRTMNGARMNKGDDSKRENPFVGMLDEPDSVNKEIQDLISLESYGNDNDDSSELELESTNVEDRVDFGPVYRCLHIHSVLGDRHEFEKCYRNQRKRQCTLLLTLSKQESVRNYHEFLSGVVGFFVVEDYIRHSQISMVTRNYLDELWSQTMLRVGDFVSVNSDNINDIESLLKLKDSCVLFGKTMRSLGFNVAGFKDFYEVLKKQHQKLLGNEYSNKFKDIFEGEDYTAITVQDASEMELVIDLYPYFLSPDIDILPYPKSLSFSWMVPRINQAIRDHIKKCRKFSDNLELSQTELEDQLNHTTNVLFSQTLKHFLVKAVKDSERELNRLIQLAVNMDELESACIGLQNFISSLVGTVYTNSY+L ESSSNSEMLLDDNLSINPPRSRLHAFALFKELHSKIENCIYSAI AKIDDMFDDNEYRQVNSHHSSTNNSLANSPSKKFNSISIDNNQMKPSDFITDVIAYLSITFESFTNLPARLAQTACLLSCKYID KLKTFVNSEARISERFLHQLSTDIKSLQDFTRKIPVAGVSADTLILVFEDLRQLTALVILSDWDTFIKNYRTNQNPYDRVLTSSAISLLEKTRHSDTGFSALIKSLKKNKQDKRDEEILKQLKELH
Sbjct:    1 MNEFSYMSYSNVSDFNKNFSNLISEIKSNSSGSIANIIRKLRQLETSSVNNDSSEILTKFMRHLDNEIELNNQDIEKFCNHFYQCFVDSIKELLKIQEEASELKSSFGSVQSSLMESVKKIKQDCNELSKCHLILANIDKAVENLQACLPVFDQYLKAAKSINEKRYYPALKTLNHLELNQMQRVRQFSFSDNLQNKIPGMREQIKAASKDEIKDFLENVRKHSVGLGMCAMKQMAHKTGMEVNFDSPTKRTMNGARMNKGDDSKRENPFVGMLDEPDSVNKEIQDLISLESYGNDNDDSSELELESTNVEDRVDFGPVYRCLHIHSVLGDRHEFEKCYRNQRKRQCTLLLTLSKQESVRNYHEFLSGVVGFFVVEDYIRHSQISMVTRNYLDELWSQTMLRVGDFVSVNSDNINDIESLLKLKDSCVLFGKTMRSLGFNVAGFKDFYEVLKKQHQKLLGNEYSNKFKDIFEGEDYTAITVQDASEMELVIDLYPYFLSPDIDILPYPKSLSFSWMVPRINQAIRDHIKKCRKFSDNLELSQTELEDQLNHTTNVLFSQTLKHFLVKAVKDSERELNRLIQLAVNMDELESACIGLQNFISSLVGTVYTNSYRLTESSSNSEMLLDDNLSINPPRSRLHAFALFKELHSKIENCIYSAIYAKIDDMFDDNEYRQVNSHHSSTNNSLANSPSKKFNSISIDNNQMKPSDFITDVIAYLSITFESFTNLPARLAQTACLLSCKYIDNKLKTFVNSEARISERFLHQLSTDIKSLQDFTRKIPVAGVSADTLILVFEDLRQLTALVILSDWDTFIKNYRTNQNPYDRVLTSSAISLLEKTRHSDTGFSALIKSLKKNKQDKRDEEILKQLKELH 871          
The following BLAST results are available for this feature:
BLAST of Exocyst complex component vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EXOC6B5.380e-13031.78exocyst complex component 6B [Source:HGNC Symbol;A... [more]
EXOC69.532e-13031.43exocyst complex component 6 [Source:HGNC Symbol;Ac... [more]
EXOC6B4.296e-12931.79exocyst complex component 6B [Source:HGNC Symbol;A... [more]
EXOC65.471e-12931.33exocyst complex component 6 [Source:HGNC Symbol;Ac... [more]
EXOC65.471e-12931.33exocyst complex component 6 [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of Exocyst complex component vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
sec-153.220e-11229.11Exocyst complex component 6 [Source:UniProtKB/Swi... [more]
back to top
BLAST of Exocyst complex component vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Sec152.250e-9827.64gene:FBgn0266674 transcript:FBtr0084034[more]
back to top
