Set1/Ash2 histone methyltransferase complex subunit ASH2

Overview
NameSet1/Ash2 histone methyltransferase complex subunit ASH2
Smed IDSMED30019367
Length (bp)1885
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Set1/Ash2 histone methyltransferase complex subunit ASH2 (SMED30019367) t-SNE clustered cells

Violin plots show distribution of expression levels for Set1/Ash2 histone methyltransferase complex subunit ASH2 (SMED30019367) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Set1/Ash2 histone methyltransferase complex subunit ASH2 (SMED30019367) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Set1/Ash2 histone methyltransferase complex subunit ASH2 (SMED30019367) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019367

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 18

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30019367SMESG000051162.1 SmedASXL_012878SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30019367SMESG000051162.1 SmedASXL_012878SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
tail stripeSMED30019367SMESG000051162.1 CUFF.95059.1be_Smed_v2PMID:22543868
Onal et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30019367SMESG000051162.1 CUFF.95059.1be_Smed_v2PMID:22543868
Onal et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
tail stripeSMED30019367SMESG000051162.1 isotig09869be_Smed_v2PMID:22543868
Onal et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30019367SMESG000051162.1 isotig09869be_Smed_v2PMID:22543868
Onal et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30019367SMESG000051162.1 DN305606ncbi_smed_estsPMID:23235145
Hubert et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
cephalic gangliaSMED30019367SMESG000051162.1 DN305606ncbi_smed_estsPMID:23235145
Hubert et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30019367SMESG000051162.1 DN305606ncbi_smed_estsPMID:23235145
Hubert et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30019367SMESG000051162.1 DN305606ncbi_smed_estsPMID:23235145
Hubert et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30019367SMESG000051162.1 KC262336smed_ncbi_20200123PMID:23235145
Hubert et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
cephalic gangliaSMED30019367SMESG000051162.1 KC262336smed_ncbi_20200123PMID:23235145
Hubert et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30019367SMESG000051162.1 KC262336smed_ncbi_20200123PMID:23235145
Hubert et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30019367SMESG000051162.1 KC262336smed_ncbi_20200123PMID:23235145
Hubert et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30019367SMESG000051162.1 DN296978ncbi_smed_estsPMID:23235145
Hubert et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
cephalic gangliaSMED30019367SMESG000051162.1 DN296978ncbi_smed_estsPMID:23235145
Hubert et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30019367SMESG000051162.1 DN296978ncbi_smed_estsPMID:23235145
Hubert et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30019367SMESG000051162.1 DN296978ncbi_smed_estsPMID:23235145
Hubert et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Set1/Ash2 histone methyltransferase complex subunit ASH2 vs. Ensembl Human
Match: ASH2L (ASH2 like, histone lysine methyltransferase complex subunit [Source:HGNC Symbol;Acc:HGNC:744])

HSP 1 Score: 350.517 bits (898), Expect = 4.513e-113
Identity = 217/546 (39.74%), Postives = 304/546 (55.68%), Query Frame = 1
Query:  184 RDFSIPDFQCSNCNKWFHKHCIGFTIGKAIPFMIAYHFMCKKCNESCEEVFSRKQSNFASMCQTAIANLMYIN-----NGKIYFSKEKDVIPFLEENWEALTTQPKKTFAALNPSIHKTLI-SNDIF---KHHIVG------DDVIVCLKNTNLYQMKPGYDQFRILASQLKTKVTTGGGILPQSGGWHXXXXXXXXXXXXXXXXXXXXXPSATRVGEMVTNTGKPKRGIEE---TKVKLTQFNYPVDHPFNKDSYRYIYVESDPHAKGRQLWEECEATAGRIIPGFFYRVTISQQIALATNDRAHQLKLSDSQLSVTGDKGYCMIRATQPVSRGCWYFEAKIVEQPDNSHARIGWSQSLGNLQAPCGFDKFSYACRSRFGTAFHQSKGKHYMNHGYKKGDVLGCMFIASAPNIKRVSKQNLTQALFGKLPESFKERPLIKFKNXXXXXXXXXXXXXXXXLKQLENSKITFYKNGVSYGPAFTDIFDGAYYPAISIYKQASVAVNFGPNFTFPPTDVENWMPMSERHIDLEVEQTVSDMLWLTEKD 1767
            R     + QC  C KWF     G      +PFM  Y F C  C+ S    F RKQ+N   MC +A+ANL + +     + K  FSK+KD+IPF+++ WE +TT+ +        +I KT+    D+F   +H   G      D     L + +L  + P YD  +  +S + T     GGI   S G                         A R  +    TG  K+   +   +  +L    YP++HPFNKD YRYI  E DPHA   +  E  +  AG+ IPG  YR  + +++ LA +DRA QLK+SD +L+V G+KGY M+RA+  V +G WYFE  + E P ++ AR+GWSQ LGNLQAP G+DKFSY+ RS+ GT FHQS GKHY + GY +GDVLG  F  + P     +K          LP+++K++ LIKFK+  Y+EEK+   KAEK LKQ  +S+I FYKNGV+ G A+ DIF+G Y+PAIS+YK  +V++NFGP F +PP D+  + PMS+      VE T++D+L+  E +
Sbjct:   14 RQLGEVELQCGICTKWFTADTFGIDTSSCLPFMTNYSFHCNVCHHSGNTYFLRKQANLKEMCLSALANLTWQSRTQDEHPKTMFSKDKDIIPFIDKYWECMTTRQRPGKMTWPNNIVKTMSKERDVFLVKEHPDPGSKDPEEDYPKFGLLDQDLSNIGPAYDNQK-QSSAVSTSGNLNGGIAAGSSG---------------------KGRGAKRKQQDGGTTGTTKKARSDPLFSAQRLPPHGYPLEHPFNKDGYRYILAEPDPHAPDPEKLE-LDCWAGKPIPGDLYRACLYERVLLALHDRAPQLKISDDRLTVVGEKGYSMVRASHGVRKGAWYFEITVDEMPPDTAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTKFHQSIGKHY-SSGYGQGDVLG--FYINLPEDTETAKS---------LPDTYKDKALIKFKSYLYFEEKDFVDKAEKSLKQTPHSEIIFYKNGVNQGVAYKDIFEGVYFPAISLYKSCTVSINFGPCFKYPPKDL-TYRPMSDMGWGAVVEHTLADVLYHVETE 523          
BLAST of Set1/Ash2 histone methyltransferase complex subunit ASH2 vs. Ensembl Human
Match: ASH2L (ASH2 like, histone lysine methyltransferase complex subunit [Source:HGNC Symbol;Acc:HGNC:744])

HSP 1 Score: 351.288 bits (900), Expect = 3.135e-112
Identity = 217/546 (39.74%), Postives = 304/546 (55.68%), Query Frame = 1
Query:  184 RDFSIPDFQCSNCNKWFHKHCIGFTIGKAIPFMIAYHFMCKKCNESCEEVFSRKQSNFASMCQTAIANLMYIN-----NGKIYFSKEKDVIPFLEENWEALTTQPKKTFAALNPSIHKTLI-SNDIF---KHHIVG------DDVIVCLKNTNLYQMKPGYDQFRILASQLKTKVTTGGGILPQSGGWHXXXXXXXXXXXXXXXXXXXXXPSATRVGEMVTNTGKPKRGIEE---TKVKLTQFNYPVDHPFNKDSYRYIYVESDPHAKGRQLWEECEATAGRIIPGFFYRVTISQQIALATNDRAHQLKLSDSQLSVTGDKGYCMIRATQPVSRGCWYFEAKIVEQPDNSHARIGWSQSLGNLQAPCGFDKFSYACRSRFGTAFHQSKGKHYMNHGYKKGDVLGCMFIASAPNIKRVSKQNLTQALFGKLPESFKERPLIKFKNXXXXXXXXXXXXXXXXLKQLENSKITFYKNGVSYGPAFTDIFDGAYYPAISIYKQASVAVNFGPNFTFPPTDVENWMPMSERHIDLEVEQTVSDMLWLTEKD 1767
            R     + QC  C KWF     G      +PFM  Y F C  C+ S    F RKQ+N   MC +A+ANL + +     + K  FSK+KD+IPF+++ WE +TT+ +        +I KT+    D+F   +H   G      D     L + +L  + P YD  +  +S + T     GGI   S G                         A R  +    TG  K+   +   +  +L    YP++HPFNKD YRYI  E DPHA   +  E  +  AG+ IPG  YR  + +++ LA +DRA QLK+SD +L+V G+KGY M+RA+  V +G WYFE  + E P ++ AR+GWSQ LGNLQAP G+DKFSY+ RS+ GT FHQS GKHY + GY +GDVLG  F  + P     +K          LP+++K++ LIKFK+  Y+EEK+   KAEK LKQ  +S+I FYKNGV+ G A+ DIF+G Y+PAIS+YK  +V++NFGP F +PP D+  + PMS+      VE T++D+L+  E +
Sbjct:  108 RQLGEVELQCGICTKWFTADTFGIDTSSCLPFMTNYSFHCNVCHHSGNTYFLRKQANLKEMCLSALANLTWQSRTQDEHPKTMFSKDKDIIPFIDKYWECMTTRQRPGKMTWPNNIVKTMSKERDVFLVKEHPDPGSKDPEEDYPKFGLLDQDLSNIGPAYDNQK-QSSAVSTSGNLNGGIAAGSSG---------------------KGRGAKRKQQDGGTTGTTKKARSDPLFSAQRLPPHGYPLEHPFNKDGYRYILAEPDPHAPDPEKLE-LDCWAGKPIPGDLYRACLYERVLLALHDRAPQLKISDDRLTVVGEKGYSMVRASHGVRKGAWYFEITVDEMPPDTAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTKFHQSIGKHY-SSGYGQGDVLG--FYINLPEDTETAKS---------LPDTYKDKALIKFKSYLYFEEKDFVDKAEKSLKQTPHSEIIFYKNGVNQGVAYKDIFEGVYFPAISLYKSCTVSINFGPCFKYPPKDL-TYRPMSDMGWGAVVEHTLADVLYHVETE 617          
BLAST of Set1/Ash2 histone methyltransferase complex subunit ASH2 vs. Ensembl Human
Match: ASH2L (ASH2 like, histone lysine methyltransferase complex subunit [Source:HGNC Symbol;Acc:HGNC:744])

