Rab6-interacting protein 2/elks/erc/cast,putative

Overview
NameRab6-interacting protein 2/elks/erc/cast,putative
Smed IDSMED30019373
Length (bp)7245
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Rab6-interacting protein 2/elks/erc/cast,putative (SMED30019373) t-SNE clustered cells

Violin plots show distribution of expression levels for Rab6-interacting protein 2/elks/erc/cast,putative (SMED30019373) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Rab6-interacting protein 2/elks/erc/cast,putative (SMED30019373) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Rab6-interacting protein 2/elks/erc/cast,putative (SMED30019373) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019373

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 35

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30019373h1SMcG0009596 SmedASXL_043222SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30019373h1SMcG0009596 SmedASXL_017141SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30019373h1SMcG0009597 Contig28837newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019373h1SMcG0009597 Contig28837uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019373h1SMcG0009598 Contig28837newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019373h1SMcG0009598 Contig28837uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019373h1SMcG0009596 Contig45521newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019373h1SMcG0009596 Contig45521uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019373h1SMcG0009596 Contig28837newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019373h1SMcG0009596 Contig28837uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019373h1SMcG0009596 Contig11603newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019373h1SMcG0009596 Contig11603uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019373h1SMcG0009596 Contig41921uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019373h1SMcG0009596 Contig41921newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019373h1SMcG0009597 Contig45521newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019373h1SMcG0009597 Contig45521uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019373h1SMcG0009598 Contig50378newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019373h1SMcG0009598 Contig50378uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30019373h1SMcG0009596 dd_Smed_v4_12278_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30019373h1SMcG0009596 dd_Smed_v4_12278_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30019373h1SMcG0009596 dd_Smed_v4_12278_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30019373h1SMcG0009596 dd_Smed_v4_12278_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30019373h1SMcG0009596 dd_Smed_v4_12278_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30019373h1SMcG0009596 dd_Smed_v4_12278_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019373h1SMcG0009596 Contig55839newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019373h1SMcG0009596 Contig55839uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019373h1SMcG0009596 Contig50378newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019373h1SMcG0009596 Contig50378uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019373h1SMcG0009597 Contig50378newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019373h1SMcG0009597 Contig50378uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30019373h1SMcG0009596 dd_Smed_v6_12278_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30019373h1SMcG0009596 OX_Smed_1.0.14688ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
neuronSMED30019373h1SMcG0009596 dd_Smed_v6_12278_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cholinergic neuronSMED30019373h1SMcG0009596 dd_Smed_v6_12278_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
GABAergic neuronSMED30019373h1SMcG0009596 dd_Smed_v6_12278_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Rab6-interacting protein 2/elks/erc/cast,putative vs. Ensembl Human
Match: ERC1 (ELKS/RAB6-interacting/CAST family member 1 [Source:HGNC Symbol;Acc:HGNC:17072])

HSP 1 Score: 292.738 bits (748), Expect = 1.564e-80
Identity = 265/871 (30.42%), Postives = 473/871 (54.31%), Query Frame = 3
Query:  561 SQTNQQKLNAXXXXXXXXXXXDYERDPALMGSLRPQIPLPPPMAQNIYPAPM----MGSNPGY-------------DYHFPMI--------------DNVIMDYQTDLFSIQRELAKCQQELELTKEKLTSSVNSIKSFWSPELKRERSMRKDENSKYVLLAEELHQLQMEKKTMLSNVHQXXXXXXXXXXXXNKHSQ---------------TAQEIDLLYRRCDELEKENRILTKQSEEYEKRMISQKESLVTAEENIRKLLEVVKVAKSASSGHSALQGLRLERFEEDQTEIERLRSQIHEYSQRTIDLERAIVEKDFDISRNKEQGELLNQEVQNLRQENEHIRQDIQQTQTLQSLVDTKESKILTLENEIRLLEDELARMRDEELITPTTSVNGIDDYEKNMR--STVRPHERLMKSKLEALSCEISKRDSEIYSLQSRLEMAEKQHQDQNHHINVLKEQVKTREHKISMMMADVEDFXXXXXXXXXXXXXXSQILTSSQTEKHQTESEILDLKDQCEMKDKKISLLQRKVQNLEDLLNDKENQLTTAKSKLLNLHTEHSTTEGTKAGLEESLRDRERQLERLKESKTRMEHEFQDELEMQKKLVSETKSRLDNSERELREKVAMLNEMREELSELRAVKFKRESELNTIQVQCSQKTSEVAALQLELQTVRKQYI-SDTEYKSNHRISELESQINHYSDSATRLQGEVDRLLNMVRNLESEKLEKDRQITQLECQVKEHQNTISNMKRTHQNERNYLNEDIDVLKRKEDNILVDMEVIKTTLTERENRIKELEQALRESLQITAERESYVHNKEDSYRQLELKISDQKQNLEIIQKERNQLSGQLASAQEELREKETQLKTLESE 3026
            S  N Q LNA+          D+E     +GS  P+  +    +    P  +    MGS+P               ++H P +              DN IMD QT L  + RE    ++++E+ + KL+SS+NSIK+FWSPELK+ER++RKDE SK  +  E+   +Q E + M   + Q   +  R +   N+  Q               T +    L+   +   KE  +L K  EE E R+ +QK++L   +E+I+KLLE+++            +GL  +  EED           HE ++R  + E  +   +  + + +++  +L +E+   R EN     D  +T+ LQ++++ K+SKI ++E  +R LE+E+  ++       +      ++ E+ M+     R H + MK+K+  +  E+S++D+E+ +LQ++LE    Q  D   HI VLKE +  +E + +++  +V+  R RL+EKET+L KK++ +     EK     EI DLKD  ++K++K+++LQ+K++NL++ L DKE Q+++ K ++ +L  + + T+     LEE+L ++ER +ERLKE + R E E Q+E++  KK + + K ++   + +L EK A L +++E  S L +   K++S L T+++   QK  E   ++ +L+   +  + +    + + RI  LE +I  Y D +++ Q EVDRLL +++ +E+EK +KD++I +LE QVK+    ++N+K   Q E+    + ++  +R+EDN+    + ++ +L ++++RI+ELE+ALRES+QITAERE  +  +E +    E ++ +    +E +++E   +  +L+S Q+ L EKET L  L +E
Sbjct:   55 SMENIQSLNAAYATSGPMYLSDHEN----VGSETPKSTMTLGRSGGRLPYGVRMTAMGSSPNIASSGVASDTIAFGEHHLPPVSMASTVPHSLRQARDNTIMDLQTQLKEVLRENDLLRKDVEVKESKLSSSMNSIKTFWSPELKKERALRKDEASKITIWKEQYRVVQEENQHMQMTI-QALQDELRIQRDLNQLFQQDSSSRTGEPCVAELTEENFQRLHAEHERQAKELFLLRKTLEEMELRIETQKQTLNARDESIKKLLEMLQS-----------KGLSAKATEED-----------HERTRRLAEAEMHVHHLESLLEQKEKENSMLREEMHR-RFENA---PDSAKTKALQTVIEMKDSKISSMERGLRDLEEEIQMLK-------SNGALSTEEREEEMKQMEVYRSHSKFMKNKIGQVKQELSRKDTELLALQTKLETLTNQFSDSKQHIEVLKESLTAKEQRAAILQTEVDALRLRLEEKETMLNKKTKQIQDMAEEKGTQAGEIHDLKDMLDVKERKVNVLQKKIENLQEQLRDKEKQMSSLKERVKSLQADTTNTDTALTTLEEALAEKERTIERLKEQRDRDEREKQEEIDNYKKDLKDLKEKVSLLQGDLSEKEASLLDLKEHASSLASSGLKKDSRLKTLEIALEQKKEECLKMESQLKKAHEAALEARASPEMSDRIQHLEREITRYKDESSKAQAEVDRLLEILKEVENEKNDKDKKIAELERQVKDQNKKVANLKHKEQVEKKKSAQMLEEARRREDNLNDSSQQLQDSLRKKDDRIEELEEALRESVQITAEREMVLAQEESARTNAEKQVEELLMAMEKVKQELESMKAKLSSTQQSLAEKETHLTNLRAE 887          
BLAST of Rab6-interacting protein 2/elks/erc/cast,putative vs. Ensembl Human
Match: ERC1 (ELKS/RAB6-interacting/CAST family member 1 [Source:HGNC Symbol;Acc:HGNC:17072])

HSP 1 Score: 292.738 bits (748), Expect = 1.564e-80
Identity = 265/871 (30.42%), Postives = 473/871 (54.31%), Query Frame = 3
Query:  561 SQTNQQKLNAXXXXXXXXXXXDYERDPALMGSLRPQIPLPPPMAQNIYPAPM----MGSNPGY-------------DYHFPMI--------------DNVIMDYQTDLFSIQRELAKCQQELELTKEKLTSSVNSIKSFWSPELKRERSMRKDENSKYVLLAEELHQLQMEKKTMLSNVHQXXXXXXXXXXXXNKHSQ---------------TAQEIDLLYRRCDELEKENRILTKQSEEYEKRMISQKESLVTAEENIRKLLEVVKVAKSASSGHSALQGLRLERFEEDQTEIERLRSQIHEYSQRTIDLERAIVEKDFDISRNKEQGELLNQEVQNLRQENEHIRQDIQQTQTLQSLVDTKESKILTLENEIRLLEDELARMRDEELITPTTSVNGIDDYEKNMR--STVRPHERLMKSKLEALSCEISKRDSEIYSLQSRLEMAEKQHQDQNHHINVLKEQVKTREHKISMMMADVEDFXXXXXXXXXXXXXXSQILTSSQTEKHQTESEILDLKDQCEMKDKKISLLQRKVQNLEDLLNDKENQLTTAKSKLLNLHTEHSTTEGTKAGLEESLRDRERQLERLKESKTRMEHEFQDELEMQKKLVSETKSRLDNSERELREKVAMLNEMREELSELRAVKFKRESELNTIQVQCSQKTSEVAALQLELQTVRKQYI-SDTEYKSNHRISELESQINHYSDSATRLQGEVDRLLNMVRNLESEKLEKDRQITQLECQVKEHQNTISNMKRTHQNERNYLNEDIDVLKRKEDNILVDMEVIKTTLTERENRIKELEQALRESLQITAERESYVHNKEDSYRQLELKISDQKQNLEIIQKERNQLSGQLASAQEELREKETQLKTLESE 3026
            S  N Q LNA+          D+E     +GS  P+  +    +    P  +    MGS+P               ++H P +              DN IMD QT L  + RE    ++++E+ + KL+SS+NSIK+FWSPELK+ER++RKDE SK  +  E+   +Q E + M   + Q   +  R +   N+  Q               T +    L+   +   KE  +L K  EE E R+ +QK++L   +E+I+KLLE+++            +GL  +  EED           HE ++R  + E  +   +  + + +++  +L +E+   R EN     D  +T+ LQ++++ K+SKI ++E  +R LE+E+  ++       +      ++ E+ M+     R H + MK+K+  +  E+S++D+E+ +LQ++LE    Q  D   HI VLKE +  +E + +++  +V+  R RL+EKET+L KK++ +     EK     EI DLKD  ++K++K+++LQ+K++NL++ L DKE Q+++ K ++ +L  + + T+     LEE+L ++ER +ERLKE + R E E Q+E++  KK + + K ++   + +L EK A L +++E  S L +   K++S L T+++   QK  E   ++ +L+   +  + +    + + RI  LE +I  Y D +++ Q EVDRLL +++ +E+EK +KD++I +LE QVK+    ++N+K   Q E+    + ++  +R+EDN+    + ++ +L ++++RI+ELE+ALRES+QITAERE  +  +E +    E ++ +    +E +++E   +  +L+S Q+ L EKET L  L +E
Sbjct:   55 SMENIQSLNAAYATSGPMYLSDHEN----VGSETPKSTMTLGRSGGRLPYGVRMTAMGSSPNIASSGVASDTIAFGEHHLPPVSMASTVPHSLRQARDNTIMDLQTQLKEVLRENDLLRKDVEVKESKLSSSMNSIKTFWSPELKKERALRKDEASKITIWKEQYRVVQEENQHMQMTI-QALQDELRIQRDLNQLFQQDSSSRTGEPCVAELTEENFQRLHAEHERQAKELFLLRKTLEEMELRIETQKQTLNARDESIKKLLEMLQS-----------KGLSAKATEED-----------HERTRRLAEAEMHVHHLESLLEQKEKENSMLREEMHR-RFENA---PDSAKTKALQTVIEMKDSKISSMERGLRDLEEEIQMLK-------SNGALSTEEREEEMKQMEVYRSHSKFMKNKIGQVKQELSRKDTELLALQTKLETLTNQFSDSKQHIEVLKESLTAKEQRAAILQTEVDALRLRLEEKETMLNKKTKQIQDMAEEKGTQAGEIHDLKDMLDVKERKVNVLQKKIENLQEQLRDKEKQMSSLKERVKSLQADTTNTDTALTTLEEALAEKERTIERLKEQRDRDEREKQEEIDNYKKDLKDLKEKVSLLQGDLSEKEASLLDLKEHASSLASSGLKKDSRLKTLEIALEQKKEECLKMESQLKKAHEAALEARASPEMSDRIQHLEREITRYKDESSKAQAEVDRLLEILKEVENEKNDKDKKIAELERQVKDQNKKVANLKHKEQVEKKKSAQMLEEARRREDNLNDSSQQLQDSLRKKDDRIEELEEALRESVQITAEREMVLAQEESARTNAEKQVEELLMAMEKVKQELESMKAKLSSTQQSLAEKETHLTNLRAE 887          
BLAST of Rab6-interacting protein 2/elks/erc/cast,putative vs. Ensembl Human
Match: ERC1 (ELKS/RAB6-interacting/CAST family member 1 [Source:HGNC Symbol;Acc:HGNC:17072])

HSP 1 Score: 286.96 bits (733), Expect = 2.642e-79
Identity = 265/875 (30.29%), Postives = 473/875 (54.06%), Query Frame = 3
Query:  561 SQTNQQKLNAXXXXXXXXXXXDYERDPALMGSLRPQIPLPPPMAQNIYPAPM----MGSNPGY-------------DYHFPMI--------------DNVIMDYQTDLFSIQRELAKCQQELELTKEKLTSSVNSIKSFWSPELKRERSMRKDENSKYVLLAEELHQLQMEKKTMLSNVHQXXXXXXXXXXXXNKHSQ---------------TAQEIDLLYRRCDELEKENRILTKQSEEYEKRMISQKESLVTAEENIRKLLEVVKVAKSASSGHSALQGLRLERFEEDQTEIERLRSQIHEYSQRTIDLERAIVEKDFDISRNKEQGELLNQEVQNLRQENEHIRQDIQQTQTLQSLVDTKESKILTLENEIRLLEDELARMRDEELITPTTSVNGIDDYEKNMR--STVRPHERLMKSKLEALSCEISKRDSEIYSLQSRLEMAEKQHQDQNHHINVLKEQVKTREHKISMMMADVEDFXXXXXXXXXXXXXXSQILTSSQTEKHQTESEILDLKDQCEMKDKKISLLQRKVQNLEDLLNDKENQLTTAKSKLLNLHTEHSTTEGTKAGLEESLRDRERQLERLKESKTRMEHEFQDELEMQKKLVSETKSRLDNSERELREKVAMLNEMREELSELRAVKFKRESELNTIQVQCSQKTSEVAALQLELQTVRKQYI-SDTEYKSNHRISELESQINHYSDSATRLQGEVDRLLNMVRNLESEKLEKDRQITQLEC----QVKEHQNTISNMKRTHQNERNYLNEDIDVLKRKEDNILVDMEVIKTTLTERENRIKELEQALRESLQITAERESYVHNKEDSYRQLELKISDQKQNLEIIQKERNQLSGQLASAQEELREKETQLKTLESE 3026
            S  N Q LNA+          D+E     +GS  P+  +    +    P  +    MGS+P               ++H P +              DN IMD QT L  + RE    ++++E+ + KL+SS+NSIK+FWSPELK+ER++RKDE SK  +  E+   +Q E + M   + Q   +  R +   N+  Q               T +    L+   +   KE  +L K  EE E R+ +QK++L   +E+I+KLLE+++            +GL  +  EED           HE ++R  + E  +   +  + + +++  +L +E+   R EN     D  +T+ LQ++++ K+SKI ++E  +R LE+E+  ++       +      ++ E+ M+     R H + MK+K+  +  E+S++D+E+ +LQ++LE    Q  D   HI VLKE +  +E + +++  +V+  R RL+EKET+L KK++ +     EK     EI DLKD  ++K++K+++LQ+K++NL++ L DKE Q+++ K ++ +L  + + T+     LEE+L ++ER +ERLKE + R E E Q+E++  KK + + K ++   + +L EK A L +++E  S L +   K++S L T+++   QK  E   ++ +L+   +  + +    + + RI  LE +I  Y D +++ Q EVDRLL +++ +E+EK +KD++I +LE     QVK+    ++N+K   Q E+    + ++  +R+EDN+    + ++ +L ++++RI+ELE+ALRES+QITAERE  +  +E +    E ++ +    +E +++E   +  +L+S Q+ L EKET L  L +E
Sbjct:   55 SMENIQSLNAAYATSGPMYLSDHEN----VGSETPKSTMTLGRSGGRLPYGVRMTAMGSSPNIASSGVASDTIAFGEHHLPPVSMASTVPHSLRQARDNTIMDLQTQLKEVLRENDLLRKDVEVKESKLSSSMNSIKTFWSPELKKERALRKDEASKITIWKEQYRVVQEENQHMQMTI-QALQDELRIQRDLNQLFQQDSSSRTGEPCVAELTEENFQRLHAEHERQAKELFLLRKTLEEMELRIETQKQTLNARDESIKKLLEMLQS-----------KGLSAKATEED-----------HERTRRLAEAEMHVHHLESLLEQKEKENSMLREEMHR-RFENA---PDSAKTKALQTVIEMKDSKISSMERGLRDLEEEIQMLK-------SNGALSTEEREEEMKQMEVYRSHSKFMKNKIGQVKQELSRKDTELLALQTKLETLTNQFSDSKQHIEVLKESLTAKEQRAAILQTEVDALRLRLEEKETMLNKKTKQIQDMAEEKGTQAGEIHDLKDMLDVKERKVNVLQKKIENLQEQLRDKEKQMSSLKERVKSLQADTTNTDTALTTLEEALAEKERTIERLKEQRDRDEREKQEEIDNYKKDLKDLKEKVSLLQGDLSEKEASLLDLKEHASSLASSGLKKDSRLKTLEIALEQKKEECLKMESQLKKAHEAALEARASPEMSDRIQHLEREITRYKDESSKAQAEVDRLLEILKEVENEKNDKDKKIAELESLTSRQVKDQNKKVANLKHKEQVEKKKSAQMLEEARRREDNLNDSSQQLQDSLRKKDDRIEELEEALRESVQITAEREMVLAQEESARTNAEKQVEELLMAMEKVKQELESMKAKLSSTQQSLAEKETHLTNLRAE 891          
BLAST of Rab6-interacting protein 2/elks/erc/cast,putative vs. Ensembl Human
Match: ERC1 (ELKS/RAB6-interacting/CAST family member 1 [Source:HGNC Symbol;Acc:HGNC:17072])

HSP 1 Score: 280.796 bits (717), Expect = 1.092e-76
Identity = 267/899 (29.70%), Postives = 474/899 (52.73%), Query Frame = 3
Query:  561 SQTNQQKLNAXXXXXXXXXXXDYERDPALMGSLRPQIPLPPPMAQNIYPAPM----MGSNPGY-------------DYHFPMI--------------DNVIMDYQTDLFSIQRELAKCQQELELTKEKLTSSVNSIKSFWSPELKRERSMRKDENSKYVLLAEELHQLQMEKKTMLSNVHQXXXXXXXXXXXXNKHSQ---------------TAQEIDLLYRRCDELEKENRILTKQSEEYEKRMISQKESLVTAEENIRKLLEVVKVAKSASSGHSALQGLRLERFEEDQTEIERLRSQIHEYSQRTIDLERAIVEKDFDISRNKEQGELLNQEVQNLRQENEHIRQDIQQTQTLQSLVDTKESKILTLENEIRLLEDELARMRDEELITPTTSVNGIDDYEKNMR--STVRPHERLMKSKLEALS----------------------------CEISKRDSEIYSLQSRLEMAEKQHQDQNHHINVLKEQVKTREHKISMMMADVEDFXXXXXXXXXXXXXXSQILTSSQTEKHQTESEILDLKDQCEMKDKKISLLQRKVQNLEDLLNDKENQLTTAKSKLLNLHTEHSTTEGTKAGLEESLRDRERQLERLKESKTRMEHEFQDELEMQKKLVSETKSRLDNSERELREKVAMLNEMREELSELRAVKFKRESELNTIQVQCSQKTSEVAALQLELQTVRKQYI-SDTEYKSNHRISELESQINHYSDSATRLQGEVDRLLNMVRNLESEKLEKDRQITQLECQVKEHQNTISNMKRTHQNERNYLNEDIDVLKRKEDNILVDMEVIKTTLTERENRIKELEQALRESLQITAERESYVHNKEDSYRQLELKISDQKQNLEIIQKERNQLSGQLASAQEELREKETQLKTLESE 3026
            S  N Q LNA+          D+E     +GS  P+  +    +    P  +    MGS+P               ++H P +              DN IMD QT L  + RE    ++++E+ + KL+SS+NSIK+FWSPELK+ER++RKDE SK  +  E+   +Q E + M   + Q   +  R +   N+  Q               T +    L+   +   KE  +L K  EE E R+ +QK++L   +E+I+KLLE+++            +GL  +  EED           HE ++R  + E  +   +  + + +++  +L +E+   R EN     D  +T+ LQ++++ K+SKI ++E  +R LE+E+  ++       +      ++ E+ M+     R H + MK+K+E L                              E+S++D+E+ +LQ++LE    Q  D   HI VLKE +  +E + +++  +V+  R RL+EKET+L KK++ +     EK     EI DLKD  ++K++K+++LQ+K++NL++ L DKE Q+++ K ++ +L  + + T+     LEE+L ++ER +ERLKE + R E E Q+E++  KK + + K ++   + +L EK A L +++E  S L +   K++S L T+++   QK  E   ++ +L+   +  + +    + + RI  LE +I  Y D +++ Q EVDRLL +++ +E+EK +KD++I +LE QVK+    ++N+K   Q E+    + ++  +R+EDN+    + ++ +L ++++RI+ELE+ALRES+QITAERE  +  +E +    E ++ +    +E +++E   +  +L+S Q+ L EKET L  L +E
Sbjct:   55 SMENIQSLNAAYATSGPMYLSDHEN----VGSETPKSTMTLGRSGGRLPYGVRMTAMGSSPNIASSGVASDTIAFGEHHLPPVSMASTVPHSLRQARDNTIMDLQTQLKEVLRENDLLRKDVEVKESKLSSSMNSIKTFWSPELKKERALRKDEASKITIWKEQYRVVQEENQHMQMTI-QALQDELRIQRDLNQLFQQDSSSRTGEPCVAELTEENFQRLHAEHERQAKELFLLRKTLEEMELRIETQKQTLNARDESIKKLLEMLQS-----------KGLSAKATEED-----------HERTRRLAEAEMHVHHLESLLEQKEKENSMLREEMHR-RFENA---PDSAKTKALQTVIEMKDSKISSMERGLRDLEEEIQMLK-------SNGALSTEEREEEMKQMEVYRSHSKFMKNKVEQLKEELSSKEAQWEELKKKAAGLQAEIGQVKQELSRKDTELLALQTKLETLTNQFSDSKQHIEVLKESLTAKEQRAAILQTEVDALRLRLEEKETMLNKKTKQIQDMAEEKGTQAGEIHDLKDMLDVKERKVNVLQKKIENLQEQLRDKEKQMSSLKERVKSLQADTTNTDTALTTLEEALAEKERTIERLKEQRDRDEREKQEEIDNYKKDLKDLKEKVSLLQGDLSEKEASLLDLKEHASSLASSGLKKDSRLKTLEIALEQKKEECLKMESQLKKAHEAALEARASPEMSDRIQHLEREITRYKDESSKAQAEVDRLLEILKEVENEKNDKDKKIAELERQVKDQNKKVANLKHKEQVEKKKSAQMLEEARRREDNLNDSSQQLQDSLRKKDDRIEELEEALRESVQITAEREMVLAQEESARTNAEKQVEELLMAMEKVKQELESMKAKLSSTQQSLAEKETHLTNLRAE 915          
BLAST of Rab6-interacting protein 2/elks/erc/cast,putative vs. Ensembl Human
Match: ERC1 (ELKS/RAB6-interacting/CAST family member 1 [Source:HGNC Symbol;Acc:HGNC:17072])

HSP 1 Score: 280.411 bits (716), Expect = 1.930e-76
Identity = 267/899 (29.70%), Postives = 474/899 (52.73%), Query Frame = 3
Query:  561 SQTNQQKLNAXXXXXXXXXXXDYERDPALMGSLRPQIPLPPPMAQNIYPAPM----MGSNPGY-------------DYHFPMI--------------DNVIMDYQTDLFSIQRELAKCQQELELTKEKLTSSVNSIKSFWSPELKRERSMRKDENSKYVLLAEELHQLQMEKKTMLSNVHQXXXXXXXXXXXXNKHSQ---------------TAQEIDLLYRRCDELEKENRILTKQSEEYEKRMISQKESLVTAEENIRKLLEVVKVAKSASSGHSALQGLRLERFEEDQTEIERLRSQIHEYSQRTIDLERAIVEKDFDISRNKEQGELLNQEVQNLRQENEHIRQDIQQTQTLQSLVDTKESKILTLENEIRLLEDELARMRDEELITPTTSVNGIDDYEKNMR--STVRPHERLMKSKLEALS----------------------------CEISKRDSEIYSLQSRLEMAEKQHQDQNHHINVLKEQVKTREHKISMMMADVEDFXXXXXXXXXXXXXXSQILTSSQTEKHQTESEILDLKDQCEMKDKKISLLQRKVQNLEDLLNDKENQLTTAKSKLLNLHTEHSTTEGTKAGLEESLRDRERQLERLKESKTRMEHEFQDELEMQKKLVSETKSRLDNSERELREKVAMLNEMREELSELRAVKFKRESELNTIQVQCSQKTSEVAALQLELQTVRKQYI-SDTEYKSNHRISELESQINHYSDSATRLQGEVDRLLNMVRNLESEKLEKDRQITQLECQVKEHQNTISNMKRTHQNERNYLNEDIDVLKRKEDNILVDMEVIKTTLTERENRIKELEQALRESLQITAERESYVHNKEDSYRQLELKISDQKQNLEIIQKERNQLSGQLASAQEELREKETQLKTLESE 3026
            S  N Q LNA+          D+E     +GS  P+  +    +    P  +    MGS+P               ++H P +              DN IMD QT L  + RE    ++++E+ + KL+SS+NSIK+FWSPELK+ER++RKDE SK  +  E+   +Q E + M   + Q   +  R +   N+  Q               T +    L+   +   KE  +L K  EE E R+ +QK++L   +E+I+KLLE+++            +GL  +  EED           HE ++R  + E  +   +  + + +++  +L +E+   R EN     D  +T+ LQ++++ K+SKI ++E  +R LE+E+  ++       +      ++ E+ M+     R H + MK+K+E L                              E+S++D+E+ +LQ++LE    Q  D   HI VLKE +  +E + +++  +V+  R RL+EKET+L KK++ +     EK     EI DLKD  ++K++K+++LQ+K++NL++ L DKE Q+++ K ++ +L  + + T+     LEE+L ++ER +ERLKE + R E E Q+E++  KK + + K ++   + +L EK A L +++E  S L +   K++S L T+++   QK  E   ++ +L+   +  + +    + + RI  LE +I  Y D +++ Q EVDRLL +++ +E+EK +KD++I +LE QVK+    ++N+K   Q E+    + ++  +R+EDN+    + ++ +L ++++RI+ELE+ALRES+QITAERE  +  +E +    E ++ +    +E +++E   +  +L+S Q+ L EKET L  L +E
Sbjct:   55 SMENIQSLNAAYATSGPMYLSDHEN----VGSETPKSTMTLGRSGGRLPYGVRMTAMGSSPNIASSGVASDTIAFGEHHLPPVSMASTVPHSLRQARDNTIMDLQTQLKEVLRENDLLRKDVEVKESKLSSSMNSIKTFWSPELKKERALRKDEASKITIWKEQYRVVQEENQHMQMTI-QALQDELRIQRDLNQLFQQDSSSRTGEPCVAELTEENFQRLHAEHERQAKELFLLRKTLEEMELRIETQKQTLNARDESIKKLLEMLQS-----------KGLSAKATEED-----------HERTRRLAEAEMHVHHLESLLEQKEKENSMLREEMHR-RFENA---PDSAKTKALQTVIEMKDSKISSMERGLRDLEEEIQMLK-------SNGALSTEEREEEMKQMEVYRSHSKFMKNKVEQLKEELSSKEAQWEELKKKAAGLQAEIGQVKQELSRKDTELLALQTKLETLTNQFSDSKQHIEVLKESLTAKEQRAAILQTEVDALRLRLEEKETMLNKKTKQIQDMAEEKGTQAGEIHDLKDMLDVKERKVNVLQKKIENLQEQLRDKEKQMSSLKERVKSLQADTTNTDTALTTLEEALAEKERTIERLKEQRDRDEREKQEEIDNYKKDLKDLKEKVSLLQGDLSEKEASLLDLKEHASSLASSGLKKDSRLKTLEIALEQKKEECLKMESQLKKAHEAALEARASPEMSDRIQHLEREITRYKDESSKAQAEVDRLLEILKEVENEKNDKDKKIAELERQVKDQNKKVANLKHKEQVEKKKSAQMLEEARRREDNLNDSSQQLQDSLRKKDDRIEELEEALRESVQITAEREMVLAQEESARTNAEKQVEELLMAMEKVKQELESMKAKLSSTQQSLAEKETHLTNLRAE 915          
BLAST of Rab6-interacting protein 2/elks/erc/cast,putative vs. Ensembl Celegans
Match: elks-1 (Mammalian ELKS/CAST/ERC/Rab6 interacting protein homolog [Source:UniProtKB/TrEMBL;Acc:O44490])

HSP 1 Score: 60.4622 bits (145), Expect = 1.929e-8
Identity = 127/518 (24.52%), Postives = 240/518 (46.33%), Query Frame = 3
Query: 1467 QDIQQTQTLQSLVDTKE-SKILTLENEIRLLEDELARMRD--EELITPTTS-VNGIDDY-EKNMRSTVRPHE-RLMKSKLEALSCEISKRDSEIYSLQSRLEMAEKQHQDQNHHINVLKEQVKTREHKISMMMADVEDFXXXXXXXXXXXXXXSQILTSSQTEKHQTESEILDLKDQCEMKDKKISLLQRKVQNLEDLLNDKENQLTTAKSKLLNLHTEHSTTEGTKAGLEESLRDRERQLERLKESKTRMEHEFQDELEMQKKL---VSETKSRLDNSERELREKVAMLNEMREELSELRAVKFKRESELNTIQVQCSQKTSEVAALQLELQTVRKQYISDTEYKSNHRISELESQINHYSDSATRLQGEVDRLLNMVRNLESEKLEKDRQITQLECQVKEHQNTISNMKRTHQNERNYLNEDIDVLKRKEDNILVDMEVIKTTLTERENRIKELEQALRESLQITAERESYVHNKEDSYRQLELKISDQKQNLEIIQKERNQLSGQLASAQEELRE 2993
            QD+  T+  QS++ +++ S    +EN +R ++++ AR+ +  EEL+       N   D+ +KN+      HE   M+ K++    E++++  E++  Q+R++ AE+   +   H+ +LK+Q+  RE   +++  DV+  R++L  K   LE+K + + + + +   +++++ D  +     + K S L  +V +LE  + +KE +L  AK +LL+ H +    +     +E+  R+R+R  E + + +   E   +D +E QK     +++ K+ ++N ++EL ++  +L    E++ ++           N   VQ  ++  + A +      +R+    D E   N                      EV++LL MV +LE E L    Q  QL+        T S         R+            ++N+                RI+ELE+ALRES+ ITAERE  VH            +S QK +L+       Q+S QL  A++E+ E
Sbjct:  269 QDLLTTKETQSMMASQDPSGRQAIENALRRIDEKQARIVELEEELMRQRMGRSNQPRDFTDKNLSG----HEMATMRMKMDRSEVELAEKKQELFGCQTRMQTAEETANEMRGHLQLLKDQLTNREQHNTLLQGDVDALRQKLDSKNKQLEQKDERVAALERDLSSSKADVSDKGELIRQTEMKTSQLIGRVDSLETTVREKEQELDRAKIRLLS-HPDVVKEKEMTEKIEQGERERQRLAEHIDQVRRNAE---KDAMEQQKTYQNEMTQLKATIENLQKELSDRDILLESQNEKIGDM-----------NRDLVQAKKRLDD-AMVDKGTDELRR----DVEGARN----------------------EVEKLLKMVHSLEKENLTLTAQCKQLKRDDTPRAGTTSAPSAPGTLTRST---------SAQNNM--------------HKRIEELEEALRESVSITAERE--VH------------LSQQKHHLQ-------QVSSQLNEARKEITE 696          

HSP 2 Score: 59.6918 bits (143), Expect = 2.595e-8
Identity = 31/72 (43.06%), Postives = 43/72 (59.72%), Query Frame = 3
Query:  735 YDYHFPMIDNVIMDYQTDLFSIQRELAKCQQELELTKEKLTSSVNSIKSFWSPELKRERSMRKDENSKYVLL 950
            YD   P I  +     + L +I RE  + + E +   EKL  ++NSIK+FWSPELKRER MR+DE ++   L
Sbjct:  135 YDLMQPGISRIPTGTGSGL-NIAREYEQLKVEYDTMMEKLNQTMNSIKTFWSPELKRERQMRRDEATRIAQL 205          
BLAST of Rab6-interacting protein 2/elks/erc/cast,putative vs. Ensembl Fly
Match: brp (gene:FBgn0259246 transcript:FBtr0305060)

HSP 1 Score: 134.035 bits (336), Expect = 1.279e-30
Identity = 82/204 (40.20%), Postives = 140/204 (68.63%), Query Frame = 3
Query: 1677 KSKLEALSCEISKRDSEIYSLQSRLEMAEKQHQDQNHHINVLKEQVKTREHKISMMMADVEDFXXXXXXXXXXXXXXSQILTSSQTEKHQTESEILDLKDQCEMKDKKISLLQRKVQNLEDLLNDKENQLTTAKSKLLNLHTEHSTTEGTKAGLEESLRDRERQLERLKESKTRMEHEFQDELEMQKKLVSETKSRLDNSEREL 2288
            K +L+    EI +RD EI ++ ++++  E+QHQD   HI VLKE +  +E   +M+  DVE+ R RL+EK  L+EKK+Q    +  E+++  SE+ +LKD  ++KD+KIS+LQRK++NLEDLL +K+NQ+  A+++L  +   HS++EG    LEE++ D+E+Q+ +L++ + R EHE Q+E ++ ++ V++ K +L  +E E+
Sbjct:  780 KRQLDEFRLEIQRRDQEILAMAAKMKTLEEQHQDYQRHIAVLKESLCAKEEHYNMLQTDVEEMRARLEEKNRLIEKKTQGTLQTVQERNRLTSELTELKDHMDIKDRKISVLQRKIENLEDLLKEKDNQVDMARARLSAMQAHHSSSEGALTSLEEAIGDKEKQMAQLRDQRDRAEHEKQEERDLHEREVADYKIKLRAAESEV 983          

HSP 2 Score: 101.293 bits (251), Expect = 1.174e-20
Identity = 73/178 (41.01%), Postives = 112/178 (62.92%), Query Frame = 3
Query:  705 PAPMMGSNPGYDYHFPMIDNVIM-DYQTDLFSIQRELAKCQQELELTKEKLTSSVNSIKSFWSPELKRERSMRKDENSKYVLLAEELHQLQME--KKTMLSNVHQXXXXXXXXXXXXNKHSQTAQEIDLLYRRCDELEKENRILTKQSEEYEKRMISQKESLVTAEENIRKLLEVVKV 1229
            P+ M G N G     P  D   + D Q     +QREL   ++ELELT +KL SS++SIK+FWSPELK+ER++RK+E++KY L+ ++L  L  E  K+ ML  V QLE ELR      N   Q  Q+++ +Y   D L++E  IL +  ++ E R+ +QK++L+  +E+I+KLLE+++ 
Sbjct:  138 PSAMGGYNTGMG---PTSDRAYLGDLQHQNTDLQRELGNLKRELELTNQKLGSSMHSIKTFWSPELKKERALRKEESAKYSLINDQLKLLSTENQKQAML--VRQLEEELRLRMRQPNLEMQ--QQMEAIYAENDHLQREISILRETIKDLECRVETQKQTLIARDESIKKLLEMLQA 308          
BLAST of Rab6-interacting protein 2/elks/erc/cast,putative vs. Ensembl Fly
Match: brp (gene:FBgn0259246 transcript:FBtr0300245)

HSP 1 Score: 130.954 bits (328), Expect = 1.063e-29
Identity = 81/201 (40.30%), Postives = 138/201 (68.66%), Query Frame = 3
Query: 1686 LEALSCEISKRDSEIYSLQSRLEMAEKQHQDQNHHINVLKEQVKTREHKISMMMADVEDFXXXXXXXXXXXXXXSQILTSSQTEKHQTESEILDLKDQCEMKDKKISLLQRKVQNLEDLLNDKENQLTTAKSKLLNLHTEHSTTEGTKAGLEESLRDRERQLERLKESKTRMEHEFQDELEMQKKLVSETKSRLDNSEREL 2288
            L+    EI +RD EI ++ ++++  E+QHQD   HI VLKE +  +E   +M+  DVE+ R RL+EK  L+EKK+Q    +  E+++  SE+ +LKD  ++KD+KIS+LQRK++NLEDLL +K+NQ+  A+++L  +   HS++EG    LEE++ D+E+Q+ +L++ + R EHE Q+E ++ ++ V++ K +L  +E E+
Sbjct:  331 LDEFRLEIQRRDQEILAMAAKMKTLEEQHQDYQRHIAVLKESLCAKEEHYNMLQTDVEEMRARLEEKNRLIEKKTQGTLQTVQERNRLTSELTELKDHMDIKDRKISVLQRKIENLEDLLKEKDNQVDMARARLSAMQAHHSSSEGALTSLEEAIGDKEKQMAQLRDQRDRAEHEKQEERDLHEREVADYKIKLRAAESEV 531          

HSP 2 Score: 102.064 bits (253), Expect = 6.928e-21
Identity = 106/342 (30.99%), Postives = 161/342 (47.08%), Query Frame = 3
Query:  213 SRTNPNQISSTIPRQKPIPNALESDLSGYQYNTQTLPLVTQYSTNKSISTQNLSSIGNQYYSYRDRMPLDNQMIITNPINERPRPASARDPGFTDLMDMPTPQQRRLYETLYTPRHSQTNQQKLNAXXXXXXXXXXXDYERDPALMGSLRPQIPLPPPMAQNIYPAPMMGSNPGYDYHFPMIDNVIM-DYQTDLFSIQRELAKCQQELELTKEKLTSSVNSIKSFWSPELKRERSMRKDENSKYVLLAEELHQLQME--KKTMLSNVHQXXXXXXXXXXXXNKHSQTAQEIDLLYRRCDELEKENRILTKQSEEYEKRMISQKESLVTAEENIRKLLEVVKV 1229
            SR + N ++S+  R             G     Q LP V + S ++       S +      YRD   +D         + R R AS   P     MD P  + + L        H +                   D  RD +L   L  +  L    A+   P+ M G N G     P  D   + D Q     +QREL   ++ELELT +KL SS++SIK+FWSPELK+ER++RK+E++KY L+ ++L  L  E  K+ ML  V QLE ELR      N   Q  Q+++ +Y   D L++E  IL +  ++ E R+ +QK++L+  +E+I+KLLE+++ 
Sbjct:    2 SRDDYNPVTSSGVRS-----------PGRVRRLQELPTVDR-SPSRDYGAPRGSPLAMGSPYYRD---MDEPTSPAGAGHHRSRSASR--PPMAHAMDYPRTRYQSLDRGGLVDPHDR----------EFIPIREPRDRSRDRSLERGLYLEDELYGRSARQ-SPSAMGGYNTGMG---PTSDRAYLGDLQHQNTDLQRELGNLKRELELTNQKLGSSMHSIKTFWSPELKKERALRKEESAKYSLINDQLKLLSTENQKQAML--VRQLEEELRLRMRQPNLEMQ--QQMEAIYAENDHLQREISILRETIKDLECRVETQKQTLIARDESIKKLLEMLQA 308          
BLAST of Rab6-interacting protein 2/elks/erc/cast,putative vs. Ensembl Fly
Match: brp (gene:FBgn0259246 transcript:FBtr0336693)

HSP 1 Score: 130.568 bits (327), Expect = 1.101e-29
Identity = 81/201 (40.30%), Postives = 138/201 (68.66%), Query Frame = 3
Query: 1686 LEALSCEISKRDSEIYSLQSRLEMAEKQHQDQNHHINVLKEQVKTREHKISMMMADVEDFXXXXXXXXXXXXXXSQILTSSQTEKHQTESEILDLKDQCEMKDKKISLLQRKVQNLEDLLNDKENQLTTAKSKLLNLHTEHSTTEGTKAGLEESLRDRERQLERLKESKTRMEHEFQDELEMQKKLVSETKSRLDNSEREL 2288
            L+    EI +RD EI ++ ++++  E+QHQD   HI VLKE +  +E   +M+  DVE+ R RL+EK  L+EKK+Q    +  E+++  SE+ +LKD  ++KD+KIS+LQRK++NLEDLL +K+NQ+  A+++L  +   HS++EG    LEE++ D+E+Q+ +L++ + R EHE Q+E ++ ++ V++ K +L  +E E+
Sbjct:  285 LDEFRLEIQRRDQEILAMAAKMKTLEEQHQDYQRHIAVLKESLCAKEEHYNMLQTDVEEMRARLEEKNRLIEKKTQGTLQTVQERNRLTSELTELKDHMDIKDRKISVLQRKIENLEDLLKEKDNQVDMARARLSAMQAHHSSSEGALTSLEEAIGDKEKQMAQLRDQRDRAEHEKQEERDLHEREVADYKIKLRAAESEV 485          