BLAST of Exocyst complex component vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
exoc6b4.784e-13631.76exocyst complex component 6B [Source:ZFIN;Acc:ZDB-... [more]
exoc6b1.329e-13531.64exocyst complex component 6B [Source:ZFIN;Acc:ZDB-... [more]
exoc68.459e-13131.21exocyst complex component 6 [Source:ZFIN;Acc:ZDB-G... [more]
exoc6b1.187e-11630.48exocyst complex component 6B [Source:ZFIN;Acc:ZDB-... [more]
exoc6b8.836e-3534.84exocyst complex component 6B [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of Exocyst complex component vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adam92.860e-12531.36ADAM metallopeptidase domain 9 [Source:Xenbase;Acc... [more]
adam94.319e-12531.36ADAM metallopeptidase domain 9 [Source:Xenbase;Acc... [more]
adam94.765e-12531.36ADAM metallopeptidase domain 9 [Source:Xenbase;Acc... [more]
adam94.228e-12431.59ADAM metallopeptidase domain 9 [Source:Xenbase;Acc... [more]
adam97.882e-12431.25ADAM metallopeptidase domain 9 [Source:Xenbase;Acc... [more]
back to top
BLAST of Exocyst complex component vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Exoc6b1.195e-13031.78exocyst complex component 6B [Source:MGI Symbol;Ac... [more]
Exoc61.597e-12731.08exocyst complex component 6 [Source:MGI Symbol;Acc... [more]
Exoc61.748e-12631.03exocyst complex component 6 [Source:MGI Symbol;Acc... [more]
Exoc64.570e-12631.08exocyst complex component 6 [Source:MGI Symbol;Acc... [more]
back to top
BLAST of Exocyst complex component vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A6H5Z3|EXC6B_MOUSE8.357e-13031.78Exocyst complex component 6B OS=Mus musculus OX=10... [more]
sp|Q9Y2D4|EXC6B_HUMAN2.584e-12931.78Exocyst complex component 6B OS=Homo sapiens OX=96... [more]
sp|Q8TAG9|EXOC6_HUMAN4.577e-12931.43Exocyst complex component 6 OS=Homo sapiens OX=960... [more]
sp|E2R766|EXOC6_CANLF1.604e-12631.40Exocyst complex component 6 OS=Canis lupus familia... [more]
sp|O54923|EXOC6_RAT3.972e-12630.85Exocyst complex component 6 OS=Rattus norvegicus O... [more]
back to top
BLAST of Exocyst complex component vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G7Y9K10.000e+036.01Exocyst complex component OS=Clonorchis sinensis O... [more]
A0A4S2LF991.147e-17936.22Exocyst complex component OS=Opisthorchis felineus... [more]
A0A1S8X9C22.132e-17936.10Exocyst complex component OS=Opisthorchis viverrin... [more]
A0A3Q0KP406.497e-17935.79Exocyst complex component OS=Schistosoma mansoni O... [more]