HSP 1 Score: 328.561 bits (841), Expect = 3.968e-105
Identity = 207/514 (40.27%), Postives = 292/514 (56.81%), Query Frame = 1
Query:  280 MIAYHFMCKKCNESCEEVFSRKQSNFASMCQTAIANLMYIN-----NGKIYFSKEKDVIPFLEENWEALTTQPKKTFAALNPSIHKTLI-SNDIF---KHHIVG------DDVIVCLKNTNLYQMKPGYDQFRILASQLKTKVTTGGGILPQSGGWHXXXXXXXXXXXXXXXXXXXXXPSATRVGEMVTNTGKPKRGIEE---TKVKLTQFNYPVDHPFNKDSYRYIYVESDPHAKGRQLWEECEATAGRIIPGFFYRVTISQQIALATNDRAHQLKLSDSQLSVTGDKGYCMIRATQPVSRGCWYFEAKIVEQPDNSHARIGWSQSLGNLQAPCGFDKFSYACRSRFGTAFHQSKGKHYMNHGYKKGDVLGCMFIASAPNIKRVSKQNLTQALFGKLPESFKERPLIKFKNXXXXXXXXXXXXXXXXLKQLENSKITFYKNGVSYGPAFTDIFDGAYYPAISIYKQASVAVNFGPNFTFPPTDVENWMPMSERHIDLEVEQTVSDMLWLTEKD 1767
            M  Y F C  C+ S    F RKQ+N   MC +A+ANL + +     + K  FSK+KD+IPF+++ WE +TT+ +        +I KT+    D+F   +H   G      D     L + +L  + P YD  +  +S + T     GGI   S G                         A R  +    TG  K+   +   +  +L    YP++HPFNKD YRYI  E DPHA   +  E  +  AG+ IPG  YR  + +++ LA +DRA QLK+SD +L+V G+KGY M+RA+  V +G WYFE  + E P ++ AR+GWSQ LGNLQAP G+DKFSY+ RS+ GT FHQS GKHY + GY +GDVLG  F  + P     +K          LP+++K++ LIKFK+  Y+EEK+   KAEK LKQ  +S+I FYKNGV+ G A+ DIF+G Y+PAIS+YK  +V++NFGP F +PP D+  + PMS+      VE T++D+L+  E +
Sbjct:    1 MTNYSFHCNVCHHSGNTYFLRKQANLKEMCLSALANLTWQSRTQDEHPKTMFSKDKDIIPFIDKYWECMTTRQRPGKMTWPNNIVKTMSKERDVFLVKEHPDPGSKDPEEDYPKFGLLDQDLSNIGPAYDNQK-QSSAVSTSGNLNGGIAAGSSG---------------------KGRGAKRKQQDGGTTGTTKKARSDPLFSAQRLPPHGYPLEHPFNKDGYRYILAEPDPHAPDPEKLE-LDCWAGKPIPGDLYRACLYERVLLALHDRAPQLKISDDRLTVVGEKGYSMVRASHGVRKGAWYFEITVDEMPPDTAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTKFHQSIGKHY-SSGYGQGDVLG--FYINLPEDTETAKS---------LPDTYKDKALIKFKSYLYFEEKDFVDKAEKSLKQTPHSEIIFYKNGVNQGVAYKDIFEGVYFPAISLYKSCTVSINFGPCFKYPPKDL-TYRPMSDMGWGAVVEHTLADVLYHVETE 478          
BLAST of Set1/Ash2 histone methyltransferase complex subunit ASH2 vs. Ensembl Human
Match: ASH2L (ASH2 like, histone lysine methyltransferase complex subunit [Source:HGNC Symbol;Acc:HGNC:744])

HSP 1 Score: 291.197 bits (744), Expect = 9.782e-91
Identity = 197/546 (36.08%), Postives = 278/546 (50.92%), Query Frame = 1
Query:  184 RDFSIPDFQCSNCNKWFHKHCIGFTIGKAIPFMIAYHFMCKKCNESCEEVFSRKQSNFASMCQTAIANLMYIN-----NGKIYFSKEKDVIPFLEENWEALTTQPKKTFAALNPSIHKTLI-SNDIF---KHHIVG------DDVIVCLKNTNLYQMKPGYDQFRILASQLKTKVTTGGGILPQSGGWHXXXXXXXXXXXXXXXXXXXXXPSATRVGEMVTNTGKPKRGIEE---TKVKLTQFNYPVDHPFNKDSYRYIYVESDPHAKGRQLWEECEATAGRIIPGFFYRVTISQQIALATNDRAHQLKLSDSQLSVTGDKGYCMIRATQPVSRGCWYFEAKIVEQPDNSHARIGWSQSLGNLQAPCGFDKFSYACRSRFGTAFHQSKGKHYMNHGYKKGDVLGCMFIASAPNIKRVSKQNLTQALFGKLPESFKERPLIKFKNXXXXXXXXXXXXXXXXLKQLENSKITFYKNGVSYGPAFTDIFDGAYYPAISIYKQASVAVNFGPNFTFPPTDVENWMPMSERHIDLEVEQTVSDMLWLTEKD 1767
            R     + QC  C KWF     G      +PFM  Y F C  C+ S    F RKQ+N   MC +A+ANL + +     + K  FSK+KD+IPF+++ WE +TT+ +        +I KT+    D+F   +H   G      D     L + +L  + P YD  +  +S + T     GGI   S G                         A R  +    TG  K+   +   +  +L    YP++HPFNKD YRYI  E DPHA   +  E  +  AG+ IPG  YR  + +++ LA +DRA QLK+SD +L+V G+KGY M+RA+  V +G WYFE  + E P ++ AR+GWSQ LGNLQAP G+DKFSY+ RS+ GT FHQS GKHY + GY +GDVLG  F  + P     +K          LP+++K++ LIKFK+  Y+EEK+   KAEK LKQ  +S+                                 V++NFGP F +PP D+  + PMS+      VE T++D+L+  E +
Sbjct:   14 RQLGEVELQCGICTKWFTADTFGIDTSSCLPFMTNYSFHCNVCHHSGNTYFLRKQANLKEMCLSALANLTWQSRTQDEHPKTMFSKDKDIIPFIDKYWECMTTRQRPGKMTWPNNIVKTMSKERDVFLVKEHPDPGSKDPEEDYPKFGLLDQDLSNIGPAYDNQK-QSSAVSTSGNLNGGIAAGSSG---------------------KGRGAKRKQQDGGTTGTTKKARSDPLFSAQRLPPHGYPLEHPFNKDGYRYILAEPDPHAPDPEKLE-LDCWAGKPIPGDLYRACLYERVLLALHDRAPQLKISDDRLTVVGEKGYSMVRASHGVRKGAWYFEITVDEMPPDTAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTKFHQSIGKHY-SSGYGQGDVLG--FYINLPEDTETAKS---------LPDTYKDKALIKFKSYLYFEEKDFVDKAEKSLKQTPHSE---------------------------------VSINFGPCFKYPPKDL-TYRPMSDMGWGAVVEHTLADVLYHVETE 490          
BLAST of Set1/Ash2 histone methyltransferase complex subunit ASH2 vs. Ensembl Human
Match: ASH2L (ASH2 like, histone lysine methyltransferase complex subunit [Source:HGNC Symbol;Acc:HGNC:744])

HSP 1 Score: 187.963 bits (476), Expect = 2.085e-55
Identity = 105/203 (51.72%), Postives = 141/203 (69.46%), Query Frame = 1
Query: 1093 GYCMIRATQPVSRGCWYFEAKIVEQPDNSHARIGWSQSLGNLQAPCGFDKFSYACRSRFGTAFHQSKGKHYMNHGYKKGDVLGCMFIASAPNIKRVSKQNLTQALFGKLPESFKERPLIKFKNXXXXXXXXXXXXXXXXLKQLENSKITFYKNGVSYGPAFTDIFDGAYYPAISIYKQASVAVNFGPNFTFPPTDVENWMPMS 1701
            GY M+RA+  V +G WYFE  + E P ++ AR+GWSQ LGNLQAP G+DKFSY+ RS+ GT FHQS GKHY + GY +GDVLG  F  + P     +K          LP+++K++ LIKFK+  Y+EEK+   KAEK LKQ  +S+I FYKNGV+ G A+ DIF+G Y+PAIS+YK  +V++NFGP F +PP D+  + P+S
Sbjct:    2 GYSMVRASHGVRKGAWYFEITVDEMPPDTAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTKFHQSIGKHY-SSGYGQGDVLG--FYINLPEDTETAKS---------LPDTYKDKALIKFKSYLYFEEKDFVDKAEKSLKQTPHSEIIFYKNGVNQGVAYKDIFEGVYFPAISLYKSCTVSINFGPCFKYPPKDL-TYRPVS 191          
BLAST of Set1/Ash2 histone methyltransferase complex subunit ASH2 vs. Ensembl Celegans
Match: ash-2 (Set1/Ash2 histone methyltransferase complex subunit ash-2 [Source:UniProtKB/Swiss-Prot;Acc:G5EFZ3])

HSP 1 Score: 278.87 bits (712), Expect = 1.267e-85
Identity = 187/561 (33.33%), Postives = 290/561 (51.69%), Query Frame = 1
Query:  166 CYCNTQRDFSIPDFQCSNCNKWFHKHCIGF---TIGKAIPFMIAYHFMCKKCNESCEEVFSRKQSNFASMCQTAIANL---MYINNGKI----------YFSKEKDVIPFLEENWEALTT--QPKKTFAALNPSIHKTLISNDIFKHHIVGDDVIVCLKNTNLYQMKPGYDQFRILAS---QLKTKVTTGGGILPQSGGWHXXXXXXXXXXXXXXXXXXXXXPSATRVGEMVTNTGKPKRGIEETKVKLTQFNYPVDHPFNKDSYRYIYVESDPHAKGRQLWEECEATAGRIIPGFFYRVTISQQIALATNDRAHQLKLSDSQLSVTGDKGYCMIRATQPVSRGCWYFEAKIVEQPDNSHARIGWSQSLGNLQAPCGFDKFSYACRSRFGTAFHQSKGKHYMNHGYKKGDVLGCMFIASAPNIKRVS-KQNLTQALFGKLPESFKERPLIKFKNXXXXXXXXXXXXXXXXLKQLENSKITFYKNGVSYGPAFTDIFDGAYYPAISIYKQASVAVNFGPNFTFPPTDVENWMPMSERHIDLEVEQTVSDMLWLTEKDDTIEQ 1782
            CYC+ +R+    +  CS C KWFH  C+          +PFMI Y F CK+C  + E+ +  K+++   MC T +A L       +GK+          Y S + +++P++ ENW  LT   Q K+    L P++   L   +IF  H   DD +  L   NL  + P ++  +++     + + +      + P  G                      +  ++ R       TGK ++   +           +D PF+KD+YRY   E DP+      W + +++A  +IP F YR  ++  + +++NDRA QL ++ +  S+TG +GY M RA+  VS+G WYFE    +QPD+SH RIGWSQS  +LQA  G++KFSY  RS+ GT FH++KGK Y   G+K+GDVLGC+     P  K++    NL    +  LP S K   LI FK +Y++E +EE++   K L ++  S I F+ NG S G A+ +I+ GAYYP+ISI+K A+  +N GP F   P        +  R  + + EQT+SDML+L  K+  ++ 
Sbjct:   22 CYCDGKRELGSVEVVCSTCLKWFHGRCLKEFHELNSNGVPFMICYTFTCKQCRPTAED-WKAKKADLVQMCVTVLATLSAERLKADGKLSAEHVPEDFTYLSLKDEIVPYMNENWYMLTAIKQKKEWHQNLAPTL---LKEKNIFVQH-NDDDDLFALAEKNLSLLGPLHEAVKLIGKRPIERENREPRHIELPPIEG--------------------PKTRGASKRRHAEAPVTGKKQKLAADYSSTAAPNGVQIDIPFSKDNYRYYLTEVDPNVPEDPAWNQNQSSA-YVIPSFHYRELLNPTVNVSSNDRAFQLSINGN--SITGFEGYSMARASHGVSKGTWYFEVNFDDQPDDSHIRIGWSQSYASLQACVGYNKFSYGWRSKHGTKFHEAKGKKYHFGGFKQGDVLGCLI--HLPVDKKLQIPANLPSEKY--LPVSHKGFNLISFKANYFFEVQEESADIAKTLVEMPGSYIEFFHNGKSCGKAYENIYAGAYYPSISIFKSATATMNLGPKFRNLPRGATG---IHARADEQQHEQTLSDMLYLVSKEVNLDH 547          
BLAST of Set1/Ash2 histone methyltransferase complex subunit ASH2 vs. Ensembl Celegans
Match: ash-2 (Set1/Ash2 histone methyltransferase complex subunit ash-2 [Source:UniProtKB/Swiss-Prot;Acc:G5EFZ3])