HSP 2 Score: 101.293 bits (251), Expect = 8.929e-21
Identity = 73/178 (41.01%), Postives = 112/178 (62.92%), Query Frame = 3
Query:  705 PAPMMGSNPGYDYHFPMIDNVIM-DYQTDLFSIQRELAKCQQELELTKEKLTSSVNSIKSFWSPELKRERSMRKDENSKYVLLAEELHQLQME--KKTMLSNVHQXXXXXXXXXXXXNKHSQTAQEIDLLYRRCDELEKENRILTKQSEEYEKRMISQKESLVTAEENIRKLLEVVKV 1229
            P+ M G N G     P  D   + D Q     +QREL   ++ELELT +KL SS++SIK+FWSPELK+ER++RK+E++KY L+ ++L  L  E  K+ ML  V QLE ELR      N   Q  Q+++ +Y   D L++E  IL +  ++ E R+ +QK++L+  +E+I+KLLE+++ 
Sbjct:   92 PSAMGGYNTGMG---PTSDRAYLGDLQHQNTDLQRELGNLKRELELTNQKLGSSMHSIKTFWSPELKKERALRKEESAKYSLINDQLKLLSTENQKQAML--VRQLEEELRLRMRQPNLEMQ--QQMEAIYAENDHLQREISILRETIKDLECRVETQKQTLIARDESIKKLLEMLQA 262          
BLAST of Rab6-interacting protein 2/elks/erc/cast,putative vs. Ensembl Fly
Match: brp (gene:FBgn0259246 transcript:FBtr0300542)

HSP 1 Score: 130.568 bits (327), Expect = 1.350e-29
Identity = 81/201 (40.30%), Postives = 138/201 (68.66%), Query Frame = 3
Query: 1686 LEALSCEISKRDSEIYSLQSRLEMAEKQHQDQNHHINVLKEQVKTREHKISMMMADVEDFXXXXXXXXXXXXXXSQILTSSQTEKHQTESEILDLKDQCEMKDKKISLLQRKVQNLEDLLNDKENQLTTAKSKLLNLHTEHSTTEGTKAGLEESLRDRERQLERLKESKTRMEHEFQDELEMQKKLVSETKSRLDNSEREL 2288
            L+    EI +RD EI ++ ++++  E+QHQD   HI VLKE +  +E   +M+  DVE+ R RL+EK  L+EKK+Q    +  E+++  SE+ +LKD  ++KD+KIS+LQRK++NLEDLL +K+NQ+  A+++L  +   HS++EG    LEE++ D+E+Q+ +L++ + R EHE Q+E ++ ++ V++ K +L  +E E+
Sbjct:  285 LDEFRLEIQRRDQEILAMAAKMKTLEEQHQDYQRHIAVLKESLCAKEEHYNMLQTDVEEMRARLEEKNRLIEKKTQGTLQTVQERNRLTSELTELKDHMDIKDRKISVLQRKIENLEDLLKEKDNQVDMARARLSAMQAHHSSSEGALTSLEEAIGDKEKQMAQLRDQRDRAEHEKQEERDLHEREVADYKIKLRAAESEV 485          

HSP 2 Score: 102.064 bits (253), Expect = 6.312e-21
Identity = 96/287 (33.45%), Postives = 145/287 (50.52%), Query Frame = 3
Query:  378 IGNQYYSYRDRMPLDNQMIITNPINERPRPASARDPGFTDLMDMPTPQQRRLYETLYTPRHSQTNQQKLNAXXXXXXXXXXXDYERDPALMGSLRPQIPLPPPMAQNIYPAPMMGSNPGYDYHFPMIDNVIM-DYQTDLFSIQRELAKCQQELELTKEKLTSSVNSIKSFWSPELKRERSMRKDENSKYVLLAEELHQLQME--KKTMLSNVHQXXXXXXXXXXXXNKHSQTAQEIDLLYRRCDELEKENRILTKQSEEYEKRMISQKESLVTAEENIRKLLEVVKV 1229
            +G+ YY  RD   +D         + R R AS   P     MD P  + + L        H +                   D  RD +L   L  +  L    A+   P+ M G N G     P  D   + D Q     +QREL   ++ELELT +KL SS++SIK+FWSPELK+ER++RK+E++KY L+ ++L  L  E  K+ ML  V QLE ELR      N   Q  Q+++ +Y   D L++E  IL +  ++ E R+ +QK++L+  +E+I+KLLE+++ 
Sbjct:    1 MGSPYY--RD---MDEPTSPAGAGHHRSRSASR--PPMAHAMDYPRTRYQSLDRGGLVDPHDR----------EFIPIREPRDRSRDRSLERGLYLEDELYGRSARQ-SPSAMGGYNTGMG---PTSDRAYLGDLQHQNTDLQRELGNLKRELELTNQKLGSSMHSIKTFWSPELKKERALRKEESAKYSLINDQLKLLSTENQKQAML--VRQLEEELRLRMRQPNLEMQ--QQMEAIYAENDHLQREISILRETIKDLECRVETQKQTLIARDESIKKLLEMLQA 262          
BLAST of Rab6-interacting protein 2/elks/erc/cast,putative vs. Ensembl Fly
Match: brp (gene:FBgn0259246 transcript:FBtr0299916)

HSP 1 Score: 130.568 bits (327), Expect = 1.350e-29
Identity = 81/201 (40.30%), Postives = 138/201 (68.66%), Query Frame = 3
Query: 1686 LEALSCEISKRDSEIYSLQSRLEMAEKQHQDQNHHINVLKEQVKTREHKISMMMADVEDFXXXXXXXXXXXXXXSQILTSSQTEKHQTESEILDLKDQCEMKDKKISLLQRKVQNLEDLLNDKENQLTTAKSKLLNLHTEHSTTEGTKAGLEESLRDRERQLERLKESKTRMEHEFQDELEMQKKLVSETKSRLDNSEREL 2288
            L+    EI +RD EI ++ ++++  E+QHQD   HI VLKE +  +E   +M+  DVE+ R RL+EK  L+EKK+Q    +  E+++  SE+ +LKD  ++KD+KIS+LQRK++NLEDLL +K+NQ+  A+++L  +   HS++EG    LEE++ D+E+Q+ +L++ + R EHE Q+E ++ ++ V++ K +L  +E E+
Sbjct:  285 LDEFRLEIQRRDQEILAMAAKMKTLEEQHQDYQRHIAVLKESLCAKEEHYNMLQTDVEEMRARLEEKNRLIEKKTQGTLQTVQERNRLTSELTELKDHMDIKDRKISVLQRKIENLEDLLKEKDNQVDMARARLSAMQAHHSSSEGALTSLEEAIGDKEKQMAQLRDQRDRAEHEKQEERDLHEREVADYKIKLRAAESEV 485          

HSP 2 Score: 102.064 bits (253), Expect = 6.312e-21
Identity = 96/287 (33.45%), Postives = 145/287 (50.52%), Query Frame = 3
Query:  378 IGNQYYSYRDRMPLDNQMIITNPINERPRPASARDPGFTDLMDMPTPQQRRLYETLYTPRHSQTNQQKLNAXXXXXXXXXXXDYERDPALMGSLRPQIPLPPPMAQNIYPAPMMGSNPGYDYHFPMIDNVIM-DYQTDLFSIQRELAKCQQELELTKEKLTSSVNSIKSFWSPELKRERSMRKDENSKYVLLAEELHQLQME--KKTMLSNVHQXXXXXXXXXXXXNKHSQTAQEIDLLYRRCDELEKENRILTKQSEEYEKRMISQKESLVTAEENIRKLLEVVKV 1229
            +G+ YY  RD   +D         + R R AS   P     MD P  + + L        H +                   D  RD +L   L  +  L    A+   P+ M G N G     P  D   + D Q     +QREL   ++ELELT +KL SS++SIK+FWSPELK+ER++RK+E++KY L+ ++L  L  E  K+ ML  V QLE ELR      N   Q  Q+++ +Y   D L++E  IL +  ++ E R+ +QK++L+  +E+I+KLLE+++ 
Sbjct:    1 MGSPYY--RD---MDEPTSPAGAGHHRSRSASR--PPMAHAMDYPRTRYQSLDRGGLVDPHDR----------EFIPIREPRDRSRDRSLERGLYLEDELYGRSARQ-SPSAMGGYNTGMG---PTSDRAYLGDLQHQNTDLQRELGNLKRELELTNQKLGSSMHSIKTFWSPELKKERALRKEESAKYSLINDQLKLLSTENQKQAML--VRQLEEELRLRMRQPNLEMQ--QQMEAIYAENDHLQREISILRETIKDLECRVETQKQTLIARDESIKKLLEMLQA 262          
BLAST of Rab6-interacting protein 2/elks/erc/cast,putative vs. Ensembl Zebrafish
Match: ERC1 (si:dkey-222l13.1 [Source:ZFIN;Acc:ZDB-GENE-110411-39])

HSP 1 Score: 306.22 bits (783), Expect = 3.718e-85
Identity = 265/823 (32.20%), Postives = 458/823 (55.65%), Query Frame = 3
Query:  714 MMGSNPGY--------------DYHFPMI-------------DNVIMDYQTDLFSIQRELAKCQQELELTKEKLTSSVNSIKSFWSPELKRERSMRKDENSK-------YVLLAEELHQLQMEKKTM---------LSNVHQXXXXXXXXXXXXNKHSQTAQEIDLLYRRCDELEKENRILTKQSEEYEKRMISQKESLVTAEENIRKLLEVVKVAKSASSGHSALQGLRLERFEEDQTEIERLRSQIHEYSQRTIDLERAI--VEKDFDISRNKEQGELLNQEVQNLRQENEHIR----QDIQQTQTLQSLVDTKESKILTLENEIRLLEDELARMRDEELITPTTSVNGIDDYEKNMR--STVRPHERLMKSKLEALSCEISKRDSEIYSLQSRLEMAEKQHQDQNHHINVLKEQVKTREHKISMMMADVEDFXXXXXXXXXXXXXXSQILTSSQTEKHQTESEILDLKDQCEMKDKKISLLQRKVQNLEDLLNDKENQLTTAKSKLLNLHTEHSTTEGTKAGLEESLRDRERQLERLKESKTRMEHEFQDELEMQKKLVSETKSRLDNSERELREKVAMLNEMREELSELRAVKFKRESELNTIQVQCSQKTSEVAALQLELQTVRKQYI-SDTEYKSNHRISELESQINHYSDSATRLQGEVDRLLNMVRNLESEKLEKDRQITQLECQVKEHQNTISNMKRTHQNERNYLNEDIDVLKRKEDNILVDMEVIKTTLTERENRIKELEQALRESLQITAERESYVHNKEDSYRQLELKISDQKQNLEIIQKERNQLSGQLASAQEELREKETQLKTLESE 3026
            +MGS+P                D+H P               DN IMD QT L  + RE    ++E+++ + KL+SS+NSIK+FWSPELK+ER++RKDE SK       Y ++ +E   LQM  + +         L+ + Q +   R  + L  +   T +    L+   +   KE  +L K  EE E R+ +QK++L   +E+I+KLLE+++            +GL  +  EED           HE ++R  D E  I  +E   D  R+KE G         L +E+ H R     +  +T+ LQ++++ K+SKI ++E  +R LEDE+  ++       +      ++ E+ M+     R H + MK+K++ +  ++S++DSE+  LQ++LE    Q  D   H++VLKE +  +E + +++  +V+  R RL+EKE  L KKS+ +     EK     EI DLKD  ++K++K+++LQ+K++NL++ L DKE Q+++ K ++ +L  + S T+   + LEE+L ++ER +ERLKE + R E E  +ELE  KK + E K +++  + +L ++ A L +++E  S L +   K++S+L ++++   QK  E   L+ +L+      + + T    + RI+ LE ++  Y + A + Q EVDRLL ++R +E+EK +KDR+I +LE Q+K+    ++N+K   Q E+N   + ++  +++EDNI    + +K +L  +++RI+ELE+ALRES+QITAERE  +  +E +    E ++ +    +E +++E   +  +L+S Q+ L EKE+ L TL +E
Sbjct:  111 VMGSSPNIATGSPGTTDAIAFGDHHMPSTLASTVPHSLRQARDNTIMDLQTQLKEVLRENELLRKEVDVKESKLSSSMNSIKTFWSPELKKERALRKDEASKISVWKEQYRVVQDENQHLQMTIQALQDELRIQRDLNQLFQQDPSSRPGEPLTAE--LTEENFQRLHGEHERQAKELFLLRKTLEEMELRIDTQKQTLNARDESIKKLLEMLQS-----------KGLSAKASEED-----------HERTRRLADAEMHIHHLESLLD-QRDKEMG---------LLREDLHRRYEGAPESAKTKALQTVIEMKDSKIGSMERSLRDLEDEIQMLK-------SNGALSTEEREEEMKQMEVYRSHSKFMKNKIDQVKQDLSRKDSELLGLQTKLETLTNQFSDSKQHVDVLKESLTAKEQRAAILQTEVDALRLRLEEKEATLNKKSKQIQEVSEEKGTLNGEIHDLKDMLDVKERKVNVLQKKIENLQEQLKDKEKQMSSLKERVKSLQADTSNTDTALSTLEEALAEKERIIERLKEQRDRDEREKSEELESNKKELKELKEKVNVLQGDLSDREASLLDLKEHASSLASSGLKKDSKLKSLEIALEQKKEECIKLESQLKKAHSVAVEAQTSAGLSERIATLEQEVARYKEDAGKAQAEVDRLLEILREMENEKNDKDRKINELERQMKDQSKKVANLKHKEQVEKNKNAQLMEEARKREDNINESSQQVKDSLRLKDDRIEELEEALRESVQITAEREMVLAQEESARANAEKQMEELLAAMEKVKQELESMKAKLSSTQQSLAEKESHLTTLRAE 892          
BLAST of Rab6-interacting protein 2/elks/erc/cast,putative vs. Ensembl Zebrafish
Match: erc1a (ELKS/RAB6-interacting/CAST family member 1a [Source:ZFIN;Acc:ZDB-GENE-091214-5])

HSP 1 Score: 248.44 bits (633), Expect = 6.467e-67
Identity = 239/761 (31.41%), Postives = 429/761 (56.37%), Query Frame = 3
Query:  759 DNVIMDYQTDLFSIQRELAKCQQELELTKEKLTSSVNSIKSFWSPELKRERSMRKDENSKYVLLAEELHQLQMEKKTMLSNVHQXXXXXXXXXXXXNKHSQTAQEIDLLYRRCDELEKENR---ILTKQSEEYEKRMISQKESLVTAEENIRKLLEVVKVAKSASSGHSALQGLRLERFEEDQTEIERLR-SQIHEYSQRTIDLERAIVEKDFDISRNKEQGELLNQEVQNLRQENEHIRQDIQQTQTLQSLVDTKESKILTLENEIRLLEDELARMRDEELITPTTSVNGIDDYEKNMRSTVRPHERLMKSKLEALSCEISKRDSEIYSLQSRLEMAEKQHQDQNHHINVLKEQVKTREHKISMMMADVEDFXXXXXXXXXXXXXXSQILTSSQTEKHQTESEILDLKDQCEMKDKKISLLQRKVQNLEDLLNDKENQLTTAKSKLLNLHTEHSTTEGTKAGLEESLRDRERQLERLKESKTRMEHEFQDELEMQKKLVSETKSRLDNSERELREKVAMLNEMREELSELRAVKFKRESELNTIQVQCSQKTSEVAALQLELQTVRKQYI-SDTEYKSNHRISELESQINHYSDSATRLQGEVDRLLNMVRNLESEKLEKDRQITQLECQVKEHQNTISNMKRTHQNERNYLNEDIDVLKRKEDNILVDMEVIKTTLTERENRIKELEQALRESLQITAERESYVHNKEDSYRQLELKISDQKQNLEIIQKERNQLSGQLASAQEELREKETQLKTLESE 3026
            DN IM+ Q  L  + RE    ++E+E+ + KL+SS++SIKSFWSPELK+ER++RKDE SK  +  E+   +Q E + + + V Q      R +   N+  Q   E  L     +E E++ R   +L +  EE E RM +Q+++LV  +++++KLLE++      S G SA      +  EED     RL  +++H +      LE  + ++D ++   +E+   L++ ++           +  +T+ LQ++++ K+S+I +LE  +R LED++  +R   ++    S     +  K M    R H + MK+K++ +  ++S++D+++  LQ++LE    Q  D   HI VLKE +  +E + +++  +V+  R RL+EKET L KKS+ +     EK     EI DLKD  ++K++K+++LQ+K++NL++ L DKE Q+++ + ++ +L T+ S T+     LE+SL ++ER +ERLKE + R E E  +EL+  KK + E K ++   + +L ++   L +++E  S L +   K++S+L ++++   Q+  E + L+ +L+      + +    + + RIS LE+ ++ + + + + Q EVDRLL+++R +E+EK +KDR+I++LE Q+KE        K      RN                 V+    + +L ++  RI+ELE+ALRES+QITAERE  +  +E +    E ++ +    +E ++ E   +  +++S Q+ L EKE  L TL +E
Sbjct:  154 DNTIMELQAQLKEVLRENELLRKEIEVKESKLSSSMSSIKSFWSPELKKERALRKDEASKISVWKEQYRAVQDETQHLQTTV-QALQAELRIQRDLNQLLQPPGE-PLACEPSEEQERQARELFLLRRTLEEMELRMEAQRQTLVARDDSVKKLLEMLH-----SKGPSA------KASEEDHERTRRLADAEMHAHH-----LENLLEQRDKELVALREE---LHRRLEGT--------PETTKTKALQTVIEMKDSQIGSLERGLRELEDQVMMLRSSSML----SCEERQEEAKQM-EVYRNHTKFMKNKMDQVKQDLSRKDTQLLGLQTKLETLTNQFSDSKQHIEVLKESLTAKEQRAAILQTEVDALRLRLEEKETTLNKKSKQIQEMSEEKSTLNGEIHDLKDMLDVKERKVNVLQKKIENLQEQLRDKEKQMSSLRERVKSLQTDTSNTDTALTTLEDSLAEKERIIERLKEQRDREEREKAEELDTSKKELKELKEKVSLLQGDLSDRETSLLDLKEHASSLASSGLKKDSKLKSLEIALEQRREECSKLENQLKKAHSAAVNAQANAEISERISSLEADVSRHREDSAKAQAEVDRLLDILRQMENEKNDKDRKISELERQMKEQSKKSGKHKEPPGKGRN-----------------VNDGPQQESLRQKAERIEELEEALRESVQITAEREMVLAQEEAARNHQEKQMEELLGAMEKVKLELESMKAKMSSTQQSLAEKEAHLTTLRAE 863          
BLAST of Rab6-interacting protein 2/elks/erc/cast,putative vs. Ensembl Zebrafish
Match: erc1a (ELKS/RAB6-interacting/CAST family member 1a [Source:ZFIN;Acc:ZDB-GENE-091214-5])

HSP 1 Score: 248.44 bits (633), Expect = 6.467e-67
Identity = 239/761 (31.41%), Postives = 429/761 (56.37%), Query Frame = 3
Query:  759 DNVIMDYQTDLFSIQRELAKCQQELELTKEKLTSSVNSIKSFWSPELKRERSMRKDENSKYVLLAEELHQLQMEKKTMLSNVHQXXXXXXXXXXXXNKHSQTAQEIDLLYRRCDELEKENR---ILTKQSEEYEKRMISQKESLVTAEENIRKLLEVVKVAKSASSGHSALQGLRLERFEEDQTEIERLR-SQIHEYSQRTIDLERAIVEKDFDISRNKEQGELLNQEVQNLRQENEHIRQDIQQTQTLQSLVDTKESKILTLENEIRLLEDELARMRDEELITPTTSVNGIDDYEKNMRSTVRPHERLMKSKLEALSCEISKRDSEIYSLQSRLEMAEKQHQDQNHHINVLKEQVKTREHKISMMMADVEDFXXXXXXXXXXXXXXSQILTSSQTEKHQTESEILDLKDQCEMKDKKISLLQRKVQNLEDLLNDKENQLTTAKSKLLNLHTEHSTTEGTKAGLEESLRDRERQLERLKESKTRMEHEFQDELEMQKKLVSETKSRLDNSERELREKVAMLNEMREELSELRAVKFKRESELNTIQVQCSQKTSEVAALQLELQTVRKQYI-SDTEYKSNHRISELESQINHYSDSATRLQGEVDRLLNMVRNLESEKLEKDRQITQLECQVKEHQNTISNMKRTHQNERNYLNEDIDVLKRKEDNILVDMEVIKTTLTERENRIKELEQALRESLQITAERESYVHNKEDSYRQLELKISDQKQNLEIIQKERNQLSGQLASAQEELREKETQLKTLESE 3026
            DN IM+ Q  L  + RE    ++E+E+ + KL+SS++SIKSFWSPELK+ER++RKDE SK  +  E+   +Q E + + + V Q      R +   N+  Q   E  L     +E E++ R   +L +  EE E RM +Q+++LV  +++++KLLE++      S G SA      +  EED     RL  +++H +      LE  + ++D ++   +E+   L++ ++           +  +T+ LQ++++ K+S+I +LE  +R LED++  +R   ++    S     +  K M    R H + MK+K++ +  ++S++D+++  LQ++LE    Q  D   HI VLKE +  +E + +++  +V+  R RL+EKET L KKS+ +     EK     EI DLKD  ++K++K+++LQ+K++NL++ L DKE Q+++ + ++ +L T+ S T+     LE+SL ++ER +ERLKE + R E E  +EL+  KK + E K ++   + +L ++   L +++E  S L +   K++S+L ++++   Q+  E + L+ +L+      + +    + + RIS LE+ ++ + + + + Q EVDRLL+++R +E+EK +KDR+I++LE Q+KE        K      RN                 V+    + +L ++  RI+ELE+ALRES+QITAERE  +  +E +    E ++ +    +E ++ E   +  +++S Q+ L EKE  L TL +E
Sbjct:  154 DNTIMELQAQLKEVLRENELLRKEIEVKESKLSSSMSSIKSFWSPELKKERALRKDEASKISVWKEQYRAVQDETQHLQTTV-QALQAELRIQRDLNQLLQPPGE-PLACEPSEEQERQARELFLLRRTLEEMELRMEAQRQTLVARDDSVKKLLEMLH-----SKGPSA------KASEEDHERTRRLADAEMHAHH-----LENLLEQRDKELVALREE---LHRRLEGT--------PETTKTKALQTVIEMKDSQIGSLERGLRELEDQVMMLRSSSML----SCEERQEEAKQM-EVYRNHTKFMKNKMDQVKQDLSRKDTQLLGLQTKLETLTNQFSDSKQHIEVLKESLTAKEQRAAILQTEVDALRLRLEEKETTLNKKSKQIQEMSEEKSTLNGEIHDLKDMLDVKERKVNVLQKKIENLQEQLRDKEKQMSSLRERVKSLQTDTSNTDTALTTLEDSLAEKERIIERLKEQRDREEREKAEELDTSKKELKELKEKVSLLQGDLSDRETSLLDLKEHASSLASSGLKKDSKLKSLEIALEQRREECSKLENQLKKAHSAAVNAQANAEISERISSLEADVSRHREDSAKAQAEVDRLLDILRQMENEKNDKDRKISELERQMKEQSKKSGKHKEPPGKGRN-----------------VNDGPQQESLRQKAERIEELEEALRESVQITAEREMVLAQEEAARNHQEKQMEELLGAMEKVKLELESMKAKMSSTQQSLAEKEAHLTTLRAE 863          
BLAST of Rab6-interacting protein 2/elks/erc/cast,putative vs. Ensembl Zebrafish
Match: erc1a (ELKS/RAB6-interacting/CAST family member 1a [Source:ZFIN;Acc:ZDB-GENE-091214-5])

HSP 1 Score: 247.284 bits (630), Expect = 1.394e-66
Identity = 239/761 (31.41%), Postives = 429/761 (56.37%), Query Frame = 3
Query:  759 DNVIMDYQTDLFSIQRELAKCQQELELTKEKLTSSVNSIKSFWSPELKRERSMRKDENSKYVLLAEELHQLQMEKKTMLSNVHQXXXXXXXXXXXXNKHSQTAQEIDLLYRRCDELEKENR---ILTKQSEEYEKRMISQKESLVTAEENIRKLLEVVKVAKSASSGHSALQGLRLERFEEDQTEIERLR-SQIHEYSQRTIDLERAIVEKDFDISRNKEQGELLNQEVQNLRQENEHIRQDIQQTQTLQSLVDTKESKILTLENEIRLLEDELARMRDEELITPTTSVNGIDDYEKNMRSTVRPHERLMKSKLEALSCEISKRDSEIYSLQSRLEMAEKQHQDQNHHINVLKEQVKTREHKISMMMADVEDFXXXXXXXXXXXXXXSQILTSSQTEKHQTESEILDLKDQCEMKDKKISLLQRKVQNLEDLLNDKENQLTTAKSKLLNLHTEHSTTEGTKAGLEESLRDRERQLERLKESKTRMEHEFQDELEMQKKLVSETKSRLDNSERELREKVAMLNEMREELSELRAVKFKRESELNTIQVQCSQKTSEVAALQLELQTVRKQYI-SDTEYKSNHRISELESQINHYSDSATRLQGEVDRLLNMVRNLESEKLEKDRQITQLECQVKEHQNTISNMKRTHQNERNYLNEDIDVLKRKEDNILVDMEVIKTTLTERENRIKELEQALRESLQITAERESYVHNKEDSYRQLELKISDQKQNLEIIQKERNQLSGQLASAQEELREKETQLKTLESE 3026
            DN IM+ Q  L  + RE    ++E+E+ + KL+SS++SIKSFWSPELK+ER++RKDE SK  +  E+   +Q E + + + V Q      R +   N+  Q   E  L     +E E++ R   +L +  EE E RM +Q+++LV  +++++KLLE++      S G SA      +  EED     RL  +++H +      LE  + ++D ++   +E+   L++ ++           +  +T+ LQ++++ K+S+I +LE  +R LED++  +R   ++    S     +  K M    R H + MK+K++ +  ++S++D+++  LQ++LE    Q  D   HI VLKE +  +E + +++  +V+  R RL+EKET L KKS+ +     EK     EI DLKD  ++K++K+++LQ+K++NL++ L DKE Q+++ + ++ +L T+ S T+     LE+SL ++ER +ERLKE + R E E  +EL+  KK + E K ++   + +L ++   L +++E  S L +   K++S+L ++++   Q+  E + L+ +L+      + +    + + RIS LE+ ++ + + + + Q EVDRLL+++R +E+EK +KDR+I++LE Q+KE        K      RN                 V+    + +L ++  RI+ELE+ALRES+QITAERE  +  +E +    E ++ +    +E ++ E   +  +++S Q+ L EKE  L TL +E
Sbjct:  154 DNTIMELQAQLKEVLRENELLRKEIEVKESKLSSSMSSIKSFWSPELKKERALRKDEASKISVWKEQYRAVQDETQHLQTTV-QALQAELRIQRDLNQLLQPPGE-PLACEPSEEQERQARELFLLRRTLEEMELRMEAQRQTLVARDDSVKKLLEMLH-----SKGPSA------KASEEDHERTRRLADAEMHAHH-----LENLLEQRDKELVALREE---LHRRLEGT--------PETTKTKALQTVIEMKDSQIGSLERGLRELEDQVMMLRSSSML----SCEERQEEAKQM-EVYRNHTKFMKNKMDQVKQDLSRKDTQLLGLQTKLETLTNQFSDSKQHIEVLKESLTAKEQRAAILQTEVDALRLRLEEKETTLNKKSKQIQEMSEEKSTLNGEIHDLKDMLDVKERKVNVLQKKIENLQEQLRDKEKQMSSLRERVKSLQTDTSNTDTALTTLEDSLAEKERIIERLKEQRDREEREKAEELDTSKKELKELKEKVSLLQGDLSDRETSLLDLKEHASSLASSGLKKDSKLKSLEIALEQRREECSKLENQLKKAHSAAVNAQANAEISERISSLEADVSRHREDSAKAQAEVDRLLDILRQMENEKNDKDRKISELERQMKEQSKKSGKHKEPPGKGRN-----------------VNDGPQQESLRQKAERIEELEEALRESVQITAEREMVLAQEEAARNHQEKQMEELLGAMEKVKLELESMKAKMSSTQQSLAEKEAHLTTLRAE 863          
BLAST of Rab6-interacting protein 2/elks/erc/cast,putative vs. Ensembl Zebrafish
Match: erc1a (ELKS/RAB6-interacting/CAST family member 1a [Source:ZFIN;Acc:ZDB-GENE-091214-5])

HSP 1 Score: 243.432 bits (620), Expect = 2.912e-65
Identity = 239/765 (31.24%), Postives = 429/765 (56.08%), Query Frame = 3
Query:  759 DNVIMDYQTDLFSIQRELAKCQQELELTKEKLTSSVNSIKSFWSPELKRERSMRKDENSKYVLLAEELHQLQMEKKTMLSNVHQXXXXXXXXXXXXNKHSQTAQEIDLLYRRCDELEKENR---ILTKQSEEYEKRMISQKESLVTAEENIRKLLEVVKVAKSASSGHSALQGLRLERFEEDQTEIERLR-SQIHEYSQRTIDLERAIVEKDFDISRNKEQGELLNQEVQNLRQENEHIRQDIQQTQTLQSLVDTKESKILTLENEIRLLEDELARMRDEELITPTTSVNGIDDYEKNMRSTVRPHERLMKSKLEALSCEISKRDSEIYSLQSRLEMAEKQHQDQNHHINVLKEQVKTREHKISMMMADVEDFXXXXXXXXXXXXXXSQILTSSQTEKHQTESEILDLKDQCEMKDKKISLLQRKVQNLEDLLNDKENQLTTAKSKLLNLHTEHSTTEGTKAGLEESLRDRERQLERLKESKTRMEHEFQDELEMQKKLVSETKSRLDNSERELREKVAMLNEMREELSELRAVKFKRESELNTIQVQCSQKTSEVAALQLELQTVRKQYI-SDTEYKSNHRISELESQINHYSDSATRLQGEVDRLLNMVRNLESEKLEKDRQITQLEC----QVKEHQNTISNMKRTHQNERNYLNEDIDVLKRKEDNILVDMEVIKTTLTERENRIKELEQALRESLQITAERESYVHNKEDSYRQLELKISDQKQNLEIIQKERNQLSGQLASAQEELREKETQLKTLESE 3026
            DN IM+ Q  L  + RE    ++E+E+ + KL+SS++SIKSFWSPELK+ER++RKDE SK  +  E+   +Q E + + + V Q      R +   N+  Q   E  L     +E E++ R   +L +  EE E RM +Q+++LV  +++++KLLE++      S G SA      +  EED     RL  +++H +      LE  + ++D ++   +E+   L++ ++           +  +T+ LQ++++ K+S+I +LE  +R LED++  +R   ++    S     +  K M    R H + MK+K++ +  ++S++D+++  LQ++LE    Q  D   HI VLKE +  +E + +++  +V+  R RL+EKET L KKS+ +     EK     EI DLKD  ++K++K+++LQ+K++NL++ L DKE Q+++ + ++ +L T+ S T+     LE+SL ++ER +ERLKE + R E E  +EL+  KK + E K ++   + +L ++   L +++E  S L +   K++S+L ++++   Q+  E + L+ +L+      + +    + + RIS LE+ ++ + + + + Q EVDRLL+++R +E+EK +KDR+I++LE     Q+KE        K      RN                 V+    + +L ++  RI+ELE+ALRES+QITAERE  +  +E +    E ++ +    +E ++ E   +  +++S Q+ L EKE  L TL +E
Sbjct:  154 DNTIMELQAQLKEVLRENELLRKEIEVKESKLSSSMSSIKSFWSPELKKERALRKDEASKISVWKEQYRAVQDETQHLQTTV-QALQAELRIQRDLNQLLQPPGE-PLACEPSEEQERQARELFLLRRTLEEMELRMEAQRQTLVARDDSVKKLLEMLH-----SKGPSA------KASEEDHERTRRLADAEMHAHH-----LENLLEQRDKELVALREE---LHRRLEGT--------PETTKTKALQTVIEMKDSQIGSLERGLRELEDQVMMLRSSSML----SCEERQEEAKQM-EVYRNHTKFMKNKMDQVKQDLSRKDTQLLGLQTKLETLTNQFSDSKQHIEVLKESLTAKEQRAAILQTEVDALRLRLEEKETTLNKKSKQIQEMSEEKSTLNGEIHDLKDMLDVKERKVNVLQKKIENLQEQLRDKEKQMSSLRERVKSLQTDTSNTDTALTTLEDSLAEKERIIERLKEQRDREEREKAEELDTSKKELKELKEKVSLLQGDLSDRETSLLDLKEHASSLASSGLKKDSKLKSLEIALEQRREECSKLENQLKKAHSAAVNAQANAEISERISSLEADVSRHREDSAKAQAEVDRLLDILRQMENEKNDKDRKISELESVASRQMKEQSKKSGKHKEPPGKGRN-----------------VNDGPQQESLRQKAERIEELEEALRESVQITAEREMVLAQEEAARNHQEKQMEELLGAMEKVKLELESMKAKMSSTQQSLAEKEAHLTTLRAE 867          
BLAST of Rab6-interacting protein 2/elks/erc/cast,putative vs. Ensembl Xenopus
Match: erc1 (ELKS/RAB6-interacting/CAST family member 1 [Source:NCBI gene;Acc:100145199])

HSP 1 Score: 277.715 bits (709), Expect = 8.206e-76
Identity = 251/772 (32.51%), Postives = 431/772 (55.83%), Query Frame = 3
Query:  717 MGSNPGY-------------DYHFPMI--------------DNVIMDYQTDLFSIQRELAKCQQELELTKEKLTSSVNSIKSFWSPELKRERSMRKDENSK-------YVLLAEELHQLQMEKKTM---------LSNVHQXXXXXXXXXXXXNKHSQTAQEIDLLYRRCDELEKENRILTKQSEEYEKRMISQKESLVTAEENIRKLLEVVKVAKSASSGHSALQGLRLERFEEDQTEIERLRSQIHEYSQRTIDLERAIVEKDFDISRNKEQGELLNQEVQNLRQENEHIRQDIQQTQTLQSLVDTKESKILTLENEIRLLEDELARMRDEELITPTTSVNGIDDYEKNMR--STVRPHERLMKSKLEALSCEISKRDSEIYSLQSRLEMAEKQHQDQNHHINVLKEQVKTREHKISMMMADVEDFXXXXXXXXXXXXXXSQILTSSQTEKHQTESEILDLKDQCEMKDKKISLLQRKVQNLEDLLNDKENQLTTAKSKLLNLHTEHSTTEGTKAGLEESLRDRERQLERLKESKTRMEHEFQDELEMQKKLVSETKSRLDNSERELREKVAMLNEMREELSELRAVKFKRESELNTIQVQCSQKTSEVAALQLELQTVRKQYISDTEYKS----NHRISELESQINHYSDSATRLQGEVDRLLNMVRNLESEKLEKDRQITQLECQVKEHQNTISNMKRTHQNERNYLNEDIDVLKRKEDNILVDMEVIKTTLTERENRIKELEQALRESLQITAERESYVHNKEDSYR 2885
            MGS+P               D+H P +              DN IMD Q  L  + RE    ++++E+ + KL+SS+NSIK+FWSPELK+ER++RKDE SK       Y ++ EE   LQM  + M         L+ + Q ++  R ++ L  +   T     LL+   D   KE  +L K  EE E R+ +QK++L   +E+I+KLLE+++            +G+  +  EED           HE ++R  + E  +   D  + + +++  +L +E+   R EN     D  +T+ LQ++++ K+SKI ++E  +R LEDE+  ++       +      ++ E+ M+     R H + MK+K+  +  E+S++D+E+ +LQ++LE    Q  D   H+ VLKE +  +E + +++  +V+  R RL+EKET+L KK++ +     EK     EI DLKD  ++K++K+++LQ+K++NL++ L DKE QL++ K ++ +L  + + T+     LEE+L ++ER +ERLK+ + R E E Q+ELE  KK + + K ++   + +L EK + L +++E  S L +   K++S L T+++   Q+  E   L+LE Q +RK      E KS    N R  ++E  +  Y +   + Q EVDRLL++++ +E+EK EKD +I +LE Q+K+    ++ +K   Q E+    + +D  +R+EDN+    + ++  + ++++RI+ELE+ALRES+QITAERE  V  +E+S R
Sbjct:  107 MGSSPNIATSGVASDTIAFGDHHLPPVSMASTVPHSLRQARDNTIMDLQAQLKEVLRENDLLRKDVEVKESKLSSSMNSIKTFWSPELKKERALRKDEVSKITVWKEQYRVVQEENQHLQMSIQAMQDELRIQRDLNQLFQQDSVGRLKEPLTGE--LTEDNFRLLHVEHDRQAKELFLLRKTLEEMELRIDTQKQTLSARDESIKKLLEMLQS-----------KGIPNKVMEED-----------HERTRRLAEAEMHVHHLDSLLEQKEKENNILREELHR-RFENA---PDSAKTKALQTVIEMKDSKITSMERGLRDLEDEIQMLK-------SNGAMSTEEREEEMKQMEVYRSHSKFMKNKIGQVKQELSRKDTELLALQTKLETLNNQFSDSKQHVEVLKESLTAKEQRAAILQTEVDALRLRLEEKETMLNKKTKQIQEMSEEKGTLSGEIHDLKDMLDVKERKVNVLQKKIENLQEQLRDKEKQLSSLKDRVKSLQADTTNTDTALTTLEEALAEKERIIERLKDQRDRDEREKQEELESYKKELKDLKEKVSVLQGDLSEKESSLLDLKEHASTLASSSLKKDSRLKTLEIALEQRKEEF--LKLESQ-LRKALELAQEAKSNPETNERFQQMERDVTRYREEVGKSQAEVDRLLDILKEMENEKNEKDTKIAELERQIKDQNKKVATLKHKEQVEKKKNAQLLDEARRREDNLTDSSQQLQDVMRQKDDRIEELEEALRESVQITAERE-MVLAQEESAR 839          
BLAST of Rab6-interacting protein 2/elks/erc/cast,putative vs. Ensembl Xenopus
Match: erc1 (ELKS/RAB6-interacting/CAST family member 1 [Source:NCBI gene;Acc:100145199])

HSP 1 Score: 263.848 bits (673), Expect = 6.383e-72
Identity = 265/859 (30.85%), Postives = 452/859 (52.62%), Query Frame = 3
Query:  561 SQTNQQKLNAXXXXXXXXXXXDYERDPALMG--SLRPQIPLPPPMAQNIYPAPM--MGSNPGY-------------DYHFPMI--------------DNVIMDYQTDLFSIQRELAKCQQELELTKEKLTSSVNSIKSFWSPELKRERSMRKDENSK-------YVLLAEELHQLQMEKKTM---------LSNVHQXXXXXXXXXXXXNKHSQTAQEIDLLYRRCDELEKENRILTKQSEEYEKRMISQKESLVTAEENIRKLLEVVKVAKSASSGHSALQGLRLERFEEDQTEIERLRSQIHEYSQRTIDLERAIVEKDFDISRNKEQGELLNQEVQNLRQENEHIRQDIQQTQTLQSLVDTKESKILTLENEIRLLEDELARMRDEELITPTTSVNGIDDYEKNMR--STVRPHERLMKSKLEALS-------------------------------CEISKRDSEIYSLQSRLEMAEKQHQDQNHHINVLKEQVKTREHKISMMMADVEDFXXXXXXXXXXXXXXSQILTSSQTEKHQTESEILDLKDQCEMKDKKISLLQRKVQNLEDLLNDKENQLTTAKSKLLNLHTEHSTTEGTKAGLEESLRDRERQLERLKESKTRMEHEFQDELEMQKKLVSETKSRLDNSERELREKVAMLNEMREELSELRAVKFKRESELNTIQVQCSQKTSEVAALQLELQTVRKQYISDTEYKS----NHRISELESQINHYSDSATRLQGEVDRLLNMVRNLESEKLEKDRQITQLECQVKEHQNTISNMKRTHQNERNYLNEDIDVLKRKEDNILVDMEVIKTTLTERENRIKELEQALRESLQITAERESYVHNKEDSYR 2885
            S  N Q LNA+          D+E    ++G  + +  + L     +  Y   M  MGS+P               D+H P +              DN IMD Q  L  + RE    ++++E+ + KL+SS+NSIK+FWSPELK+ER++RKDE SK       Y ++ EE   LQM  + M         L+ + Q ++  R ++ L  +   T     LL+   D   KE  +L K  EE E R+ +QK++L   +E+I+KLLE+++            +G+  +  EED           HE ++R  + E  +   D  + + +++  +L +E+   R EN     D  +T+ LQ++++ K+SKI ++E  +R LEDE+  ++       +      ++ E+ M+     R H + MK+K+E L                                 E+S++D+E+ +LQ++LE    Q  D   H+ VLKE +  +E + +++  +V+  R RL+EKET+L KK++ +     EK     EI DLKD  ++K++K+++LQ+K++NL++ L DKE QL++ K ++ +L  + + T+     LEE+L ++ER +ERLK+ + R E E Q+ELE  KK + + K ++   + +L EK + L +++E  S L +   K++S L T+++   Q+  E   L+LE Q +RK      E KS    N R  ++E  +  Y +   + Q EVDRLL++++ +E+EK EKD +I +LE Q+K+    ++ +K   Q E+    + +D  +R+EDN+    + ++  + ++++RI+ELE+ALRES+QITAERE  V  +E+S R
Sbjct:   55 SMENIQSLNAAYATASPMYLSDHE----IVGGDTAKSTMTLGRSGGRLPYGVRMTAMGSSPNIATSGVASDTIAFGDHHLPPVSMASTVPHSLRQARDNTIMDLQAQLKEVLRENDLLRKDVEVKESKLSSSMNSIKTFWSPELKKERALRKDEVSKITVWKEQYRVVQEENQHLQMSIQAMQDELRIQRDLNQLFQQDSVGRLKEPLTGEL--TEDNFRLLHVEHDRQAKELFLLRKTLEEMELRIDTQKQTLSARDESIKKLLEMLQS-----------KGIPNKVMEED-----------HERTRRLAEAEMHVHHLDSLLEQKEKENNILREELHR-RFENA---PDSAKTKALQTVIEMKDSKITSMERGLRDLEDEIQMLK-------SNGAMSTEEREEEMKQMEVYRSHSKFMKNKVEQLKEELSAKENQAEELRKRVSALQTEQSSIGQVKQELSRKDTELLALQTKLETLNNQFSDSKQHVEVLKESLTAKEQRAAILQTEVDALRLRLEEKETMLNKKTKQIQEMSEEKGTLSGEIHDLKDMLDVKERKVNVLQKKIENLQEQLRDKEKQLSSLKDRVKSLQADTTNTDTALTTLEEALAEKERIIERLKDQRDRDEREKQEELESYKKELKDLKEKVSVLQGDLSEKESSLLDLKEHASTLASSSLKKDSRLKTLEIALEQRKEEF--LKLESQ-LRKALELAQEAKSNPETNERFQQMERDVTRYREEVGKSQAEVDRLLDILKEMENEKNEKDTKIAELERQIKDQNKKVATLKHKEQVEKKKNAQLLDEARRREDNLTDSSQQLQDVMRQKDDRIEELEEALRESVQITAERE-MVLAQEESAR 870          
BLAST of Rab6-interacting protein 2/elks/erc/cast,putative vs. Ensembl Xenopus
Match: erc1 (ELKS/RAB6-interacting/CAST family member 1 [Source:NCBI gene;Acc:100145199])