A0A0R3U6G16.591e-17836.14Exocyst complex component OS=Mesocestoides corti O... [more]
back to top
BLAST of Exocyst complex component vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
exoc67.139e-13431.52exocyst complex component 6 [Source:NCBI gene;Acc:... [more]
exoc62.717e-13131.15exocyst complex component 6 [Source:NCBI gene;Acc:... [more]
exoc61.215e-13031.16exocyst complex component 6 [Source:NCBI gene;Acc:... [more]
exoc61.782e-12931.16exocyst complex component 6 [Source:NCBI gene;Acc:... [more]
exoc6b1.657e-12830.96exocyst complex component 6B [Source:NCBI gene;Acc... [more]
back to top
BLAST of Exocyst complex component vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
exoc6b6.364e-4535.04exocyst complex component 6B [Source:ZFIN;Acc:ZDB-... [more]
ENSPMAT00000005958.11.257e-3824.64pep scaffold:Pmarinus_7.0:GL480787:1115:18513:-1 g... [more]
ENSPMAT00000010427.16.705e-3735.68pep scaffold:Pmarinus_7.0:GL476649:196476:219160:-... [more]
exoc65.721e-2727.57exocyst complex component 6 [Source:ZFIN;Acc:ZDB-G... [more]
ENSPMAT00000000848.18.329e-2231.40pep scaffold:Pmarinus_7.0:GL477081:172551:184963:-... [more]
back to top
BLAST of Exocyst complex component vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Exocyst complex component vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO306992.717e-2434.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Exocyst complex component vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
exoc6b2.592e-13231.19exocyst complex component 6B [Source:NCBI gene;Acc... [more]
exoc61.710e-13130.67exocyst complex component 6 [Source:NCBI gene;Acc:... [more]
exoc6b4.111e-13131.19exocyst complex component 6B [Source:NCBI gene;Acc... [more]
exoc61.789e-12929.88exocyst complex component 6 [Source:NCBI gene;Acc:... [more]
exoc61.141e-12830.32exocyst complex component 6 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Exocyst complex component vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000065870.10.000e+099.43SMESG000065870.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019378 ID=SMED30019378|Name=Exocyst complex component|organism=Schmidtea mediterranea sexual|type=transcript|length=2994bp
GAACTCGAATTTCCTAGGTAAATGAATTTTTACTAATGACCAATAATTTA
ACTAATTTTGATTGGAATATTAATTTACGTTCTAGTGGAATCCACAGTGA
ATTATTAATTAAATTTGAAATAAATAAAGAATCTGAATCTGATAATAAAA
AAATATTATTAAATCTTTCTGATCAAGATTTGGATAAGCTCCTAGAATCG
TTAAATTCAATCAAAGATCGCATTAGTCAATTATCTCGATAAAAACTATG