HSP 1 Score: 278.485 bits (711), Expect = 1.988e-85
Identity = 188/563 (33.39%), Postives = 292/563 (51.87%), Query Frame = 1
Query:  166 CYCNTQRDFSIPDFQCSNCNKWFHKHCIG----FTI-GKAIPFMIAYHFMCKKCNESCEEVFSRKQSNFASMCQTAIANL---MYINNGKI----------YFSKEKDVIPFLEENWEALTT--QPKKTFAALNPSIHKTLISNDIFKHHIVGDDVIVCLKNTNLYQMKPGYDQFRILAS---QLKTKVTTGGGILPQSGGWHXXXXXXXXXXXXXXXXXXXXXPSATRVGEMVTNTGKPKRGIEETKVKLTQFNYPVDHPFNKDSYRYIYVESDPHAKGRQLWEECEATAGRIIPGFFYRVTISQQIALATNDRAHQLKLSDSQLSVTGDKGYCMIRATQPVSRGCWYFEAKIVEQPDNSHARIGWSQSLGNLQAPCGFDKFSYACRSRFGTAFHQSKGKHYMNHGYKKGDVLGCMFIASAPNIKRVS-KQNLTQALFGKLPESFKERPLIKFKNXXXXXXXXXXXXXXXXLKQLENSKITFYKNGVSYGPAFTDIFDGAYYPAISIYKQASVAVNFGPNFTFPPTDVENWMPMSERHIDLEVEQTVSDMLWLTEKDDTIEQ 1782
            CYC+ +R+    +  CS C KWFH  C+     F+     +PFMI Y F CK+C  + E+ +  K+++   MC T +A L       +GK+          Y S + +++P++ ENW  LT   Q K+    L P++   L   +IF  H   DD +  L   NL  + P ++  +++     + + +      + P  G                      +  ++ R       TGK ++   +           +D PF+KD+YRY   E DP+      W + +++A  +IP F YR  ++  + +++NDRA QL ++ +  S+TG +GY M RA+  VS+G WYFE    +QPD+SH RIGWSQS  +LQA  G++KFSY  RS+ GT FH++KGK Y   G+K+GDVLGC+     P  K++    NL    +  LP S K   LI FK +Y++E +EE++   K L ++  S I F+ NG S G A+ +I+ GAYYP+ISI+K A+  +N GP F   P        +  R  + + EQT+SDML+L  K+  ++ 
Sbjct:   22 CYCDGKRELGSVEVVCSTCLKWFHGRCLKEFHEFSRNSNGVPFMICYTFTCKQCRPTAED-WKAKKADLVQMCVTVLATLSAERLKADGKLSAEHVPEDFTYLSLKDEIVPYMNENWYMLTAIKQKKEWHQNLAPTL---LKEKNIFVQH-NDDDDLFALAEKNLSLLGPLHEAVKLIGKRPIERENREPRHIELPPIEG--------------------PKTRGASKRRHAEAPVTGKKQKLAADYSSTAAPNGVQIDIPFSKDNYRYYLTEVDPNVPEDPAWNQNQSSA-YVIPSFHYRELLNPTVNVSSNDRAFQLSINGN--SITGFEGYSMARASHGVSKGTWYFEVNFDDQPDDSHIRIGWSQSYASLQACVGYNKFSYGWRSKHGTKFHEAKGKKYHFGGFKQGDVLGCLI--HLPVDKKLQIPANLPSEKY--LPVSHKGFNLISFKANYFFEVQEESADIAKTLVEMPGSYIEFFHNGKSCGKAYENIYAGAYYPSISIFKSATATMNLGPKFRNLPRGATG---IHARADEQQHEQTLSDMLYLVSKEVNLDH 549          
BLAST of Set1/Ash2 histone methyltransferase complex subunit ASH2 vs. Ensembl Celegans
Match: ash-2 (Set1/Ash2 histone methyltransferase complex subunit ash-2 [Source:UniProtKB/Swiss-Prot;Acc:G5EFZ3])

HSP 1 Score: 276.174 bits (705), Expect = 1.603e-84
Identity = 189/565 (33.45%), Postives = 292/565 (51.68%), Query Frame = 1
Query:  166 CYCNTQRDFSIPDFQCSNCNKWFHKHCIGF---TIGKAIPFMIAYHFMCKKCNESCEEVFSRKQSNFASMCQTAIANL---MYINNGKI----------YFSKEKDVIPFLEENWEALTT--QPKKTFAALNPSIHKTLISNDIFKHHIVGDDVIVCLKNTNLYQMKPGYDQFRILAS---QLKTKVTTGGGILPQSGGWHXXXXXXXXXXXXXXXXXXXXXPSATRVGEMVTNTGKPKRGIEETKVKLTQFNYP----VDHPFNKDSYRYIYVESDPHAKGRQLWEECEATAGRIIPGFFYRVTISQQIALATNDRAHQLKLSDSQLSVTGDKGYCMIRATQPVSRGCWYFEAKIVEQPDNSHARIGWSQSLGNLQAPCGFDKFSYACRSRFGTAFHQSKGKHYMNHGYKKGDVLGCMFIASAPNIKRVS-KQNLTQALFGKLPESFKERPLIKFKNXXXXXXXXXXXXXXXXLKQLENSKITFYKNGVSYGPAFTDIFDGAYYPAISIYKQASVAVNFGPNFTFPPTDVENWMPMSERHIDLEVEQTVSDMLWLTEKDDTIEQ 1782
            CYC+ +R+    +  CS C KWFH  C+          +PFMI Y F CK+C  + E+ +  K+++   MC T +A L       +GK+          Y S + +++P++ ENW  LT   Q K+    L P++   L   +IF  H   DD +  L   NL  + P ++  +++     + + +      + P  G                      +  ++ R       TGK K+ +       +    P    +D PF+KD+YRY   E DP+      W + +++A  +IP F YR  ++  + +++NDRA QL ++ +  S+TG +GY M RA+  VS+G WYFE    +QPD+SH RIGWSQS  +LQA  G++KFSY  RS+ GT FH++KGK Y   G+K+GDVLGC+     P  K++    NL    +  LP S K   LI FK +Y++E +EE++   K L ++  S I F+ NG S G A+ +I+ GAYYP+ISI+K A+  +N GP F   P        +  R  + + EQT+SDML+L  K+  ++ 
Sbjct:   22 CYCDGKRELGSVEVVCSTCLKWFHGRCLKEFHELNSNGVPFMICYTFTCKQCRPTAED-WKAKKADLVQMCVTVLATLSAERLKADGKLSAEHVPEDFTYLSLKDEIVPYMNENWYMLTAIKQKKEWHQNLAPTL---LKEKNIFVQH-NDDDDLFALAEKNLSLLGPLHEAVKLIGKRPIERENREPRHIELPPIEG--------------------PKTRGASKRRHAEAPVTGK-KQKLTSRAADYSSTAAPNGVQIDIPFSKDNYRYYLTEVDPNVPEDPAWNQNQSSA-YVIPSFHYRELLNPTVNVSSNDRAFQLSINGN--SITGFEGYSMARASHGVSKGTWYFEVNFDDQPDDSHIRIGWSQSYASLQACVGYNKFSYGWRSKHGTKFHEAKGKKYHFGGFKQGDVLGCLI--HLPVDKKLQIPANLPSEKY--LPVSHKGFNLISFKANYFFEVQEESADIAKTLVEMPGSYIEFFHNGKSCGKAYENIYAGAYYPSISIFKSATATMNLGPKFRNLPRGATG---IHARADEQQHEQTLSDMLYLVSKEVNLDH 550          
BLAST of Set1/Ash2 histone methyltransferase complex subunit ASH2 vs. Ensembl Celegans
Match: ash-2 (Set1/Ash2 histone methyltransferase complex subunit ash-2 [Source:UniProtKB/Swiss-Prot;Acc:G5EFZ3])

HSP 1 Score: 275.789 bits (704), Expect = 2.594e-84
Identity = 192/567 (33.86%), Postives = 293/567 (51.68%), Query Frame = 1
Query:  166 CYCNTQRDFSIPDFQCSNCNKWFHKHCIG----FTI-GKAIPFMIAYHFMCKKCNESCEEVFSRKQSNFASMCQTAIANL---MYINNGKI----------YFSKEKDVIPFLEENWEALTT--QPKKTFAALNPSIHKTLISNDIFKHHIVGDDVIVCLKNTNLYQMKPGYDQFRILAS---QLKTKVTTGGGILPQSGGWHXXXXXXXXXXXXXXXXXXXXXPSATRVGEMVTNTGKPKRGIEETKVKLTQFNYP----VDHPFNKDSYRYIYVESDPHAKGRQLWEECEATAGRIIPGFFYRVTISQQIALATNDRAHQLKLSDSQLSVTGDKGYCMIRATQPVSRGCWYFEAKIVEQPDNSHARIGWSQSLGNLQAPCGFDKFSYACRSRFGTAFHQSKGKHYMNHGYKKGDVLGCMFIASAPNIKRVS-KQNLTQALFGKLPESFKERPLIKFKNXXXXXXXXXXXXXXXXLKQLENSKITFYKNGVSYGPAFTDIFDGAYYPAISIYKQASVAVNFGPNFTFPPTDVENWMPMSERHIDLEVEQTVSDMLWLTEKDDTIEQ 1782
            CYC+ +R+    +  CS C KWFH  C+     F+     +PFMI Y F CK+C  + E+ +  K+++   MC T +A L       +GK+          Y S + +++P++ ENW  LT   Q K+    L P++   L   +IF  H   DD +  L   NL  + P ++  +++     + + +      + P  G                         S  R  E    TGK K+ +       +    P    +D PF+KD+YRY   E DP+      W + +++A  +IP F YR  ++  + +++NDRA QL ++ +  S+TG +GY M RA+  VS+G WYFE    +QPD+SH RIGWSQS  +LQA  G++KFSY  RS+ GT FH++KGK Y   G+K+GDVLGC+     P  K++    NL    +  LP S K   LI FK +Y++E +EE++   K L ++  S I F+ NG S G A+ +I+ GAYYP+ISI+K A+  +N GP F   P        +  R  + + EQT+SDML+L  K+  ++ 
Sbjct:   22 CYCDGKRELGSVEVVCSTCLKWFHGRCLKEFHEFSRNSNGVPFMICYTFTCKQCRPTAED-WKAKKADLVQMCVTVLATLSAERLKADGKLSAEHVPEDFTYLSLKDEIVPYMNENWYMLTAIKQKKEWHQNLAPTL---LKEKNIFVQH-NDDDDLFALAEKNLSLLGPLHEAVKLIGKRPIERENREPRHIELPPIEG-------------------PKTRGASKRRHAEAPV-TGK-KQKLTSRAADYSSTAAPNGVQIDIPFSKDNYRYYLTEVDPNVPEDPAWNQNQSSA-YVIPSFHYRELLNPTVNVSSNDRAFQLSINGN--SITGFEGYSMARASHGVSKGTWYFEVNFDDQPDDSHIRIGWSQSYASLQACVGYNKFSYGWRSKHGTKFHEAKGKKYHFGGFKQGDVLGCLI--HLPVDKKLQIPANLPSEKY--LPVSHKGFNLISFKANYFFEVQEESADIAKTLVEMPGSYIEFFHNGKSCGKAYENIYAGAYYPSISIFKSATATMNLGPKFRNLPRGATG---IHARADEQQHEQTLSDMLYLVSKEVNLDH 552          
BLAST of Set1/Ash2 histone methyltransferase complex subunit ASH2 vs. Ensembl Fly
Match: ash2 (gene:FBgn0000139 transcript:FBtr0084660)