HSP 1 Score: 263.848 bits (673), Expect = 2.826e-71
Identity = 253/803 (31.51%), Postives = 432/803 (53.80%), Query Frame = 3
Query:  717 MGSNPGY-------------DYHFPMI--------------DNVIMDYQTDLFSIQRELAKCQQELELTKEKLTSSVNSIKSFWSPELKRERSMRKDENSK-------YVLLAEELHQLQMEKKTM---------LSNVHQXXXXXXXXXXXXNKHSQTAQEIDLLYRRCDELEKENRILTKQSEEYEKRMISQKESLVTAEENIRKLLEVVKVAKSASSGHSALQGLRLERFEEDQTEIERLRSQIHEYSQRTIDLERAIVEKDFDISRNKEQGELLNQEVQNLRQENEHIRQDIQQTQTLQSLVDTKESKILTLENEIRLLEDELARMRDEELITPTTSVNGIDDYEKNMR--STVRPHERLMKSKLEALS-------------------------------CEISKRDSEIYSLQSRLEMAEKQHQDQNHHINVLKEQVKTREHKISMMMADVEDFXXXXXXXXXXXXXXSQILTSSQTEKHQTESEILDLKDQCEMKDKKISLLQRKVQNLEDLLNDKENQLTTAKSKLLNLHTEHSTTEGTKAGLEESLRDRERQLERLKESKTRMEHEFQDELEMQKKLVSETKSRLDNSERELREKVAMLNEMREELSELRAVKFKRESELNTIQVQCSQKTSEVAALQLELQTVRKQYISDTEYKS----NHRISELESQINHYSDSATRLQGEVDRLLNMVRNLESEKLEKDRQITQLECQVKEHQNTISNMKRTHQNERNYLNEDIDVLKRKEDNILVDMEVIKTTLTERENRIKELEQALRESLQITAERESYVHNKEDSYR 2885
            MGS+P               D+H P +              DN IMD Q  L  + RE    ++++E+ + KL+SS+NSIK+FWSPELK+ER++RKDE SK       Y ++ EE   LQM  + M         L+ + Q ++  R ++ L  +   T     LL+   D   KE  +L K  EE E R+ +QK++L   +E+I+KLLE+++            +G+  +  EED           HE ++R  + E  +   D  + + +++  +L +E+   R EN     D  +T+ LQ++++ K+SKI ++E  +R LEDE+  ++       +      ++ E+ M+     R H + MK+K+E L                                 E+S++D+E+ +LQ++LE    Q  D   H+ VLKE +  +E + +++  +V+  R RL+EKET+L KK++ +     EK     EI DLKD  ++K++K+++LQ+K++NL++ L DKE QL++ K ++ +L  + + T+     LEE+L ++ER +ERLK+ + R E E Q+ELE  KK + + K ++   + +L EK + L +++E  S L +   K++S L T+++   Q+  E   L+LE Q +RK      E KS    N R  ++E  +  Y +   + Q EVDRLL++++ +E+EK EKD +I +LE Q+K+    ++ +K   Q E+    + +D  +R+EDN+    + ++  + ++++RI+ELE+ALRES+QITAERE  V  +E+S R
Sbjct:  107 MGSSPNIATSGVASDTIAFGDHHLPPVSMASTVPHSLRQARDNTIMDLQAQLKEVLRENDLLRKDVEVKESKLSSSMNSIKTFWSPELKKERALRKDEVSKITVWKEQYRVVQEENQHLQMSIQAMQDELRIQRDLNQLFQQDSVGRLKEPLTGE--LTEDNFRLLHVEHDRQAKELFLLRKTLEEMELRIDTQKQTLSARDESIKKLLEMLQS-----------KGIPNKVMEED-----------HERTRRLAEAEMHVHHLDSLLEQKEKENNILREELHR-RFENA---PDSAKTKALQTVIEMKDSKITSMERGLRDLEDEIQMLK-------SNGAMSTEEREEEMKQMEVYRSHSKFMKNKVEQLKEELSAKENQAEELRKRVSALQTEQSSIGQVKQELSRKDTELLALQTKLETLNNQFSDSKQHVEVLKESLTAKEQRAAILQTEVDALRLRLEEKETMLNKKTKQIQEMSEEKGTLSGEIHDLKDMLDVKERKVNVLQKKIENLQEQLRDKEKQLSSLKDRVKSLQADTTNTDTALTTLEEALAEKERIIERLKDQRDRDEREKQEELESYKKELKDLKEKVSVLQGDLSEKESSLLDLKEHASTLASSSLKKDSRLKTLEIALEQRKEEF--LKLESQ-LRKALELAQEAKSNPETNERFQQMERDVTRYREEVGKSQAEVDRLLDILKEMENEKNEKDTKIAELERQIKDQNKKVATLKHKEQVEKKKNAQLLDEARRREDNLTDSSQQLQDVMRQKDDRIEELEEALRESVQITAERE-MVLAQEESAR 870          
BLAST of Rab6-interacting protein 2/elks/erc/cast,putative vs. Ensembl Xenopus
Match: erc1 (ELKS/RAB6-interacting/CAST family member 1 [Source:NCBI gene;Acc:100145199])

HSP 1 Score: 263.848 bits (673), Expect = 2.965e-71
Identity = 253/803 (31.51%), Postives = 432/803 (53.80%), Query Frame = 3
Query:  717 MGSNPGY-------------DYHFPMI--------------DNVIMDYQTDLFSIQRELAKCQQELELTKEKLTSSVNSIKSFWSPELKRERSMRKDENSK-------YVLLAEELHQLQMEKKTM---------LSNVHQXXXXXXXXXXXXNKHSQTAQEIDLLYRRCDELEKENRILTKQSEEYEKRMISQKESLVTAEENIRKLLEVVKVAKSASSGHSALQGLRLERFEEDQTEIERLRSQIHEYSQRTIDLERAIVEKDFDISRNKEQGELLNQEVQNLRQENEHIRQDIQQTQTLQSLVDTKESKILTLENEIRLLEDELARMRDEELITPTTSVNGIDDYEKNMR--STVRPHERLMKSKLEALS-------------------------------CEISKRDSEIYSLQSRLEMAEKQHQDQNHHINVLKEQVKTREHKISMMMADVEDFXXXXXXXXXXXXXXSQILTSSQTEKHQTESEILDLKDQCEMKDKKISLLQRKVQNLEDLLNDKENQLTTAKSKLLNLHTEHSTTEGTKAGLEESLRDRERQLERLKESKTRMEHEFQDELEMQKKLVSETKSRLDNSERELREKVAMLNEMREELSELRAVKFKRESELNTIQVQCSQKTSEVAALQLELQTVRKQYISDTEYKS----NHRISELESQINHYSDSATRLQGEVDRLLNMVRNLESEKLEKDRQITQLECQVKEHQNTISNMKRTHQNERNYLNEDIDVLKRKEDNILVDMEVIKTTLTERENRIKELEQALRESLQITAERESYVHNKEDSYR 2885
            MGS+P               D+H P +              DN IMD Q  L  + RE    ++++E+ + KL+SS+NSIK+FWSPELK+ER++RKDE SK       Y ++ EE   LQM  + M         L+ + Q ++  R ++ L  +   T     LL+   D   KE  +L K  EE E R+ +QK++L   +E+I+KLLE+++            +G+  +  EED           HE ++R  + E  +   D  + + +++  +L +E+   R EN     D  +T+ LQ++++ K+SKI ++E  +R LEDE+  ++       +      ++ E+ M+     R H + MK+K+E L                                 E+S++D+E+ +LQ++LE    Q  D   H+ VLKE +  +E + +++  +V+  R RL+EKET+L KK++ +     EK     EI DLKD  ++K++K+++LQ+K++NL++ L DKE QL++ K ++ +L  + + T+     LEE+L ++ER +ERLK+ + R E E Q+ELE  KK + + K ++   + +L EK + L +++E  S L +   K++S L T+++   Q+  E   L+LE Q +RK      E KS    N R  ++E  +  Y +   + Q EVDRLL++++ +E+EK EKD +I +LE Q+K+    ++ +K   Q E+    + +D  +R+EDN+    + ++  + ++++RI+ELE+ALRES+QITAERE  V  +E+S R
Sbjct:  107 MGSSPNIATSGVASDTIAFGDHHLPPVSMASTVPHSLRQARDNTIMDLQAQLKEVLRENDLLRKDVEVKESKLSSSMNSIKTFWSPELKKERALRKDEVSKITVWKEQYRVVQEENQHLQMSIQAMQDELRIQRDLNQLFQQDSVGRLKEPLTGEL--TEDNFRLLHVEHDRQAKELFLLRKTLEEMELRIDTQKQTLSARDESIKKLLEMLQS-----------KGIPNKVMEED-----------HERTRRLAEAEMHVHHLDSLLEQKEKENNILREELHR-RFENA---PDSAKTKALQTVIEMKDSKITSMERGLRDLEDEIQMLK-------SNGAMSTEEREEEMKQMEVYRSHSKFMKNKVEQLKEELSAKENQAEELRKRVSALQTEQSSIGQVKQELSRKDTELLALQTKLETLNNQFSDSKQHVEVLKESLTAKEQRAAILQTEVDALRLRLEEKETMLNKKTKQIQEMSEEKGTLSGEIHDLKDMLDVKERKVNVLQKKIENLQEQLRDKEKQLSSLKDRVKSLQADTTNTDTALTTLEEALAEKERIIERLKDQRDRDEREKQEELESYKKELKDLKEKVSVLQGDLSEKESSLLDLKEHASTLASSSLKKDSRLKTLEIALEQRKEEF--LKLESQ-LRKALELAQEAKSNPETNERFQQMERDVTRYREEVGKSQAEVDRLLDILKEMENEKNEKDTKIAELERQIKDQNKKVATLKHKEQVEKKKNAQLLDEARRREDNLTDSSQQLQDVMRQKDDRIEELEEALRESVQITAERE-MVLAQEESAR 870          
BLAST of Rab6-interacting protein 2/elks/erc/cast,putative vs. Ensembl Xenopus
Match: erc1 (ELKS/RAB6-interacting/CAST family member 1 [Source:NCBI gene;Acc:100145199])

HSP 1 Score: 251.521 bits (641), Expect = 3.974e-68
Identity = 240/781 (30.73%), Postives = 417/781 (53.39%), Query Frame = 3
Query:  561 SQTNQQKLNAXXXXXXXXXXXDYERDPALMG--SLRPQIPLPPPMAQNIYPAPM--MGSNPGY-------------DYHFPMI--------------DNVIMDYQTDLFSIQRELAKCQQELELTKEKLTSSVNSIKSFWSPELKRERSMRKDENSK-------YVLLAEELHQLQMEKKTM---------LSNVHQXXXXXXXXXXXXNKHSQTAQEIDLLYRRCDELEKENRILTKQSEEYEKRMISQKESLVTAEENIRKLLEVVKVAKSASSGHSALQGLRLERFEEDQTEIERLRSQIHEYSQRTIDLERAIVEKDFDISRNKEQGELLNQEVQNLRQENEHIRQDIQQTQTLQSLVDTKESKILTLENEIRLLEDELARMRDEELITPTTSVNGIDDYEKNMR--STVRPHERLMKSKLEALSCEISKRDSEIYSLQSRLEMAEKQHQDQNHHINVLKEQVKTREHKISMMMADVEDFXXXXXXXXXXXXXXSQILTSSQTEKHQTESEILDLKDQCEMKDKKISLLQRKVQNLEDLLNDKENQLTTAKSKLLNLHTEHSTTEGTKAGLEESLRDRERQLERLKESKTRMEHEFQDELEMQKKLVSETKSRLDNSERELREKVAMLNEMREELSELRAVKFKRESELNTIQVQCSQKTSEVAALQLELQTVRKQYISDTEYKS----NHRISELESQINHYSDSATRLQGEVDRLLNMVRNLESEKLEKDRQITQLECQVKEHQNTISNMKRTHQNERNYLNEDIDVLKRKEDNI 2744
            S  N Q LNA+          D+E    ++G  + +  + L     +  Y   M  MGS+P               D+H P +              DN IMD Q  L  + RE    ++++E+ + KL+SS+NSIK+FWSPELK+ER++RKDE SK       Y ++ EE   LQM  + M         L+ + Q ++  R ++ L  +   T     LL+   D   KE  +L K  EE E R+ +QK++L   +E+I+KLLE+++            +G+  +  EED           HE ++R  + E  +   D  + + +++  +L +E+   R EN     D  +T+ LQ++++ K+SKI ++E  +R LEDE+  ++       +      ++ E+ M+     R H + MK+K+  +  E+S++D+E+ +LQ++LE    Q  D   H+ VLKE +  +E + +++  +V+  R RL+EKET+L KK++ +     EK     EI DLKD  ++K++K+++LQ+K++NL++ L DKE QL++ K ++ +L  + + T+     LEE+L ++ER +ERLK+ + R E E Q+ELE  KK + + K ++   + +L EK + L +++E  S L +   K++S L T+++   Q+  E   L+ +L+ V     S+ E KS    N R  ++E  +  Y +   + Q EVDRLL++++ +E+EK EKD +I +LE Q+K+    ++ +K   Q E+    + +D  +R+EDN+
Sbjct:   55 SMENIQSLNAAYATASPMYLSDHE----IVGGDTAKSTMTLGRSGGRLPYGVRMTAMGSSPNIATSGVASDTIAFGDHHLPPVSMASTVPHSLRQARDNTIMDLQAQLKEVLRENDLLRKDVEVKESKLSSSMNSIKTFWSPELKKERALRKDEVSKITVWKEQYRVVQEENQHLQMSIQAMQDELRIQRDLNQLFQQDSVGRLKEPLTGE--LTEDNFRLLHVEHDRQAKELFLLRKTLEEMELRIDTQKQTLSARDESIKKLLEMLQS-----------KGIPNKVMEED-----------HERTRRLAEAEMHVHHLDSLLEQKEKENNILREELHR-RFENA---PDSAKTKALQTVIEMKDSKITSMERGLRDLEDEIQMLK-------SNGAMSTEEREEEMKQMEVYRSHSKFMKNKIGQVKQELSRKDTELLALQTKLETLNNQFSDSKQHVEVLKESLTAKEQRAAILQTEVDALRLRLEEKETMLNKKTKQIQEMSEEKGTLSGEIHDLKDMLDVKERKVNVLQKKIENLQEQLRDKEKQLSSLKDRVKSLQADTTNTDTALTTLEEALAEKERIIERLKDQRDRDEREKQEELESYKKELKDLKEKVSVLQGDLSEKESSLLDLKEHASTLASSSLKKDSRLKTLEIALEQRKEEFLKLESQLRKV-----SNAEAKSNPETNERFQQMERDVTRYREEVGKSQAEVDRLLDILKEMENEKNEKDTKIAELERQIKDQNKKVATLKHKEQVEKKKNAQLLDEARRREDNL 791          
BLAST of Rab6-interacting protein 2/elks/erc/cast,putative vs. Ensembl Mouse
Match: Erc1 (ELKS/RAB6-interacting/CAST family member 1 [Source:MGI Symbol;Acc:MGI:2151013])

HSP 1 Score: 296.59 bits (758), Expect = 4.954e-82
Identity = 267/874 (30.55%), Postives = 480/874 (54.92%), Query Frame = 3
Query:  561 SQTNQQKLNAXXXXXXXXXXXDYERDPALMGSLRPQIPLPPPMAQNIYPAPM----MGSNPGY-------------DYHFPMI--------------DNVIMDYQTDLFSIQRELAKCQQELELTKEKLTSSVNSIKSFWSPELKRERSMRKDENSKYVLLAEELHQLQMEKKTMLSNVHQXXXXXXXXXXXXNKHSQ---------------TAQEIDLLYRRCDELEKENRILTKQSEEYEKRMISQKESLVTAEENIRKLLEVVKVAKSASSGHSALQGLRLERFEEDQTEIERLRSQIHEYSQRTIDLERAIVEKDFDISRNKEQGELLNQEVQNLRQENEHIRQDIQQTQTLQSLVDTKESKILTLENEIRLLEDELARMRDEELITPTTSVNGIDDYEKNMR--STVRPHERLMKSKLEALSCEISKRDSEIYSLQSRLEMAEKQHQDQNHHINVLKEQVKTREHKISMMMADVEDFXXXXXXXXXXXXXXSQILTSSQTEKHQTESEILDLKDQCEMKDKKISLLQRKVQNLEDLLNDKENQLTTAKSKLLNLHTEHSTTEGTKAGLEESLRDRERQLERLKESKTRMEHEFQDELEMQKKLVSETKSRLDNSERELREKVAMLNEMREELSELRAVKFKRESELNTIQVQCSQKTSEVAALQLELQTVRKQYISDTEYKSN----HRISELESQINHYSDSATRLQGEVDRLLNMVRNLESEKLEKDRQITQLECQVKEHQNTISNMKRTHQNERNYLNEDIDVLKRKEDNILVDMEVIKTTLTERENRIKELEQALRESLQITAERESYVHNKEDSYRQLELKISDQKQNLEIIQKERNQLSGQLASAQEELREKETQLKTLESE 3026
            S  N Q LNA+          D+E     +G+  P+  +    +    P  +    MGS+P               ++H P +              DN IMD QT L  + RE    ++++E+ + KL+SS+NSIK+FWSPELK+ER++RKDE SK  +  E+   +Q E + M   + Q   +  R +   N+  Q               T +    L+   +   KE  +L K  EE E R+ +QK++L   +E+I+KLLE+++            +GL  +  EED           HE ++R  + E  +   +  + + +++  +L +E+   R EN     D  +T+ LQ++++ K+SKI ++E  +R LE+E+  ++    ++        ++ E+ M+     R H + MK+K+  +  E+S++D+E+ +LQ++LE    Q  D   HI VLKE +  +E + +++  +V+  R RL+EKET+L KK++ +     EK     EI DLKD  ++K++K+++LQ+K++NL++ L DKE Q+++ K ++ +L  + + T+     LEE+L D+ER +ERLKE + R E E Q+E++  KK + + + ++   + +L EK A L +++E  S L +   K++S L T+++   QK  E   L++E Q ++K + +  E +++     RI +LE +I+ Y D +++ Q EVDRLL +++ +E+EK +KD++I +LE QVK+    ++N+K   Q E+    + ++  +R+ED++    + ++ +L ++++RI+ELE+ALRES+QITAERE  +  +E +    E ++ +    +E +++E   +  +L+S Q+ L EKET L  L +E
Sbjct:   55 SMENIQSLNAAYATSGPMYLSDHEN----VGAETPKSTMTLGRSGGRLPYGVRMTAMGSSPNIASSGVASDTIAFGEHHLPPVSMASTVPHSLRQARDNTIMDLQTQLKEVLRENDLLRKDVEVKESKLSSSMNSIKTFWSPELKKERALRKDEASKITIWKEQYRVVQEENQHMQMTI-QALQDELRIQRDLNQLFQQDSSSRTGEPCVAELTEENFQRLHAEHERQAKELFLLRKTLEEMELRIETQKQTLNARDESIKKLLEMLQS-----------KGLSAKATEED-----------HERTRRLAEAEMHVHHLESLLEQKEKENNMLREEMHR-RFENA---PDSAKTKALQTVIEMKDSKISSMERGLRDLEEEIQMLKSNGALSS-------EEREEEMKQMEVYRSHSKFMKNKIGQVKQELSRKDTELLALQTKLETLTNQFSDSKQHIEVLKESLTAKEQRAAILQTEVDALRLRLEEKETMLNKKTKQIQDMAEEKGTQAGEIHDLKDMLDVKERKVNVLQKKIENLQEQLRDKEKQMSSLKERVKSLQADTTNTDTALTTLEEALADKERTIERLKEQRDRDEREKQEEIDTYKKDLKDLREKVSLLQGDLSEKEASLLDIKEHASSLASSGLKKDSRLKTLEIALEQKKEEC--LKMESQ-LKKAHEATLEARASPEMSDRIQQLEREISRYKDESSKAQTEVDRLLEILKEVENEKNDKDKKIAELERQVKDQNKKVANLKHKEQVEKKKSAQMLEEARRREDSLSDSSQQLQDSLRKKDDRIEELEEALRESVQITAEREMVLAQEESARTNAEKQVEELLMAMEKVKQELESMKAKLSSTQQSLAEKETHLTNLRAE 887          
BLAST of Rab6-interacting protein 2/elks/erc/cast,putative vs. Ensembl Mouse
Match: Erc1 (ELKS/RAB6-interacting/CAST family member 1 [Source:MGI Symbol;Acc:MGI:2151013])

HSP 1 Score: 291.582 bits (745), Expect = 5.907e-81
Identity = 267/878 (30.41%), Postives = 480/878 (54.67%), Query Frame = 3
Query:  561 SQTNQQKLNAXXXXXXXXXXXDYERDPALMGSLRPQIPLPPPMAQNIYPAPM----MGSNPGY-------------DYHFPMI--------------DNVIMDYQTDLFSIQRELAKCQQELELTKEKLTSSVNSIKSFWSPELKRERSMRKDENSKYVLLAEELHQLQMEKKTMLSNVHQXXXXXXXXXXXXNKHSQ---------------TAQEIDLLYRRCDELEKENRILTKQSEEYEKRMISQKESLVTAEENIRKLLEVVKVAKSASSGHSALQGLRLERFEEDQTEIERLRSQIHEYSQRTIDLERAIVEKDFDISRNKEQGELLNQEVQNLRQENEHIRQDIQQTQTLQSLVDTKESKILTLENEIRLLEDELARMRDEELITPTTSVNGIDDYEKNMR--STVRPHERLMKSKLEALSCEISKRDSEIYSLQSRLEMAEKQHQDQNHHINVLKEQVKTREHKISMMMADVEDFXXXXXXXXXXXXXXSQILTSSQTEKHQTESEILDLKDQCEMKDKKISLLQRKVQNLEDLLNDKENQLTTAKSKLLNLHTEHSTTEGTKAGLEESLRDRERQLERLKESKTRMEHEFQDELEMQKKLVSETKSRLDNSERELREKVAMLNEMREELSELRAVKFKRESELNTIQVQCSQKTSEVAALQLELQTVRKQYISDTEYKS----NHRISELESQINHYSDSATRLQGEVDRLLNMVRNLESEKLEKDRQITQLEC----QVKEHQNTISNMKRTHQNERNYLNEDIDVLKRKEDNILVDMEVIKTTLTERENRIKELEQALRESLQITAERESYVHNKEDSYRQLELKISDQKQNLEIIQKERNQLSGQLASAQEELREKETQLKTLESE 3026
            S  N Q LNA+          D+E     +G+  P+  +    +    P  +    MGS+P               ++H P +              DN IMD QT L  + RE    ++++E+ + KL+SS+NSIK+FWSPELK+ER++RKDE SK  +  E+   +Q E + M   + Q   +  R +   N+  Q               T +    L+   +   KE  +L K  EE E R+ +QK++L   +E+I+KLLE+++            +GL  +  EED           HE ++R  + E  +   +  + + +++  +L +E+   R EN     D  +T+ LQ++++ K+SKI ++E  +R LE+E+  ++    ++        ++ E+ M+     R H + MK+K+  +  E+S++D+E+ +LQ++LE    Q  D   HI VLKE +  +E + +++  +V+  R RL+EKET+L KK++ +     EK     EI DLKD  ++K++K+++LQ+K++NL++ L DKE Q+++ K ++ +L  + + T+     LEE+L D+ER +ERLKE + R E E Q+E++  KK + + + ++   + +L EK A L +++E  S L +   K++S L T+++   QK  E   L++E Q ++K + +  E ++    + RI +LE +I+ Y D +++ Q EVDRLL +++ +E+EK +KD++I +LE     QVK+    ++N+K   Q E+    + ++  +R+ED++    + ++ +L ++++RI+ELE+ALRES+QITAERE  +  +E +    E ++ +    +E +++E   +  +L+S Q+ L EKET L  L +E
Sbjct:   55 SMENIQSLNAAYATSGPMYLSDHEN----VGAETPKSTMTLGRSGGRLPYGVRMTAMGSSPNIASSGVASDTIAFGEHHLPPVSMASTVPHSLRQARDNTIMDLQTQLKEVLRENDLLRKDVEVKESKLSSSMNSIKTFWSPELKKERALRKDEASKITIWKEQYRVVQEENQHMQMTI-QALQDELRIQRDLNQLFQQDSSSRTGEPCVAELTEENFQRLHAEHERQAKELFLLRKTLEEMELRIETQKQTLNARDESIKKLLEMLQS-----------KGLSAKATEED-----------HERTRRLAEAEMHVHHLESLLEQKEKENNMLREEMHR-RFENA---PDSAKTKALQTVIEMKDSKISSMERGLRDLEEEIQMLKSNGALSS-------EEREEEMKQMEVYRSHSKFMKNKIGQVKQELSRKDTELLALQTKLETLTNQFSDSKQHIEVLKESLTAKEQRAAILQTEVDALRLRLEEKETMLNKKTKQIQDMAEEKGTQAGEIHDLKDMLDVKERKVNVLQKKIENLQEQLRDKEKQMSSLKERVKSLQADTTNTDTALTTLEEALADKERTIERLKEQRDRDEREKQEEIDTYKKDLKDLREKVSLLQGDLSEKEASLLDIKEHASSLASSGLKKDSRLKTLEIALEQKKEEC--LKMESQ-LKKAHEATLEARASPEMSDRIQQLEREISRYKDESSKAQTEVDRLLEILKEVENEKNDKDKKIAELESLTSRQVKDQNKKVANLKHKEQVEKKKSAQMLEEARRREDSLSDSSQQLQDSLRKKDDRIEELEEALRESVQITAEREMVLAQEESARTNAEKQVEELLMAMEKVKQELESMKAKLSSTQQSLAEKETHLTNLRAE 891          
BLAST of Rab6-interacting protein 2/elks/erc/cast,putative vs. Ensembl Mouse
Match: Erc1 (ELKS/RAB6-interacting/CAST family member 1 [Source:MGI Symbol;Acc:MGI:2151013])

HSP 1 Score: 284.263 bits (726), Expect = 7.850e-78
Identity = 269/902 (29.82%), Postives = 481/902 (53.33%), Query Frame = 3
Query:  561 SQTNQQKLNAXXXXXXXXXXXDYERDPALMGSLRPQIPLPPPMAQNIYPAPM----MGSNPGY-------------DYHFPMI--------------DNVIMDYQTDLFSIQRELAKCQQELELTKEKLTSSVNSIKSFWSPELKRERSMRKDENSKYVLLAEELHQLQMEKKTMLSNVHQXXXXXXXXXXXXNKHSQ---------------TAQEIDLLYRRCDELEKENRILTKQSEEYEKRMISQKESLVTAEENIRKLLEVVKVAKSASSGHSALQGLRLERFEEDQTEIERLRSQIHEYSQRTIDLERAIVEKDFDISRNKEQGELLNQEVQNLRQENEHIRQDIQQTQTLQSLVDTKESKILTLENEIRLLEDELARMRDEELITPTTSVNGIDDYEKNMR--STVRPHERLMKSKLEALS----------------------------CEISKRDSEIYSLQSRLEMAEKQHQDQNHHINVLKEQVKTREHKISMMMADVEDFXXXXXXXXXXXXXXSQILTSSQTEKHQTESEILDLKDQCEMKDKKISLLQRKVQNLEDLLNDKENQLTTAKSKLLNLHTEHSTTEGTKAGLEESLRDRERQLERLKESKTRMEHEFQDELEMQKKLVSETKSRLDNSERELREKVAMLNEMREELSELRAVKFKRESELNTIQVQCSQKTSEVAALQLELQTVRKQYISDTEYKSN----HRISELESQINHYSDSATRLQGEVDRLLNMVRNLESEKLEKDRQITQLECQVKEHQNTISNMKRTHQNERNYLNEDIDVLKRKEDNILVDMEVIKTTLTERENRIKELEQALRESLQITAERESYVHNKEDSYRQLELKISDQKQNLEIIQKERNQLSGQLASAQEELREKETQLKTLESE 3026
            S  N Q LNA+          D+E     +G+  P+  +    +    P  +    MGS+P               ++H P +              DN IMD QT L  + RE    ++++E+ + KL+SS+NSIK+FWSPELK+ER++RKDE SK  +  E+   +Q E + M   + Q   +  R +   N+  Q               T +    L+   +   KE  +L K  EE E R+ +QK++L   +E+I+KLLE+++            +GL  +  EED           HE ++R  + E  +   +  + + +++  +L +E+   R EN     D  +T+ LQ++++ K+SKI ++E  +R LE+E+  ++    ++        ++ E+ M+     R H + MK+K+E L                              E+S++D+E+ +LQ++LE    Q  D   HI VLKE +  +E + +++  +V+  R RL+EKET+L KK++ +     EK     EI DLKD  ++K++K+++LQ+K++NL++ L DKE Q+++ K ++ +L  + + T+     LEE+L D+ER +ERLKE + R E E Q+E++  KK + + + ++   + +L EK A L +++E  S L +   K++S L T+++   QK  E   L++E Q ++K + +  E +++     RI +LE +I+ Y D +++ Q EVDRLL +++ +E+EK +KD++I +LE QVK+    ++N+K   Q E+    + ++  +R+ED++    + ++ +L ++++RI+ELE+ALRES+QITAERE  +  +E +    E ++ +    +E +++E   +  +L+S Q+ L EKET L  L +E
Sbjct:   55 SMENIQSLNAAYATSGPMYLSDHEN----VGAETPKSTMTLGRSGGRLPYGVRMTAMGSSPNIASSGVASDTIAFGEHHLPPVSMASTVPHSLRQARDNTIMDLQTQLKEVLRENDLLRKDVEVKESKLSSSMNSIKTFWSPELKKERALRKDEASKITIWKEQYRVVQEENQHMQMTI-QALQDELRIQRDLNQLFQQDSSSRTGEPCVAELTEENFQRLHAEHERQAKELFLLRKTLEEMELRIETQKQTLNARDESIKKLLEMLQS-----------KGLSAKATEED-----------HERTRRLAEAEMHVHHLESLLEQKEKENNMLREEMHR-RFENA---PDSAKTKALQTVIEMKDSKISSMERGLRDLEEEIQMLKSNGALSS-------EEREEEMKQMEVYRSHSKFMKNKVEQLKEELSSKDAQGEELKKRAAGLQSEIGQVKQELSRKDTELLALQTKLETLTNQFSDSKQHIEVLKESLTAKEQRAAILQTEVDALRLRLEEKETMLNKKTKQIQDMAEEKGTQAGEIHDLKDMLDVKERKVNVLQKKIENLQEQLRDKEKQMSSLKERVKSLQADTTNTDTALTTLEEALADKERTIERLKEQRDRDEREKQEEIDTYKKDLKDLREKVSLLQGDLSEKEASLLDIKEHASSLASSGLKKDSRLKTLEIALEQKKEEC--LKMESQ-LKKAHEATLEARASPEMSDRIQQLEREISRYKDESSKAQTEVDRLLEILKEVENEKNDKDKKIAELERQVKDQNKKVANLKHKEQVEKKKSAQMLEEARRREDSLSDSSQQLQDSLRKKDDRIEELEEALRESVQITAEREMVLAQEESARTNAEKQVEELLMAMEKVKQELESMKAKLSSTQQSLAEKETHLTNLRAE 915          
BLAST of Rab6-interacting protein 2/elks/erc/cast,putative vs. Ensembl Mouse
Match: Erc1 (ELKS/RAB6-interacting/CAST family member 1 [Source:MGI Symbol;Acc:MGI:2151013])

HSP 1 Score: 279.641 bits (714), Expect = 2.916e-76
Identity = 269/906 (29.69%), Postives = 481/906 (53.09%), Query Frame = 3
Query:  561 SQTNQQKLNAXXXXXXXXXXXDYERDPALMGSLRPQIPLPPPMAQNIYPAPM----MGSNPGY-------------DYHFPMI--------------DNVIMDYQTDLFSIQRELAKCQQELELTKEKLTSSVNSIKSFWSPELKRERSMRKDENSKYVLLAEELHQLQMEKKTMLSNVHQXXXXXXXXXXXXNKHSQ---------------TAQEIDLLYRRCDELEKENRILTKQSEEYEKRMISQKESLVTAEENIRKLLEVVKVAKSASSGHSALQGLRLERFEEDQTEIERLRSQIHEYSQRTIDLERAIVEKDFDISRNKEQGELLNQEVQNLRQENEHIRQDIQQTQTLQSLVDTKESKILTLENEIRLLEDELARMRDEELITPTTSVNGIDDYEKNMR--STVRPHERLMKSKLEALS----------------------------CEISKRDSEIYSLQSRLEMAEKQHQDQNHHINVLKEQVKTREHKISMMMADVEDFXXXXXXXXXXXXXXSQILTSSQTEKHQTESEILDLKDQCEMKDKKISLLQRKVQNLEDLLNDKENQLTTAKSKLLNLHTEHSTTEGTKAGLEESLRDRERQLERLKESKTRMEHEFQDELEMQKKLVSETKSRLDNSERELREKVAMLNEMREELSELRAVKFKRESELNTIQVQCSQKTSEVAALQLELQTVRKQYISDTEYKS----NHRISELESQINHYSDSATRLQGEVDRLLNMVRNLESEKLEKDRQITQLEC----QVKEHQNTISNMKRTHQNERNYLNEDIDVLKRKEDNILVDMEVIKTTLTERENRIKELEQALRESLQITAERESYVHNKEDSYRQLELKISDQKQNLEIIQKERNQLSGQLASAQEELREKETQLKTLESE 3026
            S  N Q LNA+          D+E     +G+  P+  +    +    P  +    MGS+P               ++H P +              DN IMD QT L  + RE    ++++E+ + KL+SS+NSIK+FWSPELK+ER++RKDE SK  +  E+   +Q E + M   + Q   +  R +   N+  Q               T +    L+   +   KE  +L K  EE E R+ +QK++L   +E+I+KLLE+++            +GL  +  EED           HE ++R  + E  +   +  + + +++  +L +E+   R EN     D  +T+ LQ++++ K+SKI ++E  +R LE+E+  ++    ++        ++ E+ M+     R H + MK+K+E L                              E+S++D+E+ +LQ++LE    Q  D   HI VLKE +  +E + +++  +V+  R RL+EKET+L KK++ +     EK     EI DLKD  ++K++K+++LQ+K++NL++ L DKE Q+++ K ++ +L  + + T+     LEE+L D+ER +ERLKE + R E E Q+E++  KK + + + ++   + +L EK A L +++E  S L +   K++S L T+++   QK  E   L++E Q ++K + +  E ++    + RI +LE +I+ Y D +++ Q EVDRLL +++ +E+EK +KD++I +LE     QVK+    ++N+K   Q E+    + ++  +R+ED++    + ++ +L ++++RI+ELE+ALRES+QITAERE  +  +E +    E ++ +    +E +++E   +  +L+S Q+ L EKET L  L +E
Sbjct:   55 SMENIQSLNAAYATSGPMYLSDHEN----VGAETPKSTMTLGRSGGRLPYGVRMTAMGSSPNIASSGVASDTIAFGEHHLPPVSMASTVPHSLRQARDNTIMDLQTQLKEVLRENDLLRKDVEVKESKLSSSMNSIKTFWSPELKKERALRKDEASKITIWKEQYRVVQEENQHMQMTI-QALQDELRIQRDLNQLFQQDSSSRTGEPCVAELTEENFQRLHAEHERQAKELFLLRKTLEEMELRIETQKQTLNARDESIKKLLEMLQS-----------KGLSAKATEED-----------HERTRRLAEAEMHVHHLESLLEQKEKENNMLREEMHR-RFENA---PDSAKTKALQTVIEMKDSKISSMERGLRDLEEEIQMLKSNGALSS-------EEREEEMKQMEVYRSHSKFMKNKVEQLKEELSSKDAQGEELKKRAAGLQSEIGQVKQELSRKDTELLALQTKLETLTNQFSDSKQHIEVLKESLTAKEQRAAILQTEVDALRLRLEEKETMLNKKTKQIQDMAEEKGTQAGEIHDLKDMLDVKERKVNVLQKKIENLQEQLRDKEKQMSSLKERVKSLQADTTNTDTALTTLEEALADKERTIERLKEQRDRDEREKQEEIDTYKKDLKDLREKVSLLQGDLSEKEASLLDIKEHASSLASSGLKKDSRLKTLEIALEQKKEEC--LKMESQ-LKKAHEATLEARASPEMSDRIQQLEREISRYKDESSKAQTEVDRLLEILKEVENEKNDKDKKIAELESLTSRQVKDQNKKVANLKHKEQVEKKKSAQMLEEARRREDSLSDSSQQLQDSLRKKDDRIEELEEALRESVQITAEREMVLAQEESARTNAEKQVEELLMAMEKVKQELESMKAKLSSTQQSLAEKETHLTNLRAE 919          
BLAST of Rab6-interacting protein 2/elks/erc/cast,putative vs. Ensembl Mouse
Match: Erc1 (ELKS/RAB6-interacting/CAST family member 1 [Source:MGI Symbol;Acc:MGI:2151013])

