SMED30019370

Overview
NameSMED30019370
Smed IDSMED30019370
Length (bp)320
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30019370 (SMED30019370) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30019370 (SMED30019370) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019370

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30019370SMESG000065696.1 dd_Smed_v4_22938_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30019370SMESG000065696.1 dd_Smed_v4_22938_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30019370SMESG000065696.1 dd_Smed_v4_22938_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30019370 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.001732:6440..7185 -1365
v31.001732:5481..5778 -1026
v31.001732:5746..6774 -983
v31.001732:7145..7437 -603
Homology
BLAST of SMED30019370 vs. Planmine SMEST
Match: SMESG000065696.1 (SMESG000065696.1)

HSP 1 Score: 172.17 bits (435), Expect = 5.247e-51
Identity = 96/112 (85.71%), Postives = 97/112 (86.61%), Query Frame = 1
Query:    1 VDNSSVFPE------KSISNEFIEYRNQSNIIDSVLINKSQTSIRYLESDKTFVLSNAEDGQNIADKSIFTEYREMPSKLPPKNSSSIDDIQHLSNRSPVDNNSVIPETGEV 318
            VDNSSV PE      KSISNEFIE  NQSNI DSVLINKSQTSIRYLESDKTFVLSNAEDGQNIADKSI  EYREMPSKL P NSSSI DIQHLSNRSPVDN+SVIPETGEV
Sbjct:  368 VDNSSVIPETGEFIEKSISNEFIENLNQSNINDSVLINKSQTSIRYLESDKTFVLSNAEDGQNIADKSIINEYREMPSKLSPINSSSI-DIQHLSNRSPVDNSSVIPETGEV 478          

HSP 2 Score: 133.265 bits (334), Expect = 2.541e-37
Identity = 75/102 (73.53%), Postives = 80/102 (78.43%), Query Frame = 1
Query:    1 VDNSSVFPEKSISNEFIEYRNQSNIIDSVLINKSQTSIRYLESDKTFVLSNAEDGQNIADKSIFTEYREMPSKLPPKNSSSIDDIQHLSNRSPVDNNSVIPE 306
            V NS + PEKSISNEFIEYRNQSNIIDSVLINKSQTSIRY ESDKTFVLSNAEDGQNI+DKSI  E  +M SKL  KN         LSN+S VDN+SV PE
Sbjct:  616 VKNSLLLPEKSISNEFIEYRNQSNIIDSVLINKSQTSIRYSESDKTFVLSNAEDGQNISDKSIINENSKMSSKLSHKN---------LSNKSQVDNSSVFPE 708          

HSP 3 Score: 114.39 bits (285), Expect = 1.037e-30
Identity = 78/134 (58.21%), Postives = 87/134 (64.93%), Query Frame = 1
Query:    1 VDNSSVFPE------KSISNEFIEYRNQSNIIDSVLINKSQTSIRYLESDKTFVLSNAEDGQN--IADK-----SIFTEYR----------------EMPSKLPPKNSSSIDDIQHLSNRSPVDNNSVIPETGE 315
            VDNSSV PE      KSISNEFIE RNQSNIIDS LINKSQ+S R  +S+KTFVL N+   +N  +  K     S F E +                E+P KLPP NSSSI DIQHLSNRSPVDN+SVIPETGE
Sbjct:  247 VDNSSVIPETGEVIEKSISNEFIENRNQSNIIDSGLINKSQSSKRSFQSNKTFVLRNSIPNENPEMLSKLPHTNSAFREMQSISLNENSNSERSILSEIPPKLPPINSSSI-DIQHLSNRSPVDNSSVIPETGE 379          

HSP 4 Score: 108.997 bits (271), Expect = 7.966e-29
Identity = 73/108 (67.59%), Postives = 84/108 (77.78%), Query Frame = 1
Query:    1 VDNSSVFPEKSISNEFIEYRNQSNIIDSVLINKSQTSIRYLESDKTFVLSNAEDGQNIADKSIFTEYREMPSKLPPKNSSSIDDIQHLS------NRSPVDNNSVIPE 306
            VDNSSVFPEKSISNEFIE  NQS+IIDSVLIN SQTSIRYLESDKTFVLSNAED +NIAD+SI  E  E+PS L   +SSS+ +IQ LS      N+S +D + +I E
Sbjct:  700 VDNSSVFPEKSISNEFIENLNQSDIIDSVLINNSQTSIRYLESDKTFVLSNAED-KNIADQSIINEISEIPSNLSSIDSSSV-EIQALSEFIENRNQSNIDGSVIINE 805          