HSP 1 Score: 380.948 bits (977), Expect = 6.080e-125
Identity = 213/547 (38.94%), Postives = 318/547 (58.14%), Query Frame = 1
Query:  166 CYCNTQRDFSIPDFQCSNCNKWFHKHCIGFTIGKA--IPFMIAYHFMCKKCNESCEEVFSRKQSNFASMCQTAIANLMYI--NNGK--IYFSKEKDVIPFLEENWEALTTQPKKTFAALNPSIHKTLISN--DIFKHHIVGD-DVIVCLKNTNLYQMKPGYDQFRILASQLKTKVTTGGGILPQSGGWHXXXXXXXXXXXXXXXXXXXXXPSATRVGEMVTNTGKPKRGIEETKVKLTQFNYPVDHPFNKDSYRYIYVESDPHAKGRQLWEECEATAGRIIPGFFYRVTISQQIALATNDRAHQLKLSDSQLSVTGDKGYCMIRATQPVSRGCWYFEAKIVEQPDNSHARIGWSQSLGNLQAPCGFDKFSYACRSRFGTAFHQSKGKHYMNHGYKKGDVLGCMFIASAPNIKRVSKQNLTQALFGKLPESFKERPLIKFKNXXXXXXXXXXXXXXXXLKQLENSKITFYKNGVSYGPAFTDIFDGAYYPAISIYKQASVAVNFGPNFTFPPTDVENWMP-MSERHIDLEVEQTVSDMLWLTEKDDTI 1776
            CYC  +R+ +I +  C+ C++W H+ C+ + +GK   +PF+  Y F+CK C+ S  E F + Q+  + MC  AIAN+      +G+  I FSK+K++IP++E+ WEA+TT P++   +   ++ ++L+ +   +F +    +   +  L + +L  +KP Y+              +  G L  +   +      K            S P+  +        G+P   I    VKL    YP++HPFNKD YRYI  E DPHA  RQ ++E    AG+ IPG+ YR+ +   + LA +DRA QLK+S+ +L+VTG++GYCM+RAT  V+RGCWYFE  I E PD +  R+GW +  GNLQAP G+DKF Y+ RSR GT F +S GKHY +  Y +GD LG  F+   P           +A    LP +FK+RPL+KFK+  YYE+K++ ++  K L  L+ S+I F+KNG S G AF DI+ G+Y+PAISI+K A+V+VNFGP F +P   VE+    M +R  +L  EQ ++D L+LTE D  +
Sbjct:   37 CYCGKERNLNIVELLCATCSRWVHETCVSYQLGKGKLLPFITNYVFVCKNCSASGLESFRKSQATISQMCHCAIANMQQAASRDGRRQIQFSKDKEIIPYIEQYWEAMTTMPRRLTQSWYSTVQRSLVKDVQTLFTYEEHAEHGAMYGLFHQDLRIIKPNYESM------------SKSGALRLTDDGYTQASLSKNNRQKRKFPGTDSGPTGKK--------GRPSSDIT-ANVKLPPHGYPLEHPFNKDGYRYILAEPDPHAPFRQEFDESSDWAGKPIPGWLYRILVPHSVLLALHDRAPQLKISEDRLAVTGERGYCMVRATHSVNRGCWYFEVTIEEMPDGAATRLGWGREYGNLQAPLGYDKFGYSWRSRKGTKFTESHGKHYSD-AYVEGDTLG--FLIELPE----------EASLDYLPNTFKDRPLVKFKSHLYYEDKDKITETLKNLHILQGSRIEFFKNGQSQGVAFEDIYAGSYFPAISIHKSATVSVNFGPAFKYPEVLVEHKAKGMHDRVEELITEQCLADTLYLTEHDGRL 549          
BLAST of Set1/Ash2 histone methyltransferase complex subunit ASH2 vs. Ensembl Fly
Match: ash2 (gene:FBgn0000139 transcript:FBtr0084659)

HSP 1 Score: 294.664 bits (753), Expect = 2.497e-94
Identity = 157/324 (48.46%), Postives = 212/324 (65.43%), Query Frame = 1
Query:  808 GKPKRGIEETKVKLTQFNYPVDHPFNKDSYRYIYVESDPHAKGRQLWEECEATAGRIIPGFFYRVTISQQIALATNDRAHQLKLSDSQLSVTGDKGYCMIRATQPVSRGCWYFEAKIVEQPDNSHARIGWSQSLGNLQAPCGFDKFSYACRSRFGTAFHQSKGKHYMNHGYKKGDVLGCMFIASAPNIKRVSKQNLTQALFGKLPESFKERPLIKFKNXXXXXXXXXXXXXXXXLKQLENSKITFYKNGVSYGPAFTDIFDGAYYPAISIYKQASVAVNFGPNFTFPPTDVENWMP-MSERHIDLEVEQTVSDMLWLTEKDDTI 1776
            G+P   I    VKL    YP++HPFNKD YRYI  E DPHA  RQ ++E    AG+ IPG+ YR+ +   + LA +DRA QLK+S+ +L+VTG++GYCM+RAT  V+RGCWYFE  I E PD +  R+GW +  GNLQAP G+DKF Y+ RSR GT F +S GKHY +  Y +GD LG  F+   P           +A    LP +FK+RPL+KFK+  YYE+K++ ++  K L  L+ S+I F+KNG S G AF DI+ G+Y+PAISI+K A+V+VNFGP F +P   VE+    M +R  +L  EQ ++D L+LTE D  +
Sbjct:   34 GRPSSDIT-ANVKLPPHGYPLEHPFNKDGYRYILAEPDPHAPFRQEFDESSDWAGKPIPGWLYRILVPHSVLLALHDRAPQLKISEDRLAVTGERGYCMVRATHSVNRGCWYFEVTIEEMPDGAATRLGWGREYGNLQAPLGYDKFGYSWRSRKGTKFTESHGKHYSD-AYVEGDTLG--FLIELPE----------EASLDYLPNTFKDRPLVKFKSHLYYEDKDKITETLKNLHILQGSRIEFFKNGQSQGVAFEDIYAGSYFPAISIHKSATVSVNFGPAFKYPEVLVEHKAKGMHDRVEELITEQCLADTLYLTEHDGRL 343          
BLAST of Set1/Ash2 histone methyltransferase complex subunit ASH2 vs. Ensembl Fly
Match: ash2 (gene:FBgn0000139 transcript:FBtr0306171)

HSP 1 Score: 194.512 bits (493), Expect = 7.286e-58
Identity = 108/223 (48.43%), Postives = 145/223 (65.02%), Query Frame = 1
Query: 1102 MIRATQPVSRGCWYFEAKIVEQPDNSHARIGWSQSLGNLQAPCGFDKFSYACRSRFGTAFHQSKGKHYMNHGYKKGDVLGCMFIASAPNIKRVSKQNLTQALFGKLPESFKERPLIKFKNXXXXXXXXXXXXXXXXLKQLENSKITFYKNGVSYGPAFTDIFDGAYYPAISIYKQASVAVNFGPNFTFPPTDVENWMP-MSERHIDLEVEQTVSDMLWLTEKD 1767
            M+RAT  V+RGCWYFE  I E PD +  R+GW +  GNLQAP G+DKF Y+ RSR GT F +S GKHY +  Y +GD LG  F+   P           +A    LP +FK+RPL+KFK+  YYE+K++ ++  K L  L+ S+I F+KNG S G AF DI+ G+Y+PAISI+K A+V+VNFGP F +P   VE+    M +R  +L  EQ ++D L+LTE D
Sbjct:    1 MVRATHSVNRGCWYFEVTIEEMPDGAATRLGWGREYGNLQAPLGYDKFGYSWRSRKGTKFTESHGKHYSD-AYVEGDTLG--FLIELPE----------EASLDYLPNTFKDRPLVKFKSHLYYEDKDKITETLKNLHILQGSRIEFFKNGQSQGVAFEDIYAGSYFPAISIHKSATVSVNFGPAFKYPEVLVEHKAKGMHDRVEELITEQCLADTLYLTEHD 210          
BLAST of Set1/Ash2 histone methyltransferase complex subunit ASH2 vs. Ensembl Zebrafish
Match: ash2l (ash2 like, histone lysine methyltransferase complex subunit [Source:ZFIN;Acc:ZDB-GENE-030131-494])