HSP 1 Score: 279.641 bits (714), Expect = 2.916e-76
Identity = 269/906 (29.69%), Postives = 481/906 (53.09%), Query Frame = 3
Query:  561 SQTNQQKLNAXXXXXXXXXXXDYERDPALMGSLRPQIPLPPPMAQNIYPAPM----MGSNPGY-------------DYHFPMI--------------DNVIMDYQTDLFSIQRELAKCQQELELTKEKLTSSVNSIKSFWSPELKRERSMRKDENSKYVLLAEELHQLQMEKKTMLSNVHQXXXXXXXXXXXXNKHSQ---------------TAQEIDLLYRRCDELEKENRILTKQSEEYEKRMISQKESLVTAEENIRKLLEVVKVAKSASSGHSALQGLRLERFEEDQTEIERLRSQIHEYSQRTIDLERAIVEKDFDISRNKEQGELLNQEVQNLRQENEHIRQDIQQTQTLQSLVDTKESKILTLENEIRLLEDELARMRDEELITPTTSVNGIDDYEKNMR--STVRPHERLMKSKLEALS----------------------------CEISKRDSEIYSLQSRLEMAEKQHQDQNHHINVLKEQVKTREHKISMMMADVEDFXXXXXXXXXXXXXXSQILTSSQTEKHQTESEILDLKDQCEMKDKKISLLQRKVQNLEDLLNDKENQLTTAKSKLLNLHTEHSTTEGTKAGLEESLRDRERQLERLKESKTRMEHEFQDELEMQKKLVSETKSRLDNSERELREKVAMLNEMREELSELRAVKFKRESELNTIQVQCSQKTSEVAALQLELQTVRKQYISDTEYKS----NHRISELESQINHYSDSATRLQGEVDRLLNMVRNLESEKLEKDRQITQLEC----QVKEHQNTISNMKRTHQNERNYLNEDIDVLKRKEDNILVDMEVIKTTLTERENRIKELEQALRESLQITAERESYVHNKEDSYRQLELKISDQKQNLEIIQKERNQLSGQLASAQEELREKETQLKTLESE 3026
            S  N Q LNA+          D+E     +G+  P+  +    +    P  +    MGS+P               ++H P +              DN IMD QT L  + RE    ++++E+ + KL+SS+NSIK+FWSPELK+ER++RKDE SK  +  E+   +Q E + M   + Q   +  R +   N+  Q               T +    L+   +   KE  +L K  EE E R+ +QK++L   +E+I+KLLE+++            +GL  +  EED           HE ++R  + E  +   +  + + +++  +L +E+   R EN     D  +T+ LQ++++ K+SKI ++E  +R LE+E+  ++    ++        ++ E+ M+     R H + MK+K+E L                              E+S++D+E+ +LQ++LE    Q  D   HI VLKE +  +E + +++  +V+  R RL+EKET+L KK++ +     EK     EI DLKD  ++K++K+++LQ+K++NL++ L DKE Q+++ K ++ +L  + + T+     LEE+L D+ER +ERLKE + R E E Q+E++  KK + + + ++   + +L EK A L +++E  S L +   K++S L T+++   QK  E   L++E Q ++K + +  E ++    + RI +LE +I+ Y D +++ Q EVDRLL +++ +E+EK +KD++I +LE     QVK+    ++N+K   Q E+    + ++  +R+ED++    + ++ +L ++++RI+ELE+ALRES+QITAERE  +  +E +    E ++ +    +E +++E   +  +L+S Q+ L EKET L  L +E
Sbjct:   55 SMENIQSLNAAYATSGPMYLSDHEN----VGAETPKSTMTLGRSGGRLPYGVRMTAMGSSPNIASSGVASDTIAFGEHHLPPVSMASTVPHSLRQARDNTIMDLQTQLKEVLRENDLLRKDVEVKESKLSSSMNSIKTFWSPELKKERALRKDEASKITIWKEQYRVVQEENQHMQMTI-QALQDELRIQRDLNQLFQQDSSSRTGEPCVAELTEENFQRLHAEHERQAKELFLLRKTLEEMELRIETQKQTLNARDESIKKLLEMLQS-----------KGLSAKATEED-----------HERTRRLAEAEMHVHHLESLLEQKEKENNMLREEMHR-RFENA---PDSAKTKALQTVIEMKDSKISSMERGLRDLEEEIQMLKSNGALSS-------EEREEEMKQMEVYRSHSKFMKNKVEQLKEELSSKDAQGEELKKRAAGLQSEIGQVKQELSRKDTELLALQTKLETLTNQFSDSKQHIEVLKESLTAKEQRAAILQTEVDALRLRLEEKETMLNKKTKQIQDMAEEKGTQAGEIHDLKDMLDVKERKVNVLQKKIENLQEQLRDKEKQMSSLKERVKSLQADTTNTDTALTTLEEALADKERTIERLKEQRDRDEREKQEEIDTYKKDLKDLREKVSLLQGDLSEKEASLLDIKEHASSLASSGLKKDSRLKTLEIALEQKKEEC--LKMESQ-LKKAHEATLEARASPEMSDRIQQLEREISRYKDESSKAQTEVDRLLEILKEVENEKNDKDKKIAELESLTSRQVKDQNKKVANLKHKEQVEKKKSAQMLEEARRREDSLSDSSQQLQDSLRKKDDRIEELEEALRESVQITAEREMVLAQEESARTNAEKQVEELLMAMEKVKQELESMKAKLSSTQQSLAEKETHLTNLRAE 919          
BLAST of Rab6-interacting protein 2/elks/erc/cast,putative vs. UniProt/SwissProt
Match: sp|Q8IUD2|RB6I2_HUMAN (ELKS/Rab6-interacting/CAST family member 1 OS=Homo sapiens OX=9606 GN=ERC1 PE=1 SV=1)

HSP 1 Score: 280.411 bits (716), Expect = 9.268e-76
Identity = 267/899 (29.70%), Postives = 474/899 (52.73%), Query Frame = 3
Query:  561 SQTNQQKLNAXXXXXXXXXXXDYERDPALMGSLRPQIPLPPPMAQNIYPAPM----MGSNPGY-------------DYHFPMI--------------DNVIMDYQTDLFSIQRELAKCQQELELTKEKLTSSVNSIKSFWSPELKRERSMRKDENSKYVLLAEELHQLQMEKKTMLSNVHQXXXXXXXXXXXXNKHSQ---------------TAQEIDLLYRRCDELEKENRILTKQSEEYEKRMISQKESLVTAEENIRKLLEVVKVAKSASSGHSALQGLRLERFEEDQTEIERLRSQIHEYSQRTIDLERAIVEKDFDISRNKEQGELLNQEVQNLRQENEHIRQDIQQTQTLQSLVDTKESKILTLENEIRLLEDELARMRDEELITPTTSVNGIDDYEKNMR--STVRPHERLMKSKLEALS----------------------------CEISKRDSEIYSLQSRLEMAEKQHQDQNHHINVLKEQVKTREHKISMMMADVEDFXXXXXXXXXXXXXXSQILTSSQTEKHQTESEILDLKDQCEMKDKKISLLQRKVQNLEDLLNDKENQLTTAKSKLLNLHTEHSTTEGTKAGLEESLRDRERQLERLKESKTRMEHEFQDELEMQKKLVSETKSRLDNSERELREKVAMLNEMREELSELRAVKFKRESELNTIQVQCSQKTSEVAALQLELQTVRKQYI-SDTEYKSNHRISELESQINHYSDSATRLQGEVDRLLNMVRNLESEKLEKDRQITQLECQVKEHQNTISNMKRTHQNERNYLNEDIDVLKRKEDNILVDMEVIKTTLTERENRIKELEQALRESLQITAERESYVHNKEDSYRQLELKISDQKQNLEIIQKERNQLSGQLASAQEELREKETQLKTLESE 3026
            S  N Q LNA+          D+E     +GS  P+  +    +    P  +    MGS+P               ++H P +              DN IMD QT L  + RE    ++++E+ + KL+SS+NSIK+FWSPELK+ER++RKDE SK  +  E+   +Q E + M   + Q   +  R +   N+  Q               T +    L+   +   KE  +L K  EE E R+ +QK++L   +E+I+KLLE+++            +GL  +  EED           HE ++R  + E  +   +  + + +++  +L +E+   R EN     D  +T+ LQ++++ K+SKI ++E  +R LE+E+  ++       +      ++ E+ M+     R H + MK+K+E L                              E+S++D+E+ +LQ++LE    Q  D   HI VLKE +  +E + +++  +V+  R RL+EKET+L KK++ +     EK     EI DLKD  ++K++K+++LQ+K++NL++ L DKE Q+++ K ++ +L  + + T+     LEE+L ++ER +ERLKE + R E E Q+E++  KK + + K ++   + +L EK A L +++E  S L +   K++S L T+++   QK  E   ++ +L+   +  + +    + + RI  LE +I  Y D +++ Q EVDRLL +++ +E+EK +KD++I +LE QVK+    ++N+K   Q E+    + ++  +R+EDN+    + ++ +L ++++RI+ELE+ALRES+QITAERE  +  +E +    E ++ +    +E +++E   +  +L+S Q+ L EKET L  L +E
Sbjct:   55 SMENIQSLNAAYATSGPMYLSDHEN----VGSETPKSTMTLGRSGGRLPYGVRMTAMGSSPNIASSGVASDTIAFGEHHLPPVSMASTVPHSLRQARDNTIMDLQTQLKEVLRENDLLRKDVEVKESKLSSSMNSIKTFWSPELKKERALRKDEASKITIWKEQYRVVQEENQHMQMTI-QALQDELRIQRDLNQLFQQDSSSRTGEPCVAELTEENFQRLHAEHERQAKELFLLRKTLEEMELRIETQKQTLNARDESIKKLLEMLQS-----------KGLSAKATEED-----------HERTRRLAEAEMHVHHLESLLEQKEKENSMLREEMHR-RFENA---PDSAKTKALQTVIEMKDSKISSMERGLRDLEEEIQMLK-------SNGALSTEEREEEMKQMEVYRSHSKFMKNKVEQLKEELSSKEAQWEELKKKAAGLQAEIGQVKQELSRKDTELLALQTKLETLTNQFSDSKQHIEVLKESLTAKEQRAAILQTEVDALRLRLEEKETMLNKKTKQIQDMAEEKGTQAGEIHDLKDMLDVKERKVNVLQKKIENLQEQLRDKEKQMSSLKERVKSLQADTTNTDTALTTLEEALAEKERTIERLKEQRDRDEREKQEEIDNYKKDLKDLKEKVSLLQGDLSEKEASLLDLKEHASSLASSGLKKDSRLKTLEIALEQKKEECLKMESQLKKAHEAALEARASPEMSDRIQHLEREITRYKDESSKAQAEVDRLLEILKEVENEKNDKDKKIAELERQVKDQNKKVANLKHKEQVEKKKSAQMLEEARRREDNLNDSSQQLQDSLRKKDDRIEELEEALRESVQITAEREMVLAQEESARTNAEKQVEELLMAMEKVKQELESMKAKLSSTQQSLAEKETHLTNLRAE 915          
BLAST of Rab6-interacting protein 2/elks/erc/cast,putative vs. UniProt/SwissProt
Match: sp|Q99MI1|RB6I2_MOUSE (ELKS/Rab6-interacting/CAST family member 1 OS=Mus musculus OX=10090 GN=Erc1 PE=1 SV=1)

HSP 1 Score: 280.026 bits (715), Expect = 1.503e-75
Identity = 269/906 (29.69%), Postives = 481/906 (53.09%), Query Frame = 3
Query:  561 SQTNQQKLNAXXXXXXXXXXXDYERDPALMGSLRPQIPLPPPMAQNIYPAPM----MGSNPGY-------------DYHFPMI--------------DNVIMDYQTDLFSIQRELAKCQQELELTKEKLTSSVNSIKSFWSPELKRERSMRKDENSKYVLLAEELHQLQMEKKTMLSNVHQXXXXXXXXXXXXNKHSQ---------------TAQEIDLLYRRCDELEKENRILTKQSEEYEKRMISQKESLVTAEENIRKLLEVVKVAKSASSGHSALQGLRLERFEEDQTEIERLRSQIHEYSQRTIDLERAIVEKDFDISRNKEQGELLNQEVQNLRQENEHIRQDIQQTQTLQSLVDTKESKILTLENEIRLLEDELARMRDEELITPTTSVNGIDDYEKNMR--STVRPHERLMKSKLEALS----------------------------CEISKRDSEIYSLQSRLEMAEKQHQDQNHHINVLKEQVKTREHKISMMMADVEDFXXXXXXXXXXXXXXSQILTSSQTEKHQTESEILDLKDQCEMKDKKISLLQRKVQNLEDLLNDKENQLTTAKSKLLNLHTEHSTTEGTKAGLEESLRDRERQLERLKESKTRMEHEFQDELEMQKKLVSETKSRLDNSERELREKVAMLNEMREELSELRAVKFKRESELNTIQVQCSQKTSEVAALQLELQTVRKQYISDTEYKS----NHRISELESQINHYSDSATRLQGEVDRLLNMVRNLESEKLEKDRQITQLEC----QVKEHQNTISNMKRTHQNERNYLNEDIDVLKRKEDNILVDMEVIKTTLTERENRIKELEQALRESLQITAERESYVHNKEDSYRQLELKISDQKQNLEIIQKERNQLSGQLASAQEELREKETQLKTLESE 3026
            S  N Q LNA+          D+E     +G+  P+  +    +    P  +    MGS+P               ++H P +              DN IMD QT L  + RE    ++++E+ + KL+SS+NSIK+FWSPELK+ER++RKDE SK  +  E+   +Q E + M   + Q   +  R +   N+  Q               T +    L+   +   KE  +L K  EE E R+ +QK++L   +E+I+KLLE+++            +GL  +  EED           HE ++R  + E  +   +  + + +++  +L +E+   R EN     D  +T+ LQ++++ K+SKI ++E  +R LE+E+  ++    ++        ++ E+ M+     R H + MK+K+E L                              E+S++D+E+ +LQ++LE    Q  D   HI VLKE +  +E + +++  +V+  R RL+EKET+L KK++ +     EK     EI DLKD  ++K++K+++LQ+K++NL++ L DKE Q+++ K ++ +L  + + T+     LEE+L D+ER +ERLKE + R E E Q+E++  KK + + + ++   + +L EK A L +++E  S L +   K++S L T+++   QK  E   L++E Q ++K + +  E ++    + RI +LE +I+ Y D +++ Q EVDRLL +++ +E+EK +KD++I +LE     QVK+    ++N+K   Q E+    + ++  +R+ED++    + ++ +L ++++RI+ELE+ALRES+QITAERE  +  +E +    E ++ +    +E +++E   +  +L+S Q+ L EKET L  L +E
Sbjct:   55 SMENIQSLNAAYATSGPMYLSDHEN----VGAETPKSTMTLGRSGGRLPYGVRMTAMGSSPNIASSGVASDTIAFGEHHLPPVSMASTVPHSLRQARDNTIMDLQTQLKEVLRENDLLRKDVEVKESKLSSSMNSIKTFWSPELKKERALRKDEASKITIWKEQYRVVQEENQHMQMTI-QALQDELRIQRDLNQLFQQDSSSRTGEPCVAELTEENFQRLHAEHERQAKELFLLRKTLEEMELRIETQKQTLNARDESIKKLLEMLQS-----------KGLSAKATEED-----------HERTRRLAEAEMHVHHLESLLEQKEKENNMLREEMHR-RFENA---PDSAKTKALQTVIEMKDSKISSMERGLRDLEEEIQMLKSNGALSS-------EEREEEMKQMEVYRSHSKFMKNKVEQLKEELSSKDAQGEELKKRAAGLQSEIGQVKQELSRKDTELLALQTKLETLTNQFSDSKQHIEVLKESLTAKEQRAAILQTEVDALRLRLEEKETMLNKKTKQIQDMAEEKGTQAGEIHDLKDMLDVKERKVNVLQKKIENLQEQLRDKEKQMSSLKERVKSLQADTTNTDTALTTLEEALADKERTIERLKEQRDRDEREKQEEIDTYKKDLKDLREKVSLLQGDLSEKEASLLDIKEHASSLASSGLKKDSRLKTLEIALEQKKEEC--LKMESQ-LKKAHEATLEARASPEMSDRIQQLEREISRYKDESSKAQTEVDRLLEILKEVENEKNDKDKKIAELESLTSRQVKDQNKKVANLKHKEQVEKKKSAQMLEEARRREDSLSDSSQQLQDSLRKKDDRIEELEEALRESVQITAEREMVLAQEESARTNAEKQVEELLMAMEKVKQELESMKAKLSSTQQSLAEKETHLTNLRAE 919          
BLAST of Rab6-interacting protein 2/elks/erc/cast,putative vs. UniProt/SwissProt
Match: sp|Q811U3|RB6I2_RAT (ELKS/Rab6-interacting/CAST family member 1 OS=Rattus norvegicus OX=10116 GN=Erc1 PE=1 SV=1)

HSP 1 Score: 243.432 bits (620), Expect = 1.713e-64
Identity = 246/837 (29.39%), Postives = 441/837 (52.69%), Query Frame = 3
Query:  561 SQTNQQKLNAXXXXXXXXXXXDYERDPALMGSLRPQIPLPPPMAQNIYPAPM----MGSNPGY-------------DYHFPMI--------------DNVIMDYQTDLFSIQRELAKCQQELELTKEKLTSSVNSIKSFWSPELKRERSMRKDENSKYVLLAEELHQLQMEKKTMLSNVHQXXXXXXXXXXXXNKHSQ---------------TAQEIDLLYRRCDELEKENRILTKQSEEYEKRMISQKESLVTAEENIRKLLEVVKVAKSASSGHSALQGLRLERFEEDQTEIERLRSQIHEYSQRTIDLERAIVEKDFDISRNKEQGELLNQEVQNLRQENEHIRQDIQQTQTLQSLVDTKESKILTLENEIRLLEDELARMRDEELITPTTSVNGIDDYEKNMR--STVRPHERLMKSKLEALSCEISKRDSEIYSLQSRLEMAEKQHQDQNHHINVLKEQVKTREHKISMMMADVEDFXXXXXXXXXXXXXXSQILTSSQTEKHQTESEILDLKDQCEMKDKKISLLQRKVQNLEDLLNDKENQLTTAKSKLLNLHTEHSTTEGTKAGLEESLRDRERQLERLKESKTRMEHEFQDELEMQKKLVSETKSRLDNSERELREKVAMLNEMREELSELRAVKFKRESELNTIQVQCSQKTSEVAALQLELQTVRKQYISDTEYKS----NHRISELESQINHYSDSATRLQGEVDRLLNMVRNLESEKLEKDRQITQLEC----QVKEHQNTISNMKRTHQNERNYLNEDIDVLKRKEDN------------ILVDMEVIKTTLTERENRIKELEQALRESLQITAERESYVHN 2867
            S  N Q LNA+          D+E     +G+  P+  +    +    P  +    MGS+P               ++H P +              DN IMD QT L  + RE    ++++E+ + KL+SS+NSIK+FWSPELK+ER++RKDE SK  +  E+   +Q E + M   + Q   +  R +   N+  Q               T +    L+   +   KE  +L K  EE E R+ +QK++L   +E+I+KLLE+++            +GL  +  EED           HE ++R  + E  +   +  + + +++  +L +E+   R EN     D  +T+ LQ++++ K+SKI ++E  +R LE+E+  ++       +      ++ E+ M+     R H + MK+K+  +  E+S++D+E+ +LQ++LE    Q  D   HI VLKE +  +E + +++  +V+  R RL+EKET+L KK++ +     EK     EI DLKD  ++K++K+++LQ+K++NL++ L DKE Q+++ K ++ +L  + + T+     LEE+L D+ER +ERLKE + R E E Q+E++  KK + + K ++   + +L EK A L +++E  S L +   K++S L T+++   QK  E   L++E Q ++K + +  E ++    + RI +LE +I  Y D +++ Q EVDRLL +++ +E+EK +KD++I +LE     QVK+    ++N+K   Q E+    + ++  +R+ED+            +L+ ME +K  L   + ++   +Q+L       AE+E+++ N
Sbjct:   55 SMENIQSLNAAYATSGPMYLSDHEN----VGAETPKSTMTLGRSGGRLPYGVRMTAMGSSPNIASSGVASDTIAFGEHHLPPVSMASTVPHSLRQARDNTIMDLQTQLKEVLRENDLLRKDVEVKESKLSSSMNSIKTFWSPELKKERALRKDEASKITIWKEQYRVVQEENQHMQMTI-QALQDELRIQRDLNQLFQQDSSSRTGEPCVAELTEENFQRLHAEHERQAKELFLLRKTLEEMELRIETQKQTLNARDESIKKLLEMLQS-----------KGLSAKATEED-----------HERTRRLAEAEMHVHHLESLLEQKEKENNMLREEMHR-RFENA---PDSAKTKALQTVIEMKDSKISSMERGLRDLEEEIQMLK-------SNGALSTEEREEEMKQMEVYRSHSKFMKNKIGQVKQELSRKDTELLALQTKLETLTNQFSDSKQHIEVLKESLTAKEQRAAILQTEVDALRLRLEEKETMLNKKTKQIQDMAEEKGTQAGEIHDLKDMLDVKERKVNVLQKKIENLQEQLRDKEKQMSSLKERVKSLQADTTNTDTALTTLEEALADKERTIERLKEQRDRDEREKQEEIDTYKKDLKDLKEKVSLLQGDLSEKEASLLDLKEHASSLASSGLKKDSRLKTLEIALEQKKEEC--LKMESQ-LKKAHEATLEARASPEMSDRIQQLEREIARYKDESSKAQTEVDRLLEILKEVENEKNDKDKKIAELESLTSRQVKDQNKKVANLKHKEQVEKKKSAQMLEEARRREDSLSDSSQQLQVEELLMAMEKVKQELESMKAKLSSTQQSL-------AEKETHLTN 843          
BLAST of Rab6-interacting protein 2/elks/erc/cast,putative vs. UniProt/SwissProt
Match: sp|O15083|ERC2_HUMAN (ERC protein 2 OS=Homo sapiens OX=9606 GN=ERC2 PE=1 SV=3)

HSP 1 Score: 241.506 bits (615), Expect = 8.120e-64
Identity = 213/712 (29.92%), Postives = 392/712 (55.06%), Query Frame = 3
Query:  708 APMMGSNPGYDYHFPMI-----DNVIMDYQTDLFSIQRELAKCQQELELTKEKLTSSVNSIKSFWSPELKRERSMRKDENSKYVLLAEEL-------HQLQMEKKTMLSNVHQXXXXXXXXXXXXNKHSQTAQEIDLL---YRRC----DELEKENRILTKQSEEYEKRMISQKESLVTAEENIRKLLEVVKVAKSASSGHSALQGLRLERFEEDQTEIERLRSQIHEYSQRTIDLERAIVEKDFDISRNKEQGELLNQEVQNLRQENEHIRQDIQQTQTLQSLVDTKESKILTLENEIRLLEDELARMRDEELITPTTSVNGI---DDYEKNMR--STVRPHERLMKSKLEALSCEISKRDSEIYSLQSRLEMAEKQHQDQNHHINVLKEQVKTREHKISMMMADVEDFXXXXXXXXXXXXXXSQILTSSQTEKHQTESEILDLKDQCEMKDKKISLLQRKVQNLEDLLNDKENQLTTAKSKLLNLHTEHSTTEGTKAGLEESLRDRERQLERLKESKTRMEHEFQDELEMQKKLVSETKSRLDNSERELREKVAMLNEMREELSELRAVKFKRESELNTIQVQCSQKTSEVAALQLELQTVRKQYISD-----TEYKSNHRISELESQINHYSDSATRLQGEVDRLLNMVRNLESEKLEKDRQITQLEC----QVKEHQNTISNMKRTHQNERNYLNEDIDVLKRKEDNI 2744
              + GS+  + +  P +     D+ ++D Q  L  +QRE    ++EL++   KL SS+NSIK+FWSPELK+ER +RK+E ++  +L E++         LQ+  + +   +          ++           I+L    +RR     D   KE  +L K  EE E R+ +QK++L   +E+I+KLLE+++            +GL  +  E+D           +E ++R  + E  +   +  + + +++   L +E+    Q    ++ +  +T+ LQ++++ K++KI +LE  IR LEDE+  ++           NG+   +D E+ ++     + H + MK+K++ L  E+SK++SE+ +LQ++LE    Q+ D   HI VLKE +  +E + +++  +V+  R RL+EKE+ L KK++ L     EK     EI D+KD  E+K++KI++LQ+K++NL++ L DK+ QLT  K ++ +L T+ S T+   A LEE+L ++ER +ERLKE + R + E  +E+E  +K   + K +++  + EL EK + L +++E  S L +   KR+S+L ++++   QK  E +  +LE Q  +   I D      E+    +I +L+ + ++Y D   + Q EVDRLL +++ +E+EK +KD++I +LE      +K+    ++N+K   Q E+    + ++ ++R+ED++
Sbjct:  122 GGLTGSSHHHHHQVPSMLRQVRDSTMLDLQAQLKELQRENDLLRKELDIKDSKLGSSMNSIKTFWSPELKKERVLRKEEAARMSVLKEQMRVSHEENQHLQLTIQALQDELRTQRDLNHLLQQESGNRGAEHFTIELTEENFRRLQAEHDRQAKELFLLRKTLEEMELRIETQKQTLNARDESIKKLLEMLQS-----------KGLPSKSLEDD-----------NERTRRMAEAESQVSHLEVILDQKEKENIHLREELHRRSQ----LQPEPAKTKALQTVIEMKDTKIASLERNIRDLEDEIQMLK----------ANGVLNTEDREEEIKQIEVYKSHSKFMKTKIDQLKQELSKKESELLALQTKLETLSNQNSDCKQHIEVLKESLTAKEQRAAILQTEVDALRLRLEEKESFLNKKTKQLQDLTEEKGTLAGEIRDMKDMLEVKERKINVLQKKIENLQEQLRDKDKQLTNLKDRVKSLQTDSSNTDTALATLEEALSEKERIIERLKEQRERDDRERLEEIESFRKENKDLKEKVNALQAELTEKESSLIDLKEHASSLASAGLKRDSKLKSLEIAIEQKKEECS--KLEAQLKKAHNIEDDSRMNPEFAD--QIKQLDKEASYYRDECGKAQAEVDRLLEILKEVENEKNDKDKKIAELESLTLRHMKDQNKKVANLKHNQQLEKKKNAQLLEEVRRREDSM 793          
BLAST of Rab6-interacting protein 2/elks/erc/cast,putative vs. UniProt/SwissProt
Match: sp|Q6PH08|ERC2_MOUSE (ERC protein 2 OS=Mus musculus OX=10090 GN=Erc2 PE=1 SV=2)

HSP 1 Score: 236.884 bits (603), Expect = 2.116e-62
Identity = 216/735 (29.39%), Postives = 405/735 (55.10%), Query Frame = 3
Query:  759 DNVIMDYQTDLFSIQRELAKCQQELELTKEKLTSSVNSIKSFWSPELKRERSMRKDENSKYVLLAEEL-------HQLQMEKKTMLSNVHQXXXXXXXXXXXXNKHSQTAQEIDLL---YRRC----DELEKENRILTKQSEEYEKRMISQKESLVTAEENIRKLLEVVKVAKSASSGHSALQGLRLERFEEDQTEIERLRSQIHEYSQRTIDLERAIVEKDFDISRNKEQGELLNQEVQNLRQENEHIRQDIQQTQTLQSLVDTKESKILTLENEIRLLEDELARMRDEELITPTTSVNGI---DDYEKNMR--STVRPHERLMKSKLEALSCEISKRDSEIYSLQSRLEMAEKQHQDQNHHINVLKEQVKTREHKISMMMADVEDFXXXXXXXXXXXXXXSQILTSSQTEKHQTESEILDLKDQCEMKDKKISLLQRKVQNLEDLLNDKENQLTTAKSKLLNLHTEHSTTEGTKAGLEESLRDRERQLERLKESKTRMEHEFQDELEMQKKLVSETKSRLDNSERELREKVAMLNEMREELSELRAVKFKRESELNTIQVQCSQKTSEVAALQLELQTVRKQYISDTEYKSN----HRISELESQINHYSDSATRLQGEVDRLLNMVRNLESEKLEKDRQITQLEC----QVKEHQNTISNMKRTHQNERNYLNEDIDVLKRKEDNIL-----VDMEVIKTTLTERENRIKELEQALRESLQITAERESYVHN 2867
            D+ ++D Q  L  +QRE    ++EL++   KL SS+NSIK+FWSPELK+ER +RK+E ++  +L E++         LQ+  + +   +          ++           I+L    +RR     D   KE  +L K  EE E R+ +QK++L   +E+I+KLLE+++            +GL  +  E+D           +E ++R  + E  +   +  + + +++   L +E+    Q    ++ +  +T+ LQ++++ K++KI +LE  IR LEDE+  ++           NG+   +D E+ ++     + H + MK+K++ L  E+SK++SE+ +LQ++LE    Q+ D   HI VLKE +  +E + +++  +V+  R RL+EKE+ L KK++ L     EK     EI D+KD  E+K++KI++LQ+K++NL++ L DK+ QLT  K ++ +L T+ S T+   A LEE+L ++ER +ERLKE + R + E  +E+E  +K   + K +++  + EL EK + L +++E  S L +   KR+S+L ++++   QK  E   L+ +L   +K +  + + + N     R+ +L+ + ++Y D   + Q EVDRLL +++ +E+EK +KD++I +LE      +K+    ++N+K   Q E+    + ++ ++R+ED+++     + +E +   L +    +   +  L  + Q  AE+E+++ N
Sbjct:  144 DSTMLDLQAQLKELQRENDLLRKELDIKDSKLGSSMNSIKTFWSPELKKERVLRKEEAARMSVLKEQMRVSHEENQHLQLTIQALQDELRTQRDLNHLLQQESGNRGAEHFTIELTEENFRRLQAEHDRQAKELFLLRKTLEEMELRIETQKQTLNARDESIKKLLEMLQS-----------KGLPSKSLEDD-----------NERTRRMAEAESQVSHLEVILDQKEKENIHLREELHRRSQ----LQPEPAKTKALQTVIEMKDTKIASLERNIRDLEDEVQMLK----------ANGVLNTEDREEEIKQIEVYKSHSKFMKTKIDQLKQELSKKESELLALQTKLETLSNQNSDCKQHIEVLKESLTAKEQRAAILQTEVDALRLRLEEKESFLNKKTKQLQDLTEEKGTLAGEIRDMKDMLEVKERKINVLQKKIENLQEQLRDKDKQLTNLKDRVKSLQTDSSNTDTALATLEEALSEKERIIERLKEQRERDDRERLEEIESFRKENKDLKEKVNALQAELTEKESSLIDLKEHASSLASAGLKRDSKLKSLEIAIEQKKEECNKLEAQL---KKAHNIEDDSRMNPEFADRLKQLDKEASYYRDECGKAQAEVDRLLEILKEVENEKNDKDKKIAELESLTLRHMKDQNKKVANLKYNQQLEKKKNAQLLEEVRRREDSMVDNSQHLQIEELMNALEKTRQELDATKARLASTQQSLAEKEAHLAN 839          
BLAST of Rab6-interacting protein 2/elks/erc/cast,putative vs. TrEMBL
Match: A0A5K4FCC9 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 1118.22 bits (2891), Expect = 0.000e+0
Identity = 863/2441 (35.35%), Postives = 1396/2441 (57.19%), Query Frame = 3
Query:  321 PLVTQYSTNKSISTQNLSSIGNQYYSYRDRMPLDNQMIITNPINERPRP--ASARDPGFTDLMDMPTPQQRRL---------------YETLYTPRHSQTNQQKLNAXXXXXXXXXXXDYERD------PALMG---------SLRPQIPLPPPMAQNIYPAPMMGSNPGYDYHFPMIDNVIMDYQTDLFSIQRELAKCQQELELTKEKLTSSVNSIKSFWSPELKRERSMRKDENSKYVLLAEELHQLQMEKKTMLSNVHQXXXXXXXXXXXXNKH--------SQTAQEIDLLYRRCDELEKENRILTKQSEEYEKRMISQKESLVTAEENIRKLLEVVKVAKSA-------------------SSG-HSALQGLRLERFEEDQTEIERLRSQIHEYSQRTIDLERAIVEKDFDISRNKEQGELLNQEVQNLRQENEHIRQDIQQTQTLQSLVDTKESKILTLENEIRLLEDELARMRDEELITPTTSVN-GIDDYEKNMRSTVRPHERLMKSKLEALSCEISKRDSEIYSLQSRLEMAEKQHQDQNHHINVLKEQVKTREHKISMMMADVEDFXXXXXXXXXXXXXXSQILTSSQTEKHQTESEILDLKDQCEMKDKKISLLQRKVQNLEDLLNDKENQLTTAKSKLLNLHTEHSTTEGTKAGLEESLRDRERQLERLKESKTRMEHEFQDELEMQKKLVSETKSRLDNSERELREKVAMLNEMREELSELRAVKFKRESELNTIQVQCSQKTSEVAALQLELQTVRKQYISDTEYKSNHRISELESQINHYSDSATRLQGEVDRLLNMVRNLESEKLEKDRQITQLECQVKEHQNTISNMKRTHQNERNYLNEDIDVLKRKEDNILVDMEVIKTTLTERENRIKELEQALRESLQITAERESYVHNKEDSYRQLELKISDQKQNLEIIQKERNQLSGQLASAQEELREKETQLKTLESECFQNYIPELDRQRKSNQELVLRVQALVKIIQGREFQLSEQERISLTELGLYPDTFAHRGYPSTGRISAGPYSTGYNNYSKVTWSMGSYPISHTSALMGGSV-PHINSPGG--LG----------MHRTSAFHSTLGHTDEMTHLGRLLHEKEQMLHQQMEDISRLRLQNSELEAKLKAMEDRITSSSYYSSKL--------TG--------------GTEFAVLQHQNTELTSKVTYLKNILEEKE----------DKIKTLSTENRTNFLQMEIERIKREMNSTIADKDTHISILASDLEKVKQEKTEVNNNLIASQLDVKEKTDKIRFMESEQSKMNMDREALQKKYQTALNHLSEKSEKIENLEREIFQKQADEIXXXXXXXXXXSHRLSFMQKSLSDRDGKIEHLEKEHYKLRDEVTALQKQNHNSENEIKRLRDELTYREQRLKQIQNDHSEEINQLRATTMENTSRVSQLRHSLEEKDQXXXXXXXXXXXXXXXXXXXXRRLRDKDNDMARITNDLAEKDTVIKSLERDYNDEVQRHQKANEDASSRINLIQKRVEEREARLRKIEQENNELLDEIHNLRKRNHEIESNLDVMKQQLLEKDECILPTSRSSSVMDMGYNMFNSHTINGTYTSHKEVPVSASINQEIDKLKKQNQDVLNSNLLLQKEVDEASLQNDRLAMDREFLSKQLVELQQKHDLIKKSLQIKEKEFTNRELEFTKLKSEDSNKILMINQEIMKQKNELFKELENRDLQMSELSREVENLQRQLIESENNLQARN-------IQIKELQNYVDQLIRERDDAR-------LRASSTTGVGSSNFRM---NSXXXXXXXXXXIEKLTYDSDRAQKENRDLRNRIQELSRQLQETQTNC-------DTIVKDRDLLKEQLQNRGKE----------------------------------NQIIQLSKEMERLHRAEETHNQQLQELQKNATEAEEELDRVR-------------KECQKKLDASRIEHEKALNQLEKLQLALRDHQEQTXXXXXXXXXXXXXXXXKLKHQCANLSKKLITLQHEYETKERQIQQLTETLD----HARKENYELQKAIDEFQNHEQQIEYELSNXXXXXXXXXXXXXXXXAWACQMKDALNNKGMELTNLQQARGKSIDKQQMSL-----QNHISDLTDQLQMKEKQVDDLTKQLENANQEIREQEYLLQDLTQKLDSIQYDSKFQNVQYNNQTPSKGELDKIKEELASTKRNLLEKDQRIKLLETECFQQQADEIERLRKELKNLSNQDQRIKXXXXXXXXXXXXXXNNDMQSLKIEVDSLKRELNTKNDQIEKFERECQEKHLRRIDGLQLKLKRTEEEFQILERQIEELKRNLDERDKLVKQLKLSQHQATSVXXXXXXXXYSRYQDEVNVKNQQIKTLERQINGQIKEILEIKQEALTASICEKDANIALLQMSGANNTHAQQAMQKL 7085
            PL+   +      T +L   G  Y + R      ++ +   PIN +P    + + +PG + ++    P   R                Y +L             N S +    +   DY  +      P + G          +   +P   P +    PA ++  NP                 TD+ ++QRE  + Q EL +T+EKL +   SI++FWSPELKRER+MRK+EN+KY +LA+ LHQLQ+EK+TML  +H +E++LR+E++ RN+         S    E+DL  R+ DEL  ENR L K  E+ ++R+ + K SL   EE++R+L++ VK  KS+                   S G  S +  ++L+R E D+ EI RLR+Q++E S R  ++ER ++E++F++SR KE  + L QE + LRQE E +R D +QTQTLQSLVDTKESKILTLENEIRLLEDE+ R+RD+ LITP TS + GIDD +K ++   R +ER++KSK+E L+ E+SKR+ E+Y+LQSRLEM +KQHQDQNHHINVLKEQV TREHKISM+ AD EDFRKR+KEKE LLEKKS+ LT++QT K Q E E+ +LKDQ ++KD+KISLLQ+K++N+EDLLNDK+ QL TA+++L  + TE  +++G++ G EE+L+D++RQ+ERLKE++ R E E  +ELE QK+L +E K+RLD  ++EL EK   L E+R+E S+ R  +FK E+E++ +Q Q SQ+ SEV  LQ+E Q ++KQ  ++++ K   R +ELE Q+NHY +++++LQ EVDRLL   R +++EK +K+ Q+ +L+ +++E QN ++N+KR+ QNER   ++ ++ L+++E+N   D E++K  +TE++ RI+ELEQALRES+++TAERE Y   ++D  R LE ++ + + NLE  Q+ERN LS QLASAQEEL ++E QLKTLE ECFQNY+PEL++ R+SN E  LRV A++K+ QGRE  L++Q+R +L+ + L+P+   H  +     +S G  + G  + ++ +  +  Y   HT +  GGS+ PH+       +G          +   ++    L  + ++  L R+L EKE ML Q +++++RLR QNSELE +LKA +  + + +   + L        TG                E A+L+  N EL+ K   L+  L+E+           D++K+    + T+F +M    ++RE+ S  A+++  ++ L S +E +K+E+ + N     ++ D+ EK  ++R +ESE  K   +++ALQKKY++ L+ LSEKSEK++ +E++  +   DEIK+L  E  +  H +S++Q ++  R+  IE  EKE +KLRDE+  ++KQ   +E E+K LRD+  YRE+R+KQIQN ++EE+ +LR T  E  +R+  L   L+EK                       +L+ + +++                  R   DE+ R Q   E+ ++R+++ QKR EERE RLRK+E EN++LLDEIH LRK N E+ES +D ++Q+LL++ E       + SV  +         +  T      + +S + NQE+D+L+KQ  ++  S    QK  +EA +Q D++ +  + L    V+ +Q+++  KK     E++  N+  E  +  SE        +Q  +K + EL KELE ++ Q+  L+++++   RQ          R+       + I +LQ  + Q I +RD AR        RA ++T      + +   N Q+    L Q ++ +T +S+R Q+E +   +RIQ+LSRQLQETQ+NC       D++    D LK  +   G                                    +    LS+EM+RLHR  E    QL+  Q++  E+   +D ++             KE  K+L+  ++E+    N+L K Q   R+ Q QT+  +++++++QQ   EK   Q  N + +L  ++      E++I ++++ L+    H +++  EL++         QQ+E+E +  + E +    E + L+    Q+     N+G  +             +QM++     Q++ + +  +LQ+ +++  +L  ++ + +Q IRE E      T+ L+ ++  ++ ++ Q   Q   + +L+ ++E+L  T++ L EK + + +LE    + Q++EI  L+KEL N   Q + +       S +  S        LKIE+D+LK+E+N + D + + ERECQEKH+ RI+ +Q +L+R EEE   L + ++E +  L+ERD++++QL+  Q Q + +ELE+L+ E++  +D++   N++I TL +Q+  Q  EIL IK E+LTAS+CEK+ANIAL++++   NT + QA++KL
Sbjct:   70 PLIEGDTGGIDHRTTSLDRRGEYYGTLRGNFDSQSERLTRKPINRQPYTLKSLSSNPGLSGILGSANPSSGRRAHSYDMNLEKQGLTDYNSLLAAAGVGGVGVGTNPSIYGYPTNPLLDYSSNLGVPTFPTIGGLDYATLQRSGVYSGLPQTQPTS---IPAGLIPHNPA----------------TDITTLQRECVRLQHELHVTREKLNACTISIRTFWSPELKRERAMRKEENAKYAILADHLHQLQLEKQTMLETLHNMESDLRQERDKRNRSRFSGSTNDSDGLNELDLAKRQIDELTLENRQLKKSIEDSDRRITNLKSSLNATEESLRRLVDAVKAGKSSNINPETTTSTNLTTGDGLTSVGDQSTISSIKLDRIEADRLEISRLRNQLNETSTRRSEVERQLIERNFELSRIKEDFDALLQEHRQLRQECETLRHDTRQTQTLQSLVDTKESKILTLENEIRLLEDEITRLRDDGLITPNTSTSSGIDDLDKTLQ-VFRSNERILKSKIEMLNSEMSKRECELYTLQSRLEMTDKQHQDQNHHINVLKEQVNTREHKISMLTADAEDFRKRIKEKENLLEKKSKALTNAQTAKRQIEQELNELKDQMDIKDRKISLLQKKIENIEDLLNDKDTQLATAQARLSRISTERVSSDGSRIGWEETLKDKDRQIERLKEARQRNESEIAEELETQKRLNTEFKNRLDLLQKELDEKTTQLMEIRDETSDYRTSRFKLETEISQLQTQLSQRNSEVTTLQMEKQLLQKQLTTESDMKFLQRTAELEGQLNHYMENSSKLQTEVDRLL---RTIDTEKFDKENQLNELKEELREAQNNLNNLKRSQQNERKKSSQQLEELRQREENAQSDNEILKGIITEKDGRIRELEQALRESVRLTAEREIYASGRDDETRHLEQQVRELRSNLEHFQRERNNLSAQLASAQEELTDRENQLKTLEQECFQNYLPELEKLRRSNHEANLRVAAMIKLTQGREHTLTDQDRAALSTIPLFPNISLHGTWSG---MSGGLENIGATSGTRRSDYLAPY---HTGS--GGSLSPHLAGSAFQFIGNTSSSGGVGTVGGRASVPGQLMSSPDVIMLTRMLQEKENMLQQHLQELTRLRFQNSELEIRLKATQRELDTKAARLNVLETTHLNSSTGIHDLSTRSPSSNQLSKELAILRKTNQELSVKFNQLQMELDERSRGGTSTVGAYDRLKSSMGLHTTDFTEMAT--LRRELASAKAEREVEVASLNSQMELIKRERDDFNEKFNETKTDLTEKIHQLRTLESEIEKRISEKDALQKKYESVLSQLSEKSEKLKQIEQDCAKSHIDEIKRLNTELNDLKHHVSYLQNTIKSRETHIETTEKESFKLRDELNNIRKQLATAEAEVKSLRDDAVYREERIKQIQNQYTEELARLRCTNQEQVTRIGHLEMKLDEKGH---------------------QLKSQTSEI------------------RCQADEITRLQSTIEETNNRLSVNQKRAEEREMRLRKLENENHDLLDEIHGLRKGNTELESQIDSLRQRLLDRQES------TESVTGV--------PLTSTRIYQPSLGLSTTSNQELDRLRKQYTEMKTSCEQAQKSFEEAQIQYDQMKIQYDNLQ---VQYEQENEKCKKL----EEQLRNKINELNEQTSETRTLTKPTHQLTLKIE-ELQKELERKEAQIICLNKQID---RQYTSLSTTPDGRHTDSTNQQLLIADLQVRLRQAIEDRDIAREQLTTNLTRAETSTLDIQQQYMLDKQNLQQQITNLTQTVQNITNESERYQREFKQASSRIQQLSRQLQETQSNCDSIARQRDSLRDQLDQLKRSMGRSGSATVTSIFGINSSTGGMRPASAGPGNYDNVPLYGTTSGTTHLSREMDRLHRECENLQNQLRISQESEQESRSLVDNLKNDIKNLTNEIEQFKEQIKELEKQKMEYN---NELTKTQ---RELQTQTDETKDKLTHTQQLLIEKTS-QLENAANQLNNVRQYCSELEQRINEMSQRLNMAESHTQQQAEELKRC--------QQLEFECNQLRNEIKASHNEVQHLQLQLDQLNREYQNQGRRM-------------EQMTIELSTTQSNTNQIKQELQLTKERNKELETKITDTHQTIRESE------TETLNILR--AELKDSQMIKQRLEE-QLNSLQEDLRQTQQELDEKTRALDILENTHLRNQSEEIISLQKELNNARMQIEELGGPIEPGSKLRGS-------PLKIEIDTLKKEINKREDALNRLERECQEKHIHRIETMQSQLRRFEEETANLNQVLDEQRVELEERDRVIRQLRSDQAQGSLIELEKLKAEHNGCKDKIEQLNKRITTLNKQVEDQSDEILTIKLESLTASLCEKEANIALMELTAPKNTTSNQALEKL 2369          
BLAST of Rab6-interacting protein 2/elks/erc/cast,putative vs. TrEMBL
Match: A0A068WH31 (ELKS:Rab6 interacting:CAST family OS=Echinococcus granulosus OX=6210 GN=EgrG_000962800 PE=4 SV=1)