HSP 5 Score: 93.5893 bits (231), Expect = 2.022e-23
Identity = 55/86 (63.95%), Postives = 65/86 (75.58%), Query Frame = 1
Query:    1 VDNSSVFPE------KSISNEFIEYRNQSNIIDSVLINKSQTSIRYLESDKTFVLSNAEDGQNIADKSIFTEYREMPSKLPPKNSS 240
            VDNSSV PE      KSISNEFIE RNQSNIIDS LINKSQ+S R  +S+KTFVL N+++GQN+ADKSI  E  E+  KL  +NS+
Sbjct:  466 VDNSSVIPETGEVIEKSISNEFIENRNQSNIIDSGLINKSQSSKRSFQSNKTFVLRNSDEGQNVADKSIPNENPEITYKLSRENST 551          

HSP 6 Score: 68.1662 bits (165), Expect = 1.736e-14
Identity = 39/48 (81.25%), Postives = 40/48 (83.33%), Query Frame = 1
Query:  175 ADKSIFTEYREMPSKLPPKNSSSIDDIQHLSNRSPVDNNSVIPETGEV 318
            ADKSI  E   MPSKL P NSSSID IQHLSNRSPVDN+SVIPETGEV
Sbjct:  215 ADKSIINE--NMPSKLHPINSSSID-IQHLSNRSPVDNSSVIPETGEV 259          

HSP 7 Score: 62.003 bits (149), Expect = 2.314e-12
Identity = 41/73 (56.16%), Postives = 46/73 (63.01%), Query Frame = 1
Query:    1 VDNSSVFPEKSISNEFIEYRNQSNIIDSVLINKSQTSIRYLESDKTFVLSNAEDG---QNIADKSIFTEYREM 210
            VDNSSV PEK ISN FIE +NQSNI  S+LINK +  I  L S+      N E G    NIA+KSI  EY EM
Sbjct:  859 VDNSSVIPEKPISNRFIENQNQSNIDRSILINKLRLPIECLGSN------NDESGLENHNIANKSIINEYPEM 925          

HSP 8 Score: 44.2838 bits (103), Expect = 3.639e-6
Identity = 41/91 (45.05%), Postives = 52/91 (57.14%), Query Frame = 1
Query:   43 EFIEYRNQSNIIDSVLINKSQTSIRYLESDKTFVLSNAEDG---QNIADKSIFTEYREMPSKLPPKNSSSIDDIQHLSNRSPVDNNSVIPE 306
            EFIE RNQSNI  SV+IN+ Q  +    S+        E G    NIA+KSI  E +   S L   +SS I +I  L+ +S VDN+SVIPE
Sbjct:  787 EFIENRNQSNIDGSVIINEFQLPMECSGSNTN------EPGLANHNIANKSIINENQ---SNLSSIDSSGI-EILALTEQSQVDNSSVIPE 867          
BLAST of SMED30019370 vs. Planmine SMEST
Match: SMESG000065696.1 (SMESG000065696.1)

HSP 1 Score: 172.17 bits (435), Expect = 5.670e-51
Identity = 96/112 (85.71%), Postives = 97/112 (86.61%), Query Frame = 1
Query:    1 VDNSSVFPE------KSISNEFIEYRNQSNIIDSVLINKSQTSIRYLESDKTFVLSNAEDGQNIADKSIFTEYREMPSKLPPKNSSSIDDIQHLSNRSPVDNNSVIPETGEV 318
            VDNSSV PE      KSISNEFIE  NQSNI DSVLINKSQTSIRYLESDKTFVLSNAEDGQNIADKSI  EYREMPSKL P NSSSI DIQHLSNRSPVDN+SVIPETGEV
Sbjct:  363 VDNSSVIPETGEFIEKSISNEFIENLNQSNINDSVLINKSQTSIRYLESDKTFVLSNAEDGQNIADKSIINEYREMPSKLSPINSSSI-DIQHLSNRSPVDNSSVIPETGEV 473          

HSP 2 Score: 133.265 bits (334), Expect = 2.694e-37
Identity = 75/102 (73.53%), Postives = 80/102 (78.43%), Query Frame = 1
Query:    1 VDNSSVFPEKSISNEFIEYRNQSNIIDSVLINKSQTSIRYLESDKTFVLSNAEDGQNIADKSIFTEYREMPSKLPPKNSSSIDDIQHLSNRSPVDNNSVIPE 306
            V NS + PEKSISNEFIEYRNQSNIIDSVLINKSQTSIRY ESDKTFVLSNAEDGQNI+DKSI  E  +M SKL  KN         LSN+S VDN+SV PE
Sbjct:  611 VKNSLLLPEKSISNEFIEYRNQSNIIDSVLINKSQTSIRYSESDKTFVLSNAEDGQNISDKSIINENSKMSSKLSHKN---------LSNKSQVDNSSVFPE 703          