HSP 1 Score: 343.969 bits (881), Expect = 4.619e-110
Identity = 215/549 (39.16%), Postives = 307/549 (55.92%), Query Frame = 1
Query:  184 RDFSIPDFQCSNCNKWFHKHCIGFTIGKAIPFMIAYHFMCKKCNESCEEVFSRKQSNFASMCQTAIANLMYIN-----NGKIYFSKEKDVIPFLEENWEALTTQPKKTFAALNPSIHKTLI-SNDIF---KHHIVG------DDVIVCLKNTNLYQMKPGYDQFRILASQLKTKVTTGGGILPQSGGWHXXXXXXXXXXXXXXXXXXXXXPSATRVGEMVTN---TGKPKRGIEE---TKVKLTQFNYPVDHPFNKDSYRYIYVESDPHAKGRQLWEECEATAGRIIPGFFYRVTISQQIALATNDRAHQLKLSDSQLSVTGDKGYCMIRATQPVSRGCWYFEAKIVEQPDNSHARIGWSQSLGNLQAPCGFDKFSYACRSRFGTAFHQSKGKHYMNHGYKKGDVLGCMFIASAPNIKRVSKQNLTQALFGKLPESFKERPLIKFKNXXXXXXXXXXXXXXXXLKQLENSKITFYKNGVSYGPAFTDIFDGAYYPAISIYKQASVAVNFGPNFTFPPTDVENWMPMSERHIDLEVEQTVSDMLWLTEKD 1767
            R     + QC+ C KWF            +PFM  Y F C  C+ S    F RKQ+N   MC TA+ANL + +     + K  FSK+KD+IPF+++ WE +TT+ +        +I KT+    D+F   +H   G      D     L + +L  + P YD  + +     T VT  GG+   +GG           +             A R  +   +   TG  KR   +   +  +L    YP++HPFNKD YRYI  E DPHA   +  E  +  AG+ IPG  YR  + +++ LA +DRA QLK+SD +L+VTG+KGY M+RA+  V +G W+FE  + E P ++ AR+GWSQ LGNLQAP G+DKFSY+ RS+ GT FHQS GKHY + GY  GD+LG  F    P+    +K          LP+++K++ LIKFK+  Y+EEK+   KAEK LK    S++ F+KNGV+ G A+ D+F+G YYPAIS+YK  +V+VNFGP+F +PP D++ + PMS+      +E T++DML+  E +
Sbjct:   61 RQLGEVELQCALCMKWFTADTFSIDTATCLPFMTNYVFHCNVCHHSGNTYFLRKQANLKEMCLTALANLTWRSRTQEEHPKTMFSKDKDIIPFIDKYWECMTTRQRPGKLTWPNNIVKTMSKERDVFLVKEHPDPGSKDPEEDYPKFGLLDQDLGNIGPSYDNQKQM-----TTVTGAGGL---NGG--------STFSGGLPSAATGKGRGAKRKQQQQQDGAATGAAKRTRSDPLFSAQRLPPHGYPLEHPFNKDGYRYILAEPDPHAPDPEKLE-LDCWAGKPIPGDLYRACLYERVLLALHDRAPQLKISDDRLTVTGEKGYSMVRASHGVRKGSWFFEVTVDEMPQDAAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTRFHQSIGKHYSD-GYGLGDILG--FFIELPDETETAK---------ALPDTYKDKALIKFKSYLYFEEKDYVDKAEKNLKPTSTSRMIFFKNGVNQGVAYEDLFEGMYYPAISLYKGCTVSVNFGPHFKYPPKDIK-FQPMSDMGWGAVIEHTLADMLYHVETE 579          
BLAST of Set1/Ash2 histone methyltransferase complex subunit ASH2 vs. Ensembl Zebrafish
Match: ash2l (ash2 like, histone lysine methyltransferase complex subunit [Source:ZFIN;Acc:ZDB-GENE-030131-494])

HSP 1 Score: 257.299 bits (656), Expect = 2.386e-78
Identity = 160/435 (36.78%), Postives = 225/435 (51.72%), Query Frame = 1
Query:  184 RDFSIPDFQCSNCNKWFHKHCIGFTIGKAIPFMIAYHFMCKKCNESCEEVFSRKQSNFASMCQTAIANLMYIN-----NGKIYFSKEKDVIPFLEENWEALTTQPKKTFAALNPSIHKTLI-SNDIF---KHHIVG------DDVIVCLKNTNLYQMKPGYDQFRILASQLKTKVTTGGGILPQSGGWHXXXXXXXXXXXXXXXXXXXXXPSATRVGEMVTNTGKPKRGIEE---TKVKLTQFNYPVDHPFNKDSYRYIYVESDPHAKGRQLWEECEATAGRIIPGFFYRVTISQQIALATNDRAHQLKLSDSQLSVTGDKGYCMIRATQPVSRGCWYFEAKIVEQPDNSHARIGWSQSLGNLQAPCGFDKFSYACRSRFGTAFHQSKGKHYMNHGYKKGDVLGCMFIASAPNIKRVSKQNLTQALFGKLPESFK 1434
            R     + QC+ C KWF            +PFM  Y F C  C+ S    F RKQ+N   MC TA+ANL + +     + K  FSK+KD+IPF+++ WE +TT+ +        +I KT+    D+F   +H   G      D     L + +L  + P YD  + +     T VT  GG+   +GG  +    +                           TG  KR   +   +  +L    YP++HPFNKD YRYI  E DPHA   +  E  +  AG+ IPG  YR  + +++ LA +DRA QLK+SD +L+VTG+KGY M+RA+  V +G W+FE  + E P ++ AR+GWSQ LGNLQAP G+DKFSY+ RS+ GT FHQS GKHY + GY  GD+LG  F    P+    +K          LP+++K
Sbjct:   61 RQLGEVELQCALCMKWFTADTFSIDTATCLPFMTNYVFHCNVCHHSGNTYFLRKQANLKEMCLTALANLTWRSRTQEEHPKTMFSKDKDIIPFIDKYWECMTTRQRPGKLTWPNNIVKTMSKERDVFLVKEHPDPGSKDPEEDYPKFGLLDQDLGNIGPSYDNQKQM-----TTVTGAGGL---NGGLPSAATGKGRGAKRKQQQQQDG-----------AATGAAKRTRSDPLFSAQRLPPHGYPLEHPFNKDGYRYILAEPDPHAPDPEKLE-LDCWAGKPIPGDLYRACLYERVLLALHDRAPQLKISDDRLTVTGEKGYSMVRASHGVRKGSWFFEVTVDEMPQDAAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTRFHQSIGKHYSD-GYGLGDILG--FFIELPDETETAK---------ALPDTYK 463          
BLAST of Set1/Ash2 histone methyltransferase complex subunit ASH2 vs. Ensembl Zebrafish
Match: ash2l (ash2 like, histone lysine methyltransferase complex subunit [Source:ZFIN;Acc:ZDB-GENE-030131-494])

HSP 1 Score: 85.5001 bits (210), Expect = 5.233e-18
Identity = 58/181 (32.04%), Postives = 84/181 (46.41%), Query Frame = 1
Query:  184 RDFSIPDFQCSNCNKWFHKHCIGFTIGKAIPFMIAYHFMCKKCNESCEEVFSRKQSNFASMCQTAIANLMYINNG-----KIYFSKEKDVIPFLEENWEALTTQPKKTFAALNPSIHKTLI-SNDIF---KHHIVG------DDVIVCLKNTNLYQMKPGYDQFRILASQLKTKVTTGGGI 681
            R     + QC+ C KWF            +PFM  Y F C  C+ S    F RKQ+N   MC TA+ANL + +       K  FSK+KD+IPF+++ WE +TT+ +        +I KT+    D+F   +H   G      D     L + +L  + P YD  + +     T VT  GG+
Sbjct:   59 RQLGEVELQCALCMKWFTADTFSIDTATCLPFMTNYVFHCNVCHHSGNTYFLRKQANLKEMCLTALANLTWRSRTQEEHPKTMFSKDKDIIPFIDKYWECMTTRQRPGKLTWPNNIVKTMSKERDVFLVKEHPDPGSKDPEEDYPKFGLLDQDLGNIGPSYDNQKQM-----TTVTGAGGL 234          
BLAST of Set1/Ash2 histone methyltransferase complex subunit ASH2 vs. Ensembl Zebrafish
Match: mtf2 (metal response element binding transcription factor 2 [Source:ZFIN;Acc:ZDB-GENE-060512-94])

HSP 1 Score: 56.6102 bits (135), Expect = 6.153e-8
Identity = 31/102 (30.39%), Postives = 49/102 (48.04%), Query Frame = 1
Query:  166 CYCNTQRDFSIPDFQCSNCNKWFHKHCIGFTIGKAIPFMIAYHFMCKKCNESCEEVFSRKQSNFASMCQTAIANLMYINNGKIYFSKEKDVIPFLEENWEAL 471
            CYC    D+ +   QC+ C +WFH+ CI       +     Y F+C  CN S  E   R    +  +   ++ NL  I+  K YF  E +++ ++ ENW+ L
Sbjct:  209 CYCGGPGDWYLKMLQCNKCKQWFHEACIQCFQKPMLFGDRFYLFICSVCN-SGPEYLKRLPLRWVDVAHLSLYNLSVIHKKK-YFDSELELMTYINENWDRL 308          
BLAST of Set1/Ash2 histone methyltransferase complex subunit ASH2 vs. Ensembl Zebrafish
Match: mtf2 (metal response element binding transcription factor 2 [Source:ZFIN;Acc:ZDB-GENE-060512-94])

HSP 1 Score: 56.6102 bits (135), Expect = 7.266e-8
Identity = 31/102 (30.39%), Postives = 49/102 (48.04%), Query Frame = 1
Query:  166 CYCNTQRDFSIPDFQCSNCNKWFHKHCIGFTIGKAIPFMIAYHFMCKKCNESCEEVFSRKQSNFASMCQTAIANLMYINNGKIYFSKEKDVIPFLEENWEAL 471
            CYC    D+ +   QC+ C +WFH+ CI       +     Y F+C  CN S  E   R    +  +   ++ NL  I+  K YF  E +++ ++ ENW+ L
Sbjct:  202 CYCGGPGDWYLKMLQCNKCKQWFHEACIQCFQKPMLFGDRFYLFICSVCN-SGPEYLKRLPLRWVDVAHLSLYNLSVIHKKK-YFDSELELMTYINENWDRL 301          
BLAST of Set1/Ash2 histone methyltransferase complex subunit ASH2 vs. Ensembl Xenopus
Match: rab3c (RAB3C, member RAS oncogene family [Source:Xenbase;Acc:XB-GENE-494770])