HSP 1 Score: 1065.06 bits (2753), Expect = 0.000e+0
Identity = 832/2369 (35.12%), Postives = 1366/2369 (57.66%), Query Frame = 3
Query:  657 LRPQIPLPPPMAQNIYPAPMMGSNPGYDYHFPMIDN----VIMDYQTDLFSIQRELAKCQQELELTKEKLTSSVNSIKSFWSPELKRERSMRKDENSKYVLLAEELHQLQMEKKTMLSNVH------QXXXXXXXXXXXXNKHSQTAQEIDLLYRRCDELEKENRILTKQSEEYEKRMISQKESLVTAEENIRKLLEVVKVAKSASS-------------------------GHSALQGLRLERFEEDQTEIERLRSQIHEYSQRTIDLERAIVEKDFDISRNKEQGEL--LNQEVQNLRQENEHIRQDIQQTQTLQSLVDTKESKILTLENEIRLLEDELARMRDEELITPTTSVN-GIDDYEKNMRSTVRPHERLMKSKLEALSCEISKRDSEIYSLQSRLEMAEKQHQDQNHHINVLKEQVKTREHKISMMMADVEDFXXXXXXXXXXXXXXSQILTSSQTEKHQTESEILDLKDQCEMKDKKISLLQRKVQNLEDLLNDKENQLTTAKSKLLNLHTEHSTTEGTKAGLEESLRDRERQLERLKESKTRMEHEFQDELEMQKKLVSETKSRLDNSERELREKVAMLNEMREELSELRAVKFKRESELNTIQVQCSQKTSEVAALQLELQTVRKQYISDTEYKSNHRISELESQINHYSDSATRLQGEVDRLLNMVRNLESEKLEKDRQITQLECQVKEHQNTISNMKRTHQNERNYLNEDIDVLKRKEDNILVDMEVIKTTLTERENRIKELEQALRESLQITAERESYVHNKEDSYRQLELKISDQKQNLEIIQKERNQLSGQLASAQEELREKETQLKTLESEC-------------------------------------------------FQNYIPELDRQRKSNQELVLRVQALVKIIQGREFQLSEQERISLTELGLYPDTFAHRGYPSTGRISAGPYSTGYNNYSKVTWSMGSYPISHTSALM--GGSV-PHINSPGGLGMHRTSAFHS----------------------TLGHTDEMTHLGRLLHEKEQMLHQQMEDISRLRLQNSELEAKLKAME---DRITS--SSYYSSKLTGG------------------TEFAVLQHQNTELTSKVTYLKNILEEKEDK-IKTLSTENRTNFLQMEIERIKREMNSTIADKDTHISILASDLEKVKQEKTEVNNNLIASQLDVKEKTDKIRFMESEQSKMNMDREALQKKYQTALNHLSEKSEKIENLEREIFQKQADEIXXXXXXXXXXSHRLSFMQKSLSDRDGKIEHLEKEHYKLRDEVTALQKQNHNSENEIKRLRDELTYREQRLKQIQNDHSEEINQLRATTMENTSRVSQLRHSLEEKDQXXXXXXXXXXXXXXXXXXXXRRLRDKDNDMARITNDLAEKDTVIKSLERDY---NDEVQRHQKANEDASSRINLIQKRVEEREARLRKIEQENNELLDEIHNLRKRNHEIESNLDVMKQQLLEKDECILPTSRSSSVMDMGYNMFNSHTINGTYTSHKEVPVSASINQEIDKLKKQNQDVLNSNLLLQKEVDEASLQNDRLAMDREFLSKQLVELQQKHDLIKKSLQIKEKEFTNRELEFTKLKSEDSNKILMINQEI---MKQKNELFKELE---NRDLQMSELSREVENLQRQLIESE--NNLQARNIQIKELQNYVDQLIRERDDARLRASSTTGVGSSNFRMNSXXXXXXXXXXIEKLTYDSDRAQKENRDLRNRIQELSRQLQETQTNCDTIVKDRDLLK---EQLQNRGKE--------------------------------------NQIIQLSKEMERLHRAEETHNQQLQELQKNATEAEEELDRVRKECQKKLDASRIEHEKALNQLEKLQLALRDHQEQTXXXXXXXXXXXXXXXXKLKHQCANLSKKLITLQHEYETKERQIQQLTETLDHARKENYELQKAIDEFQNHEQQIEYELSNXXXXXXXXXXXXXXXXAWACQMKDALNNKGMELTNLQQARGKSIDKQQMSLQNHISDLTDQLQMKEKQVDDLTKQLENANQEIREQEYLLQDLTQKLDSIQY---------DSKFQNVQYNNQTPSKGE--------LDKIKEELASTKRNLLEKDQRIKLLETE----------CFQQQADEIERLRKE----LKNLSNQDQRIKXXXXXXXXXXXXXXNND---MQSLKIEVDSLKRELNTKNDQIEKFERECQEKHLRRIDGLQLKLKRTEEEFQILERQIEELKRNLDERDKLVKQLK-LSQHQATSVXXXXXXXXYSRYQDEVNVKNQQIKTLERQINGQIKEILEIKQEALTASICEKDANIALLQMSGANNTHAQQAMQKLMNE 7094
            L   + L  P+A    P+ +  S  GY      +DN    + +    D+ +IQRE  +  QEL++T+EKL + + SI++FWSPELKRER+MRK+EN+KY +LA+ LHQLQ+EK+TML  +H      + E E    +           E +++ RR DEL  EN +L+K  E+ EKR  S + SL+T EE++R+L+E VK  K+ ++                         G S L  +R++R E D+ EI RLR Q++E   R  + E+A+VE   +++RN+ + EL  ++Q+   L+ ENE +R +I++ QTLQ++VDTKESKILTLENEIRLLEDE+AR+RDE ++TPTTS++ GI+D ++ + +T R +ERL+KSK+E L+ E+SKRD+EIY+LQSRLEMAEKQ QDQNHHI+VLKEQVK RE+K+SM+ AD+EDFRKRLKEKE LLEKK++++ S+ T K Q E+E+ +LKDQ ++K++KISLLQRKV+NLE+++ +KE QLT+ KS+L  L +E   TEG KA LE++L++++RQ+ERLK+++ R E E+ +E E Q+++  E + RLD + R+L EK A L+E  EE+++LR+ ++KR++E+  +Q Q  Q+ +E++ALQLE Q + KQ  ++TE K    ++ELESQ+NHY +SA++LQ EVDRLLNM+R  +S+KL+KD QI +LE Q+ E QN I ++KR+ Q +R   ++ +D  +++ D    D E++K  + E+E R++ELEQALRES+++TAERE++V ++EDS RQLE +  +    +E +Q+ERN LS QLAS QEELR++E+QLK L++EC                                                 FQ YIPEL+R  ++NQE  LR+ ALVK++QG E  L+EQ++ +L    LYP + AH+   STG ++      G+           S P +  +  +  GGS+ PH++          SAFH                        +   D +  LGRLLHEKE ML QQ++D++RLR QNSE+E ++K+++   D  TS  ++   ++LT G                   E A L+  NTE+  K+  L+  L+E+E++ I+   T++ ++ L  EIER+K E+     ++++    L  +  +   E   VN    A + +++EK DKIR +E E++K+N D E+LQKKY T +  L+EKS++++ + R+  +    EI++L  +++E +HR++++ K+L +R+GK+E  E E  + + E    +K+ H+ E+E+K LR+E+TY+++RL+Q+Q  H+EE++++R+   E  SR++ L+ +++EKD   K+   +++K+K +LE +K RL++ + +  +I N+LAEK   +++LE +     DE+ R Q + E++ S+ +++QKR +E+E RLRKIE EN+ LLDEIH LRKRNHE+ S++ V++Q+LL++ E  +P + SS   +    +F+         S  E P S  +  E   L+K+N ++ N    L+K   +     D+L+ +RE L+K   E  +K   ++ S+  K+ E     +EF +  S +  ++ +  + +   + +KN   ++L    ++ +++S+L+  V    R    +E   NLQ R  Q  +  N  +++++ R+++ L  S               + Q  +Q+ + ++   ++  Q+E +    RIQEL+RQL+ETQTNCD+I   RD L+   EQLQ  G                                           +QLS+E+ RLHR +E    QL           +  +R  ++ +++ +A++ E  +    L + Q  +++ +E     ++E +     E+E+ K Q   L K+L  LQ +   K   ++QLT           +L+ + D+ +  EQ++                          QM     N+ +E  N QQ +      QQ  L   +  +  +L ++E Q   LT++ + + ++  +Q  ++++L+++L++ +          ++  Q   +  +  +  E        +  +K +L +  +     ++RI+ LE +            +Q     E  ++E    + NLS ++Q +K +  + +      ++ D    QSLK EVD LK+EL+ ++  I K E+EC+EKH+R+++ LQ++L+R EEE   + R ++E ++ ++ERD+LV+QL+  SQ    + ELE+L+ E++R   ++  K QQ++TL +Q+  Q +EIL  K EALTAS+CEKDAN+AL+Q +   N  + QA+QKL NE
Sbjct:  182 LGAGVSLMTPVAGFNNPSGV-ASYGGYGG----VDNSSGVMTLSNSVDVVNIQREFVRLHQELDVTREKLNACMTSIRTFWSPELKRERAMRKEENAKYAILADHLHQLQLEKQTMLQALHNSDADLRREREKNASRFKMGPDGNEVNEFEVMRRRIDELTCENCLLSKSIEKAEKRASSLQASLITTEESLRRLVEAVKSGKAVTAQQQSGQQQQQQIGGGSKTDQALAPVGDSGLASIRIDRLESDRNEIGRLREQLNEAFHRESEAEKALVE--CEMTRNQLKDELDGVSQDYDALKHENEGLRLNIREVQTLQAIVDTKESKILTLENEIRLLEDEIARLRDEGIVTPTTSLSSGIEDVDRTL-NTFRSNERLLKSKVEFLTSELSKRDNEIYALQSRLEMAEKQQQDQNHHISVLKEQVKARENKVSMLTADIEDFRKRLKEKEGLLEKKTKLVASNTTGKRQLETELAELKDQVDLKERKISLLQRKVENLEEMVTEKETQLTSLKSRLSRLSSEKIGTEGPKASLEDTLKEKDRQIERLKDARERNEAEWAEEAEGQRRVQLELRGRLDTALRDLDEKSAQLSEALEEVAQLRSSRYKRDTEVGQLQAQLRQRDAEMSALQLEKQLLHKQVANETEMKYAKTVAELESQVNHYMESASKLQSEVDRLLNMIRTCDSDKLDKDNQIHELEEQLHEAQNQIGSLKRSQQADRKKNSQVLDEARQRADTFQNDAELLKNVIAEKEVRVRELEQALRESVRLTAEREAHVASREDSTRQLEHQFRELHSTVEHLQRERNNLSSQLASLQEELRDRESQLKNLKAECVPFTPVVNGEHKWKLWAQMRGVKVHAATKSISDSGGNKPGAETQRQRIFFQGYIPELERLCRTNQEANLRIAALVKLVQGDEEHLTEQDKSALATFPLYP-SLAHKTAVSTGPLAKTQTRLGH----------PSVPGAGQTGFLAPGGSISPHLSG---------SAFHLIGSSSATAAATAATLTAGGINLPMQSADSIL-LGRLLHEKETMLQQQLQDLTRLRFQNSEMEVRIKSLQRELDNKTSRLNALEVAQLTAGVSGLVDWQSQIAGMPITQAELATLRQANTEMHEKLLQLQTSLQERENELIRVQRTQSSSSTL--EIERLKLELTKLKDERESIERTLRLENTRASDELARVNTTASAVETELQEKRDKIRLLEFEKTKLNSDLESLQKKYHTVIGQLTEKSDRLQQMGRDCDKNHITEIQRLTKDSDELNHRVTYLHKALQEREGKLEQQETELARQKVESANAKKKTHSLESELKSLREEITYKDERLRQLQVQHAEELSRMRSVQQEQGSRLNHLQLTIDEKDHEFKTVQGDLDKTKSDLEYTKNRLQEVETERTQINNELAEKVDKLRTLELECESRADEMARLQSSLEESKSKASILQKRADEQEQRLRKIENENHNLLDEIHGLRKRNHELGSHIAVLRQRLLDRGEQAMPFASSSPSAE----IFSQ--------SIAEKP-STKLTAEAGSLRKRNAELENELHSLRKRTQDLQTPVDQLSYERESLNKSYEEEMKKRVQLESSI-TKQSET----VEFPQTPSAEVEELHLAVKHLKGELGRKNSQIEQLTQQLDQAVKLSQLA-SVSGADRDAFVTELKLNLQ-RTQQALDAANDQNRVLQARNESALFES---------------QKQHLIQRSLNEMNIQNEGLQREVQQSSGRIQELTRQLRETQTNCDSIAIQRDNLQNRLEQLQQSGGGMRSYNISGGSYLGRPASVAAGYSDLMLLTTGGTSSGSITTGVQLSRELARLHREQEVMRDQL-----------DTAERSTRQFKQEAEAAKCEATRLREDLRQQQETVKEMKENLRNSKDEATKEITAETERYKQQHEELEKQLRNLQEQLSAKGVLVEQLTN----------QLKTSQDKCKQFEQKL-------------------------LQM-----NQQIESLNAQQDQVAFERNQQQRLSYELETIKKELSIRENQFIQLTQKFDQSLKDASDQSQVIKELSRQLEAAKTTQRAAVEVENAHHQAAAWATEQSANAEQSQQDHETMAALKADLQNVMKAKDTAEKRIQKLENDLQNQTKALDVAVEQAHITAEVCKREHLTFIDNLSRENQDLKMALNEANQAHSRSTSFDEPASQSLKKEVDVLKKELDKRDVVITKLEKECKEKHVRKLEALQVQLRRYEEETANMNRVLDEQRKGIEERDRLVRQLRDESQKNGGAAELEKLQAEHARCSQQIQQKQQQLETLMKQLEQQAEEILTTKIEALTASLCEKDANLALIQTTELQNVASNQAVQKLNNE 2433          
BLAST of Rab6-interacting protein 2/elks/erc/cast,putative vs. TrEMBL
Match: A0A4E0S0A4 (ERC protein 2 OS=Fasciola hepatica OX=6192 GN=D915_003647 PE=4 SV=1)

HSP 1 Score: 1048.5 bits (2710), Expect = 0.000e+0
Identity = 827/2343 (35.30%), Postives = 1319/2343 (56.30%), Query Frame = 3
Query:  624 DYERDPALMG-SLRPQIPLPPPMAQNIYP---APMMGSNPGYDYH------FPMIDNVIMDYQ--TDLFSIQRELAKCQQELELTKEKLTSSVNSIKSFWSPELKRERSMRKDENSKYVLLAEELHQLQMEKKTMLSNVH-------QXXXXXXXXXXXXNKHSQTAQEIDLLYRRCDELEKENRILTKQSEEYEKRMISQKESLVTAEENIRKLLEVVKVAKSASSGHSAL---------------------QGLRLERFEEDQTEIERLRSQIHEYSQRTIDLERAIVEKDFDISRNKEQGELLNQEVQNLRQENEHIRQDIQQTQTLQSLVDTKESKILTLENEIRLLEDELARMRDEELITPTTSVN-GIDDYEKNMRSTVRPHERLMKSKLEALSCEISKRDSEIYSLQSRLEMAEKQHQDQNHHINVLKEQVKTREHKISMMMADVEDFXXXXXXXXXXXXXXSQILTSSQTEKHQTESEILDLKDQCEMKDKKISLLQRKVQNLEDLLNDKENQLTTAKSKLLNLHTEHSTTEGTKAGLEESLRDRERQLERLKESKTRMEHEFQDELEMQKKLVSETKSRLDNSERELREKVAMLNEMREELSELRAVKFKRESELNTIQVQCSQKTSEVAALQLELQTVRKQYISDTEYKSNHRISELESQINHYSDSATRLQGEVDRLLNMVRNLESEKLEKDRQITQLECQVKEHQNTISNMKRTHQNERNYLNEDIDVLKRKEDNILVDMEVIKTTLTERENRIKELEQALRESLQITAERESYVHNKEDSYRQLELKISDQKQNLEIIQKERNQLSGQLASAQEELREKETQLKTLESECFQNYIPELDRQRKSNQELVLRVQALVKIIQGREFQLSEQERISLTELGLYPDTFAHRGYPSTGRISAGPYS----TGYNNYSKVTWSMGSYPISHTSA--LMGGSVPHINSPGGLGMHRTSAFHSTLGH---TDEMTHLGRLLHEKEQMLHQQMEDISRLRLQNSELEAKLKAME---------------------DRITSSSYYSSKLTGGTEFAVLQHQNTELTSKVTYLKNILEEKEDKIKTL-----STENRTNFLQMEIERIKREMNSTIADKDTHISILASDLEKVKQEKTEVNNNLIASQLDVKEKTDKIRFMESEQSKMNMDREALQKKYQTALNHLSEKSEKIENLEREIFQKQADEIXXXXXXXXXXSHRLSFMQKSLSDRDGKIEHLEKEHYKLRDEVTALQKQNHNSENEIKRLRDELTYREQRLKQIQNDHSEEINQLRATTMENTSRVSQLRHSLEEKDQXXXXXXXXXXXXXXXXXXXXRRLRDKDNDMARITNDLAEKDTVIKSLERDYNDEVQRHQKANEDASSRINLIQKRVEEREARLRKIEQENNELLDEIHNLRKRNHEIESNLDVMKQQLLEKDECILPTSRSSSVMDMGYNMFNSHTINGTYTSHKEVPVSAS--INQEIDKLKKQNQDVLNSNLLLQKEVDEASLQNDRLAMDREFLSKQLVELQQKHDLIKKSLQIKEKEFTNRELEFTKLKSEDSNKILMINQ--------EIMKQKNELFKELENRDLQMSELSREVENLQRQLIESENNLQARNIQ--IKELQNYVDQLIRERDDARLRASSTTGVGSSNF----------RMNSXXXXXXXXXXIEKLTYDSDRAQKENRDLRNRIQELSRQLQETQTNCDTIVKDRDLLKEQLQ---------------------------------------------NRGKENQIIQLSKEMERLHRAEETHNQQLQELQKNATEAEEELDRVRKECQKKLDASRIEHEKALNQLEKLQLALRDHQEQTXXXXXXXXXXXXXXXXKLKHQCANLSKKLITLQHEYETKERQIQQLTETLDHARKENYELQKAIDEFQNHEQQIEYELSNXXXXXXXXXXXXXXXXAWACQMKDALNNKGMELTNLQQARGKSIDKQQMSLQNHISDLTDQLQMKEKQVDDLTKQLENANQEIREQEYLLQDLTQKLDSIQYDSKFQNVQYNNQTPSKGELDKIKEELASTKR-----NLLEKDQR--IKLLETECFQQQADEIERLRKELKNLSNQDQRIKXXXXXXXXXXXXXXNNDMQSLKIEVDSLKRELNTKNDQIEKFERECQEKHLRR-------IDGLQLKLKRTEEEFQILERQIEE------------LKR-----------------NLDERDKLVKQLKLSQHQATSVXXXXXXXXYSRYQDEVNVKNQQIKTLERQINGQIKEILEIKQEALTASICEKDANIALLQMSGANNTHAQQAMQKLMNE 7094
            DY    A  G    P I   PP     Y    AP + S  G DY       +P I   ++++   +D+ ++QRE  + Q EL++T+EKL +   SI++FWSPELKRERSMRK+EN+KY +LA+ LHQLQ+EK+TML  +H       +      R +   +   +   E+DL  R+ DEL  EN+ L K  EE ++R  + K SL   EE++R+L+E VK  K+A++                            +RLER E D+ EI RLR Q++E   R  D ER +V+++F+ SR KE+   L Q+ + L+QEN+ +RQD++QTQTLQS+VDTKESKI+TLENEIRLLEDE+ R+RD+ LITP TS + GIDD +K ++ T R +ERL+KSK+E L+ EISKRD EIY+LQSRLEM +KQHQDQ HHINVLKEQVKTREHKI+M+ AD EDFRKRLKEKET LEKK++ L ++QT K Q E+E+ +LKDQ ++K++KISLLQRK++NLEDLLNDK+ QL  +K++L  + +E +  EG +A +EESL++RE   ERLKE++ R E    DE++ QK++V+E +SRL++ +RE  EK + L E+REEL ELR  ++K ESE++ +Q Q +Q+ SE+A LQ+E Q   KQ  S+ E K N RI+ELE+Q+NHY ++ ++LQ E+DRL   +R L++EK E+++Q+ +++ +++E QN +S++KR+ Q ER    + ++  +++EDN   D+E++K  ++E+++RI+ELEQALRES+++TAERE Y   ++D  R LE ++ + + NLE +Q+ERN LS QLA+ QEEL ++E QLKTLE ECFQNY+PEL++ R++N E  +RV A+VK+ QGRE  L++Q+R +L+ + L+P+  +  G+  TG    GP S    TG   Y      +G+Y    T++  L G +   I +             S  G    + ++  L R+L +KE  + Q + +++ LR QNSELE +LKA +                      RI +S    + L+   E   L+  N +L+ K+  L+  L+++E +++ +     +T + T+F +M +  ++RE+ +  A+K+T I  L S LEK K E+ E NN L      + EK++++R  E+E+ K  MDREALQKKY+  L  L +K++K++ +E E+  KQA+E+++ K E ++  H  +++Q ++ +R+ +IE +EKE  KLRDE+ +++KQ  N E E+K L++EL YRE+RL+Q+Q  H++E+++LR+   E  +R S L   L+EK+                       L+ + +++ R                  ++DE+ R Q + E+ ++R+ + QKRVEERE RL+K+E EN++LLDEIH LRK N ++ES +D ++Q+LL++ +      R  SV   G +   S  I     +H+ V  S+S  +NQE+++++KQ  +  +     QK +++A +Q D++ + R  L  QL                 E+E   R +   KL++ D    + ++Q        +   Q NEL  ELE ++ Q++ L++E+E +Q      +    A N Q  + +LQ  + Q+  ERD A+ + ++      S +          +    +    L Q  +  T ++DR Q+E R    R+Q+LSRQLQETQ NCD+I + RD L++QL                                                G      QLS+E++RLHR  E   QQL+  Q+    +  E++R+++E            E+   ++E+ ++ L++ ++Q +  E E+   Q+EES+K + Q   L +KL   + +   K   ++ L+  L+  R+   EL++ +++                                  ++  A +    +L +LQQ +          LQ   + L +++Q K  ++  LT QL+  N+E + Q++ L+ +T +L + Q  +    V+   Q   + +  + ++  A   R     N   +  R  I+LL+TE   + A   + + K L  L N+    +    +++ +  S   N ++     + SL+REL     Q+E+     +     +       ID L+ +L + E+    LER+ +E            L+R                  L+ERD+L++QL+ +Q QA++VELE+LR E++  +++   + ++I TL  QI  Q  EIL IK EALTAS+CEK+ANIAL++++   N  + QA++KL  E
Sbjct:  150 DYNSLLAAAGVGTNPNIYGNPPTQLLDYSGLTAPTLSSLGGLDYASLQRAAYPTIQPALLNFAAASDITTLQRECLRLQHELDITREKLNACTTSIRTFWSPELKRERSMRKEENAKYAILADHLHQLQLEKQTMLETLHNMEEDLRRERDIRIRGRFSSDHGREHLSELDLAKRQVDELTLENKQLKKAVEEADRRTSNVKTSLTATEESLRRLIEAVKAGKAATAAGVPTSETGGSTGVAAAAAAVDASGASNIRLERIESDRAEISRLRHQLNEACTRGSDAERQLVDRNFEFSRLKEEFTALLQDHRQLKQENDSLRQDVRQTQTLQSIVDTKESKIMTLENEIRLLEDEITRLRDDGLITPNTSTSSGIDDLDKTLQ-TFRSNERLLKSKIEMLNGEISKRDCEIYTLQSRLEMTDKQHQDQTHHINVLKEQVKTREHKIAMLTADTEDFRKRLKEKETQLEKKTKALANAQTSKRQLETELAELKDQLDIKERKISLLQRKIENLEDLLNDKDTQLAASKARLTRISSERAGVEGVRAAIEESLKEREVLSERLKEARARGESPGLDEIDAQKRIVAELRSRLESVQREADEKASKLLELREELGELRTGRYKHESEVSQLQSQLNQQASEMATLQIEKQMQHKQISSEYELKYNQRITELENQVNHYVENNSKLQSEIDRL---IRTLDNEKYEREKQMHEMQEELRESQNNLSSLKRSQQTERKKQTQLLEEARQREDNAHSDVEILKGIMSEKDSRIRELEQALRESVRLTAEREIYASGRDDETRHLEQQLREMRTNLEQLQRERNNLSAQLATVQEELSDRENQLKTLEQECFQNYLPELEKLRRANHEANMRVAAMVKLTQGREHTLTDQDRAALSGIPLFPNLASSGGWSVTG--VGGPTSSRLLTGSGGY------LGAYHSGGTTSPHLAGSAFQLIGNSSSALAAAAGGRASVPGQPIPSPDVVMLTRMLQDKENTIQQHLHELTHLRFQNSELEIRLKATQRELEAKSTRLSILEAAQYSALSRIEASGPSPTGLSN--EITQLRKANQDLSVKLAQLQMDLDDRERQLRAMDRLQSTTRSTTDFSEMAM--LRRELVTVKAEKETEILSLNSQLEKTKAERDETNNKLKEVTNALAEKSNQLRLTEAEKDKELMDREALQKKYEVVLTQLGDKTDKVQYMENEM-SKQAEEVRRQKAELDDMRHHSTYLQNTIQERENRIEAVEKESSKLRDELVSVKKQLSNLEAEVKGLQEELAYREERLRQLQTQHTDEMSRLRSANQEQATRNSHLEMKLDEKEHE---------------------LKTQSSELRR------------------HSDEIARLQASIEEYTNRLAVSQKRVEERELRLKKLENENHDLLDEIHGLRKGNTDLESQVDSLRQRLLDRQD------RPGSV---GPSAAMSPPIR----THQSVYGSSSTTMNQELERVRKQYTETKSLQEQTQKALEDAQIQYDQMTVQRNTLRTQL-----------------EQEIAKRAMLEEKLRASDDQWKVRVSQAENSEQSRQATLQLNELRNELERKEAQITCLNKELERVQTSSALRDRLPDATNQQLLLADLQVRLRQVTEERDQAKDQLAAAVSHTESTYLETQQQLLLEKQTLHQQVANLTQTAQNATSEADRYQREARQASARVQQLSRQLQETQNNCDSIARQRDSLRDQLDQLKRTPGRSGSSALSSVANLFGTGGGTSYSARPASAGPGSYETFGGYGTMGSTSQLSRELDRLHREHELTLQQLRTTQEAEEMSRNEMNRIKQEL-----------EQMKQEVEQQKVRLKELEQQKQSLESEMVRIQREESDKAQQQQRELREKLQWTEQQLNEKTSHVENLSHQLNSTRQYCGELEQNVNQITQ-------------------------------RLNTAESRTQSQLNDLQQYQ---------QLQTEYNVLRNEIQGKNSEIQRLTIQLDQVNREYQNQQHQLEQMTIELSTTQ--ANLTQVKQEAQQWQQQQQQQQQQASAMGARRPGTDNATRETGRETIQLLQTEII-EAAHNRQEMEKHLDELQNELCATRNELDEKTRLLRSLEENQLKQQNEMIASLQRELQVARAQVEELGGSTEPGASGKASPLKIEIDSLKRELTKREDTIARLERECQEKHVRRIEAMQAQLRRFEEEAANLNKVLDEQRAGLEERDRLIRQLRSNQAQASTVELEKLRNEHAHCKEQFEQQQKRISTLAEQIESQSDEILAIKLEALTASLCEKEANIALMELTAPKNAASNQALEKLRTE 2352          
BLAST of Rab6-interacting protein 2/elks/erc/cast,putative vs. TrEMBL
Match: A0A068YBM4 (ELKS:Rab6 interacting:CAST family OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000962800 PE=4 SV=1)

HSP 1 Score: 1045.8 bits (2703), Expect = 0.000e+0
Identity = 821/2351 (34.92%), Postives = 1349/2351 (57.38%), Query Frame = 3
Query:  657 LRPQIPLPPPMAQNIYPAPMMGSNPGYDYHFPMIDNVIMDYQTDLFSIQRELAKCQQELELTKEKLTSSVNSIKSFWSPELKRERSMRKDENSKYVLLAEELHQLQMEKKTMLSNVH------QXXXXXXXXXXXXNKHSQTAQEIDLLYRRCDELEKENRILTKQSEEYEKRMISQKESLVTAEENIRKLLEVVKVAKSASS-------------------------GHSALQGLRLERFEEDQTEIERLRSQIHEYSQRTIDLERAIVEKDFDISRNKEQGEL--LNQEVQNLRQENEHIRQDIQQTQTLQSLVDTKESKILTLENEIRLLEDELARMRDEELITPTTSVN-GIDDYEKNMRSTVRPHERLMKSKLEALSCEISKRDSEIYSLQSRLEMAEKQHQDQNHHINVLKEQVKTREHKISMMMADVEDFXXXXXXXXXXXXXXSQILTSSQTEKHQTESEILDLKDQCEMKDKKISLLQRKVQNLEDLLNDKENQLTTAKSKLLNLHTEHSTTEGTKAGLEESLRDRERQLERLKESKTRMEHEFQDELEMQKKLVSETKSRLDNSERELREKVAMLNEMREELSELRAVKFKRESELNTIQVQCSQKTSEVAALQLELQTVRKQYISDTEYKSNHRISELESQINHYSDSATRLQGEVDRLLNMVRNLESEKLEKDRQITQLECQVKEHQNTISNMKRTHQNERNYLNEDIDVLKRKEDNILVDMEVIKTTLTERENRIKELEQALRESLQITAERESYVHNKEDSYRQLELKISDQKQNLEIIQKERNQLSGQLASAQEELREKETQLKTLESEC------------------------------------------------FQNYIPELDRQRKSNQELVLRVQALVKIIQGREFQLSEQERISLTELGLYPDTFAHRGYPSTGRISAGPYSTGYNNYSKVTWSMGSYPISHTSALMGGSVPHI------NSPGGLGMHRTSAFHSTLGHTDEMTHLGRLLHEKEQMLHQQMEDISRLRLQNSELEAKLKAME---DRITS--SSYYSSKLTGG------------------TEFAVLQHQNTELTSKVTYLKNILEEKED---KIKTLSTENRTNFLQMEIERIKREMNSTIADKDTHISILASDLEKVKQEKTEVNNNLIASQLDVKEKTDKIRFMESEQSKMNMDREALQKKYQTALNHLSEKSEKIENLEREIFQKQADEIXXXXXXXXXXSHRLSFMQKSLSDRDGKIEHLEKEHYKLRDEVTALQKQNHNSENEIKRLRDELTYREQRLKQIQNDHSEEINQLRATTMENTSRVSQLRHSLEEKDQXXXXXXXXXXXXXXXXXXXXRRLRDKDNDMARITNDLAEKDTVIKSLERDY---NDEVQRHQKANEDASSRINLIQKRVEEREARLRKIEQENNELLDEIHNLRKRNHEIESNLDVMKQQLLEKDECILPTSRSSSVMDMGYNMFNSHTINGTYTSHKEVPVSASINQEIDKLKKQNQDVLNSNLLLQKEVDEASLQNDRLAMDREFLSKQLVE-----LQQKHDLIKKSLQIKEKEFTNRELE-----FTKLKSEDSNKILMINQEIMKQKNELFKELENRDLQMSELSREVENLQRQLIESE--NNLQARNIQIKELQNYVDQLIRERDDARLRASSTTGVGSSNFRMNSXXXXXXXXXXIEKLTYDSDRAQKENRDLRNRIQELSRQLQETQTNCDTIVKDRDLLK---EQLQNRG--------------------------------------KENQIIQLSKEMERLHRAEETHNQQLQELQKNATEAEEELDRVRKECQKKLDASRIEHEKALNQLEKLQLALRDHQEQTXXXXXXXXXXXXXXXXKLKHQCANLSKKLITLQHEYETKERQIQQLTETLDHARKENYELQKAIDEFQNHEQQIEYELSNXXXXXXXXXXXXXXXXAWACQMKDALNNKGMELTNLQQARGKSIDKQQMSLQNHISDLTDQLQMKEKQVDDLTKQLENANQEIREQEYLLQDLTQKLDSIQY---------DSKFQNVQYNNQTPSKGE--------LDKIKEELASTKRNLLEKDQRIKLLE------TECFQQQADE----IERLRKE----LKNLSNQDQRIKXXXXXXXXXXXXXXNND---MQSLKIEVDSLKRELNTKNDQIEKFERECQEKHLRRIDGLQLKLKRTEEEFQILERQIEELKRNLDERDKLVKQLKL-SQHQATSVXXXXXXXXYSRYQDEVNVKNQQIKTLERQINGQIKEILEIKQEALTASICEKDANIALLQMSGANNTHAQQAMQKLMNE 7094
            L   + L  P+A    P+ +  S  GY         + +    D+ +IQRE  +  QEL++T+EKL + + SI++FWSPELKRER+MRK+EN+KY +LA+ LHQLQ+EK+TML  +H      + E E    +           E +++ RR DEL  EN +L+K  EE EKR  S + SL+T EE++R+L+E VK  K+ ++                         G S L  +R++R E D+ EI RLR Q++E   R  + E+A+VE   +++RN+ + EL  ++Q+   L+ ENE +R ++++ QTLQ++VDTKESKILTLENEIRLLEDE+AR+RDE ++TPTTS++ GI+D ++ + +T R +ERL+KSK+E L+ E+SKRD+EIY+LQSRLEMAEKQ QDQNHHI+VLKEQVK RE+K+SM+ AD+EDFRKRLKEKE LLEKK++++ S+ T K Q E+E+ +LKDQ ++K++KISLLQRKV+NLE+++ +KE QL + KS+L  L  E   TEG KA LE++L++++RQ+ERLK+++ R E E+ +E E Q+++  E + RLD + R+L EK A L+E  EE+++LR+ ++KR++E++ +Q Q  Q+ +E+++LQL  Q + KQ  ++TE K    ++ELESQ+NHY++SA++LQ EVDRLLNM+R  +S+KL+KD QI +LE Q+ E QN I ++KR+ Q +R   ++ +D  + + D    D E++K  + E+E R++ELEQALRES+++TAERE++V ++EDS RQLE +  +    +E +Q+ERN LS QL S QEELR++E+QLK L++EC                                                 Q YIPEL+R   +NQE  LR+ ALVK++QG E  L+EQ++ +L    LYP + AH+   STG ++      G+ +    T +    P    S  + GS  H+       +            +  +   D +  LGRLLHEKE ML QQ++D++RLR QNSE+E ++K+++   D  TS  ++   ++LT G                   E   L+  NTE+  K+  L+  L+E+E+   +++ + + + T    +EIER+K E+     ++++    L     +   E   VN    A + +++EK DKI  +E E++K+N D E+LQKKY T +  L+EK+++++ + R+  +    EI++L  +++E ++R++++ K+L +R+GK+E  E E  + + E    +K+ H+ E+E+K LR+E+TY+++RL+Q+Q  H+EE++++R+   E  SR++ L+ +++EKD   K+   +++K+K +LE +K RL++ + +  +I  +L EK   ++++E +     DE+ R Q + E++ S+ N++QKR +E+E RLRK+E EN+ LLDEIH LRKRNHE+ S++ V++Q+LL++ E  +P + SS   +     F+         S  E P S  +  E   L+K+N ++ N    L++   +  +Q D+L+ +RE L+K   E     +Q +  + K+S  +K  +  + E+E        LK E   K   I Q        L ++L ++ +++S+L+  V  + R    +E   NLQ R  Q  +  N  +++++ R+++ L  S    +     R   QE    L Q + ++   ++  Q+E +    RIQEL+RQL+ETQTNCD+I   RD L+   EQLQ  G                                           +QLS+E+ RLHR +E    QL   + +A + ++E +        K +A+R+  +     L + Q  +++ +E     ++E +     E+E+ K Q   L K+L  LQ +   K   ++QLT           +L+ + D+ +  EQ++                          QM     N+ +E  N QQ +      QQ  L   +  +  +L ++E Q   LT++ + + ++  +Q  ++++L+++L++ +          ++  Q   +  +  +  E        +  +K +L +  +     ++RI+ LE      T+      D+    +E  ++E    + NLS ++Q +K +  + +      ++ D    QSLK EVD LK+EL+ ++  I K E+ECQEKH+R+++ LQ++L+R EEE   + R ++E ++ ++ERD+LV+QL+   Q    + ELE+L+ E++R   ++  K QQ++TL +Q+  Q +EIL  K EALTAS+CEKDAN+AL+Q +   N  + QA+QKL NE
Sbjct:  177 LGAGVSLMTPVAGFNNPSGV-ASYGGYGGVSNSSGVMTLSNSVDVVNIQRECVRLHQELDVTREKLNACMTSIRTFWSPELKRERAMRKEENAKYAILADHLHQLQLEKQTMLQALHNSDADLRREREKNASRFKMGPDGNEVNEFEVMRRRIDELTCENCLLSKSIEEAEKRASSLQASLITTEESLRRLVEAVKSGKAVTAQQQSGQQQQQQIGGGSKADQALAPVGDSGLASIRIDRLESDRNEIGRLREQLNEAFHRESEAEKALVE--CEMTRNQLKDELDGVSQDYDALKHENEGLRLNLREVQTLQAIVDTKESKILTLENEIRLLEDEIARLRDEGIVTPTTSLSSGIEDVDRTL-NTFRSNERLLKSKVEFLTSELSKRDNEIYALQSRLEMAEKQQQDQNHHISVLKEQVKARENKVSMLTADIEDFRKRLKEKEGLLEKKTKLVASNATGKRQLETELAELKDQVDLKERKISLLQRKVENLEEMVTEKETQLASLKSRLSRLSNEKIGTEGPKASLEDTLKEKDRQIERLKDARERNEAEWAEEAEGQRRIQLELRERLDTALRDLDEKSAQLSEALEEVAQLRSSRYKRDTEVSQLQAQLRQRDAEMSSLQLAKQLLHKQVANETEMKYAKTVAELESQVNHYTESASKLQSEVDRLLNMIRTCDSDKLDKDNQIHELEEQLHEAQNQIGSLKRSQQADRKKNSQVLDEARHRADTFQNDAELLKNVIAEKEVRVRELEQALRESVRLTAEREAHVASREDSTRQLEHQFRELHSTVEHLQRERNNLSSQLVSLQEELRDRESQLKNLKAECVSFTPLVHGEHKWKLWAQMRGVKVHAATKNSDSGGGKPEAETQRQRIFLQGYIPELERLCCANQEANLRIAALVKLVQGDEEHLTEQDKSALATFPLYP-SLAHKTAVSTGPLAKTQTRLGHPSVPGATQTGFLAPGGSISPHLSGSAFHLIGSSSATAAATAATLTAGGINLPMQSADSIL-LGRLLHEKETMLQQQLQDLTRLRFQNSEMEVRIKSLQRELDNKTSRLNALEVAQLTAGVSGLVDWQSQIAGMPIAQAELVTLRQANTEMREKLLQLQTSLQERENELIRVQRMQSSSST----LEIERLKLELTKLKDERESIERTLRLKNTRASDELARVNTAASAVETELQEKGDKISLLEFEKTKLNSDLESLQKKYHTVIGQLTEKTDRLQQMGRDCDKNHITEIQRLTKDSDELNNRVTYLHKALQEREGKLEQQETELARQKVESANAKKKTHSLESELKSLREEITYKDERLRQLQVQHAEELSRMRSVQQEQGSRLNHLQLTIDEKDHEFKTVQGDLDKTKSDLEYTKNRLQEVEAERTQINTELTEKVDKLRTMELECESRADEMARLQSSLEESKSKANILQKRTDEQEQRLRKLENENHNLLDEIHGLRKRNHELGSHIAVLRQRLLDRGEQAMPFASSSPSAE----RFSQ--------SIAEKP-STKLTVEAGSLRKRNAELENELHSLRERTQDLQIQVDKLSYERENLNKSYEEEMKKRVQLESSITKQSETVKFPQTPSAEVEELHLAVKHLKGELGRKNSQIEQ--------LTQQL-DQAVKLSQLA-SVSGVDRDAFVTELKLNLQ-RTQQALDAANDQNRVLQARNESALFESQQQHLIQ---RQTLQEQMSALNQSLNEMNIQNEGLQREVQQSSGRIQELTRQLRETQTNCDSIAIQRDNLQNRLEQLQQSGGGMRSYNISGGSYLGRPASVAAGYSDLMLLTTGGTSSDSTTTGVQLSRELARLHREQEVMRNQLDTAEHSARQFKQEAEAA------KCEATRLRED-----LRQQQETVKEMKENLRNSKDEATKKITAETERYKQQHEELEKQLRNLQEQLSAKGVLVEQLTN----------QLKTSQDKCKQFEQKL-------------------------LQM-----NQQIESLNAQQDQVAFERNQQQRLSYELETIKKELSIRENQFIQLTQKFDQSLKDASDQSQVIKELSRQLEAAKTTQRAAVEVENAHHQAAAWATEQSANAEQSQQDHETIAALKADLQNVMKAKDTAEKRIQKLENSLQSQTKALDVAVDQAHITVEVCKREHLTLIDNLSRENQDLKMALNEANQAHSRSTSFDEPASQSLKKEVDVLKKELDKRDVVITKLEKECQEKHVRKLEALQVQLRRYEEETANMNRVLDEQRKGIEERDRLVRQLRAECQKNGGAAELEKLQAEHARCSQQIQQKQQQLETLMKQLEQQAEEILTTKIEALTASLCEKDANLALIQTTKLQNVASNQAVQKLNNE 2439          
BLAST of Rab6-interacting protein 2/elks/erc/cast,putative vs. TrEMBL
Match: A0A504XBC4 (ELKS/Rab6-interacting/CAST family member 1 OS=Fasciola gigantica OX=46835 GN=FGIG_07387 PE=4 SV=1)