HSP 3 Score: 114.005 bits (284), Expect = 1.132e-30
Identity = 78/134 (58.21%), Postives = 87/134 (64.93%), Query Frame = 1
Query:    1 VDNSSVFPE------KSISNEFIEYRNQSNIIDSVLINKSQTSIRYLESDKTFVLSNAEDGQN--IADK-----SIFTEYR----------------EMPSKLPPKNSSSIDDIQHLSNRSPVDNNSVIPETGE 315
            VDNSSV PE      KSISNEFIE RNQSNIIDS LINKSQ+S R  +S+KTFVL N+   +N  +  K     S F E +                E+P KLPP NSSSI DIQHLSNRSPVDN+SVIPETGE
Sbjct:  242 VDNSSVIPETGEVIEKSISNEFIENRNQSNIIDSGLINKSQSSKRSFQSNKTFVLRNSIPNENPEMLSKLPHTNSAFREMQSISLNENSNSERSILSEIPPKLPPINSSSI-DIQHLSNRSPVDNSSVIPETGE 374          

HSP 4 Score: 108.997 bits (271), Expect = 8.201e-29
Identity = 73/108 (67.59%), Postives = 84/108 (77.78%), Query Frame = 1
Query:    1 VDNSSVFPEKSISNEFIEYRNQSNIIDSVLINKSQTSIRYLESDKTFVLSNAEDGQNIADKSIFTEYREMPSKLPPKNSSSIDDIQHLS------NRSPVDNNSVIPE 306
            VDNSSVFPEKSISNEFIE  NQS+IIDSVLIN SQTSIRYLESDKTFVLSNAED +NIAD+SI  E  E+PS L   +SSS+ +IQ LS      N+S +D + +I E
Sbjct:  695 VDNSSVFPEKSISNEFIENLNQSDIIDSVLINNSQTSIRYLESDKTFVLSNAED-KNIADQSIINEISEIPSNLSSIDSSSV-EIQALSEFIENRNQSNIDGSVIINE 800          

HSP 5 Score: 93.2041 bits (230), Expect = 2.164e-23
Identity = 55/86 (63.95%), Postives = 65/86 (75.58%), Query Frame = 1
Query:    1 VDNSSVFPE------KSISNEFIEYRNQSNIIDSVLINKSQTSIRYLESDKTFVLSNAEDGQNIADKSIFTEYREMPSKLPPKNSS 240
            VDNSSV PE      KSISNEFIE RNQSNIIDS LINKSQ+S R  +S+KTFVL N+++GQN+ADKSI  E  E+  KL  +NS+
Sbjct:  461 VDNSSVIPETGEVIEKSISNEFIENRNQSNIIDSGLINKSQSSKRSFQSNKTFVLRNSDEGQNVADKSIPNENPEITYKLSRENST 546          

HSP 6 Score: 67.781 bits (164), Expect = 1.788e-14
Identity = 39/48 (81.25%), Postives = 40/48 (83.33%), Query Frame = 1
Query:  175 ADKSIFTEYREMPSKLPPKNSSSIDDIQHLSNRSPVDNNSVIPETGEV 318
            ADKSI  E   MPSKL P NSSSID IQHLSNRSPVDN+SVIPETGEV
Sbjct:  210 ADKSIINE--NMPSKLHPINSSSID-IQHLSNRSPVDNSSVIPETGEV 254          

HSP 7 Score: 62.003 bits (149), Expect = 2.477e-12
Identity = 41/73 (56.16%), Postives = 46/73 (63.01%), Query Frame = 1
Query:    1 VDNSSVFPEKSISNEFIEYRNQSNIIDSVLINKSQTSIRYLESDKTFVLSNAEDG---QNIADKSIFTEYREM 210
            VDNSSV PEK ISN FIE +NQSNI  S+LINK +  I  L S+      N E G    NIA+KSI  EY EM
Sbjct:  854 VDNSSVIPEKPISNRFIENQNQSNIDRSILINKLRLPIECLGSN------NDESGLENHNIANKSIINEYPEM 920          