HSP 1 Score: 344.354 bits (882), Expect = 4.070e-110
Identity = 216/538 (40.15%), Postives = 306/538 (56.88%), Query Frame = 1
Query:  202 DFQCSNCNKWFHKHCIGFTIGKAIPFMIAYHFMCKKCNESCEEVFSRKQSNFASMCQTAIANLMYINNG-----KIYFSKEKDVIPFLEENWEALTTQPKKTFAALNPSIHKTLI-SNDIF---KHHIVG------DDVIVCLKNTNLYQMKPGYDQFRILASQLKTKVTTGGGILPQSGGWHXXXXXXXXXXXXXXXXXXXXXPSATRVGEMVTNTGKPKRGIEE---TKVKLTQFNYPVDHPFNKDSYRYIYVESDPHAKGRQLWEECEATAGRIIPGFFYRVTISQQIALATNDRAHQLKLSDSQLSVTGDKGYCMIRATQPVSRGCWYFEAKIVEQPDNSHARIGWSQSLGNLQAPCGFDKFSYACRSRFGTAFHQSKGKHYMNHGYKKGDVLGCMFIASAPNIKRVSKQNLTQALFGKLPESFKERPLIKFKNXXXXXXXXXXXXXXXXLKQLENSKITFYKNGVSYGPAFTDIFDGAYYPAISIYKQASVAVNFGPNFTFPPTDVENWMPMSERHIDLEVEQTVSDMLWLTE 1761
            + QC  C KWF     G      +PFM  Y F C  C+ S    F RKQ+N   MC T +ANL + +       K  FSK+KD+IPF+++ WE+LTT+ +        SI KT+    D+F   +H   G      D     L + +L  + P YD      +Q ++   + GG L                N +A  ++ A    A R  +   +T   KR   +   +  +L    YP++HPFNKD YRYI  E DPHA   +  E  +  AG+ IPG  YR  + +++ LA +DRA QLK+SD +L+V G+KGY M+RA+  V +G WYFE  + E P ++ AR+GWSQ+LGNLQAP G+DKFSY+ RS+ GT FHQS GKHY +  Y +GD LG  F    P++   ++          LP+++K++ LIKFK+  Y+EEK+   KAEK LKQ   S+I FYKNGV+ G A+ D+F+G YYPAIS+YK  +V++NFGP+F +PP DV ++ PMS+   +  VE T++DM +  E
Sbjct:   76 ELQCGICMKWFGADTFGIDTTSCLPFMTNYSFHCNVCHHSGNTYFLRKQANLKEMCLTGLANLTWQSRNQDEHPKTMFSKDKDIIPFIDKYWESLTTRQRPGKMTWPNSIVKTMTKERDVFLVKEHPDPGSKDPEEDYPKFGLLDQDLGNIGPAYD------NQKQSNAVSIGGSL----------------NGSAAASSSAKGRGAKRKQQDGGSTSTAKRTRSDPLFSAQRLPPHGYPLEHPFNKDGYRYILAEPDPHAPDPEKLE-LDCWAGKPIPGDLYRACLYERVLLALHDRAPQLKISDDRLTVLGEKGYSMVRASHGVRKGAWYFEIFVDEMPPDTAARLGWSQALGNLQAPLGYDKFSYSWRSKKGTRFHQSIGKHY-SESYGQGDTLG--FYICLPDLTETAQA---------LPDTYKDKALIKFKSYLYFEEKDFVDKAEKSLKQCPGSEIVFYKNGVNKGLAYKDMFEGVYYPAISLYKGCTVSINFGPHFKYPPKDV-SFRPMSDMAWEAVVEHTLADMFYHVE 577          
BLAST of Set1/Ash2 histone methyltransferase complex subunit ASH2 vs. Ensembl Xenopus
Match: rab3c (RAB3C, member RAS oncogene family [Source:Xenbase;Acc:XB-GENE-494770])

HSP 1 Score: 318.546 bits (815), Expect = 4.329e-100
Identity = 209/546 (38.28%), Postives = 298/546 (54.58%), Query Frame = 1
Query:  184 RDFSIPDFQCSNCNKWFHKHCIGFTIGKAIPFMIAYHFMCKKCNESCEEVFSRKQSNFASMCQTAIANLMYINNG-----KIYFSKEKDVIPFLEENWEALTTQPKKTFAALNPSIHKTLI-SNDIF---KHHIVG------DDVIVCLKNTNLYQMKPGYDQFRILASQLKTKVTTGGGILPQSGGWHXXXXXXXXXXXXXXXXXXXXXPSATRVGEMVTNTGKPKRGIEE---TKVKLTQFNYPVDHPFNKDSYRYIYVESDPHAKGRQLWEECEATAGRIIPGFFYRVTISQQIALATNDRAHQLKLSDSQLSVTGDKGYCMIRATQPVSRGCWYFEAKIVEQPDNSHARIGWSQSLGNLQAPCGFDKFSYACRSRFGTAFHQSKGKHYMNHGYKKGDVLGCMFIASAPNIKRVSKQNLTQALFGKLPESFKERPLIKFKNXXXXXXXXXXXXXXXXLKQLENSKITFYKNGVSYGPAFTDIFDGAYYPAISIYKQASVAVNFGPNFTFPPTDVENWMPMSERHIDLEVEQTVSDMLWLTEKD 1767
            R     + QC  C KWF     G      +PFM  Y F C  C+ S    F RKQ+N   MC T +ANL + +       K  FSK+KD+IPF+++ WE+LTT+ +        SI KT+    D+F   +H   G      D     L + +L  + P YD      +Q ++   + GG L                N +A  ++ A    A R  +   +T   KR   +   +  +L    YP++HPFNKD YRYI  E DPHA   +  E  +  AG+ IPG  YR  + +++ LA +DRA QLK+SD +L+V G+KGY M+RA+  V +G WYFE  + E P ++ AR+GWSQ+LGNLQAP G+DKFSY+ RS+ GT FHQS GKHY +  Y +GD LG  F    P++   ++          LP+++K++ LIKFK+  Y+EEK+   KAEK LKQ   S+I FYKNGV+ G A+ D+F+G YYPAIS+YK     +N   ++T P     + + MS+   +  VE T++DM +  E +
Sbjct:   73 RQLGDIELQCGICMKWFGADTFGIDTTSCLPFMTNYSFHCNVCHHSGNTYFLRKQANLKEMCLTGLANLTWQSRNQDEHPKTMFSKDKDIIPFIDKYWESLTTRQRPGKMTWPNSIVKTMTKERDVFLVKEHPDPGSKDPEEDYPKFGLLDQDLGNIGPAYD------NQKQSNAVSIGGSL----------------NGSAAASSSAKGRGAKRKQQDGGSTSTAKRTRSDPLFSAQRLPPHGYPLEHPFNKDGYRYILAEPDPHAPDPEKLE-LDCWAGKPIPGDLYRACLYERVLLALHDRAPQLKISDDRLTVLGEKGYSMVRASHGVRKGAWYFEIFVDEMPPDTAARLGWSQALGNLQAPLGYDKFSYSWRSKKGTRFHQSIGKHY-SESYGQGDTLG--FYICLPDLTETAQ---------ALPDTYKDKALIKFKSYLYFEEKDFVDKAEKSLKQCPGSEIVFYKNGVNKGLAYKDMFEGVYYPAISLYK----GINPSKHYTKPTMFFSSLLQMSDMAWEAVVEHTLADMFYHVETE 579          
BLAST of Set1/Ash2 histone methyltransferase complex subunit ASH2 vs. Ensembl Xenopus
Match: rab3c (RAB3C, member RAS oncogene family [Source:Xenbase;Acc:XB-GENE-494770])

HSP 1 Score: 294.664 bits (753), Expect = 4.544e-91
Identity = 202/549 (36.79%), Postives = 290/549 (52.82%), Query Frame = 1
Query:  202 DFQCSNCNKWFHKHCIGFTIGKAIPFMIAYHFMCKKCNESCEEVFSRKQSNFASMCQTAIANLMYINNG-----KIYFSKEKDVIPFLEENWEALTTQPKKTFAALNPSIHKTLI-SNDIF---KHHIVG------DDVIVCLKNTNLYQMKPGYDQFRILASQLKTKVTTGGGILPQSGGWHXXXXXXXXXXXXXXXXXXXXXPSATRVGEMVTNTGKPKRGIEE---TKVKLTQFNYPVDHPFNKDSYRYIYVESDPHAKGRQLWEECEATAGRIIPGFFYRVTISQQIALATNDRAHQLKLSDSQLSVTGDKGYCMIRATQPVSRGCWYFEAKIVEQPDNSHARIGWSQSLGNLQAPCGFDKFSYACRSRFGTAFHQSKGKHYMNHGYKKGDVLGCMFIASAPNIKRVSKQNLTQALFGKLPESFKERPLIKFKNXXXXXXXXXXXXXXXXLKQLENSKITFYKNGVSYGPAFTDIFDGAYYPAISIY---------KQASVAVNFGPNFTFPPTDVENWMPMSERHIDLEVEQTVSDMLWLTEKD 1767
            + QC  C KWF     G      +PFM  Y F C  C+ S    F RKQ+N   MC T +ANL + +       K  FSK+KD+IPF+++ WE+LTT+ +        SI KT+    D+F   +H   G      D     L + +L  + P YD      +Q ++   + GG L                N +A  ++ A    A R  +   +T   KR   +   +  +L    YP++HPFNKD YRYI  E DPHA   +  E  +  AG+ IPG  YR  + +++ LA +DRA QLK+SD +L+V G+KGY M+RA+  V +G WYFE  + E P ++ AR+GWSQ+LGNLQAP G+DKFSY+ RS+ GT FHQS GKHY +  Y +GD LG  F    P++   ++          LP+++K++ LIKFK+  Y+EEK+   KAEK LKQ   S++         G       +  YYP IS +             V++NFGP+F +PP DV ++ PMS+   +  VE T++DM +  E +
Sbjct:   74 ELQCGICMKWFGADTFGIDTTSCLPFMTNYSFHCNVCHHSGNTYFLRKQANLKEMCLTGLANLTWQSRNQDEHPKTMFSKDKDIIPFIDKYWESLTTRQRPGKMTWPNSIVKTMTKERDVFLVKEHPDPGSKDPEEDYPKFGLLDQDLGNIGPAYD------NQKQSNAVSIGGSL----------------NGSAAASSSAKGRGAKRKQQDGGSTSTAKRTRSDPLFSAQRLPPHGYPLEHPFNKDGYRYILAEPDPHAPDPEKLE-LDCWAGKPIPGDLYRACLYERVLLALHDRAPQLKISDDRLTVLGEKGYSMVRASHGVRKGAWYFEIFVDEMPPDTAARLGWSQALGNLQAPLGYDKFSYSWRSKKGTRFHQSIGKHY-SESYGQGDTLG--FYICLPDLTETAQ---------ALPDTYKDKALIKFKSYLYFEEKDFVDKAEKSLKQCPGSEV---------GVGRVRELEPKYYPQISEFFNNLLCTCQHNHGVSINFGPHFKYPPKDV-SFRPMSDMAWEAVVEHTLADMFYHVETE 577          
BLAST of Set1/Ash2 histone methyltransferase complex subunit ASH2 vs. Ensembl Xenopus
Match: rab3c (RAB3C, member RAS oncogene family [Source:Xenbase;Acc:XB-GENE-494770])