HSP 1 Score: 1020.38 bits (2637), Expect = 0.000e+0
Identity = 778/2193 (35.48%), Postives = 1238/2193 (56.45%), Query Frame = 3
Query:  708 APMMGSNPGYDYH------FPMIDNVIMDYQ--TDLFSIQRELAKCQQELELTKEKLTSSVNSIKSFWSPELKRERSMRKDENSKYVLLAEELHQLQMEKKTMLSNVH------QXXXXXXXXXXXXNKHS-QTAQEIDLLYRRCDELEKENRILTKQSEEYEKRMISQKESLVTAEENIRKLLEVVKVAKSASSGHSAL---------------------QGLRLERFEEDQTEIERLRSQIHEYSQRTIDLERAIVEKDFDISRNKEQGELLNQEVQNLRQENEHIRQDIQQTQTLQSLVDTKESKILTLENEIRLLEDELARMRDEELITPTTSVN-GIDDYEKNMRSTVRPHERLMKSKLEALSCEISKRDSEIYSLQSRLEMAEKQHQDQNHHINVLKEQVKTREHKISMMMADVEDFXXXXXXXXXXXXXXSQILTSSQTEKHQTESEILDLKDQCEMKDKKISLLQRKVQNLEDLLNDKENQLTTAKSKLLNLHTEHSTTEGTKAGLEESLRDRERQLERLKESKTRMEHEFQDELEMQKKLVSETKSRLDNSERELREKVAMLNEMREELSELRAVKFKRESELNTIQVQCSQKTSEVAALQLELQTVRKQYISDTEYKSNHRISELESQINHYSDSATRLQGEVDRLLNMVRNLESEKLEKDRQITQLECQVKEHQNTISNMKRTHQNERNYLNEDIDVLKRKEDNILVDMEVIKTTLTERENRIKELEQALRESLQITAERESYVHNKEDSYRQLELKISDQKQNLEIIQKERNQLSGQLASAQEELREKETQLKTLESECFQNYIPELDRQRKSNQELVLRVQALVKIIQGREFQLSEQERISLTELGLYPDTFAHRGYPSTGRISAGPYS----TGYNNYSKVTWSMGSYPISHTSA--LMGGSVPHINSPGGLGMHRTSAFHSTLGH---TDEMTHLGRLLHEKEQMLHQQMEDISRLRLQNSELEAKLKAME---------------------DRITSSSYYSSKLTGGTEFAVLQHQNTELTSKVTYLKNILEEKEDKIKTL-----STENRTNFLQMEIERIKREMNSTIADKDTHISILASDLEKVKQEKTEVNNNLIASQLDVKEKTDKIRFMESEQSKMNMDREALQKKYQTALNHLSEKSEKIENLEREIFQKQADEIXXXXXXXXXXSHRLSFMQKSLSDRDGKIEHLEKEHYKLRDEVTALQKQNHNSENEIKRLRDELTYREQRLKQIQNDHSEEINQLRATTMENTSRVSQLRHSLEEKDQXXXXXXXXXXXXXXXXXXXXRRLRDKDNDMARITNDLAEKDTVIKSLERDYNDEVQRHQKANEDASSRINLIQKRVEEREARLRKIEQENNELLDEIHNLRKRNHEIESNLDVMKQQLLEKDECILPTSRSSSVMDMGYNMFNSHTINGTYTSHKEV--PVSASINQEIDKLKKQNQDVLNSNLLLQKEVDEASLQNDRLAMDREFLSKQLVELQQKHDLIKKSLQIKEKEFTNRELEFTKLKSEDSNKILMINQ--------EIMKQKNELFKELENRDLQMSELSREVENLQRQLIESENNLQARNIQ--IKELQNYVDQLIRERDDARLRASSTTGVGSSNF----------RMNSXXXXXXXXXXIEKLTYDSDRAQKENRDLRNRIQELSRQLQETQTNCDTIVKDRDLLKEQL---------------------------------------------QNRGKENQIIQLSKEMERLHRAEETHNQQLQELQKNATEAEEELDRVRKECQKKLDASRIEHEKALNQLEKLQLALRDHQEQTXXXXXXXXXXXXXXXXKLKHQCANLSKKLITLQHEYETKERQIQQLTETLDHARKENYELQKAIDEFQNHEQQIEYELSNXXXXXXXXXXXXXXXXAWACQMKDALNNKGMELTNLQQARGKSIDKQQMSLQNHISDLTDQLQMKEKQVDDLTKQLENANQEIREQEYLLQDLTQKLDSIQYD-----------------------------------------------SKFQNVQYNNQTPSKGELDKIKEELASTKRNLLEKDQRIKLLETECFQQQADEIERLRKELKNLSNQDQRIKXXXXXXXXXXXXXXNNDMQSLKIEVDSLKRELNTKNDQIEKFERECQEKHLRRIDGLQL 6728
            AP + S  G DY       +P I   ++++   +D+ ++QRE  + Q EL++T+EKL +   SI++FWSPELKRERSMRK+EN+KY +LA+ LHQLQ+EK+TML  +H      + E ++R      ++H  +   E+DL  R+ DEL  EN+ L K  EE ++R  + K SL   EE++R+L+E VK  K+A++                            +RLER E D+ EI RLR Q++E   R  D ER +V+++F+ SR KE+   L Q+ + L+QEN+ +RQD++QTQTLQS+VDTKESKI+TLENEIRLLEDE+ R+RD+ LITP TS + GIDD +K ++ T R +ERL+KSK+E L+ EISKRD EIY+LQSRLEM +KQHQDQ HHINVLKEQVKTREHKI+M+ AD EDFRKRLKEKET LEKK++ L ++QT K Q E+E+ +LKDQ ++K++KISLLQRK++NLEDLLNDK+ QL  +K++L  + +E +  EG +A +EESL++RE   ERLKE++TR E    DE++ QK++V+E +SRL+  +RE  EK + L E+REEL ELR  ++K ESE++ +Q Q +Q+ SE+A LQ+E Q   KQ  S+ E K + RI+ELESQ+NHY ++ ++LQ E+DRL   +R L++EK E+++Q+ +++ +++E QN +S++KR+ Q ER    + ++  +++EDN   D+E++K  ++E+++RI+ELEQALRES+++TAERE Y   ++D  R LE ++ + + NLE +Q+ERN LS QLA+ QEEL ++E QLKTLE ECFQNY+PEL++ R++N E  +RV A+VK+ QGRE  L++Q+R +L+ + L+P+  +  G+  TG    GP S    TG   Y      +G+Y    T++  L G +   I +             S  G    + ++  L R+L +KE  + Q + +++ LR QNSELE +LKA +                      RI +S    + L+   E   L+  N +L+ K+  L+  L+++E +++ +     +T + T+F +M +  ++RE+ +  A+K+T I  L S LEK K E+ E NN L      + EK++++R  E+E+ K  MDREALQKKY+  L  L +K++K++ +E E+  KQA+E+++ K E ++  H  +++Q ++ +R+ +IE +EKE  KLRDE+ +L+KQ  N E E+K L++EL YRE+RL+Q+Q  H++E+++LR+   E  +R S L   L+EK+                       L+ + +++ R                  ++DE+ R Q + E+ ++R+ + QKRVEERE RL+K+E EN++LLDEIH LRK N ++ES +D ++Q+LL++ +      R  SV   G +   S  I     +H+ V  P S ++NQE+++++KQ  +  +     QK +++A +Q D++ + R  L  QL                 E+E   R +   KL++ D    + ++Q        +   Q NEL  ELE ++ Q++ L++E+E +Q      +    A N Q  + +LQ  + Q+  ERD A+ + ++      S +          +    +    L Q  +  T ++DR Q+E R    R+Q+LSRQLQETQ NCD+I + RD L++QL                                                G      QLS+E++RLHR  E   QQL+  Q+    +  E++R+++E            E+   ++E+ ++ L++ ++Q +  E E+   Q+EES+K + Q   L +KL   + +   K   ++ L+  L++ R+   EL++ +++                                  ++  A +    +L +LQQ +          LQ   S L +++Q K  ++  LT QL+  N+E + Q++ L+ +T +L + Q +                                               ++     +N Q   K  LD+++ EL +T+  L EK + ++ LE    +QQ + I  L++EL       Q  +    +    +   ++     LKIE+DSLKREL  + D I + E+EC    L  ++ L+L
Sbjct:  182 APTLSSLGGLDYASLQRAAYPTIQPALLNFAAASDITTLQRECLRLQHELDITREKLNACTTSIRTFWSPELKRERSMRKEENAKYAILADHLHQLQLEKQTMLETLHNMEEDLRRERDIRIRGRFSSEHGREHLSELDLAKRQVDELTLENKQLKKAVEEADRRTSNVKASLTATEESLRRLIEAVKAGKAATAAGVPTSETGGSTGVAAAAAAVDASGASNIRLERIESDRAEISRLRHQLNEACTRGSDAERQLVDRNFEFSRLKEEFAALLQDHRQLKQENDSLRQDVRQTQTLQSIVDTKESKIMTLENEIRLLEDEITRLRDDGLITPNTSTSSGIDDLDKTLQ-TFRSNERLLKSKIEMLNGEISKRDCEIYTLQSRLEMTDKQHQDQTHHINVLKEQVKTREHKIAMLTADTEDFRKRLKEKETQLEKKTKALANAQTSKRQLETELTELKDQLDIKERKISLLQRKIENLEDLLNDKDTQLAASKARLTRISSERAGVEGVRAAIEESLKEREVLSERLKEARTRGESPGLDEIDAQKRIVAELRSRLELVQREADEKASKLLELREELGELRTGRYKHESEVSQLQSQLNQQASEMATLQIEKQMQHKQISSEYELKYSQRITELESQVNHYVENNSKLQSEIDRL---IRTLDNEKYEREKQMHEMQEELRESQNNLSSLKRSQQTERKKQTQLLEEARQREDNAHSDVEILKGIMSEKDSRIRELEQALRESVRLTAEREIYASGRDDETRHLEQQLREMRTNLEQLQRERNNLSAQLATVQEELSDRENQLKTLEQECFQNYLPELEKLRRANHEANMRVAAMVKLTQGREHTLTDQDRAALSGIPLFPNLASSGGWSVTG--VGGPTSSRLLTGSGGY------LGAYHSGGTTSPHLAGSAFQLIGNSSSALAAAAGGRASVPGQPIPSPDVVMLTRMLQDKENTIQQHLHELTHLRFQNSELEIRLKATQRELEAKSTRLSILEAAQYSALSRIEASGPSPTGLSN--EITQLRKANQDLSVKLAQLQMDLDDRERQLRAMDRLQSTTRSTTDFSEMAM--LRRELVTVKAEKETEILSLNSQLEKTKAERDETNNKLKEVTSALAEKSNQLRLTEAEKDKELMDREALQKKYEVVLTQLGDKTDKVQYMENEM-SKQAEEVRRQKAELDDMRHHSTYLQNTIQERENRIEAVEKESSKLRDELVSLKKQLSNLETEVKGLQEELAYREERLRQLQTQHTDEMSRLRSANQEQATRNSHLEMKLDEKEHE---------------------LKTQSSELRR------------------HSDEIARLQASIEEYTNRLAVSQKRVEERELRLKKLENENHDLLDEIHGLRKGNTDLESQVDSLRQRLLDRQD------RPGSV---GPSAAMSPPIR----THQSVYGPSSTTMNQELERVRKQYSETKSLQEQTQKALEDAQIQYDQMTVQRNTLRTQL-----------------EQEIAKRAMLEEKLRASDDQWKVRVSQAENSEQSRQATLQLNELRNELERKEAQITCLNKELERVQTSSALRDRLPDATNQQLLLADLQVRLRQVTEERDQAKDQLAAAVSHTESTYLETQQQLLLEKQTLHQQVANLTQTAQNATSEADRYQREARQASARVQQLSRQLQETQNNCDSIARQRDSLRDQLDQLKRTPGRSGSSALSSVANLFGTGGGTSYSARPASAGPGSYETFGGYGTMGSTSQLSRELDRLHREHELTLQQLRTTQEAEEMSRNEMNRIKQEL-----------EQMKQEVEQQKVRLKELEQQKQSLESEMVRIQREESDKAQQQQRELREKLQWTEQQLNEKTSHVENLSHQLNNTRQYCGELEQNVNQITQ-------------------------------RLNTAESRTQSQLNDLQQYQ---------QLQTEYSVLRNEIQGKNSEIQRLTIQLDQVNREYQNQQHQLEQMTIELSTTQANLTQVKREAQQWQQQQQQQQQAITMGASRPGTDNATRETGRETIQLLQTEIIEAAHNRQEMEK-HLDELQNELCATRNELDEKTRLLRSLEENQLKQQNEMIASLQREL-------QVARAQVEELGGSTGQGASGKASPLKIEIDSLKRELTKREDTIARLEKECVSLTLSYVNSLKL 2229          
BLAST of Rab6-interacting protein 2/elks/erc/cast,putative vs. Ensembl Cavefish
Match: si:dkey-222l13.1 (ELKS/Rab6-interacting/CAST family member 1-like [Source:NCBI gene;Acc:107196956])

HSP 1 Score: 276.944 bits (707), Expect = 1.476e-75
Identity = 261/850 (30.71%), Postives = 461/850 (54.24%), Query Frame = 3
Query:  654 SLRPQIPLPPPMAQNIYPAPMMGSNPGY-DYHFP-------------MIDNVIMDYQTDLFSIQRELAKCQQELELTKEKLTSSVNSIKSFWSPELKRERSMRKDENSK-------YVLLAEELHQLQMEKKTM---------LSNVHQXXXXXXXXXXXXNKHSQTAQEIDLLYRRCDELEKENRILTKQSEEYEKRMISQKESLVTAEENIRKLLEVVKVAKSASSGHSALQGLRLERFEEDQTEIERLRSQIHEYSQRTIDLERAI--VEKDFDISRNKEQGELLNQEVQNLRQENEHIR----QDIQQTQTLQSLVDTKESKILTLENEIRLLEDELARMRDEELITPTTSVNGIDDYEKNMR--STVRPHERLMKSKLEALSCEISKRDSEIYSLQSRLEMAEKQHQDQNHHINVLKEQVKTREHKISMMMADVEDFXXXXXXXXXXXXXXSQILTSSQTEKHQTESEILDLKDQCEMKDKKISLLQRKVQNLEDLLNDKENQLTTAKSKLLNLHTEHSTTEGTKAGLEESLRDRERQLERLKESKTRMEHEFQDELEMQKKLVSETKSRLDNSERELREKVAMLNEMREELSELRAVKFKRESELNTIQVQCSQKTSEVAALQLEL---QTVRKQYISDTEYKSNHRISELESQINHYSDSATRLQGEVDRLLNMVRNLESEKLEKDRQITQLECQVKEHQNTISNMKRTHQNERNYLNEDIDVLKRKEDNILVDMEVIKTTLTERENRIKELEQALRESLQITAERESYVHNKEDSYRQLE------------------LKISDQKQNLEIIQKERNQLSGQLASAQEELREKETQLKTLESE 3026
             +R  +    P      P  M   +  + D+H P               DN IMD Q  L  + RE    ++E+++ + KL+SS+NSIK+FWSPELK+ER++RKDE SK       Y ++ +E+  LQM  + +         L+ + Q +  +R  +    +   T +    L+   +   KE  +L K  EE E R+ +QK++L   +E+I+KLLE+++            +GL  +  EED           HE ++R  + E  I  +E   D  R+KE   L         +E+ H R     +  +T+ LQ++++ K+SKI +LE  +R +E+E+  ++       +      ++ E+ M+     R H + MK+K++ +  ++S++DSE+  LQ++LE    Q  D   HI VLKE +  +E + +++  +V+  R RL+EKET+L KK++ +  +  EK     EI DLKD  ++K++K+++LQ+K++NL++ L DKE Q+++ K ++ +L  + S T+     LEE+L ++ER +ERLKE + R E E  +ELE  KK + E K ++   + +L ++   + +++E  S L +   K++S+L ++++   QK  E   L+ +L   QT   +  ++TE   + RIS L+ ++  + + AT+ Q EVDRLL ++R +E+EK +KDR+I +LE Q+K+    ++++K   Q E++   + ++  +++EDNI    + +K +L +++ RI+ELE+ALRES+QITAERE  +  +E +    E                   K+ +    +E +++E   +  +L+S Q+ L EKE  L TL +E
Sbjct:  103 GVRTTVMGSSPNIATGSPGSMASDSIAFGDHHMPSSMASTVPHSLRQARDNTIMDLQAQLKEVLRENELLRKEVDVKESKLSSSMNSIKTFWSPELKKERALRKDEVSKIAVWKEQYRVVQDEMQHLQMTIQALQDELRIQRDLNQLFQQDCSVRPGEPFSAE--LTEENFQRLHSEHERQAKELFLLRKTLEEMELRIDTQKQTLGARDESIKKLLEMLQS-----------KGLSAKASEED-----------HERTRRLAEAEMHIHHLESLLD-QRDKEMCGL---------REDLHRRFEGAPESAKTKALQTVIEMKDSKISSLERSLRDMEEEVQMLK-------SNGALSTEEREEEMKQMEVYRSHSKFMKNKIDQVKQDLSRKDSELLGLQTKLETLTNQFSDSKQHIEVLKESLTAKEQRAAILQTEVDALRLRLEEKETMLNKKTKQIQETSEEKGTLNGEIHDLKDMLDVKERKVTVLQKKIENLQEQLRDKEKQMSSLKERVKSLQADTSNTDTALTTLEEALAEKERIIERLKEQRDRDEREKGEELENNKKELKELKEKISLLQGDLSDRETTVLDLKEHASSLASSGLKKDSKLKSLEINLEQKKEECIKLENQLKKAQTAAVEAQANTEL--SERISALQQEVARHKEDATKAQAEVDRLLEILREMENEKNDKDRKINELERQMKDQTKKVASLKHKEQVEKSKNAQLMEEARKREDNINESSQQVKDSLKQKDERIEELEEALRESVQITAEREMVLAQEEAARTHAEKQLFHEPMHDSNHTGFKWFKMEELLSAMEKVKQELESMKAKLSSTQQSLAEKEAHLTTLRAE 909          
BLAST of Rab6-interacting protein 2/elks/erc/cast,putative vs. Ensembl Cavefish
Match: si:dkey-222l13.1 (ELKS/Rab6-interacting/CAST family member 1-like [Source:NCBI gene;Acc:107196956])

HSP 1 Score: 275.404 bits (703), Expect = 4.246e-75
Identity = 260/848 (30.66%), Postives = 461/848 (54.36%), Query Frame = 3
Query:  654 SLRPQIPLPPPMAQNIYPAPMMGSNPGY-DYHFP-------------MIDNVIMDYQTDLFSIQRELAKCQQELELTKEKLTSSVNSIKSFWSPELKRERSMRKDENSK-------YVLLAEELHQLQMEKKTM---------LSNVHQXXXXXXXXXXXXNKHSQTAQEIDLLYRRCDELEKENRILTKQSEEYEKRMISQKESLVTAEENIRKLLEVVKVAKSASSGHSALQGLRLERFEEDQTEIERLRSQIHEYSQRTIDLERAI--VEKDFDISRNKEQGELLNQEVQNLRQENEHIR----QDIQQTQTLQSLVDTKESKILTLENEIRLLEDELARMRDEELITPTTSVNGIDDYEKNMR--STVRPHERLMKSKLEALSCEISKRDSEIYSLQSRLEMAEKQHQDQNHHINVLKEQVKTREHKISMMMADVEDFXXXXXXXXXXXXXXSQILTSSQTEKHQTESEILDLKDQCEMKDKKISLLQRKVQNLEDLLNDKENQLTTAKSKLLNLHTEHSTTEGTKAGLEESLRDRERQLERLKESKTRMEHEFQDELEMQKKLVSETKSRLDNSERELREKVAMLNEMREELSELRAVKFKRESELNTIQVQCSQKTSEVAALQLEL---------------QTVRKQYISDTEYKSNHRISELESQINHYSDSATRLQGEVDRLLNMVRNLESEKLEKDRQITQLEC----QVKEHQNTISNMKRTHQNERNYLNEDIDVLKRKEDNILVDMEVIKTTLTERENRIKELEQALRESLQITAERESYVHNKEDSYRQLELKISDQKQNLEIIQKERNQLSGQLASAQEELREKETQLKTLESE 3026
             +R  +    P      P  M   +  + D+H P               DN IMD Q  L  + RE    ++E+++ + KL+SS+NSIK+FWSPELK+ER++RKDE SK       Y ++ +E+  LQM  + +         L+ + Q +  +R  +    +   T +    L+   +   KE  +L K  EE E R+ +QK++L   +E+I+KLLE+++            +GL  +  EED           HE ++R  + E  I  +E   D  R+KE   L         +E+ H R     +  +T+ LQ++++ K+SKI +LE  +R +E+E+  ++       +      ++ E+ M+     R H + MK+K++ +  ++S++DSE+  LQ++LE    Q  D   HI VLKE +  +E + +++  +V+  R RL+EKET+L KK++ +  +  EK     EI DLKD  ++K++K+++LQ+K++NL++ L DKE Q+++ K ++ +L  + S T+     LEE+L ++ER +ERLKE + R E E  +ELE  KK + E K ++   + +L ++   + +++E  S L +   K++S+L ++++   QK  E   L+ +L               QT   +  ++TE   + RIS L+ ++  + + AT+ Q EVDRLL ++R +E+EK +KDR+I +LE     Q+K+    ++++K   Q E++   + ++  +++EDNI    + +K +L +++ RI+ELE+ALRES+QITAERE  +  +E +    E ++ +    +E +++E   +  +L+S Q+ L EKE  L TL +E
Sbjct:  103 GVRTTVMGSSPNIATGSPGSMASDSIAFGDHHMPSSMASTVPHSLRQARDNTIMDLQAQLKEVLRENELLRKEVDVKESKLSSSMNSIKTFWSPELKKERALRKDEVSKIAVWKEQYRVVQDEMQHLQMTIQALQDELRIQRDLNQLFQQDCSVRPGEPFSAE--LTEENFQRLHSEHERQAKELFLLRKTLEEMELRIDTQKQTLGARDESIKKLLEMLQS-----------KGLSAKASEED-----------HERTRRLAEAEMHIHHLESLLD-QRDKEMCGL---------REDLHRRFEGAPESAKTKALQTVIEMKDSKISSLERSLRDMEEEVQMLK-------SNGALSTEEREEEMKQMEVYRSHSKFMKNKIDQVKQDLSRKDSELLGLQTKLETLTNQFSDSKQHIEVLKESLTAKEQRAAILQTEVDALRLRLEEKETMLNKKTKQIQETSEEKGTLNGEIHDLKDMLDVKERKVTVLQKKIENLQEQLRDKEKQMSSLKERVKSLQADTSNTDTALTTLEEALAEKERIIERLKEQRDRDEREKGEELENNKKELKELKEKISLLQGDLSDRETTVLDLKEHASSLASSGLKKDSKLKSLEINLEQKKEECIKLENQLKKHTEHMSGHPSNRAQTAAVEAQANTEL--SERISALQQEVARHKEDATKAQAEVDRLLEILREMENEKNDKDRKINELESLASRQMKDQTKKVASLKHKEQVEKSKNAQLMEEARKREDNINESSQQVKDSLKQKDERIEELEEALRESVQITAEREMVLAQEEAARTHAEKQMEELLSAMEKVKQELESMKAKLSSTQQSLAEKEAHLTTLRAE 907          
BLAST of Rab6-interacting protein 2/elks/erc/cast,putative vs. Ensembl Cavefish
Match: si:dkey-222l13.1 (ELKS/Rab6-interacting/CAST family member 1-like [Source:NCBI gene;Acc:107196956])

HSP 1 Score: 271.552 bits (693), Expect = 9.607e-74
Identity = 263/863 (30.48%), Postives = 461/863 (53.42%), Query Frame = 3
Query:  654 SLRPQIPLPPPMAQNIYPAPMMGSNPGY-DYHFP-------------MIDNVIMDYQTDLFSIQRELAKCQQELELTKEKLTSSVNSIKSFWSPELKRERSMRKDENSK-------YVLLAEELHQLQMEKKTM---------LSNVHQXXXXXXXXXXXXNKHSQTAQEIDLLYRRCDELEKENRILTKQSEEYEKRMISQKESLVTAEENIRKLLEVVKVAKSASSGHSALQGLRLERFEEDQTEIERLRSQIHEYSQRTIDLERAI--VEKDFDISRNKEQGELLNQEVQNLRQENEHIR----QDIQQTQTLQSLVDTKESKILTLENEIRLLEDELARMRDEELITPTTSVNGIDDYEKNMR--STVRPHERLMKSKLEALSCEI-------------------------------SKRDSEIYSLQSRLEMAEKQHQDQNHHINVLKEQVKTREHKISMMMADVEDFXXXXXXXXXXXXXXSQILTSSQTEKHQTESEILDLKDQCEMKDKKISLLQRKVQNLEDLLNDKENQLTTAKSKLLNLHTEHSTTEGTKAGLEESLRDRERQLERLKESKTRMEHEFQDELEMQKKLVSETKSRLDNSERELREKVAMLNEMREELSELRAVKFKRESELNTIQVQCSQKTSEVAALQLEL---QTVRKQYISDTEYKSNHRISELESQINHYSDSATRLQGEVDRLLNMVRNLESEKLEKDRQITQLECQVKEHQNTISNMKRTHQNERNYLNEDIDVLKRKEDNILVDMEVIKTTLTERENRIKELEQALRESLQITAERESYVHNKEDSYRQLELKISDQKQNLEIIQKERNQLSGQLASAQEELREKETQLKTLESE 3026
             +R  +    P      P  M   +  + D+H P               DN IMD Q  L  + RE    ++E+++ + KL+SS+NSIK+FWSPELK+ER++RKDE SK       Y ++ +E+  LQM  + +         L+ + Q +  +R  +    +   T +    L+   +   KE  +L K  EE E R+ +QK++L   +E+I+KLLE+++            +GL  +  EED           HE ++R  + E  I  +E   D  R+KE   L         +E+ H R     +  +T+ LQ++++ K+SKI +LE  +R +E+E+  ++       +      ++ E+ M+     R H + MK+K+E L  E+                               S++DSE+  LQ++LE    Q  D   HI VLKE +  +E + +++  +V+  R RL+EKET+L KK++ +  +  EK     EI DLKD  ++K++K+++LQ+K++NL++ L DKE Q+++ K ++ +L  + S T+     LEE+L ++ER +ERLKE + R E E  +ELE  KK + E K ++   + +L ++   + +++E  S L +   K++S+L ++++   QK  E   L+ +L   QT   +  ++TE   + RIS L+ ++  + + AT+ Q EVDRLL ++R +E+EK +KDR+I +LE Q+K+    ++++K   Q E++   + ++  +++EDNI    + +K +L +++ RI+ELE+ALRES+QITAERE  +  +E +    E ++ +    +E +++E   +  +L+S Q+ L EKE  L TL +E
Sbjct:  103 GVRTTVMGSSPNIATGSPGSMASDSIAFGDHHMPSSMASTVPHSLRQARDNTIMDLQAQLKEVLRENELLRKEVDVKESKLSSSMNSIKTFWSPELKKERALRKDEVSKIAVWKEQYRVVQDEMQHLQMTIQALQDELRIQRDLNQLFQQDCSVRPGEPFSAE--LTEENFQRLHSEHERQAKELFLLRKTLEEMELRIDTQKQTLGARDESIKKLLEMLQS-----------KGLSAKASEED-----------HERTRRLAEAEMHIHHLESLLD-QRDKEMCGL---------REDLHRRFEGAPESAKTKALQTVIEMKDSKISSLERSLRDMEEEVQMLK-------SNGALSTEEREEEMKQMEVYRSHSKFMKNKVEQLKEELAHSEAQGEELRKRAAELQQEVSAIDQVKQDLSRKDSELLGLQTKLETLTNQFSDSKQHIEVLKESLTAKEQRAAILQTEVDALRLRLEEKETMLNKKTKQIQETSEEKGTLNGEIHDLKDMLDVKERKVTVLQKKIENLQEQLRDKEKQMSSLKERVKSLQADTSNTDTALTTLEEALAEKERIIERLKEQRDRDEREKGEELENNKKELKELKEKISLLQGDLSDRETTVLDLKEHASSLASSGLKKDSKLKSLEINLEQKKEECIKLENQLKKAQTAAVEAQANTEL--SERISALQQEVARHKEDATKAQAEVDRLLEILREMENEKNDKDRKINELERQMKDQTKKVASLKHKEQVEKSKNAQLMEEARKREDNINESSQQVKDSLKQKDERIEELEEALRESVQITAEREMVLAQEEAARTHAEKQMEELLSAMEKVKQELESMKAKLSSTQQSLAEKEAHLTTLRAE 922          
BLAST of Rab6-interacting protein 2/elks/erc/cast,putative vs. Ensembl Cavefish
Match: si:dkey-222l13.1 (ELKS/Rab6-interacting/CAST family member 1-like [Source:NCBI gene;Acc:107196956])

HSP 1 Score: 264.233 bits (674), Expect = 8.095e-72
Identity = 264/881 (29.97%), Postives = 461/881 (52.33%), Query Frame = 3
Query:  654 SLRPQIPLPPPMAQNIYPAPMMGSNPGY-DYHFP-------------MIDNVIMDYQTDLFSIQRELAKCQQELELTKEKLTSSVNSIKSFWSPELKRERSMRKDENSK-------YVLLAEELHQLQMEKKTM---------LSNVHQXXXXXXXXXXXXNKHSQTAQEIDLLYRRCDELEKENRILTKQSEEYEKRMISQKESLVTAEENIRKLLEVVKVAKSASSGHSALQGLRLERFEEDQTEIERLRSQIHEYSQRTIDLERAI--VEKDFDISRNKEQGELLNQEVQNLRQENEHIR----QDIQQTQTLQSLVDTKESKILTLENEIRLLEDELARMRDEELITPTTSVNGIDDYEKNMR--STVRPHERLMKSKLEALSCEI-------------------------------SKRDSEIYSLQSRLEMAEKQHQDQNHHINVLKEQVKTREHKISMMMADVEDFXXXXXXXXXXXXXXSQILTSSQTEKHQTESEILDLKDQCEMKDKKISLLQRKVQNLEDLLNDKENQLTTAKSKLLNLHTEHSTTEGTKAGLEESLRDRERQLERLKESKTRMEHEFQDELEMQKKLVSETKSRLDNSERELREKVAMLNEMREELSELRAVKFKRESELNTIQVQCSQKTSEVAALQLEL---QTVRKQYISDTEYKSNHRISELESQINHYSDSATRLQGEVDRLLNMVRNLESEKLEKDRQITQLECQVKEHQNTISNMKRTHQNERNYLNEDIDVLKRKEDNILVDMEVIKTTLTERENRIKELEQALRESLQITAERESYVHNKEDSYRQLE------------------LKISDQKQNLEIIQKERNQLSGQLASAQEELREKETQLKTLESE 3026
             +R  +    P      P  M   +  + D+H P               DN IMD Q  L  + RE    ++E+++ + KL+SS+NSIK+FWSPELK+ER++RKDE SK       Y ++ +E+  LQM  + +         L+ + Q +  +R  +    +   T +    L+   +   KE  +L K  EE E R+ +QK++L   +E+I+KLLE+++            +GL  +  EED           HE ++R  + E  I  +E   D  R+KE   L         +E+ H R     +  +T+ LQ++++ K+SKI +LE  +R +E+E+  ++       +      ++ E+ M+     R H + MK+K+E L  E+                               S++DSE+  LQ++LE    Q  D   HI VLKE +  +E + +++  +V+  R RL+EKET+L KK++ +  +  EK     EI DLKD  ++K++K+++LQ+K++NL++ L DKE Q+++ K ++ +L  + S T+     LEE+L ++ER +ERLKE + R E E  +ELE  KK + E K ++   + +L ++   + +++E  S L +   K++S+L ++++   QK  E   L+ +L   QT   +  ++TE   + RIS L+ ++  + + AT+ Q EVDRLL ++R +E+EK +KDR+I +LE Q+K+    ++++K   Q E++   + ++  +++EDNI    + +K +L +++ RI+ELE+ALRES+QITAERE  +  +E +    E                   K+ +    +E +++E   +  +L+S Q+ L EKE  L TL +E
Sbjct:  103 GVRTTVMGSSPNIATGSPGSMASDSIAFGDHHMPSSMASTVPHSLRQARDNTIMDLQAQLKEVLRENELLRKEVDVKESKLSSSMNSIKTFWSPELKKERALRKDEVSKIAVWKEQYRVVQDEMQHLQMTIQALQDELRIQRDLNQLFQQDCSVRPGEPFSAE--LTEENFQRLHSEHERQAKELFLLRKTLEEMELRIDTQKQTLGARDESIKKLLEMLQS-----------KGLSAKASEED-----------HERTRRLAEAEMHIHHLESLLD-QRDKEMCGL---------REDLHRRFEGAPESAKTKALQTVIEMKDSKISSLERSLRDMEEEVQMLK-------SNGALSTEEREEEMKQMEVYRSHSKFMKNKVEQLKEELAHSEAQGEELRKRAAELQQEVSAIDQVKQDLSRKDSELLGLQTKLETLTNQFSDSKQHIEVLKESLTAKEQRAAILQTEVDALRLRLEEKETMLNKKTKQIQETSEEKGTLNGEIHDLKDMLDVKERKVTVLQKKIENLQEQLRDKEKQMSSLKERVKSLQADTSNTDTALTTLEEALAEKERIIERLKEQRDRDEREKGEELENNKKELKELKEKISLLQGDLSDRETTVLDLKEHASSLASSGLKKDSKLKSLEINLEQKKEECIKLENQLKKAQTAAVEAQANTEL--SERISALQQEVARHKEDATKAQAEVDRLLEILREMENEKNDKDRKINELERQMKDQTKKVASLKHKEQVEKSKNAQLMEEARKREDNINESSQQVKDSLKQKDERIEELEEALRESVQITAEREMVLAQEEAARTHAEKQLFHEPMHDSNHTGFKWFKMEELLSAMEKVKQELESMKAKLSSTQQSLAEKEAHLTTLRAE 940          
BLAST of Rab6-interacting protein 2/elks/erc/cast,putative vs. Ensembl Cavefish
Match: si:dkey-222l13.1 (ELKS/Rab6-interacting/CAST family member 1-like [Source:NCBI gene;Acc:107196956])

HSP 1 Score: 263.077 bits (671), Expect = 5.199e-71
Identity = 264/881 (29.97%), Postives = 461/881 (52.33%), Query Frame = 3
Query:  654 SLRPQIPLPPPMAQNIYPAPMMGSNPGY-DYHFP-------------MIDNVIMDYQTDLFSIQRELAKCQQELELTKEKLTSSVNSIKSFWSPELKRERSMRKDENSK-------YVLLAEELHQLQMEKKTM---------LSNVHQXXXXXXXXXXXXNKHSQTAQEIDLLYRRCDELEKENRILTKQSEEYEKRMISQKESLVTAEENIRKLLEVVKVAKSASSGHSALQGLRLERFEEDQTEIERLRSQIHEYSQRTIDLERAI--VEKDFDISRNKEQGELLNQEVQNLRQENEHIR----QDIQQTQTLQSLVDTKESKILTLENEIRLLEDELARMRDEELITPTTSVNGIDDYEKNMR--STVRPHERLMKSKLEALSCEI-------------------------------SKRDSEIYSLQSRLEMAEKQHQDQNHHINVLKEQVKTREHKISMMMADVEDFXXXXXXXXXXXXXXSQILTSSQTEKHQTESEILDLKDQCEMKDKKISLLQRKVQNLEDLLNDKENQLTTAKSKLLNLHTEHSTTEGTKAGLEESLRDRERQLERLKESKTRMEHEFQDELEMQKKLVSETKSRLDNSERELREKVAMLNEMREELSELRAVKFKRESELNTIQVQCSQKTSEVAALQLEL---QTVRKQYISDTEYKSNHRISELESQINHYSDSATRLQGEVDRLLNMVRNLESEKLEKDRQITQLECQVKEHQNTISNMKRTHQNERNYLNEDIDVLKRKEDNILVDMEVIKTTLTERENRIKELEQALRESLQITAERESYVHNKEDSYRQLE------------------LKISDQKQNLEIIQKERNQLSGQLASAQEELREKETQLKTLESE 3026
             +R  +    P      P  M   +  + D+H P               DN IMD Q  L  + RE    ++E+++ + KL+SS+NSIK+FWSPELK+ER++RKDE SK       Y ++ +E+  LQM  + +         L+ + Q +  +R  +    +   T +    L+   +   KE  +L K  EE E R+ +QK++L   +E+I+KLLE+++            +GL  +  EED           HE ++R  + E  I  +E   D  R+KE   L         +E+ H R     +  +T+ LQ++++ K+SKI +LE  +R +E+E+  ++       +      ++ E+ M+     R H + MK+K+E L  E+                               S++DSE+  LQ++LE    Q  D   HI VLKE +  +E + +++  +V+  R RL+EKET+L KK++ +  +  EK     EI DLKD  ++K++K+++LQ+K++NL++ L DKE Q+++ K ++ +L  + S T+     LEE+L ++ER +ERLKE + R E E  +ELE  KK + E K ++   + +L ++   + +++E  S L +   K++S+L ++++   QK  E   L+ +L   QT   +  ++TE   + RIS L+ ++  + + AT+ Q EVDRLL ++R +E+EK +KDR+I +LE Q+K+    ++++K   Q E++   + ++  +++EDNI    + +K +L +++ RI+ELE+ALRES+QITAERE  +  +E +    E                   K+ +    +E +++E   +  +L+S Q+ L EKE  L TL +E
Sbjct:  103 GVRTTVMGSSPNIATGSPGSMASDSIAFGDHHMPSSMASTVPHSLRQARDNTIMDLQAQLKEVLRENELLRKEVDVKESKLSSSMNSIKTFWSPELKKERALRKDEVSKIAVWKEQYRVVQDEMQHLQMTIQALQDELRIQRDLNQLFQQDCSVRPGEPFSAE--LTEENFQRLHSEHERQAKELFLLRKTLEEMELRIDTQKQTLGARDESIKKLLEMLQS-----------KGLSAKASEED-----------HERTRRLAEAEMHIHHLESLLD-QRDKEMCGL---------REDLHRRFEGAPESAKTKALQTVIEMKDSKISSLERSLRDMEEEVQMLK-------SNGALSTEEREEEMKQMEVYRSHSKFMKNKVEQLKEELAHSEAQGEELRKRAAELQQEVSAIDQVKQDLSRKDSELLGLQTKLETLTNQFSDSKQHIEVLKESLTAKEQRAAILQTEVDALRLRLEEKETMLNKKTKQIQETSEEKGTLNGEIHDLKDMLDVKERKVTVLQKKIENLQEQLRDKEKQMSSLKERVKSLQADTSNTDTALTTLEEALAEKERIIERLKEQRDRDEREKGEELENNKKELKELKEKISLLQGDLSDRETTVLDLKEHASSLASSGLKKDSKLKSLEINLEQKKEECIKLENQLKKAQTAAVEAQANTEL--SERISALQQEVARHKEDATKAQAEVDRLLEILREMENEKNDKDRKINELERQMKDQTKKVASLKHKEQVEKSKNAQLMEEARKREDNINESSQQVKDSLKQKDERIEELEEALRESVQITAEREMVLAQEEAARTHAEKQLFHEPMHDSNHTGFKWFKMEELLSAMEKVKQELESMKAKLSSTQQSLAEKEAHLTTLRAE 940          
BLAST of Rab6-interacting protein 2/elks/erc/cast,putative vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006462.1 (pep scaffold:Pmarinus_7.0:GL476828:28653:154462:-1 gene:ENSPMAG00000005823.1 transcript:ENSPMAT00000006462.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 122.479 bits (306), Expect = 5.439e-28
Identity = 146/551 (26.50%), Postives = 247/551 (44.83%), Query Frame = 3
Query:  672 PLPPPMAQNIYPAP------MMGSNPGY-DYHFPMIDNVI--------------------------MDYQTDLFSIQRELAKCQQELELTKEKLTSSVNSIKSFWSPELKRERSMRKDENSKYVLLAEELHQLQMEKKTM----------------LSNVHQXXXX------XXXXXXXXNKHSQTAQEIDLLYRRCDELEKENRILTKQSEEYEKRMISQKESLVTAEENIRKLLEVVKVAKSASSGHSALQGLRLERFEEDQTEIERLRSQIHEYSQRTIDLERAIVEKDFDISRNKEQGELLNQEVQNLRQENEHIRQDIQ----------QTQTLQSLVDTKESKILTLENEIRLLEDELARMRDEELITPTTSVNGIDDYEKNMRS--TVRPHERLMKSKLE--------------------------------ALSCEISKRDSEIYSLQSRLEMAEKQHQDQNHHINVLKEQVKTREHKISMMMADVEDFXXXXXXXXXXXXXXSQILTSSQTEKHQTESEILDLKDQCEMKDKKISLLQRKVQ 2027
            P+  P++    PAP       MGS+P       P  D +I                          ++ Q  L  +QR     ++ELE+ + KL SS++SIK+FWSPELK+ER++RK+E S+  ++ E++  +Q E + +                L+ + Q +                 +   +  E   L  + D   KE  +L +  EE E R+ +QK++L   +E+IRKLLE+++       G +     RL   E   + I                                 QG L  +E     +EN+H+R+++Q          +T+ LQ++V+ K++KI +LE  +R LEDE+  ++       T     I++ E+ ++     + H + MK+K+E                                 L  EIS++DSE+ ++Q++LE    Q+ D   HI VLKE +  +E + +++  +V+  R RL+EKE+LL KK + L     EK     EI DLKD  ++K++KI++LQ+KV+
Sbjct:   96 PMGAPVSSVPRPAPYGLRMTAMGSSPNIASAGLPGGDAIIFGENDLAYSMGAQVPASLRGVRECSMLELQAQLKEMQRANELLRRELEVKESKLGSSMSSIKTFWSPELKKERAIRKEEASRMTVIKEQMRVMQEETQHLQLTIQALQEELRTQRDLNQLFQQQDSNYPSDDKAAGDGADGRTEPSQAEFHRLRVQHDRQSKELFLLRRTLEEMELRIDTQKQTLGARDESIRKLLEMLQGKGPGGRGGTTGDDERLADAEAQLSHI---------------------------------QGLLEGRE-----RENQHLREELQRRGDGPSEPGKTKALQTVVEMKDTKIASLERNLRDLEDEVQMLK-------TNGALSIEEREEELKQMEVYKSHSKFMKNKVERMKEDLAVKEVELHELRKRVESIHSDPGSAVDQLKQEISRKDSELLAVQTKLETLTNQNSDCKQHIEVLKESLTAKEQRAAILQTEVDALRMRLEEKESLLNKKGKQLQELTEEKGTLAGEIRDLKDMLDVKERKINVLQKKVR 601          
BLAST of Rab6-interacting protein 2/elks/erc/cast,putative vs. Ensembl Medaka
Match: erc1a (ELKS/RAB6-interacting/CAST family member 1 [Source:NCBI gene;Acc:101162286])