HSP 8 Score: 44.2838 bits (103), Expect = 3.857e-6
Identity = 41/91 (45.05%), Postives = 52/91 (57.14%), Query Frame = 1
Query:   43 EFIEYRNQSNIIDSVLINKSQTSIRYLESDKTFVLSNAEDG---QNIADKSIFTEYREMPSKLPPKNSSSIDDIQHLSNRSPVDNNSVIPE 306
            EFIE RNQSNI  SV+IN+ Q  +    S+        E G    NIA+KSI  E +   S L   +SS I +I  L+ +S VDN+SVIPE
Sbjct:  782 EFIENRNQSNIDGSVIINEFQLPMECSGSNTN------EPGLANHNIANKSIINENQ---SNLSSIDSSGI-EILALTEQSQVDNSSVIPE 862          
BLAST of SMED30019370 vs. Planmine SMEST
Match: SMESG000065696.1 (SMESG000065696.1)

HSP 1 Score: 172.17 bits (435), Expect = 5.781e-51
Identity = 96/112 (85.71%), Postives = 97/112 (86.61%), Query Frame = 1
Query:    1 VDNSSVFPE------KSISNEFIEYRNQSNIIDSVLINKSQTSIRYLESDKTFVLSNAEDGQNIADKSIFTEYREMPSKLPPKNSSSIDDIQHLSNRSPVDNNSVIPETGEV 318
            VDNSSV PE      KSISNEFIE  NQSNI DSVLINKSQTSIRYLESDKTFVLSNAEDGQNIADKSI  EYREMPSKL P NSSSI DIQHLSNRSPVDN+SVIPETGEV
Sbjct:  364 VDNSSVIPETGEFIEKSISNEFIENLNQSNINDSVLINKSQTSIRYLESDKTFVLSNAEDGQNIADKSIINEYREMPSKLSPINSSSI-DIQHLSNRSPVDNSSVIPETGEV 474          

HSP 2 Score: 132.88 bits (333), Expect = 2.720e-37
Identity = 75/102 (73.53%), Postives = 80/102 (78.43%), Query Frame = 1
Query:    1 VDNSSVFPEKSISNEFIEYRNQSNIIDSVLINKSQTSIRYLESDKTFVLSNAEDGQNIADKSIFTEYREMPSKLPPKNSSSIDDIQHLSNRSPVDNNSVIPE 306
            V NS + PEKSISNEFIEYRNQSNIIDSVLINKSQTSIRY ESDKTFVLSNAEDGQNI+DKSI  E  +M SKL  KN         LSN+S VDN+SV PE
Sbjct:  612 VKNSLLLPEKSISNEFIEYRNQSNIIDSVLINKSQTSIRYSESDKTFVLSNAEDGQNISDKSIINENSKMSSKLSHKN---------LSNKSQVDNSSVFPE 704          

HSP 3 Score: 114.005 bits (284), Expect = 1.143e-30
Identity = 78/134 (58.21%), Postives = 87/134 (64.93%), Query Frame = 1
Query:    1 VDNSSVFPE------KSISNEFIEYRNQSNIIDSVLINKSQTSIRYLESDKTFVLSNAEDGQN--IADK-----SIFTEYR----------------EMPSKLPPKNSSSIDDIQHLSNRSPVDNNSVIPETGE 315
            VDNSSV PE      KSISNEFIE RNQSNIIDS LINKSQ+S R  +S+KTFVL N+   +N  +  K     S F E +                E+P KLPP NSSSI DIQHLSNRSPVDN+SVIPETGE
Sbjct:  243 VDNSSVIPETGEVIEKSISNEFIENRNQSNIIDSGLINKSQSSKRSFQSNKTFVLRNSIPNENPEMLSKLPHTNSAFREMQSISLNENSNSERSILSEIPPKLPPINSSSI-DIQHLSNRSPVDNSSVIPETGE 375          

HSP 4 Score: 108.997 bits (271), Expect = 8.281e-29
Identity = 73/108 (67.59%), Postives = 84/108 (77.78%), Query Frame = 1
Query:    1 VDNSSVFPEKSISNEFIEYRNQSNIIDSVLINKSQTSIRYLESDKTFVLSNAEDGQNIADKSIFTEYREMPSKLPPKNSSSIDDIQHLS------NRSPVDNNSVIPE 306
            VDNSSVFPEKSISNEFIE  NQS+IIDSVLIN SQTSIRYLESDKTFVLSNAED +NIAD+SI  E  E+PS L   +SSS+ +IQ LS      N+S +D + +I E
Sbjct:  696 VDNSSVFPEKSISNEFIENLNQSDIIDSVLINNSQTSIRYLESDKTFVLSNAED-KNIADQSIINEISEIPSNLSSIDSSSV-EIQALSEFIENRNQSNIDGSVIINE 801          