HSP 1 Score: 295.049 bits (754), Expect = 5.254e-91
Identity = 203/549 (36.98%), Postives = 291/549 (53.01%), Query Frame = 1
Query:  202 DFQCSNCNKWFHKHCIGFTIGKAIPFMIAYHFMCKKCNESCEEVFSRKQSNFASMCQTAIANLMYINNG-----KIYFSKEKDVIPFLEENWEALTTQPKKTFAALNPSIHKTLI-SNDIF---KHHIVG------DDVIVCLKNTNLYQMKPGYDQFRILASQLKTKVTTGGGILPQSGGWHXXXXXXXXXXXXXXXXXXXXXPSATRVGEMVTNTGKPKRGIEE---TKVKLTQFNYPVDHPFNKDSYRYIYVESDPHAKGRQLWEECEATAGRIIPGFFYRVTISQQIALATNDRAHQLKLSDSQLSVTGDKGYCMIRATQPVSRGCWYFEAKIVEQPDNSHARIGWSQSLGNLQAPCGFDKFSYACRSRFGTAFHQSKGKHYMNHGYKKGDVLGCMFIASAPNIKRVSKQNLTQALFGKLPESFKERPLIKFKNXXXXXXXXXXXXXXXXLKQLENSKITFYKNGVSYGPAFTDIFDGAYYPAISIY---------KQASVAVNFGPNFTFPPTDVENWMPMSERHIDLEVEQTVSDMLWLTEKD 1767
            + QC  C KWF     G      +PFM  Y F C  C+ S    F RKQ+N   MC T +ANL + +       K  FSK+KD+IPF+++ WE+LTT+ +        SI KT+    D+F   +H   G      D     L + +L  + P YD      +Q ++   + GG L         N K      +A  ++ A    A R  +   +T   KR   +   +  +L    YP++HPFNKD YRYI  E DPHA   +  E  +  AG+ IPG  YR  + +++ LA +DRA QLK+SD +L+V G+KGY M+RA+  V +G WYFE  + E P ++ AR+GWSQ+LGNLQAP G+DKFSY+ RS+ GT FHQS GKHY +  Y +GD LG  F    P++   ++          LP+++K++ LIKFK+  Y+EEK+   KAEK LKQ   S++         G       +  YYP IS +             V++NFGP+F +PP DV ++ PMS+   +  VE T++DM +  E +
Sbjct:   76 ELQCGICMKWFGADTFGIDTTSCLPFMTNYSFHCNVCHHSGNTYFLRKQANLKEMCLTGLANLTWQSRNQDEHPKTMFSKDKDIIPFIDKYWESLTTRQRPGKMTWPNSIVKTMTKERDVFLVKEHPDPGSKDPEEDYPKFGLLDQDLGNIGPAYD------NQKQSNAVSIGGSL---------NGKEVYFVGSAAASSSAKGRGAKRKQQDGGSTSTAKRTRSDPLFSAQRLPPHGYPLEHPFNKDGYRYILAEPDPHAPDPEKLE-LDCWAGKPIPGDLYRACLYERVLLALHDRAPQLKISDDRLTVLGEKGYSMVRASHGVRKGAWYFEIFVDEMPPDTAARLGWSQALGNLQAPLGYDKFSYSWRSKKGTRFHQSIGKHY-SESYGQGDTLG--FYICLPDLTETAQ---------ALPDTYKDKALIKFKSYLYFEEKDFVDKAEKSLKQCPGSEV---------GVGRVRELEPKYYPQISEFFNNLLCTCQHNHGVSINFGPHFKYPPKDV-SFRPMSDMAWEAVVEHTLADMFYHVETE 586          
BLAST of Set1/Ash2 histone methyltransferase complex subunit ASH2 vs. Ensembl Xenopus
Match: rab3c (RAB3C, member RAS oncogene family [Source:Xenbase;Acc:XB-GENE-494770])

HSP 1 Score: 294.278 bits (752), Expect = 7.906e-91
Identity = 203/549 (36.98%), Postives = 291/549 (53.01%), Query Frame = 1
Query:  202 DFQCSNCNKWFHKHCIGFTIGKAIPFMIAYHFMCKKCNESCEEVFSRKQSNFASMCQTAIANLMYINNG-----KIYFSKEKDVIPFLEENWEALTTQPKKTFAALNPSIHKTLI-SNDIF---KHHIVG------DDVIVCLKNTNLYQMKPGYDQFRILASQLKTKVTTGGGILPQSGGWHXXXXXXXXXXXXXXXXXXXXXPSATRVGEMVTNTGKPKRGIEE---TKVKLTQFNYPVDHPFNKDSYRYIYVESDPHAKGRQLWEECEATAGRIIPGFFYRVTISQQIALATNDRAHQLKLSDSQLSVTGDKGYCMIRATQPVSRGCWYFEAKIVEQPDNSHARIGWSQSLGNLQAPCGFDKFSYACRSRFGTAFHQSKGKHYMNHGYKKGDVLGCMFIASAPNIKRVSKQNLTQALFGKLPESFKERPLIKFKNXXXXXXXXXXXXXXXXLKQLENSKITFYKNGVSYGPAFTDIFDGAYYPAISIY---------KQASVAVNFGPNFTFPPTDVENWMPMSERHIDLEVEQTVSDMLWLTEKD 1767
            + QC  C KWF     G      +PFM  Y F C  C+ S    F RKQ+N   MC T +ANL + +       K  FSK+KD+IPF+++ WE+LTT+ +        SI KT+    D+F   +H   G      D     L + +L  + P YD      +Q ++   + GG L         N K      +A  ++ A    A R  +   +T   KR   +   +  +L    YP++HPFNKD YRYI  E DPHA   +  E  +  AG+ IPG  YR  + +++ LA +DRA QLK+SD +L+V G+KGY M+RA+  V +G WYFE  + E P ++ AR+GWSQ+LGNLQAP G+DKFSY+ RS+ GT FHQS GKHY +  Y +GD LG  F    P++   ++          LP+++K++ LIKFK+  Y+EEK+   KAEK LKQ   S++         G       +  YYP IS +             V++NFGP+F +PP DV ++ PMS+   +  VE T++DM +  E +
Sbjct:   68 ELQCGICMKWFGADTFGIDTTSCLPFMTNYSFHCNVCHHSGNTYFLRKQANLKEMCLTGLANLTWQSRNQDEHPKTMFSKDKDIIPFIDKYWESLTTRQRPGKMTWPNSIVKTMTKERDVFLVKEHPDPGSKDPEEDYPKFGLLDQDLGNIGPAYD------NQKQSNAVSIGGSL---------NGKEVYFVGSAAASSSAKGRGAKRKQQDGGSTSTAKRTRSDPLFSAQRLPPHGYPLEHPFNKDGYRYILAEPDPHAPDPEKLE-LDCWAGKPIPGDLYRACLYERVLLALHDRAPQLKISDDRLTVLGEKGYSMVRASHGVRKGAWYFEIFVDEMPPDTAARLGWSQALGNLQAPLGYDKFSYSWRSKKGTRFHQSIGKHY-SESYGQGDTLG--FYICLPDLTETAQ---------ALPDTYKDKALIKFKSYLYFEEKDFVDKAEKSLKQCPGSEV---------GVGRVRELEPKYYPQISEFFNNLLCTCQHNHGVSINFGPHFKYPPKDV-SFRPMSDMAWEAVVEHTLADMFYHVETE 578          
BLAST of Set1/Ash2 histone methyltransferase complex subunit ASH2 vs. Ensembl Mouse
Match: Ash2l (ASH2 like histone lysine methyltransferase complex subunit [Source:MGI Symbol;Acc:MGI:1344416])

HSP 1 Score: 350.132 bits (897), Expect = 3.523e-113
Identity = 216/546 (39.56%), Postives = 304/546 (55.68%), Query Frame = 1
Query:  184 RDFSIPDFQCSNCNKWFHKHCIGFTIGKAIPFMIAYHFMCKKCNESCEEVFSRKQSNFASMCQTAIANLMYIN-----NGKIYFSKEKDVIPFLEENWEALTTQPKKTFAALNPSIHKTLI-SNDIF---KHHIVG------DDVIVCLKNTNLYQMKPGYDQFRILASQLKTKVTTGGGILPQSGGWHXXXXXXXXXXXXXXXXXXXXXPSATRVGEMVTNTGKPKRGIEE---TKVKLTQFNYPVDHPFNKDSYRYIYVESDPHAKGRQLWEECEATAGRIIPGFFYRVTISQQIALATNDRAHQLKLSDSQLSVTGDKGYCMIRATQPVSRGCWYFEAKIVEQPDNSHARIGWSQSLGNLQAPCGFDKFSYACRSRFGTAFHQSKGKHYMNHGYKKGDVLGCMFIASAPNIKRVSKQNLTQALFGKLPESFKERPLIKFKNXXXXXXXXXXXXXXXXLKQLENSKITFYKNGVSYGPAFTDIFDGAYYPAISIYKQASVAVNFGPNFTFPPTDVENWMPMSERHIDLEVEQTVSDMLWLTEKD 1767
            R     + QC  C KWF     G      +PFM  Y F C  C+ S    F RKQ+N   MC +A+ANL + +     + K  FSK+KD+IPF+++ WE +TT+ +        +I KT+    D+F   +H   G      D     L + +L  + P YD  +  +S +       GGI   S G                         A R  +    TG  K+   +   +  +L    YP++HPFNKD YRYI  E DPHA   +  E  +  AG+ IPG  YR  + +++ LA +DRA QLK+SD +L+V G+KGY M+RA+  V +G WYFE  + E P ++ AR+GWSQ LGNLQAP G+DKFSY+ RS+ GT FHQS GKHY + GY +GDVLG  F  + P     +K          LP+++K++ LIKFK+  Y+EEK+   KAEK LKQ  +S+I FYKNGV+ G A+ DIF+G Y+PAIS+YK  +V++NFGP+F +PP D+  + PMS+      VE T++D+L+  E +
Sbjct:   14 RQLGEVELQCGICTKWFTADTFGIDTSSCLPFMTNYSFHCNVCHHSGNTYFLRKQANLKEMCLSALANLTWQSRTQDEHPKTMFSKDKDIIPFIDKYWECMTTRQRPGKMTWPNNIVKTMSKERDVFLVKEHPDPGSKDPEEDYPKFGLLDQDLSNIGPAYDNQK-QSSAVSASGNLNGGIAAGSSG---------------------KGRGAKRKQQDGGTTGTTKKARSDPLFSAQRLPPHGYPLEHPFNKDGYRYILAEPDPHAPDPEKLE-LDCWAGKPIPGDLYRACLYERVLLALHDRAPQLKISDDRLTVVGEKGYSMVRASHGVRKGAWYFEITVDEMPPDTAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTKFHQSIGKHY-SSGYGQGDVLG--FYINLPEDTETAKS---------LPDTYKDKALIKFKSYLYFEEKDFVDKAEKSLKQTPHSEIIFYKNGVNQGVAYRDIFEGVYFPAISLYKSCTVSINFGPSFKYPPKDL-TYHPMSDMGWGAVVEHTLADVLYHVETE 523          
BLAST of Set1/Ash2 histone methyltransferase complex subunit ASH2 vs. Ensembl Mouse
Match: Ash2l (ASH2 like histone lysine methyltransferase complex subunit [Source:MGI Symbol;Acc:MGI:1344416])