HSP 1 Score: 298.13 bits (762), Expect = 1.730e-82
Identity = 271/829 (32.69%), Postives = 467/829 (56.33%), Query Frame = 3
Query:  642 ALMGSLRPQIPLPPPMAQNIYPAPMMGSNP--GYDYHFPMI---------DNVIMDYQTDLFSIQRELAKCQQELELTKEKLTSSVNSIKSFWSPELKRERSMRKDENSKYVLLAEELHQLQMEKKTMLSNVH--QXXXXXXXXXXXXNKHSQTAQEIDLL---------YRRC----DELEKENRILTKQSEEYEKRMISQKESLVTAEENIRKLLEVVKVAKSASSGHSALQGLRLERFEEDQTEIERLR-SQIHEYSQRTIDLERAIVEKDFDISRNKEQGELLNQEVQNLRQENEHIRQDIQQTQTLQSLVDTKESKILTLENEIRLLEDELARMRDEELITPTTSVNGIDDYEKNMR--STVRPHERLMKSKLEALSCEISKRDSEIYSLQSRLEMAEKQHQDQNHHINVLKEQVKTREHKISMMMADVEDFXXXXXXXXXXXXXXSQILTSSQTEKHQTESEILDLKDQCEMKDKKISLLQRKVQNLEDLLNDKENQLTTAKSKLLNLHTEHSTTEGTKAGLEESLRDRERQLERLKESKTRMEHEFQDELEMQKKLVSETKSRLDNSERELREKVAMLNEMREELSELRAVKFKRESELNTIQVQCSQKTSEVAALQLELQTVRKQYISDTEYKSN----HRISELESQINHYSDSATRLQGEVDRLLNMVRNLESEKLEKDRQITQLECQVKEHQNTISNMKRTHQNERNYLNEDIDVLKRKEDNILVDMEVIKTTLTERENRIKELEQALRESLQITAERESYVHNKEDSYRQL-ELKISDQKQNLEIIQKERNQLSGQLASAQEELREKETQLKTLESE 3026
             ++ +  P I    P A  + PA MM  +     D+H             DN I+D Q  L  + RE    ++++E+ + KL+SS+NSIK+FWSPELK+ER++RKDE SK  +  E+   +Q E + +   V   Q E  ++R+     +    +Q  DL          YRR     +   KE  +L K  EE E R+ +QK++LV  +E+I+KLLE+++     S G SA      +  EEDQ    RL  +++H +      LE  + +++ +++  +E+   L++  +   +          +T+ LQ+++D K++KI ++E  +R +E+EL  ++   L++        ++ ++ M+     R H + MK+K+E +  ++S++D+E+  LQ++LE    Q  D   HI VLKE +  +E + +++  +V+  R RL+EKE  L KKS+ +     EK     EI DLKD  E+K++KI++LQ+K++NL++ L DKE Q+++ K ++ +L  + S T+     LEESL ++ER +ERLKE + R + E  +ELE  KK + E K +L   + +L ++   L +++E  S L +   K++S+L ++++   QK  E   L+LE Q  R Q  +  E ++N     RI  LE ++N Y + + + Q EVDRLL ++R +E+EK +KD++I++LE Q+K+    ++++K   Q E++     +D  +++EDN+      +K TL ++  RI+ELE+ALRES+QITAERE  V  +E++ R L E ++ +    +E +++E   +  +L S Q+ L EKE  L TL +E
Sbjct:  121 GVVAASTPNISTSMP-ASAVLPAGMMAGDALAFGDHHMASTVPHSLRQARDNTILDLQAQLKEVLRENELLRRDVEVKESKLSSSMNSIKTFWSPELKKERALRKDEASKITVWKEQYRVIQDEAQHLQMTVQALQDELRIQRDLNQLLQQDPASQGRDLALTSEPTEENYRRLHGEHERQAKELFLLRKTLEEMELRIDTQKQTLVARDESIKKLLEMLQ-----SKGPSA------KASEEDQERTRRLADAEMHRHH-----LESLLEQREREVTALREE---LHRRYEGTPEST--------KTKALQTVIDMKDAKINSMERGLRDMEEELLMLKSNGLLS-------CEERQEEMKQMEVYRSHTKFMKNKMEQVKQDLSRKDTEMLGLQTKLETLTNQFSDSKQHIEVLKESLTAKEQRAAILQTEVDALRLRLEEKEATLNKKSKQIQEMSEEKGTLNGEIHDLKDMLEVKERKINVLQKKIENLQEQLRDKEKQMSSLKERVKSLQADTSNTDTALTTLEESLSEKERIIERLKEQRDRDDREKTEELECTKKELKELKEKLSLLQGDLSDRETSLLDLKEHASSLASSGLKKDSKLKSMEINLEQKREEC--LKLENQLKRAQNAT-LEAQANTELAERIKNLEREVNRYKEDSVKAQAEVDRLLEILREMENEKNDKDKKISELERQMKDQTKKVASLKHKEQVEKSKNARLMDEARKREDNMSESSLQVKDTLRQKTERIEELEEALRESVQITAERE-MVLAQEEAARSLQEKQMEELLGAMEKVKQELESMRAKLGSTQQSLCEKEAHLTTLRAE 910          
BLAST of Rab6-interacting protein 2/elks/erc/cast,putative vs. Ensembl Medaka
Match: erc1a (ELKS/RAB6-interacting/CAST family member 1 [Source:NCBI gene;Acc:101162286])

HSP 1 Score: 294.278 bits (752), Expect = 8.172e-82
Identity = 276/837 (32.97%), Postives = 466/837 (55.68%), Query Frame = 3
Query:  642 ALMGSLRPQIPLPPPMAQNIYPAPMMGSNP--GYDYHFPMI---------DNVIMDYQTDLFSIQRELAKCQQELELTKEKLTSSVNSIKSFWSPELKRERSMRKDENSKYVLLAEELHQLQMEKKTMLSNVH--QXXXXXXXXXXXXNKHSQTAQEIDLL---------YRRC----DELEKENRILTKQSEEYEKRMISQKESLVTAEENIRKLLEVVKVAKSASSGHSALQGLRLERFEEDQTEIERLR-SQIHEYSQRTIDLERAIVEKDFDISRNKEQGELLNQEVQNLRQENEHIR----QDIQQTQTLQSLVDTKESKILTLENEIRLLEDELARMRDEELITPTTSVNGIDDYEKNMR--STVRPHERLMKSKLEALSCEISKRDSEIYSLQSRLEMAEKQHQDQNHHINVLKEQVKTREHKISMMMADVEDFXXXXXXXXXXXXXXSQILTSSQTEKHQTESEILDLKDQCEMKDKKISLLQRKVQNLEDLLNDKENQLTTAKSKLLNLHTEHSTTEGTKAGLEESLRDRERQLERLKESKTRMEHEFQDELEMQKKLVSETKSRLDNSERELREKVAMLNEMREELSELRAVKFKRESELNTIQVQCSQKTSEVAALQLELQTVRKQYISDTEYKSN----HRISELESQINHYSDSATRLQGEVDRLLNMVRNLESEKLEKDRQITQLEC----QVKEHQNTISNMKRTHQNERNYLNEDIDVLKRKEDNILVDMEVIKTTLTERENRIKELEQALRESLQITAERESYVHNKEDSYRQL-ELKISDQKQNLEIIQKERNQLSGQLASAQEELREKETQLKTLESE 3026
             ++ +  P I    P A  + PA MM  +     D+H             DN I+D Q  L  + RE    ++++E+ + KL+SS+NSIK+FWSPELK+ER++RKDE SK  +  E+   +Q E + +   V   Q E  ++R+     +    +Q  DL          YRR     +   KE  +L K  EE E R+ +QK++LV  +E+I+KLLE+++     S G SA      +  EEDQ    RL  +++H +      LE  + +++              +EV  LR+E  H R     +  +T+ LQ+++D K++KI ++E  +R +E+EL  ++   L++        ++ ++ M+     R H + MK+K+E +  ++S++D+E+  LQ++LE    Q  D   HI VLKE +  +E + +++  +V+  R RL+EKE  L KKS+ +     EK     EI DLKD  E+K++KI++LQ+K++NL++ L DKE Q+++ K ++ +L  + S T+     LEESL ++ER +ERLKE + R + E  +ELE  KK + E K +L   + +L ++   L +++E  S L +   K++S+L ++++   QK  E   L+LE Q  R Q  +  E ++N     RI  LE ++N Y + + + Q EVDRLL ++R +E+EK +KD++I++LE     Q+K+    ++++K   Q E++     +D  +++EDN+      +K TL ++  RI+ELE+ALRES+QITAERE  V  +E++ R L E ++ +    +E +++E   +  +L S Q+ L EKE  L TL +E
Sbjct:  121 GVVAASTPNISTSMP-ASAVLPAGMMAGDALAFGDHHMASTVPHSLRQARDNTILDLQAQLKEVLRENELLRRDVEVKESKLSSSMNSIKTFWSPELKKERALRKDEASKITVWKEQYRVIQDEAQHLQMTVQALQDELRIQRDLNQLLQQDPASQGRDLALTSEPTEENYRRLHGEHERQAKELFLLRKTLEEMELRIDTQKQTLVARDESIKKLLEMLQ-----SKGPSA------KASEEDQERTRRLADAEMHRHH-----LESLLEQRE--------------REVTALREEL-HRRYEGTPESTKTKALQTVIDMKDAKINSMERGLRDMEEELLMLKSNGLLS-------CEERQEEMKQMEVYRSHTKFMKNKMEQVKQDLSRKDTEMLGLQTKLETLTNQFSDSKQHIEVLKESLTAKEQRAAILQTEVDALRLRLEEKEATLNKKSKQIQEMSEEKGTLNGEIHDLKDMLEVKERKINVLQKKIENLQEQLRDKEKQMSSLKERVKSLQADTSNTDTALTTLEESLSEKERIIERLKEQRDRDDREKTEELECTKKELKELKEKLSLLQGDLSDRETSLLDLKEHASSLASSGLKKDSKLKSMEINLEQKREEC--LKLENQLKRAQNAT-LEAQANTELAERIKNLEREVNRYKEDSVKAQAEVDRLLEILREMENEKNDKDKKISELESLASRQMKDQTKKVASLKHKEQVEKSKNARLMDEARKREDNMSESSLQVKDTLRQKTERIEELEEALRESVQITAERE-MVLAQEEAARSLQEKQMEELLGAMEKVKQELESMRAKLGSTQQSLCEKEAHLTTLRAE 914          
BLAST of Rab6-interacting protein 2/elks/erc/cast,putative vs. Ensembl Medaka
Match: erc1a (ELKS/RAB6-interacting/CAST family member 1 [Source:NCBI gene;Acc:101162286])

HSP 1 Score: 294.664 bits (753), Expect = 2.058e-81
Identity = 270/829 (32.57%), Postives = 467/829 (56.33%), Query Frame = 3
Query:  642 ALMGSLRPQIPLPPPMAQNIYPAPMMGSNP--GYDYHFPMI---------DNVIMDYQTDLFSIQRELAKCQQELELTKEKLTSSVNSIKSFWSPELKRERSMRKDENSKYVLLAEELHQLQMEKKTMLSNVH--QXXXXXXXXXXXXNKHSQTAQEIDLL---------YRRC----DELEKENRILTKQSEEYEKRMISQKESLVTAEENIRKLLEVVKVAKSASSGHSALQGLRLERFEEDQTEIERLR-SQIHEYSQRTIDLERAIVEKDFDISRNKEQGELLNQEVQNLRQENEHIRQDIQQTQTLQSLVDTKESKILTLENEIRLLEDELARMRDEELITPTTSVNGIDDYEKNMR--STVRPHERLMKSKLEALSCEISKRDSEIYSLQSRLEMAEKQHQDQNHHINVLKEQVKTREHKISMMMADVEDFXXXXXXXXXXXXXXSQILTSSQTEKHQTESEILDLKDQCEMKDKKISLLQRKVQNLEDLLNDKENQLTTAKSKLLNLHTEHSTTEGTKAGLEESLRDRERQLERLKESKTRMEHEFQDELEMQKKLVSETKSRLDNSERELREKVAMLNEMREELSELRAVKFKRESELNTIQVQCSQKTSEVAALQLELQTVRKQYISDTEYKSN----HRISELESQINHYSDSATRLQGEVDRLLNMVRNLESEKLEKDRQITQLECQVKEHQNTISNMKRTHQNERNYLNEDIDVLKRKEDNILVDMEVIKTTLTERENRIKELEQALRESLQITAERESYVHNKEDSYRQL-ELKISDQKQNLEIIQKERNQLSGQLASAQEELREKETQLKTLESE 3026
             ++ +  P I    P A  + PA MM  +     D+H             DN I+D Q  L  + RE    ++++E+ + KL+SS+NSIK+FWSPELK+ER++RKDE SK  +  E+   +Q E + +   V   Q E  ++R+     +    +Q  DL          YRR     +   KE  +L K  EE E R+ +QK++LV  +E+I+KLLE+++     S G SA      +  EEDQ    RL  +++H +      LE  + +++ +++  +E+   L++  +   +          +T+ LQ+++D K++KI ++E  +R +E+EL  ++   L++        ++ ++ M+     R H + MK+K+E +  ++S++D+E+  LQ++LE    Q  D   HI VLKE +  +E + +++  +V+  R RL+EKE  L KKS+ +     EK     EI DLKD  E+K++KI++LQ+K++NL++ L DKE Q+++ K ++ +L  + S T+     LEESL ++ER +ERLKE + R + E  +ELE  KK + E K +L   + +L ++   L +++E  S L +   K++S+L ++++   QK  E   L+LE Q  R Q  +  E ++N     RI  LE ++N Y + + + Q EVDRLL ++R +E+EK +KD++I++LE Q+K+    ++++K   Q E++     +D  +++EDN+      ++ TL ++  RI+ELE+ALRES+QITAERE  V  +E++ R L E ++ +    +E +++E   +  +L S Q+ L EKE  L TL +E
Sbjct:  121 GVVAASTPNISTSMP-ASAVLPAGMMAGDALAFGDHHMASTVPHSLRQARDNTILDLQAQLKEVLRENELLRRDVEVKESKLSSSMNSIKTFWSPELKKERALRKDEASKITVWKEQYRVIQDEAQHLQMTVQALQDELRIQRDLNQLLQQDPASQGRDLALTSEPTEENYRRLHGEHERQAKELFLLRKTLEEMELRIDTQKQTLVARDESIKKLLEMLQ-----SKGPSA------KASEEDQERTRRLADAEMHRHH-----LESLLEQREREVTALREE---LHRRYEGTPEST--------KTKALQTVIDMKDAKINSMERGLRDMEEELLMLKSNGLLS-------CEERQEEMKQMEVYRSHTKFMKNKMEQVKQDLSRKDTEMLGLQTKLETLTNQFSDSKQHIEVLKESLTAKEQRAAILQTEVDALRLRLEEKEATLNKKSKQIQEMSEEKGTLNGEIHDLKDMLEVKERKINVLQKKIENLQEQLRDKEKQMSSLKERVKSLQADTSNTDTALTTLEESLSEKERIIERLKEQRDRDDREKTEELECTKKELKELKEKLSLLQGDLSDRETSLLDLKEHASSLASSGLKKDSKLKSMEINLEQKREEC--LKLENQLKRAQNAT-LEAQANTELAERIKNLEREVNRYKEDSVKAQAEVDRLLEILREMENEKNDKDKKISELERQMKDQTKKVASLKHKEQVEKSKNARLMDEARKREDNM--SESSLQDTLRQKTERIEELEEALRESVQITAERE-MVLAQEEAARSLQEKQMEELLGAMEKVKQELESMRAKLGSTQQSLCEKEAHLTTLRAE 908          
BLAST of Rab6-interacting protein 2/elks/erc/cast,putative vs. Ensembl Medaka
Match: erc1a (ELKS/RAB6-interacting/CAST family member 1 [Source:NCBI gene;Acc:101162286])

HSP 1 Score: 293.893 bits (751), Expect = 4.864e-81
Identity = 271/833 (32.53%), Postives = 467/833 (56.06%), Query Frame = 3
Query:  642 ALMGSLRPQIPLPPPMAQNIYPAPMMGSNP--GYDYHFPMI---------DNVIMDYQTDLFSIQRELAKCQQELELTKEKLTSSVNSIKSFWSPELKRERSMRKDENSKYVLLAEELHQLQMEKKTMLSNVH--QXXXXXXXXXXXXNKHSQTAQEIDLL---------YRRC----DELEKENRILTKQSEEYEKRMISQKESLVTAEENIRKLLEVVKVAKSASSGHSALQGLRLERFEEDQTEIERLR-SQIHEYSQRTIDLERAIVEKDFDISRNKEQGELLNQEVQNLRQENEHIRQDIQQTQTLQSLVDTKESKILTLENEIRLLEDELARMRDEELITPTTSVNGIDDYEKNMR--STVRPHERLMKSKLEALSCEISKRDSEIYSLQSRLEMAEKQHQDQNHHINVLKEQVKTREHKISMMMADVEDFXXXXXXXXXXXXXXSQILTSSQTEKHQTESEILDLKDQCEMKDKKISLLQRKVQNLEDLLNDKENQLTTAKSKLLNLHTEHSTTEGTKAGLEESLRDRERQLERLKESKTRMEHEFQDELEMQKKLVSETKSRLDNSERELREKVAMLNEMREELSELRAVKFKRESELNTIQVQCSQKTSEVAALQLELQTVRKQYISDTEYKSN----HRISELESQINHYSDSATRLQGEVDRLLNMVRNLESEKLEKDRQITQLEC----QVKEHQNTISNMKRTHQNERNYLNEDIDVLKRKEDNILVDMEVIKTTLTERENRIKELEQALRESLQITAERESYVHNKEDSYRQL-ELKISDQKQNLEIIQKERNQLSGQLASAQEELREKETQLKTLESE 3026
             ++ +  P I    P A  + PA MM  +     D+H             DN I+D Q  L  + RE    ++++E+ + KL+SS+NSIK+FWSPELK+ER++RKDE SK  +  E+   +Q E + +   V   Q E  ++R+     +    +Q  DL          YRR     +   KE  +L K  EE E R+ +QK++LV  +E+I+KLLE+++     S G SA      +  EEDQ    RL  +++H +      LE  + +++ +++  +E+   L++  +   +          +T+ LQ+++D K++KI ++E  +R +E+EL  ++   L++        ++ ++ M+     R H + MK+K+E +  ++S++D+E+  LQ++LE    Q  D   HI VLKE +  +E + +++  +V+  R RL+EKE  L KKS+ +     EK     EI DLKD  E+K++KI++LQ+K++NL++ L DKE Q+++ K ++ +L  + S T+     LEESL ++ER +ERLKE + R + E  +ELE  KK + E K +L   + +L ++   L +++E  S L +   K++S+L ++++   QK  E   L+LE Q  R Q  +  E ++N     RI  LE ++N Y + + + Q EVDRLL ++R +E+EK +KD++I++LE     Q+K+    ++++K   Q E++     +D  +++EDN+      +K TL ++  RI+ELE+ALRES+QITAERE  V  +E++ R L E ++ +    +E +++E   +  +L S Q+ L EKE  L TL +E
Sbjct:  121 GVVAASTPNISTSMP-ASAVLPAGMMAGDALAFGDHHMASTVPHSLRQARDNTILDLQAQLKEVLRENELLRRDVEVKESKLSSSMNSIKTFWSPELKKERALRKDEASKITVWKEQYRVIQDEAQHLQMTVQALQDELRIQRDLNQLLQQDPASQGRDLALTSEPTEENYRRLHGEHERQAKELFLLRKTLEEMELRIDTQKQTLVARDESIKKLLEMLQ-----SKGPSA------KASEEDQERTRRLADAEMHRHH-----LESLLEQREREVTALREE---LHRRYEGTPEST--------KTKALQTVIDMKDAKINSMERGLRDMEEELLMLKSNGLLS-------CEERQEEMKQMEVYRSHTKFMKNKMEQVKQDLSRKDTEMLGLQTKLETLTNQFSDSKQHIEVLKESLTAKEQRAAILQTEVDALRLRLEEKEATLNKKSKQIQEMSEEKGTLNGEIHDLKDMLEVKERKINVLQKKIENLQEQLRDKEKQMSSLKERVKSLQADTSNTDTALTTLEESLSEKERIIERLKEQRDRDDREKTEELECTKKELKELKEKLSLLQGDLSDRETSLLDLKEHASSLASSGLKKDSKLKSMEINLEQKREEC--LKLENQLKRAQNAT-LEAQANTELAERIKNLEREVNRYKEDSVKAQAEVDRLLEILREMENEKNDKDKKISELESLASRQMKDQTKKVASLKHKEQVEKSKNARLMDEARKREDNMSESSLQVKDTLRQKTERIEELEEALRESVQITAERE-MVLAQEEAARSLQEKQMEELLGAMEKVKQELESMRAKLGSTQQSLCEKEAHLTTLRAE 914          
BLAST of Rab6-interacting protein 2/elks/erc/cast,putative vs. Ensembl Medaka
Match: erc1a (ELKS/RAB6-interacting/CAST family member 1 [Source:NCBI gene;Acc:101162286])

HSP 1 Score: 290.041 bits (741), Expect = 6.594e-80
Identity = 271/842 (32.19%), Postives = 466/842 (55.34%), Query Frame = 3
Query:  642 ALMGSLRPQIPLPPPMAQNIYPAPMMGSNP--GYDYHFPMI---------DNVIMDYQTDLFSIQRELAKCQQELELTKEKLTSSVNSIKSFWSPELKRERSMRKDENSKYVLLAEELHQLQMEKKTMLSNVH--QXXXXXXXXXXXXNKHSQTAQEIDLL---------YRRC----DELEKENRILTKQSEEYEKRMISQKESLVTAEENIRKLLEVVKVAKSASSGHSALQGLRLERFEEDQTEIERLR-SQIHEYSQRTIDLERAIVEKDFDISRNKEQGELLNQEVQNLRQENEHIRQDIQQTQTLQSLVDTKESKILTLENEIRLLEDELARMRDEELITPTTSVNGIDDYEKNMR--STVRPHERLMKSKLEALSC-------------EISKRDSEIYSLQSRLEMAEKQHQDQNHHINVLKEQVKTREHKISMMMADVEDFXXXXXXXXXXXXXXSQILTSSQTEKHQTESEILDLKDQCEMKDKKISLLQRKVQNLEDLLNDKENQLTTAKSKLLNLHTEHSTTEGTKAGLEESLRDRERQLERLKESKTRMEHEFQDELEMQKKLVSETKSRLDNSERELREKVAMLNEMREELSELRAVKFKRESELNTIQVQCSQKTSEVAALQLELQTVRKQYISDTEYKSN----HRISELESQINHYSDSATRLQGEVDRLLNMVRNLESEKLEKDRQITQLECQVKEHQNTISNMKRTHQNERNYLNEDIDVLKRKEDNILVDMEVIKTTLTERENRIKELEQALRESLQITAERESYVHNKEDSYRQL-ELKISDQKQNLEIIQKERNQLSGQLASAQEELREKETQLKTLESE 3026
             ++ +  P I    P A  + PA MM  +     D+H             DN I+D Q  L  + RE    ++++E+ + KL+SS+NSIK+FWSPELK+ER++RKDE SK  +  E+   +Q E + +   V   Q E  ++R+     +    +Q  DL          YRR     +   KE  +L K  EE E R+ +QK++LV  +E+I+KLLE+++     S G SA      +  EEDQ    RL  +++H +      LE  + +++ +++  +E+   L++  +   +          +T+ LQ+++D K++KI ++E  +R +E+EL  ++   L++        ++ ++ M+     R H + MK+K+    C             ++S++D+E+  LQ++LE    Q  D   HI VLKE +  +E + +++  +V+  R RL+EKE  L KKS+ +     EK     EI DLKD  E+K++KI++LQ+K++NL++ L DKE Q+++ K ++ +L  + S T+     LEESL ++ER +ERLKE + R + E  +ELE  KK + E K +L   + +L ++   L +++E  S L +   K++S+L ++++   QK  E   L+LE Q  R Q  +  E ++N     RI  LE ++N Y + + + Q EVDRLL ++R +E+EK +KD++I++LE Q+K+    ++++K   Q E++     +D  +++EDN+      +K TL ++  RI+ELE+ALRES+QITAERE  V  +E++ R L E ++ +    +E +++E   +  +L S Q+ L EKE  L TL +E
Sbjct:  110 GVVAASTPNISTSMP-ASAVLPAGMMAGDALAFGDHHMASTVPHSLRQARDNTILDLQAQLKEVLRENELLRRDVEVKESKLSSSMNSIKTFWSPELKKERALRKDEASKITVWKEQYRVIQDEAQHLQMTVQALQDELRIQRDLNQLLQQDPASQGRDLALTSEPTEENYRRLHGEHERQAKELFLLRKTLEEMELRIDTQKQTLVARDESIKKLLEMLQ-----SKGPSA------KASEEDQERTRRLADAEMHRHH-----LESLLEQREREVTALREE---LHRRYEGTPEST--------KTKALQTVIDMKDAKINSMERGLRDMEEELLMLKSNGLLS-------CEERQEEMKQMEVYRSHTKFMKNKVRNKECQESNVFQMEQVKQDLSRKDTEMLGLQTKLETLTNQFSDSKQHIEVLKESLTAKEQRAAILQTEVDALRLRLEEKEATLNKKSKQIQEMSEEKGTLNGEIHDLKDMLEVKERKINVLQKKIENLQEQLRDKEKQMSSLKERVKSLQADTSNTDTALTTLEESLSEKERIIERLKEQRDRDDREKTEELECTKKELKELKEKLSLLQGDLSDRETSLLDLKEHASSLASSGLKKDSKLKSMEINLEQKREEC--LKLENQLKRAQNAT-LEAQANTELAERIKNLEREVNRYKEDSVKAQAEVDRLLEILREMENEKNDKDKKISELERQMKDQTKKVASLKHKEQVEKSKNARLMDEARKREDNMSESSLQVKDTLRQKTERIEELEEALRESVQITAERE-MVLAQEEAARSLQEKQMEELLGAMEKVKQELESMRAKLGSTQQSLCEKEAHLTTLRAE 912          
BLAST of Rab6-interacting protein 2/elks/erc/cast,putative vs. Planmine SMEST
Match: SMESG000051528.1 (SMESG000051528.1)

HSP 1 Score: 4408.59 bits (11433), Expect = 0.000e+0
Identity = 2351/2355 (99.83%), Postives = 2353/2355 (99.92%), Query Frame = 3
Query:   30 MDVGQSPIQFIDQPGTNSRTPXXXXXXXXXXXXXQLPSTSSIGALSTRLHQLRPAGSVPFSSRTNPNQISSTIPRQKPIPNALESDLSGYQYNTQTLPLVTQYSTNKSISTQNLSSIGNQYYSYRDRMPLDNQMIITNPINERPRPASARDPGFTDLMDMPTPQQRRLYETLYTPRHSQTNQQKLNAXXXXXXXXXXXDYERDPALMGSLRPQIPLPPPMAQNIYPAPMMGSNPGYDYHFPMIDNVIMDYQTDLFSIQRELAKCQQELELTKEKLTSSVNSIKSFWSPELKRERSMRKDENSKYVLLAEELHQLQMEKKTMLSNVHQXXXXXXXXXXXXNKHSQTAQEIDLLYRRCDELEKENRILTKQSEEYEKRMISQKESLVTAEENIRKLLEVVKVAKSASSGHSALQGLRLERFEEDQTEIERLRSQIHEYSQRTIDLERAIVEKDFDISRNKEQGELLNQEVQNLRQENEHIRQDIQQTQTLQSLVDTKESKILTLENEIRLLEDELARMRDEELITPTTSVNGIDDYEKNMRSTVRPHERLMKSKLEALSCEISKRDSEIYSLQSRLEMAEKQHQDQNHHINVLKEQVKTREHKISMMMADVEDFXXXXXXXXXXXXXXSQILTSSQTEKHQTESEILDLKDQCEMKDKKISLLQRKVQNLEDLLNDKENQLTTAKSKLLNLHTEHSTTEGTKAGLEESLRDRERQLERLKESKTRMEHEFQDELEMQKKLVSETKSRLDNSERELREKVAMLNEMREELSELRAVKFKRESELNTIQVQCSQKTSEVAALQLELQTVRKQYISDTEYKSNHRISELESQINHYSDSATRLQGEVDRLLNMVRNLESEKLEKDRQITQLECQVKEHQNTISNMKRTHQNERNYLNEDIDVLKRKEDNILVDMEVIKTTLTERENRIKELEQALRESLQITAERESYVHNKEDSYRQLELKISDQKQNLEIIQKERNQLSGQLASAQEELREKETQLKTLESECFQNYIPELDRQRKSNQELVLRVQALVKIIQGREFQLSEQERISLTELGLYPDTFAHRGYPSTGRISAGPYSTGYNNYSKVTWSMGSYPISHTSALMGGSVPHINSPGGLGMHRTSAFHSTLGHTDEMTHLGRLLHEKEQMLHQQMEDISRLRLQNSELEAKLKAMEDRITSSSYYSSKLTGGTEFAVLQHQNTELTSKVTYLKNILEEKEDKIKTLSTENRTNFLQMEIERIKREMNSTIADKDTHISILASDLEKVKQEKTEVNNNLIASQLDVKEKTDKIRFMESEQSKMNMDREALQKKYQTALNHLSEKSEKIENLEREIFQKQADEIXXXXXXXXXXSHRLSFMQKSLSDRDGKIEHLEKEHYKLRDEVTALQKQNHNSENEIKRLRDELTYREQRLKQIQNDHSEEINQLRATTMENTSRVSQLRHSLEEKDQXXXXXXXXXXXXXXXXXXXXRRLRDKDNDMARITNDLAEKDTVIKSLERDYNDEVQRHQKANEDASSRINLIQKRVEEREARLRKIEQENNELLDEIHNLRKRNHEIESNLDVMKQQLLEKDECILPTSRSSSVMDMGYNMFNSHTINGTYTSHKEVPVSASINQEIDKLKKQNQDVLNSNLLLQKEVDEASLQNDRLAMDREFLSKQLVELQQKHDLIKKSLQIKEKEFTNRELEFTKLKSEDSNKILMINQEIMKQKNELFKELENRDLQMSELSREVENLQRQLIESENNLQARNIQIKELQNYVDQLIRERDDARLRASSTTGVGSSNFRMNSXXXXXXXXXXIEKLTYDSDRAQKENRDLRNRIQELSRQLQETQTNCDTIVKDRDLLKEQLQNRGKENQIIQLSKEMERLHRAEETHNQQLQELQKNATEAEEELDRVRKECQKKLDASRIEHEKALNQLEKLQLALRDHQEQTXXXXXXXXXXXXXXXXKLKHQCANLSKKLITLQHEYETKERQIQQLTETLDHARKENYELQKAIDEFQNHEQQIEYELSNXXXXXXXXXXXXXXXXAWACQMKDALNNKGMELTNLQQARGKSIDKQQMSLQNHISDLTDQLQMKEKQVDDLTKQLENANQEIREQEYLLQDLTQKLDSIQYDSKFQNVQYNNQTPSKGELDKIKEELASTKRNLLEKDQRIKLLETECFQQQADEIERLRKELKNLSNQDQRIKXXXXXXXXXXXXXXNNDMQSLKIEVDSLKRELNTKNDQIEKFERECQEKHLRRIDGLQLKLKRTEEEFQILERQIEELKRNLDERDKLVKQLKLSQHQATSVXXXXXXXXYSRYQDEVNVKNQQIKTLERQINGQIKEILEIKQEALTASICEKDANIALLQMSGANNTHAQQAMQKLMNE 7094
            MDVGQSPIQFIDQPGTNSRTPNSYYYGNSNNNNNQLPSTSSIGALSTRLHQLRPAGSVPFSSRTNPNQISSTIPRQKPIPNALESDLSGYQYNTQTLPLVTQYSTNKSISTQNLSSIGNQYYSYRDRMPLDNQMIITNPINERPRPASARDPGFTDLMDMPTPQQRRLYETLYTPRHSQTNQQKLNASRFRQQRSSSFDYERDPALMGSLRPQIPLPPPMAQNIYPAPMMGSNPGYDYHFPMIDNVIMDYQTDLFSIQRELAKCQQELELTKEKLTSSVNSIKSFWSPELKRERSMRKDENSKYVLLAEELHQLQMEKKTMLSNVHQLETELRREKELRNKHSQTAQEIDLLYRRCDELEKENRILTKQSEEYEKRMISQKESLVTAEENIRKLLEVVKVAKSASSGHSALQGLRLERFEEDQTEIERLRSQIHEYSQRTIDLERAIVEKDFDISRNKEQGELLNQEVQNLRQENEHIRQDIQQTQTLQSLVDTKESKILTLENEIRLLEDELARMRDEELITPTTSVNGIDDYEKNMRSTVRPHERLMKSKLEALSCEISKRDSEIYSLQSRLEMAEKQHQDQNHHINVLKEQVKTREHKISMMMADVEDFRKRLKEKETLLEKKSQILTSSQTEKHQTESEILDLKDQCEMKDKKISLLQRKVQNLEDLLNDKENQLTTAKSKLLNLHTEHSTTEGTKAGLEESLRDRERQLERLKESKTRMEHEFQDELEMQKKLVSETKSRLDNSERELREKVAMLNEMREELSELRAVKFKRESELNTIQVQCSQKTSEVAALQLELQTVRKQYISDTEYKSNHRISELESQINHYSDSATRLQGEVDRLLNMVRNLESEKLEKDRQITQLECQVKEHQNTISNMKRTHQNERNYLNEDIDVLKRKEDNILVDMEVIKTTLTERENRIKELEQALRESLQITAERESYVHNKEDSYRQLELKISDQKQNLEIIQKERNQLSGQLASAQEELREKETQLKTLESECFQNYIPELDRQRKSNQELVLRVQALVKIIQGREFQLSEQERISLTELGLYPDTFAHRGYPSTGRISAGPYSTGYNNYSKVTWSMGSYPISHTSALMGGSVPHINSPGGLGM RTSAFHSTLGHTDEMTHLGRLLHEKEQMLHQQMEDISRLRLQNSELEAKLKAMEDRITSSSYYSSKLTGGTEFAVLQHQNTELTSKVTYLKNILEEKEDKIKTLSTENRTNFLQMEIERIKREMNSTI DKDTHISILASDLEKVKQEKTEVNNNLIASQLDVKEKTDKIRFMESEQSKMNMDREALQKKYQTALNHLSEKSEKIENLEREIFQKQADEIKKLKLENEENSHRLSFMQKSLSDRDGKIEHLEKEHYKLRDEVTALQKQNHNSENEIKRLRDELTYREQRLKQIQNDHSEEINQLRATTMENTSRVSQLRHSLEEKDQILKSKISEIEKSKGELEISKRRLRDKDNDMARITNDLAEKDTVIKSLERDYNDEVQRHQKANEDASSRINLIQKRVEEREARLRKIEQENNELLDEIHNLRKRNHEIESNLDVMKQQLLEKDECILPTSRSSSVMDMGYNMFNSHTINGTYTSHKEVPVSASINQEIDKLKKQNQD+LNSNLLLQKEVDEASLQNDRLAMDREFLSKQLVELQQKHDLIKKSLQIKEKEFTNRELEFTKLKSEDSNKILMINQEIMKQKNELFKELENRDLQMSELSREVENLQRQLIESENNLQARNIQIKELQNYVDQLIRERDDARLRASSTTGVGSSNFRMNSQENQRQLQQQIEKLTYDSDRAQKENRDLRNRIQELSRQLQETQTNCDTIVKDRDLLKEQLQNRGKENQIIQLSKEMERLHRAEETHNQQLQELQKNATEAEEELDRVRKECQKKLDASRIEHEKALNQLEKLQLALRDHQEQTERREEEISNSQQEESEKLKHQCANLSKKLI+LQHEYETKERQIQQLTETLDHARKENYELQKAIDEFQNHEQQIEYELSNEKREYEKLSEEKKELEAWACQMKDALNNKGMELTNLQQARGKSIDKQQMSLQNHISDLTDQLQMKEKQVDDLTKQLENANQEIREQEYLLQDLTQKLDSIQYDSKFQNVQYNNQTPSKGELDKIKEELASTKRNLLEKDQRIKLLETECFQQQADEIERLRKELKNLSNQDQRIKQSPAQQSPMSPSYSNNDMQSLKIEVDSLKRELNTKNDQIEKFERECQEKHLRRIDGLQLKLKRTEEEFQILERQIEELKRNLDERDKLVKQLKLSQHQATSVELERLREEYSRYQDEVNVKNQQIKTLERQINGQIKEILEIKQEALTASICEKDANIALLQMSGANNTHAQQAMQKLMNE
Sbjct:    1 MDVGQSPIQFIDQPGTNSRTPNSYYYGNSNNNNNQLPSTSSIGALSTRLHQLRPAGSVPFSSRTNPNQISSTIPRQKPIPNALESDLSGYQYNTQTLPLVTQYSTNKSISTQNLSSIGNQYYSYRDRMPLDNQMIITNPINERPRPASARDPGFTDLMDMPTPQQRRLYETLYTPRHSQTNQQKLNASRFRQQRSSSFDYERDPALMGSLRPQIPLPPPMAQNIYPAPMMGSNPGYDYHFPMIDNVIMDYQTDLFSIQRELAKCQQELELTKEKLTSSVNSIKSFWSPELKRERSMRKDENSKYVLLAEELHQLQMEKKTMLSNVHQLETELRREKELRNKHSQTAQEIDLLYRRCDELEKENRILTKQSEEYEKRMISQKESLVTAEENIRKLLEVVKVAKSASSGHSALQGLRLERFEEDQTEIERLRSQIHEYSQRTIDLERAIVEKDFDISRNKEQGELLNQEVQNLRQENEHIRQDIQQTQTLQSLVDTKESKILTLENEIRLLEDELARMRDEELITPTTSVNGIDDYEKNMRSTVRPHERLMKSKLEALSCEISKRDSEIYSLQSRLEMAEKQHQDQNHHINVLKEQVKTREHKISMMMADVEDFRKRLKEKETLLEKKSQILTSSQTEKHQTESEILDLKDQCEMKDKKISLLQRKVQNLEDLLNDKENQLTTAKSKLLNLHTEHSTTEGTKAGLEESLRDRERQLERLKESKTRMEHEFQDELEMQKKLVSETKSRLDNSERELREKVAMLNEMREELSELRAVKFKRESELNTIQVQCSQKTSEVAALQLELQTVRKQYISDTEYKSNHRISELESQINHYSDSATRLQGEVDRLLNMVRNLESEKLEKDRQITQLECQVKEHQNTISNMKRTHQNERNYLNEDIDVLKRKEDNILVDMEVIKTTLTERENRIKELEQALRESLQITAERESYVHNKEDSYRQLELKISDQKQNLEIIQKERNQLSGQLASAQEELREKETQLKTLESECFQNYIPELDRQRKSNQELVLRVQALVKIIQGREFQLSEQERISLTELGLYPDTFAHRGYPSTGRISAGPYSTGYNNYSKVTWSMGSYPISHTSALMGGSVPHINSPGGLGMQRTSAFHSTLGHTDEMTHLGRLLHEKEQMLHQQMEDISRLRLQNSELEAKLKAMEDRITSSSYYSSKLTGGTEFAVLQHQNTELTSKVTYLKNILEEKEDKIKTLSTENRTNFLQMEIERIKREMNSTITDKDTHISILASDLEKVKQEKTEVNNNLIASQLDVKEKTDKIRFMESEQSKMNMDREALQKKYQTALNHLSEKSEKIENLEREIFQKQADEIKKLKLENEENSHRLSFMQKSLSDRDGKIEHLEKEHYKLRDEVTALQKQNHNSENEIKRLRDELTYREQRLKQIQNDHSEEINQLRATTMENTSRVSQLRHSLEEKDQILKSKISEIEKSKGELEISKRRLRDKDNDMARITNDLAEKDTVIKSLERDYNDEVQRHQKANEDASSRINLIQKRVEEREARLRKIEQENNELLDEIHNLRKRNHEIESNLDVMKQQLLEKDECILPTSRSSSVMDMGYNMFNSHTINGTYTSHKEVPVSASINQEIDKLKKQNQDILNSNLLLQKEVDEASLQNDRLAMDREFLSKQLVELQQKHDLIKKSLQIKEKEFTNRELEFTKLKSEDSNKILMINQEIMKQKNELFKELENRDLQMSELSREVENLQRQLIESENNLQARNIQIKELQNYVDQLIRERDDARLRASSTTGVGSSNFRMNSQENQRQLQQQIEKLTYDSDRAQKENRDLRNRIQELSRQLQETQTNCDTIVKDRDLLKEQLQNRGKENQIIQLSKEMERLHRAEETHNQQLQELQKNATEAEEELDRVRKECQKKLDASRIEHEKALNQLEKLQLALRDHQEQTERREEEISNSQQEESEKLKHQCANLSKKLISLQHEYETKERQIQQLTETLDHARKENYELQKAIDEFQNHEQQIEYELSNEKREYEKLSEEKKELEAWACQMKDALNNKGMELTNLQQARGKSIDKQQMSLQNHISDLTDQLQMKEKQVDDLTKQLENANQEIREQEYLLQDLTQKLDSIQYDSKFQNVQYNNQTPSKGELDKIKEELASTKRNLLEKDQRIKLLETECFQQQADEIERLRKELKNLSNQDQRIKQSPAQQSPMSPSYSNNDMQSLKIEVDSLKRELNTKNDQIEKFERECQEKHLRRIDGLQLKLKRTEEEFQILERQIEELKRNLDERDKLVKQLKLSQHQATSVELERLREEYSRYQDEVNVKNQQIKTLERQINGQIKEILEIKQEALTASICEKDANIALLQMSGANNTHAQQAMQKLMNE 2355          
BLAST of Rab6-interacting protein 2/elks/erc/cast,putative vs. Planmine SMEST
Match: SMESG000051528.1 (SMESG000051528.1)