AATGAATTTTCTTATATGTCATATTCAAATGTCAGCGATTTCAATAAAAA
TTTTTCAAATCTTATATCTGAAATCAAATCCAATTCTAGCGGTTCGATTG
CAAACATTATTCGAAAATTACGCCAATTAGAAACTTCTTCTGTTAATAAT
GATTCCAGCGAAATTTTGACAAAGTTTATGCGACATCTTGACAATGAAAT
TGAATTAAATAATCAAGACATTGAGAAATTTTGCAACCATTTCTATCAGT
GTTTCGTTGATTCGATTAAAGAGTTATTAAAAATCCAAGAGGAAGCGAGT
GAATTGAAAAGTAGCTTTGGCTCAGTTCAATCATCGCTAATGGAATCGGT
TAAAAAGATCAAACAAGACTGCAATGAATTATCAAAATGCCATTTAATAT
TGGCAAACATTGACAAAGCAGTTGAGAACCTTCAAGCTTGTCTGCCAGTT
TTTGATCAGTACTTAAAAGCTGCCAAAAGCATAAATGAAAAGCGCTACTA
TCCAGCATTGAAAACCCTTAATCATCTTGAACTCAATCAAATGCAACGCG
TGAGACAGTTCTCATTTTCTGACAATTTACAAAATAAAATTCCCGGAATG
CGTGAGCAAATCAAAGCTGCTAGTAAAGATGAGATAAAGGATTTCTTGGA
AAACGTTCGGAAACATTCTGTGGGATTGGGAATGTGTGCAATGAAACTAA
TGGCACATAAAACCGGCATGGAAGTCAATTTTGATAGTCCGACTAAACGG
ACTATGAATGGAGCGAGAATGAATAAAGGCGATGATAGTAAACGCGAGAA
TCCATTTGTCGGAATGCTCGATGAACCGGATTCCGTTAATAAAGAAATCC
AAGATCTTATTTCACTGGAATCGTACGGTAACGATAATGACGATTCGTCA
GAGTTGGAGTTAGAGTCCACCAATGTCGAAGATCGTGTGGATTTTGGTCC
GGTTTATCGATGTCTGCACATTCATTCTGTCCTTGGGGATCGGCATGAAT
TCGAAAAATGCTATCGAAACCAAAGGAAAAGGCAGTGCACGCTATTGTTG
ACATTGTCAAAGCAAGAATCTGTGAGAAATTATCATGAATTTCTCAGTGG
TGTTGTTGGATTTTTTGTTGTTGAAGATTACATTCGTCATAGTCAGATAT
CGATGGTGACGCGAAATTATCTGGACGAATTATGGTCTCAAACTATGCTC
AGAGTTGGAGATTTTGTTTCTGTAAATTCAGACAATATCAATGACATTGA
AAGCTTACTTAAACTGAAAGATTCTTGCGTTTTATTTGGAAAAACTATGC
GATCTCTTGGTTTTAATGTCGCTGGCTTTAAAGACTTCTATGAAGTATTA
AAAAAACAACATCAAAAATTATTAGGCAATGAATATTCAAACAAATTTAA
AGACATTTTTGAAGGTGAAGATTACACAGCTATAACTGTTCAAGATGCTT
CAGAAATGGAATTAGTCATAGATCTTTATCCCTATTTTCTTTCTCCAGAC
ATTGATATTTTACCTTATCCGAAATCTTTATCATTTTCATGGATGGTTCC
AAGAATCAACCAGGCAATTAGAGATCACATAAAGAAATGTAGGAAATTTT
CTGATAATTTGGAACTAAGTCAAACTGAACTGGAAGATCAATTGAACCAT
ACGACAAATGTATTGTTTTCACAAACACTGAAACATTTCCTGGTGAAAGC
CGTAAAAGATTCGGAACGTGAATTAAATAGATTAATCCAATTGGCCGTTA
ATATGGATGAATTGGAGTCGGCTTGTATTGGATTGCAGAATTTCATTTCA
TCTCTTGTTGGAACAGTTTATACAAACTCATATCAACTAATGGAAAGTTC
CTCGAATTCTGAAATGTTATTGGACGACAATTTATCCATTAATCCTCCTC
GATCTCGACTCCATGCATTTGCATTGTTTAAAGAATTACACTCGAAAATC
GAAAACTGTATTTATTCAGCCATCGATGCGAAAATCGACGACATGTTCGA
CGACAACGAATATCGACAAGTCAACTCTCATCATTCTTCCACAAATAATT
CTTTGGCTAATTCACCTAGCAAGAAATTTAATTCCATTTCCATTGACAAT
AATCAAATGAAACCATCAGATTTCATCACCGATGTCATAGCGTACCTCAG
CATCACTTTTGAATCCTTTACAAATCTACCGGCCAGATTAGCTCAAACCG
CGTGCTTGCTTTCTTGTAAATATATTGACAAAAAATTGAAAACATTTGTC
AACAGTGAAGCTCGAATTTCGGAAAGGTTTCTTCACCAATTGTCTACTGA
TATCAAGTCGTTGCAAGATTTTACTAGGAAAATTCCGGTTGCCGGTGTTT
CGGCCGATACGTTGATATTAGTCTTTGAAGATCTACGCCAATTGACAGCT