HSP 5 Score: 93.2041 bits (230), Expect = 2.207e-23
Identity = 55/86 (63.95%), Postives = 65/86 (75.58%), Query Frame = 1
Query:    1 VDNSSVFPE------KSISNEFIEYRNQSNIIDSVLINKSQTSIRYLESDKTFVLSNAEDGQNIADKSIFTEYREMPSKLPPKNSS 240
            VDNSSV PE      KSISNEFIE RNQSNIIDS LINKSQ+S R  +S+KTFVL N+++GQN+ADKSI  E  E+  KL  +NS+
Sbjct:  462 VDNSSVIPETGEVIEKSISNEFIENRNQSNIIDSGLINKSQSSKRSFQSNKTFVLRNSDEGQNVADKSIPNENPEITYKLSRENST 547          

HSP 6 Score: 67.781 bits (164), Expect = 1.805e-14
Identity = 39/48 (81.25%), Postives = 40/48 (83.33%), Query Frame = 1
Query:  175 ADKSIFTEYREMPSKLPPKNSSSIDDIQHLSNRSPVDNNSVIPETGEV 318
            ADKSI  E   MPSKL P NSSSID IQHLSNRSPVDN+SVIPETGEV
Sbjct:  211 ADKSIINE--NMPSKLHPINSSSID-IQHLSNRSPVDNSSVIPETGEV 255          

HSP 7 Score: 62.003 bits (149), Expect = 2.477e-12
Identity = 41/73 (56.16%), Postives = 46/73 (63.01%), Query Frame = 1
Query:    1 VDNSSVFPEKSISNEFIEYRNQSNIIDSVLINKSQTSIRYLESDKTFVLSNAEDG---QNIADKSIFTEYREM 210
            VDNSSV PEK ISN FIE +NQSNI  S+LINK +  I  L S+      N E G    NIA+KSI  EY EM
Sbjct:  855 VDNSSVIPEKPISNRFIENQNQSNIDRSILINKLRLPIECLGSN------NDESGLENHNIANKSIINEYPEM 921          

HSP 8 Score: 44.2838 bits (103), Expect = 3.820e-6
Identity = 41/91 (45.05%), Postives = 52/91 (57.14%), Query Frame = 1
Query:   43 EFIEYRNQSNIIDSVLINKSQTSIRYLESDKTFVLSNAEDG---QNIADKSIFTEYREMPSKLPPKNSSSIDDIQHLSNRSPVDNNSVIPE 306
            EFIE RNQSNI  SV+IN+ Q  +    S+        E G    NIA+KSI  E +   S L   +SS I +I  L+ +S VDN+SVIPE
Sbjct:  783 EFIENRNQSNIDGSVIINEFQLPMECSGSNTN------EPGLANHNIANKSIINENQ---SNLSSIDSSGI-EILALTEQSQVDNSSVIPE 863          
The following BLAST results are available for this feature:
BLAST of SMED30019370 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30019370 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30019370 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30019370 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30019370 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30019370 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30019370 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30019370 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30019370 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30019370 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30019370 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30019370 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30019370 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30019370 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000065696.15.247e-5185.71SMESG000065696.1[more]
SMESG000065696.15.670e-5185.71SMESG000065696.1[more]
SMESG000065696.15.781e-5185.71SMESG000065696.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019370 ID=SMED30019370|Name=SMED30019370|organism=Schmidtea mediterranea sexual|type=transcript|length=320bp
GTTGACAATTCTTCAGTTTTTCCTGAAAAATCAATTTCCAATGAATTTAT
TGAATATCGAAATCAATCGAATATTATTGACTCAGTACTGATCAATAAAT
CTCAAACATCAATACGATATTTGGAATCCGATAAAACATTTGTACTGTCT
AATGCAGAAGATGGGCAAAATATTGCCGATAAATCGATTTTCACTGAATA
TCGAGAAATGCCATCAAAATTGCCCCCAAAAAATTCATCTAGTATCGACG
ACATTCAACATTTATCCAATAGATCACCGGTGGACAATAACTCAGTTATT
CCTGAAACCGGTGAAGTTAT
back to top

protein sequence of SMED30019370-orf-1

>SMED30019370-orf-1 ID=SMED30019370-orf-1|Name=SMED30019370-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=106bp
VDNSSVFPEKSISNEFIEYRNQSNIIDSVLINKSQTSIRYLESDKTFVLS
NAEDGQNIADKSIFTEYREMPSKLPPKNSSSIDDIQHLSNRSPVDNNSVI
PETGEV
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000026gut
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 64..86