HSP 1 Score: 2489.53 bits (6451), Expect = 0.000e+0
Identity = 1351/1355 (99.70%), Postives = 1353/1355 (99.85%), Query Frame = 3
Query: 3030 FQNYIPELDRQRKSNQELVLRVQALVKIIQGREFQLSEQERISLTELGLYPDTFAHRGYPSTGRISAGPYSTGYNNYSKVTWSMGSYPISHTSALMGGSVPHINSPGGLGMHRTSAFHSTLGHTDEMTHLGRLLHEKEQMLHQQMEDISRLRLQNSELEAKLKAMEDRITSSSYYSSKLTGGTEFAVLQHQNTELTSKVTYLKNILEEKEDKIKTLSTENRTNFLQMEIERIKREMNSTIADKDTHISILASDLEKVKQEKTEVNNNLIASQLDVKEKTDKIRFMESEQSKMNMDREALQKKYQTALNHLSEKSEKIENLEREIFQKQADEIXXXXXXXXXXSHRLSFMQKSLSDRDGKIEHLEKEHYKLRDEVTALQKQNHNSENEIKRLRDELTYREQRLKQIQNDHSEEINQLRATTMENTSRVSQLRHSLEEKDQXXXXXXXXXXXXXXXXXXXXRRLRDKDNDMARITNDLAEKDTVIKSLERDYNDEVQRHQKANEDASSRINLIQKRVEEREARLRKIEQENNELLDEIHNLRKRNHEIESNLDVMKQQLLEKDECILPTSRSSSVMDMGYNMFNSHTINGTYTSHKEVPVSASINQEIDKLKKQNQDVLNSNLLLQKEVDEASLQNDRLAMDREFLSKQLVELQQKHDLIKKSLQIKEKEFTNRELEFTKLKSEDSNKILMINQEIMKQKNELFKELENRDLQMSELSREVENLQRQLIESENNLQARNIQIKELQNYVDQLIRERDDARLRASSTTGVGSSNFRMNSXXXXXXXXXXIEKLTYDSDRAQKENRDLRNRIQELSRQLQETQTNCDTIVKDRDLLKEQLQNRGKENQIIQLSKEMERLHRAEETHNQQLQELQKNATEAEEELDRVRKECQKKLDASRIEHEKALNQLEKLQLALRDHQEQTXXXXXXXXXXXXXXXXKLKHQCANLSKKLITLQHEYETKERQIQQLTETLDHARKENYELQKAIDEFQNHEQQIEYELSNXXXXXXXXXXXXXXXXAWACQMKDALNNKGMELTNLQQARGKSIDKQQMSLQNHISDLTDQLQMKEKQVDDLTKQLENANQEIREQEYLLQDLTQKLDSIQYDSKFQNVQYNNQTPSKGELDKIKEELASTKRNLLEKDQRIKLLETECFQQQADEIERLRKELKNLSNQDQRIKXXXXXXXXXXXXXXNNDMQSLKIEVDSLKRELNTKNDQIEKFERECQEKHLRRIDGLQLKLKRTEEEFQILERQIEELKRNLDERDKLVKQLKLSQHQATSVXXXXXXXXYSRYQDEVNVKNQQIKTLERQINGQIKEILEIKQEALTASICEKDANIALLQMSGANNTHAQQAMQKLMNE 7094
            FQNYIPELDRQRKSNQELVLRVQALVKIIQGREFQLSEQERISLTELGLYPDTFAHRGYPSTGRISAGPYSTGYNNYSKVTWSMGSYPISHTSALMGGSVPHINSPGGLGM RTSAFHSTLGHTDEMTHLGRLLHEKEQMLHQQMEDISRLRLQNSELEAKLKAMEDRITSSSYYSSKLTGGTEFAVLQHQNTELTSKVTYLKNILEEKEDKIKTLSTENRTNFLQMEIERIKREMNSTI DKDTHISILASDLEKVKQEKTEVNNNLIASQLDVKEKTDKIRFMESEQSKMNMDREALQKKYQTALNHLSEKSEKIENLEREIFQKQADEIKKLKLENEENSHRLSFMQKSLSDRDGKIEHLEKEHYKLRDEVTALQKQNHNSENEIKRLRDELTYREQRLKQIQNDHSEEINQLRATTMENTSRVSQLRHSLEEKDQILKSKISEIEKSKGELEISKRRLRDKDNDMARITNDLAEKDTVIKSLERDYNDEVQRHQKANEDASSRINLIQKRVEEREARLRKIEQENNELLDEIHNLRKRNHEIESNLDVMKQQLLEKDECILPTSRSSSVMDMGYNMFNSHTINGTYTSHKEVPVSASINQEIDKLKKQNQD+LNSNLLLQKEVDEASLQNDRLAMDREFLSKQLVELQQKHDLIKKSLQIKEKEFTNRELEFTKLKSEDSNKILMINQEIMKQKNELFKELENRDLQMSELSREVENLQRQLIESENNLQARNIQIKELQNYVDQLIRERDDARLRASSTTGVGSSNFRMNSQENQRQLQQQIEKLTYDSDRAQKENRDLRNRIQELSRQLQETQTNCDTIVKDRDLLKEQLQNRGKENQIIQLSKEMERLHRAEETHNQQLQELQKNATEAEEELDRVRKECQKKLDASRIEHEKALNQLEKLQLALRDHQEQTERREEEISNSQQEESEKLKHQCANLSKKLI+LQHEYETKERQIQQLTETLDHARKENYELQKAIDEFQNHEQQIEYELSNEKREYEKLSEEKKELEAWACQMKDALNNKGMELTNLQQARGKSIDKQQMSLQNHISDLTDQLQMKEKQVDDLTKQLENANQEIREQEYLLQDLTQKLDSIQYDSKFQNVQYNNQTPSKGELDKIKEELASTKRNLLEKDQRIKLLETECFQQQADEIERLRKELKNLSNQDQRIKQSPAQQSPMSPSYSNNDMQSLKIEVDSLKRELNTKNDQIEKFERECQEKHLRRIDGLQLKLKRTEEEFQILERQIEELKRNLDERDKLVKQLKLSQHQATSVELERLREEYSRYQDEVNVKNQQIKTLERQINGQIKEILEIKQEALTASICEKDANIALLQMSGANNTHAQQAMQKLMNE
Sbjct:    3 FQNYIPELDRQRKSNQELVLRVQALVKIIQGREFQLSEQERISLTELGLYPDTFAHRGYPSTGRISAGPYSTGYNNYSKVTWSMGSYPISHTSALMGGSVPHINSPGGLGMQRTSAFHSTLGHTDEMTHLGRLLHEKEQMLHQQMEDISRLRLQNSELEAKLKAMEDRITSSSYYSSKLTGGTEFAVLQHQNTELTSKVTYLKNILEEKEDKIKTLSTENRTNFLQMEIERIKREMNSTITDKDTHISILASDLEKVKQEKTEVNNNLIASQLDVKEKTDKIRFMESEQSKMNMDREALQKKYQTALNHLSEKSEKIENLEREIFQKQADEIKKLKLENEENSHRLSFMQKSLSDRDGKIEHLEKEHYKLRDEVTALQKQNHNSENEIKRLRDELTYREQRLKQIQNDHSEEINQLRATTMENTSRVSQLRHSLEEKDQILKSKISEIEKSKGELEISKRRLRDKDNDMARITNDLAEKDTVIKSLERDYNDEVQRHQKANEDASSRINLIQKRVEEREARLRKIEQENNELLDEIHNLRKRNHEIESNLDVMKQQLLEKDECILPTSRSSSVMDMGYNMFNSHTINGTYTSHKEVPVSASINQEIDKLKKQNQDILNSNLLLQKEVDEASLQNDRLAMDREFLSKQLVELQQKHDLIKKSLQIKEKEFTNRELEFTKLKSEDSNKILMINQEIMKQKNELFKELENRDLQMSELSREVENLQRQLIESENNLQARNIQIKELQNYVDQLIRERDDARLRASSTTGVGSSNFRMNSQENQRQLQQQIEKLTYDSDRAQKENRDLRNRIQELSRQLQETQTNCDTIVKDRDLLKEQLQNRGKENQIIQLSKEMERLHRAEETHNQQLQELQKNATEAEEELDRVRKECQKKLDASRIEHEKALNQLEKLQLALRDHQEQTERREEEISNSQQEESEKLKHQCANLSKKLISLQHEYETKERQIQQLTETLDHARKENYELQKAIDEFQNHEQQIEYELSNEKREYEKLSEEKKELEAWACQMKDALNNKGMELTNLQQARGKSIDKQQMSLQNHISDLTDQLQMKEKQVDDLTKQLENANQEIREQEYLLQDLTQKLDSIQYDSKFQNVQYNNQTPSKGELDKIKEELASTKRNLLEKDQRIKLLETECFQQQADEIERLRKELKNLSNQDQRIKQSPAQQSPMSPSYSNNDMQSLKIEVDSLKRELNTKNDQIEKFERECQEKHLRRIDGLQLKLKRTEEEFQILERQIEELKRNLDERDKLVKQLKLSQHQATSVELERLREEYSRYQDEVNVKNQQIKTLERQINGQIKEILEIKQEALTASICEKDANIALLQMSGANNTHAQQAMQKLMNE 1357          
The following BLAST results are available for this feature:
BLAST of Rab6-interacting protein 2/elks/erc/cast,putative vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ERC11.564e-8030.42ELKS/RAB6-interacting/CAST family member 1 [Source... [more]
ERC11.564e-8030.42ELKS/RAB6-interacting/CAST family member 1 [Source... [more]
ERC12.642e-7930.29ELKS/RAB6-interacting/CAST family member 1 [Source... [more]
ERC11.092e-7629.70ELKS/RAB6-interacting/CAST family member 1 [Source... [more]
ERC11.930e-7629.70ELKS/RAB6-interacting/CAST family member 1 [Source... [more]
back to top
BLAST of Rab6-interacting protein 2/elks/erc/cast,putative vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
elks-11.929e-824.52Mammalian ELKS/CAST/ERC/Rab6 interacting protein h... [more]
back to top
BLAST of Rab6-interacting protein 2/elks/erc/cast,putative vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
brp1.279e-3040.20gene:FBgn0259246 transcript:FBtr0305060[more]
brp1.063e-2940.30gene:FBgn0259246 transcript:FBtr0300245[more]
brp1.101e-2940.30gene:FBgn0259246 transcript:FBtr0336693[more]
brp1.350e-2940.30gene:FBgn0259246 transcript:FBtr0300542[more]
brp1.350e-2940.30gene:FBgn0259246 transcript:FBtr0299916[more]
back to top
BLAST of Rab6-interacting protein 2/elks/erc/cast,putative vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ERC13.718e-8532.20si:dkey-222l13.1 [Source:ZFIN;Acc:ZDB-GENE-110411-... [more]
erc1a6.467e-6731.41ELKS/RAB6-interacting/CAST family member 1a [Sourc... [more]
erc1a6.467e-6731.41ELKS/RAB6-interacting/CAST family member 1a [Sourc... [more]
erc1a1.394e-6631.41ELKS/RAB6-interacting/CAST family member 1a [Sourc... [more]
erc1a2.912e-6531.24ELKS/RAB6-interacting/CAST family member 1a [Sourc... [more]
back to top
BLAST of Rab6-interacting protein 2/elks/erc/cast,putative vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
erc18.206e-7632.51ELKS/RAB6-interacting/CAST family member 1 [Source... [more]
erc16.383e-7230.85ELKS/RAB6-interacting/CAST family member 1 [Source... [more]
erc12.826e-7131.51ELKS/RAB6-interacting/CAST family member 1 [Source... [more]
erc12.965e-7131.51ELKS/RAB6-interacting/CAST family member 1 [Source... [more]
erc13.974e-6830.73ELKS/RAB6-interacting/CAST family member 1 [Source... [more]
back to top
BLAST of Rab6-interacting protein 2/elks/erc/cast,putative vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Erc14.954e-8230.55ELKS/RAB6-interacting/CAST family member 1 [Source... [more]
Erc15.907e-8130.41ELKS/RAB6-interacting/CAST family member 1 [Source... [more]
Erc17.850e-7829.82ELKS/RAB6-interacting/CAST family member 1 [Source... [more]
Erc12.916e-7629.69ELKS/RAB6-interacting/CAST family member 1 [Source... [more]
Erc12.916e-7629.69ELKS/RAB6-interacting/CAST family member 1 [Source... [more]
back to top
BLAST of Rab6-interacting protein 2/elks/erc/cast,putative vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8IUD2|RB6I2_HUMAN9.268e-7629.70ELKS/Rab6-interacting/CAST family member 1 OS=Homo... [more]
sp|Q99MI1|RB6I2_MOUSE1.503e-7529.69ELKS/Rab6-interacting/CAST family member 1 OS=Mus ... [more]
sp|Q811U3|RB6I2_RAT1.713e-6429.39ELKS/Rab6-interacting/CAST family member 1 OS=Ratt... [more]
sp|O15083|ERC2_HUMAN8.120e-6429.92ERC protein 2 OS=Homo sapiens OX=9606 GN=ERC2 PE=1... [more]
sp|Q6PH08|ERC2_MOUSE2.116e-6229.39ERC protein 2 OS=Mus musculus OX=10090 GN=Erc2 PE=... [more]
back to top
BLAST of Rab6-interacting protein 2/elks/erc/cast,putative vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K4FCC90.000e+035.35Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A068WH310.000e+035.12ELKS:Rab6 interacting:CAST family OS=Echinococcus ... [more]
A0A4E0S0A40.000e+035.30ERC protein 2 OS=Fasciola hepatica OX=6192 GN=D915... [more]
A0A068YBM40.000e+034.92ELKS:Rab6 interacting:CAST family OS=Echinococcus ... [more]
A0A504XBC40.000e+035.48ELKS/Rab6-interacting/CAST family member 1 OS=Fasc... [more]
back to top
BLAST of Rab6-interacting protein 2/elks/erc/cast,putative vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-222l13.11.476e-7530.71ELKS/Rab6-interacting/CAST family member 1-like [S... [more]
si:dkey-222l13.14.246e-7530.66ELKS/Rab6-interacting/CAST family member 1-like [S... [more]
si:dkey-222l13.19.607e-7430.48ELKS/Rab6-interacting/CAST family member 1-like [S... [more]
si:dkey-222l13.18.095e-7229.97ELKS/Rab6-interacting/CAST family member 1-like [S... [more]
si:dkey-222l13.15.199e-7129.97ELKS/Rab6-interacting/CAST family member 1-like [S... [more]
back to top
BLAST of Rab6-interacting protein 2/elks/erc/cast,putative vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000006462.15.439e-2826.50pep scaffold:Pmarinus_7.0:GL476828:28653:154462:-1... [more]
back to top
BLAST of Rab6-interacting protein 2/elks/erc/cast,putative vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Rab6-interacting protein 2/elks/erc/cast,putative vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Rab6-interacting protein 2/elks/erc/cast,putative vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
erc1a1.730e-8232.69ELKS/RAB6-interacting/CAST family member 1 [Source... [more]
erc1a8.172e-8232.97ELKS/RAB6-interacting/CAST family member 1 [Source... [more]
erc1a2.058e-8132.57ELKS/RAB6-interacting/CAST family member 1 [Source... [more]
erc1a4.864e-8132.53ELKS/RAB6-interacting/CAST family member 1 [Source... [more]
erc1a6.594e-8032.19ELKS/RAB6-interacting/CAST family member 1 [Source... [more]
back to top
BLAST of Rab6-interacting protein 2/elks/erc/cast,putative vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000051528.10.000e+099.83SMESG000051528.1[more]
SMESG000051528.10.000e+099.70SMESG000051528.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019373 ID=SMED30019373|Name=Rab6-interacting protein 2/elks/erc/cast,putative|organism=Schmidtea mediterranea sexual|type=transcript|length=7245bp
GATTTTTAAACGTATATTAAATTCTACAAATGGATGTTGGTCAGAGTCCA
ATTCAATTTATTGATCAACCAGGAACTAATTCTCGAACTCCTAATTCATA
TTATTATGGCAATTCGAATAACAACAACAATCAGCTGCCGTCGACTTCAT
CCATAGGAGCATTGTCGACTCGGCTTCACCAATTGCGACCAGCTGGAAGT
GTGCCGTTTAGTTCTCGAACGAATCCAAATCAAATTTCTTCAACAATTCC
TCGACAAAAACCAATCCCGAATGCTCTTGAAAGTGACCTTTCAGGATATC
AATACAACACACAGACGTTGCCATTGGTGACCCAATATTCGACCAATAAA
TCTATTAGCACACAAAATCTGAGCTCGATTGGCAACCAATATTACTCATA
TCGAGATCGAATGCCACTGGATAATCAGATGATTATTACTAACCCAATCA
ACGAAAGACCTCGACCGGCCAGTGCTAGAGATCCAGGATTTACCGACCTC
ATGGATATGCCTACTCCACAACAACGTCGACTCTATGAAACCCTTTATAC
CCCAAGGCACTCACAAACCAATCAACAAAAACTCAACGCCTCTAGATTTC
GACAACAAAGATCATCATCGTTTGACTATGAACGTGATCCCGCATTAATG
GGATCACTCAGACCTCAAATACCTTTGCCACCTCCTATGGCACAAAACAT
CTATCCCGCTCCTATGATGGGCTCCAATCCTGGTTACGACTACCACTTTC
CCATGATTGACAATGTTATTATGGATTATCAAACTGATTTATTTTCCATT
CAACGAGAACTGGCAAAATGCCAACAAGAGTTGGAATTGACAAAAGAAAA
ACTGACCTCTTCGGTTAACTCTATCAAATCTTTTTGGAGTCCAGAATTGA
AAAGAGAACGAAGCATGAGAAAAGATGAAAATTCTAAATACGTTTTATTA
GCAGAAGAATTGCACCAACTTCAAATGGAAAAAAAGACAATGCTATCAAA
TGTCCATCAATTGGAAACTGAATTGCGGAGAGAAAAAGAGTTACGAAATA
AACACAGTCAAACTGCTCAAGAGATTGACTTACTTTATAGGCGCTGCGAC
GAGTTGGAAAAAGAAAACCGAATTCTCACAAAACAAAGCGAAGAATATGA
GAAACGAATGATATCTCAAAAAGAAAGCCTTGTCACAGCTGAGGAGAATA
TACGTAAACTATTAGAAGTTGTTAAAGTTGCCAAATCAGCATCATCTGGA
CATAGCGCCTTACAAGGTCTACGGTTGGAAAGGTTTGAGGAAGACCAGAC
AGAAATTGAAAGGTTGAGATCCCAAATTCATGAATACTCACAGCGAACCA
TCGACTTAGAAAGAGCAATTGTTGAAAAAGATTTCGATATTTCCAGAAAT
AAAGAACAAGGAGAACTGTTAAACCAAGAAGTTCAAAATCTTCGTCAAGA
AAATGAACACATTCGACAAGACATTCAACAAACTCAAACTCTTCAATCTT
TAGTTGATACAAAAGAATCAAAAATCCTTACCCTTGAAAACGAGATCCGC
TTACTTGAAGACGAGTTAGCCCGAATGCGAGACGAAGAGCTCATTACGCC
AACAACATCAGTGAATGGAATTGATGATTATGAAAAGAACATGAGATCGA
CTGTCAGACCCCACGAAAGACTGATGAAATCAAAGCTAGAAGCATTGAGC
TGTGAAATATCGAAACGAGATTCAGAAATCTATTCTCTCCAGTCGAGATT
GGAAATGGCTGAGAAACAACATCAAGATCAAAACCATCACATAAATGTGT
TGAAAGAACAAGTAAAAACACGAGAGCACAAAATATCAATGATGATGGCG
GACGTTGAAGATTTTCGTAAGAGATTAAAAGAAAAAGAAACTCTTTTAGA
AAAGAAAAGTCAAATCCTAACCAGCAGTCAGACAGAGAAACATCAAACCG
AATCAGAAATACTGGATTTGAAAGATCAGTGCGAAATGAAAGATAAAAAA
ATATCTCTGCTTCAAAGAAAAGTTCAAAATTTAGAAGATCTTTTAAATGA
TAAAGAAAATCAGCTCACAACTGCAAAATCCAAATTACTCAATTTGCATA
CTGAACATTCAACAACAGAAGGAACAAAAGCCGGACTTGAAGAAAGCCTC
AGAGATAGAGAAAGACAATTAGAAAGATTAAAAGAATCAAAAACCCGAAT
GGAACACGAGTTTCAGGATGAACTAGAAATGCAGAAAAAACTGGTGTCAG
AAACAAAGAGTCGATTAGATAATTCGGAGCGGGAACTGCGAGAAAAAGTT
GCAATGTTGAATGAGATGAGAGAGGAGTTGTCTGAGCTTAGAGCCGTTAA
ATTCAAACGAGAATCTGAATTAAATACCATTCAAGTTCAATGCAGTCAGA
AAACCTCGGAGGTAGCCGCCTTACAGTTGGAGTTGCAAACAGTCAGAAAG
CAATATATCAGCGATACTGAATATAAATCCAATCATAGAATTTCAGAATT
GGAATCTCAGATTAACCATTATTCCGATTCTGCCACGAGATTGCAAGGAG
AAGTTGACAGATTGCTAAATATGGTGAGAAACCTGGAAAGTGAAAAATTG
GAAAAAGATCGCCAAATTACTCAGCTTGAATGCCAGGTGAAAGAGCATCA
AAACACCATCAGCAACATGAAGCGCACTCATCAAAATGAAAGAAACTATC
TTAATGAAGACATTGATGTTCTGAAAAGAAAAGAAGACAACATTTTAGTC
GACATGGAAGTTATCAAAACCACTTTAACAGAAAGAGAAAATCGAATCAA
GGAACTTGAACAAGCTCTCAGAGAAAGCCTTCAAATAACTGCTGAACGAG
AAAGTTACGTACACAATAAAGAGGATTCATATAGACAATTAGAATTAAAA
ATCAGTGATCAAAAGCAGAATTTAGAAATAATCCAGAAAGAGAGGAACCA
ACTGAGTGGGCAATTGGCATCCGCTCAAGAAGAACTTCGAGAAAAGGAAA
CACAGCTGAAAACTCTTGAGAGTGAATGTTTTCAGAATTACATTCCTGAA
CTAGACAGACAACGCAAATCAAATCAAGAACTAGTACTTCGAGTCCAAGC
TCTAGTAAAAATAATCCAGGGAAGAGAATTTCAACTGAGTGAGCAAGAGA
GGATTTCGCTCACAGAACTAGGATTGTATCCAGACACCTTTGCTCATAGA
GGATATCCATCGACAGGAAGAATATCGGCTGGACCATATTCAACTGGTTA
TAATAATTACAGTAAAGTCACTTGGAGTATGGGATCTTACCCAATCAGCC
ATACGTCAGCATTGATGGGAGGAAGTGTTCCACATATAAATTCTCCCGGT
GGGCTTGGTATGCACCGAACAAGTGCATTTCACAGTACTCTAGGACACAC
AGATGAAATGACACATTTAGGCCGTCTGCTTCATGAAAAAGAACAAATGT
TGCATCAGCAAATGGAAGACATCAGCCGGTTACGACTGCAAAACAGCGAA
CTTGAAGCGAAATTAAAAGCTATGGAAGACAGAATAACAAGCAGCTCGTA
TTATTCTTCAAAGTTGACAGGCGGGACGGAATTCGCGGTGTTGCAGCATC
AAAACACAGAACTGACGAGCAAAGTAACTTATTTGAAAAATATTTTGGAG
GAAAAGGAAGATAAAATTAAAACTTTAAGCACTGAAAATAGGACAAACTT
TTTACAGATGGAAATTGAAAGAATTAAAAGAGAAATGAATTCAACAATCG
CAGATAAAGATACTCATATATCAATACTGGCAAGCGATCTAGAAAAAGTG
AAACAAGAGAAAACGGAAGTGAACAATAATCTGATTGCGTCCCAGCTGGA
TGTGAAAGAAAAAACCGATAAAATCAGATTTATGGAATCCGAACAGTCTA
AAATGAACATGGATCGTGAAGCATTACAAAAGAAATATCAAACTGCCCTT
AATCATTTGTCGGAAAAATCAGAAAAAATAGAAAATTTAGAGCGAGAGAT
ATTTCAAAAACAAGCAGATGAGATAAAGAAATTAAAATTGGAAAATGAAG
AAAATAGTCACAGATTATCTTTCATGCAAAAATCCCTGTCAGACCGCGAC
GGCAAAATTGAACACTTAGAAAAGGAGCATTATAAACTGCGTGATGAAGT
GACAGCTTTACAGAAGCAAAATCACAACTCGGAAAACGAAATCAAACGTC
TCCGAGACGAGTTGACGTACCGAGAACAGAGACTGAAACAAATACAAAAT
GATCATTCGGAAGAAATAAATCAACTGAGAGCTACGACAATGGAAAATAC
TTCTCGTGTTTCTCAATTACGACACAGTTTAGAAGAAAAAGATCAAATAT
TGAAATCTAAAATCTCAGAAATCGAAAAGTCGAAAGGTGAATTGGAAATT
AGCAAGCGACGACTCAGAGATAAAGATAATGACATGGCAAGAATAACCAA
CGATTTGGCTGAAAAAGACACAGTTATTAAATCTTTAGAGAGAGATTACA
ATGACGAAGTTCAGAGACATCAAAAAGCCAATGAAGATGCGAGCTCTCGA
ATTAATTTGATTCAAAAACGAGTCGAAGAAAGAGAAGCACGATTGAGAAA
AATCGAACAAGAAAATAATGAGCTTTTGGATGAAATTCATAATCTTCGAA
AACGAAATCATGAAATCGAGAGCAATTTAGATGTAATGAAGCAACAACTT
TTAGAAAAAGACGAATGTATTTTACCCACCAGTCGCAGTAGCAGCGTTAT
GGATATGGGATATAATATGTTCAATTCACACACTATCAATGGAACTTACA
CGTCCCATAAAGAAGTTCCTGTTTCTGCTAGCATCAATCAGGAAATTGAT
AAGTTAAAAAAGCAAAATCAGGACGTCCTAAATTCGAATCTTTTGTTACA
AAAAGAAGTTGATGAAGCCTCACTTCAGAATGATCGTCTTGCTATGGATC
GGGAGTTCCTGTCAAAGCAATTGGTAGAACTGCAGCAGAAACATGATCTC
ATTAAGAAATCGTTGCAGATCAAGGAAAAAGAATTTACAAACAGAGAATT
GGAATTTACTAAATTAAAATCAGAAGATTCAAACAAAATTTTAATGATAA
ACCAAGAGATTATGAAACAAAAAAATGAACTATTTAAAGAACTTGAAAAT
CGAGATTTGCAGATGTCAGAATTATCCCGAGAAGTGGAAAATTTGCAGCG
ACAGCTTATAGAATCCGAAAACAATTTACAAGCTCGGAATATACAGATCA
AAGAACTCCAGAATTATGTTGACCAGCTCATTAGAGAGCGGGATGATGCA
AGATTAAGGGCTTCATCGACAACAGGAGTTGGTAGCTCAAATTTTAGGAT
GAATTCACAAGAAAATCAGAGACAACTCCAGCAACAAATTGAAAAGCTCA
CTTATGATTCGGATCGTGCTCAAAAAGAAAATCGTGATCTAAGAAATCGT
ATTCAAGAATTGAGTAGACAGTTGCAAGAAACACAAACTAATTGTGATAC
AATTGTCAAAGATCGAGATTTATTAAAAGAACAGCTGCAAAACAGAGGTA
AAGAGAATCAGATAATTCAGCTTTCAAAAGAAATGGAAAGACTTCATCGA
GCTGAAGAAACTCATAATCAACAGTTGCAAGAATTACAGAAAAATGCCAC
AGAAGCCGAAGAGGAATTGGATCGAGTTCGTAAAGAATGTCAGAAAAAGC
TAGATGCCAGTCGAATTGAGCATGAAAAAGCTCTTAACCAATTGGAGAAG
TTGCAGTTGGCATTGCGTGATCATCAAGAGCAAACGGAACGCAGAGAAGA
AGAAATATCAAATTCGCAACAAGAGGAAAGTGAAAAGTTAAAGCATCAAT
GTGCAAATCTATCGAAAAAGTTAATCACTCTCCAGCACGAATACGAAACA
AAAGAGAGACAGATTCAACAGCTCACAGAAACCTTGGACCATGCCAGAAA
GGAGAATTATGAATTGCAGAAGGCTATTGATGAATTTCAAAATCACGAAC
AACAAATAGAATATGAATTGTCGAATGAGAAAAGAGAATATGAAAAGTTA
TCCGAAGAAAAGAAAGAACTAGAAGCTTGGGCGTGCCAAATGAAGGATGC
ACTTAATAACAAAGGAATGGAATTGACAAATTTACAACAAGCCAGAGGAA
AGTCAATAGATAAGCAACAGATGAGCTTGCAGAATCACATTTCTGATTTG
ACTGACCAGTTACAGATGAAGGAAAAGCAAGTCGATGATCTCACAAAGCA
ACTGGAAAATGCAAACCAAGAAATCCGGGAACAAGAATATTTACTGCAAG
ACCTCACGCAGAAATTGGACTCAATTCAATACGACAGCAAGTTTCAGAAT
GTCCAATACAATAATCAGACTCCAAGCAAAGGAGAACTTGATAAGATAAA
AGAAGAGCTTGCCAGTACTAAAAGAAATCTCTTAGAAAAAGATCAGAGAA
TAAAATTACTTGAAACAGAATGTTTTCAACAGCAAGCCGATGAGATTGAA
AGACTACGTAAAGAACTAAAAAACCTATCAAATCAAGATCAAAGAATAAA
ACAGTCTCCAGCACAACAATCACCAATGTCGCCGTCATATTCTAATAACG
ATATGCAGTCTTTGAAAATCGAGGTTGACAGTCTTAAACGGGAACTCAAT
ACGAAGAACGATCAAATTGAAAAATTCGAAAGAGAATGTCAAGAAAAACA
TTTGAGAAGAATTGATGGATTGCAGTTGAAACTAAAACGAACGGAAGAAG
AATTTCAAATACTTGAACGACAAATAGAGGAACTCAAGAGAAATCTCGAT
GAAAGAGACAAACTAGTTAAGCAGTTAAAACTTTCTCAGCATCAAGCTAC
GAGTGTTGAGTTAGAAAGGCTCAGAGAAGAATATTCACGCTATCAAGACG
AAGTTAATGTCAAAAACCAACAAATCAAAACATTAGAAAGACAAATCAAT
GGACAAATTAAGGAGATTTTAGAAATCAAACAAGAAGCTCTTACCGCTTC
AATTTGTGAAAAGGACGCTAACATCGCATTATTACAAATGTCTGGTGCCA
ATAATACCCATGCCCAACAAGCAATGCAGAAACTGATGAACGAAAAATCC
CAACTCCAATCACAATTAAAACAACTGTCATCAACTCGTCAGAAACTCCA
AGAGGAGCAAAATAAATGATAAAAATGAATGTATTATATGAGCTGCAATT
CTTATTCTTATTTATTTATTGTTATTATTATTTATTATTATTATT
back to top

protein sequence of SMED30019373-orf-1

>SMED30019373-orf-1 ID=SMED30019373-orf-1|Name=SMED30019373-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2380bp
MDVGQSPIQFIDQPGTNSRTPNSYYYGNSNNNNNQLPSTSSIGALSTRLH
QLRPAGSVPFSSRTNPNQISSTIPRQKPIPNALESDLSGYQYNTQTLPLV
TQYSTNKSISTQNLSSIGNQYYSYRDRMPLDNQMIITNPINERPRPASAR
DPGFTDLMDMPTPQQRRLYETLYTPRHSQTNQQKLNASRFRQQRSSSFDY
ERDPALMGSLRPQIPLPPPMAQNIYPAPMMGSNPGYDYHFPMIDNVIMDY
QTDLFSIQRELAKCQQELELTKEKLTSSVNSIKSFWSPELKRERSMRKDE
NSKYVLLAEELHQLQMEKKTMLSNVHQLETELRREKELRNKHSQTAQEID
LLYRRCDELEKENRILTKQSEEYEKRMISQKESLVTAEENIRKLLEVVKV
AKSASSGHSALQGLRLERFEEDQTEIERLRSQIHEYSQRTIDLERAIVEK
DFDISRNKEQGELLNQEVQNLRQENEHIRQDIQQTQTLQSLVDTKESKIL
TLENEIRLLEDELARMRDEELITPTTSVNGIDDYEKNMRSTVRPHERLMK
SKLEALSCEISKRDSEIYSLQSRLEMAEKQHQDQNHHINVLKEQVKTREH
KISMMMADVEDFRKRLKEKETLLEKKSQILTSSQTEKHQTESEILDLKDQ
CEMKDKKISLLQRKVQNLEDLLNDKENQLTTAKSKLLNLHTEHSTTEGTK
AGLEESLRDRERQLERLKESKTRMEHEFQDELEMQKKLVSETKSRLDNSE
RELREKVAMLNEMREELSELRAVKFKRESELNTIQVQCSQKTSEVAALQL
ELQTVRKQYISDTEYKSNHRISELESQINHYSDSATRLQGEVDRLLNMVR
NLESEKLEKDRQITQLECQVKEHQNTISNMKRTHQNERNYLNEDIDVLKR
KEDNILVDMEVIKTTLTERENRIKELEQALRESLQITAERESYVHNKEDS
YRQLELKISDQKQNLEIIQKERNQLSGQLASAQEELREKETQLKTLESEC
FQNYIPELDRQRKSNQELVLRVQALVKIIQGREFQLSEQERISLTELGLY
PDTFAHRGYPSTGRISAGPYSTGYNNYSKVTWSMGSYPISHTSALMGGSV
PHINSPGGLGMHRTSAFHSTLGHTDEMTHLGRLLHEKEQMLHQQMEDISR
LRLQNSELEAKLKAMEDRITSSSYYSSKLTGGTEFAVLQHQNTELTSKVT
YLKNILEEKEDKIKTLSTENRTNFLQMEIERIKREMNSTIADKDTHISIL
ASDLEKVKQEKTEVNNNLIASQLDVKEKTDKIRFMESEQSKMNMDREALQ
KKYQTALNHLSEKSEKIENLEREIFQKQADEIKKLKLENEENSHRLSFMQ
KSLSDRDGKIEHLEKEHYKLRDEVTALQKQNHNSENEIKRLRDELTYREQ
RLKQIQNDHSEEINQLRATTMENTSRVSQLRHSLEEKDQILKSKISEIEK
SKGELEISKRRLRDKDNDMARITNDLAEKDTVIKSLERDYNDEVQRHQKA
NEDASSRINLIQKRVEEREARLRKIEQENNELLDEIHNLRKRNHEIESNL
DVMKQQLLEKDECILPTSRSSSVMDMGYNMFNSHTINGTYTSHKEVPVSA
SINQEIDKLKKQNQDVLNSNLLLQKEVDEASLQNDRLAMDREFLSKQLVE
LQQKHDLIKKSLQIKEKEFTNRELEFTKLKSEDSNKILMINQEIMKQKNE
LFKELENRDLQMSELSREVENLQRQLIESENNLQARNIQIKELQNYVDQL
IRERDDARLRASSTTGVGSSNFRMNSQENQRQLQQQIEKLTYDSDRAQKE
NRDLRNRIQELSRQLQETQTNCDTIVKDRDLLKEQLQNRGKENQIIQLSK
EMERLHRAEETHNQQLQELQKNATEAEEELDRVRKECQKKLDASRIEHEK
ALNQLEKLQLALRDHQEQTERREEEISNSQQEESEKLKHQCANLSKKLIT
LQHEYETKERQIQQLTETLDHARKENYELQKAIDEFQNHEQQIEYELSNE
KREYEKLSEEKKELEAWACQMKDALNNKGMELTNLQQARGKSIDKQQMSL
QNHISDLTDQLQMKEKQVDDLTKQLENANQEIREQEYLLQDLTQKLDSIQ
YDSKFQNVQYNNQTPSKGELDKIKEELASTKRNLLEKDQRIKLLETECFQ
QQADEIERLRKELKNLSNQDQRIKQSPAQQSPMSPSYSNNDMQSLKIEVD
SLKRELNTKNDQIEKFERECQEKHLRRIDGLQLKLKRTEEEFQILERQIE
ELKRNLDERDKLVKQLKLSQHQATSVELERLREEYSRYQDEVNVKNQQIK
TLERQINGQIKEILEIKQEALTASICEKDANIALLQMSGANNTHAQQAMQ
KLMNEKSQLQSQLKQLSSTRQKLQEEQNK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
PLANA:0000463cholinergic neuron
PLANA:0000464GABAergic neuron
Vocabulary: INTERPRO
TermDefinition
IPR019323ELKS/CAST
Vocabulary: cellular component
TermDefinition
GO:0048786presynaptic active zone
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 65..85
NoneNo IPR availableCOILSCoilCoilcoord: 1469..1546
NoneNo IPR availableCOILSCoilCoilcoord: 186..213
NoneNo IPR availableCOILSCoilCoilcoord: 9..50
NoneNo IPR availableCOILSCoilCoilcoord: 221..276
NoneNo IPR availableCOILSCoilCoilcoord: 911..945
NoneNo IPR availableCOILSCoilCoilcoord: 1115..1304
NoneNo IPR availableCOILSCoilCoilcoord: 411..445
NoneNo IPR availableCOILSCoilCoilcoord: 98..178
NoneNo IPR availableCOILSCoilCoilcoord: 746..833
NoneNo IPR availableCOILSCoilCoilcoord: 524..544
NoneNo IPR availableCOILSCoilCoilcoord: 637..685
NoneNo IPR availableCOILSCoilCoilcoord: 975..1037
NoneNo IPR availableCOILSCoilCoilcoord: 1397..1453
NoneNo IPR availableCOILSCoilCoilcoord: 573..607
NoneNo IPR availableCOILSCoilCoilcoord: 1619..1656
NoneNo IPR availableCOILSCoilCoilcoord: 1050..1105
NoneNo IPR availableCOILSCoilCoilcoord: 1548..1596
NoneNo IPR availableCOILSCoilCoilcoord: 876..903
NoneNo IPR availableCOILSCoilCoilcoord: 722..742
NoneNo IPR availableCOILSCoilCoilcoord: 1324..1372
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1444..1466
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1039..1058
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1446..1466
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1191..1213
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1038..1058
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1630..1656
NoneNo IPR availablePANTHERPTHR34491:SF9coord: 1313..1655
coord: 6..1292
NoneNo IPR availablePANTHERPTHR34491FAMILY NOT NAMEDcoord: 1313..1655
NoneNo IPR availablePANTHERPTHR34491FAMILY NOT NAMEDcoord: 6..1292
IPR019323Active zone protein ELKSPFAMPF10174Castcoord: 1397..1650
e-value: 3.1E-11
score: 42.3
coord: 3..276
e-value: 4.0E-16
score: 58.4