TTGGTGATCTTGTCCGATTGGGATACGTTTATCAAAAATTATAGAACAAA
TCAAAATCCCTACGATCGAGTTTTGACATCAAGTGCGATTAGTTTATTGG
AGAAAACTCGTCATAGTGATACCGGATTTTCCGCATTGATTAAATCACTG
AAAAAGAACAAACAAGACAAACGCGATGAAGAGATTTTGAAGCAATTAAA
AGAGCTCCATTGATTTTTTCTAAATTTCGATCGATCGATTTGTGTTATTA
TTGATATTATAATTGATTAAACTTTTCAATTTTTAATGGTTTCTTTCATT
ATTTTTTACTAAATGATTAGATAAATGATTTTCTGAGAAAAAAA
back to top

protein sequence of SMED30019378-orf-1

>SMED30019378-orf-1 ID=SMED30019378-orf-1|Name=SMED30019378-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=872bp
MNEFSYMSYSNVSDFNKNFSNLISEIKSNSSGSIANIIRKLRQLETSSVN
NDSSEILTKFMRHLDNEIELNNQDIEKFCNHFYQCFVDSIKELLKIQEEA
SELKSSFGSVQSSLMESVKKIKQDCNELSKCHLILANIDKAVENLQACLP
VFDQYLKAAKSINEKRYYPALKTLNHLELNQMQRVRQFSFSDNLQNKIPG
MREQIKAASKDEIKDFLENVRKHSVGLGMCAMKLMAHKTGMEVNFDSPTK
RTMNGARMNKGDDSKRENPFVGMLDEPDSVNKEIQDLISLESYGNDNDDS
SELELESTNVEDRVDFGPVYRCLHIHSVLGDRHEFEKCYRNQRKRQCTLL
LTLSKQESVRNYHEFLSGVVGFFVVEDYIRHSQISMVTRNYLDELWSQTM
LRVGDFVSVNSDNINDIESLLKLKDSCVLFGKTMRSLGFNVAGFKDFYEV
LKKQHQKLLGNEYSNKFKDIFEGEDYTAITVQDASEMELVIDLYPYFLSP
DIDILPYPKSLSFSWMVPRINQAIRDHIKKCRKFSDNLELSQTELEDQLN
HTTNVLFSQTLKHFLVKAVKDSERELNRLIQLAVNMDELESACIGLQNFI
SSLVGTVYTNSYQLMESSSNSEMLLDDNLSINPPRSRLHAFALFKELHSK
IENCIYSAIDAKIDDMFDDNEYRQVNSHHSSTNNSLANSPSKKFNSISID
NNQMKPSDFITDVIAYLSITFESFTNLPARLAQTACLLSCKYIDKKLKTF
VNSEARISERFLHQLSTDIKSLQDFTRKIPVAGVSADTLILVFEDLRQLT
ALVILSDWDTFIKNYRTNQNPYDRVLTSSAISLLEKTRHSDTGFSALIKS
LKKNKQDKRDEEILKQLKELH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006887exocytosis
GO:0006904vesicle docking involved in exocytosis
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR042045EXOC6/Sec15_C_dom1
IPR042044EXOC6/Sec15_C_dom2
IPR007225EXOC6/Sec15
IPR021934Sox_C
Vocabulary: cellular component
TermDefinition
GO:0000145exocyst
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 569..589
NoneNo IPR availableCOILSCoilCoilcoord: 191..211
IPR007225Exocyst complex component EXOC6/Sec15PFAMPF04091Sec15coord: 506..836
e-value: 3.8E-46
score: 158.0
IPR007225Exocyst complex component EXOC6/Sec15PIRSFPIRSF025007Sec15coord: 16..871
e-value: 1.5E-131
score: 437.8
IPR007225Exocyst complex component EXOC6/Sec15PANTHERPTHR12702SEC15coord: 57..870
IPR042045Exocyst complex component EXOC6/Sec15, C-terminal, domain 1GENE3DG3DSA:1.10.357.30coord: 441..618
e-value: 8.1E-40
score: 138.3
IPR042044Exocyst complex component EXOC6/Sec15, C-terminal, domain 2GENE3DG3DSA:1.20.58.670coord: 648..811
e-value: 7.5E-25
score: 89.4