HSP 1 Score: 350.132 bits (897), Expect = 3.523e-113
Identity = 216/546 (39.56%), Postives = 304/546 (55.68%), Query Frame = 1
Query:  184 RDFSIPDFQCSNCNKWFHKHCIGFTIGKAIPFMIAYHFMCKKCNESCEEVFSRKQSNFASMCQTAIANLMYIN-----NGKIYFSKEKDVIPFLEENWEALTTQPKKTFAALNPSIHKTLI-SNDIF---KHHIVG------DDVIVCLKNTNLYQMKPGYDQFRILASQLKTKVTTGGGILPQSGGWHXXXXXXXXXXXXXXXXXXXXXPSATRVGEMVTNTGKPKRGIEE---TKVKLTQFNYPVDHPFNKDSYRYIYVESDPHAKGRQLWEECEATAGRIIPGFFYRVTISQQIALATNDRAHQLKLSDSQLSVTGDKGYCMIRATQPVSRGCWYFEAKIVEQPDNSHARIGWSQSLGNLQAPCGFDKFSYACRSRFGTAFHQSKGKHYMNHGYKKGDVLGCMFIASAPNIKRVSKQNLTQALFGKLPESFKERPLIKFKNXXXXXXXXXXXXXXXXLKQLENSKITFYKNGVSYGPAFTDIFDGAYYPAISIYKQASVAVNFGPNFTFPPTDVENWMPMSERHIDLEVEQTVSDMLWLTEKD 1767
            R     + QC  C KWF     G      +PFM  Y F C  C+ S    F RKQ+N   MC +A+ANL + +     + K  FSK+KD+IPF+++ WE +TT+ +        +I KT+    D+F   +H   G      D     L + +L  + P YD  +  +S +       GGI   S G                         A R  +    TG  K+   +   +  +L    YP++HPFNKD YRYI  E DPHA   +  E  +  AG+ IPG  YR  + +++ LA +DRA QLK+SD +L+V G+KGY M+RA+  V +G WYFE  + E P ++ AR+GWSQ LGNLQAP G+DKFSY+ RS+ GT FHQS GKHY + GY +GDVLG  F  + P     +K          LP+++K++ LIKFK+  Y+EEK+   KAEK LKQ  +S+I FYKNGV+ G A+ DIF+G Y+PAIS+YK  +V++NFGP+F +PP D+  + PMS+      VE T++D+L+  E +
Sbjct:   14 RQLGEVELQCGICTKWFTADTFGIDTSSCLPFMTNYSFHCNVCHHSGNTYFLRKQANLKEMCLSALANLTWQSRTQDEHPKTMFSKDKDIIPFIDKYWECMTTRQRPGKMTWPNNIVKTMSKERDVFLVKEHPDPGSKDPEEDYPKFGLLDQDLSNIGPAYDNQK-QSSAVSASGNLNGGIAAGSSG---------------------KGRGAKRKQQDGGTTGTTKKARSDPLFSAQRLPPHGYPLEHPFNKDGYRYILAEPDPHAPDPEKLE-LDCWAGKPIPGDLYRACLYERVLLALHDRAPQLKISDDRLTVVGEKGYSMVRASHGVRKGAWYFEITVDEMPPDTAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTKFHQSIGKHY-SSGYGQGDVLG--FYINLPEDTETAKS---------LPDTYKDKALIKFKSYLYFEEKDFVDKAEKSLKQTPHSEIIFYKNGVNQGVAYRDIFEGVYFPAISLYKSCTVSINFGPSFKYPPKDL-TYHPMSDMGWGAVVEHTLADVLYHVETE 523          
BLAST of Set1/Ash2 histone methyltransferase complex subunit ASH2 vs. Ensembl Mouse
Match: Ash2l (ASH2 like histone lysine methyltransferase complex subunit [Source:MGI Symbol;Acc:MGI:1344416])

HSP 1 Score: 350.132 bits (897), Expect = 3.523e-113
Identity = 216/546 (39.56%), Postives = 304/546 (55.68%), Query Frame = 1
Query:  184 RDFSIPDFQCSNCNKWFHKHCIGFTIGKAIPFMIAYHFMCKKCNESCEEVFSRKQSNFASMCQTAIANLMYIN-----NGKIYFSKEKDVIPFLEENWEALTTQPKKTFAALNPSIHKTLI-SNDIF---KHHIVG------DDVIVCLKNTNLYQMKPGYDQFRILASQLKTKVTTGGGILPQSGGWHXXXXXXXXXXXXXXXXXXXXXPSATRVGEMVTNTGKPKRGIEE---TKVKLTQFNYPVDHPFNKDSYRYIYVESDPHAKGRQLWEECEATAGRIIPGFFYRVTISQQIALATNDRAHQLKLSDSQLSVTGDKGYCMIRATQPVSRGCWYFEAKIVEQPDNSHARIGWSQSLGNLQAPCGFDKFSYACRSRFGTAFHQSKGKHYMNHGYKKGDVLGCMFIASAPNIKRVSKQNLTQALFGKLPESFKERPLIKFKNXXXXXXXXXXXXXXXXLKQLENSKITFYKNGVSYGPAFTDIFDGAYYPAISIYKQASVAVNFGPNFTFPPTDVENWMPMSERHIDLEVEQTVSDMLWLTEKD 1767
            R     + QC  C KWF     G      +PFM  Y F C  C+ S    F RKQ+N   MC +A+ANL + +     + K  FSK+KD+IPF+++ WE +TT+ +        +I KT+    D+F   +H   G      D     L + +L  + P YD  +  +S +       GGI   S G                         A R  +    TG  K+   +   +  +L    YP++HPFNKD YRYI  E DPHA   +  E  +  AG+ IPG  YR  + +++ LA +DRA QLK+SD +L+V G+KGY M+RA+  V +G WYFE  + E P ++ AR+GWSQ LGNLQAP G+DKFSY+ RS+ GT FHQS GKHY + GY +GDVLG  F  + P     +K          LP+++K++ LIKFK+  Y+EEK+   KAEK LKQ  +S+I FYKNGV+ G A+ DIF+G Y+PAIS+YK  +V++NFGP+F +PP D+  + PMS+      VE T++D+L+  E +
Sbjct:   14 RQLGEVELQCGICTKWFTADTFGIDTSSCLPFMTNYSFHCNVCHHSGNTYFLRKQANLKEMCLSALANLTWQSRTQDEHPKTMFSKDKDIIPFIDKYWECMTTRQRPGKMTWPNNIVKTMSKERDVFLVKEHPDPGSKDPEEDYPKFGLLDQDLSNIGPAYDNQK-QSSAVSASGNLNGGIAAGSSG---------------------KGRGAKRKQQDGGTTGTTKKARSDPLFSAQRLPPHGYPLEHPFNKDGYRYILAEPDPHAPDPEKLE-LDCWAGKPIPGDLYRACLYERVLLALHDRAPQLKISDDRLTVVGEKGYSMVRASHGVRKGAWYFEITVDEMPPDTAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTKFHQSIGKHY-SSGYGQGDVLG--FYINLPEDTETAKS---------LPDTYKDKALIKFKSYLYFEEKDFVDKAEKSLKQTPHSEIIFYKNGVNQGVAYRDIFEGVYFPAISLYKSCTVSINFGPSFKYPPKDL-TYHPMSDMGWGAVVEHTLADVLYHVETE 523          
BLAST of Set1/Ash2 histone methyltransferase complex subunit ASH2 vs. Ensembl Mouse
Match: Ash2l (ASH2 like histone lysine methyltransferase complex subunit [Source:MGI Symbol;Acc:MGI:1344416])

HSP 1 Score: 351.288 bits (900), Expect = 1.875e-112
Identity = 216/546 (39.56%), Postives = 304/546 (55.68%), Query Frame = 1
Query:  184 RDFSIPDFQCSNCNKWFHKHCIGFTIGKAIPFMIAYHFMCKKCNESCEEVFSRKQSNFASMCQTAIANLMYIN-----NGKIYFSKEKDVIPFLEENWEALTTQPKKTFAALNPSIHKTLI-SNDIF---KHHIVG------DDVIVCLKNTNLYQMKPGYDQFRILASQLKTKVTTGGGILPQSGGWHXXXXXXXXXXXXXXXXXXXXXPSATRVGEMVTNTGKPKRGIEE---TKVKLTQFNYPVDHPFNKDSYRYIYVESDPHAKGRQLWEECEATAGRIIPGFFYRVTISQQIALATNDRAHQLKLSDSQLSVTGDKGYCMIRATQPVSRGCWYFEAKIVEQPDNSHARIGWSQSLGNLQAPCGFDKFSYACRSRFGTAFHQSKGKHYMNHGYKKGDVLGCMFIASAPNIKRVSKQNLTQALFGKLPESFKERPLIKFKNXXXXXXXXXXXXXXXXLKQLENSKITFYKNGVSYGPAFTDIFDGAYYPAISIYKQASVAVNFGPNFTFPPTDVENWMPMSERHIDLEVEQTVSDMLWLTEKD 1767
            R     + QC  C KWF     G      +PFM  Y F C  C+ S    F RKQ+N   MC +A+ANL + +     + K  FSK+KD+IPF+++ WE +TT+ +        +I KT+    D+F   +H   G      D     L + +L  + P YD  +  +S +       GGI   S G                         A R  +    TG  K+   +   +  +L    YP++HPFNKD YRYI  E DPHA   +  E  +  AG+ IPG  YR  + +++ LA +DRA QLK+SD +L+V G+KGY M+RA+  V +G WYFE  + E P ++ AR+GWSQ LGNLQAP G+DKFSY+ RS+ GT FHQS GKHY + GY +GDVLG  F  + P     +K          LP+++K++ LIKFK+  Y+EEK+   KAEK LKQ  +S+I FYKNGV+ G A+ DIF+G Y+PAIS+YK  +V++NFGP+F +PP D+  + PMS+      VE T++D+L+  E +
Sbjct:  103 RQLGEVELQCGICTKWFTADTFGIDTSSCLPFMTNYSFHCNVCHHSGNTYFLRKQANLKEMCLSALANLTWQSRTQDEHPKTMFSKDKDIIPFIDKYWECMTTRQRPGKMTWPNNIVKTMSKERDVFLVKEHPDPGSKDPEEDYPKFGLLDQDLSNIGPAYDNQK-QSSAVSASGNLNGGIAAGSSG---------------------KGRGAKRKQQDGGTTGTTKKARSDPLFSAQRLPPHGYPLEHPFNKDGYRYILAEPDPHAPDPEKLE-LDCWAGKPIPGDLYRACLYERVLLALHDRAPQLKISDDRLTVVGEKGYSMVRASHGVRKGAWYFEITVDEMPPDTAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTKFHQSIGKHY-SSGYGQGDVLG--FYINLPEDTETAKS---------LPDTYKDKALIKFKSYLYFEEKDFVDKAEKSLKQTPHSEIIFYKNGVNQGVAYRDIFEGVYFPAISLYKSCTVSINFGPSFKYPPKDL-TYHPMSDMGWGAVVEHTLADVLYHVETE 612          
BLAST of Set1/Ash2 histone methyltransferase complex subunit ASH2 vs. Ensembl Mouse
Match: Ash2l (ASH2 like histone lysine methyltransferase complex subunit [Source:MGI Symbol;Acc:MGI:1344416])

HSP 1 Score: 290.812 bits (743), Expect = 1.060e-90
Identity = 196/546 (35.90%), Postives = 278/546 (50.92%), Query Frame = 1
Query:  184 RDFSIPDFQCSNCNKWFHKHCIGFTIGKAIPFMIAYHFMCKKCNESCEEVFSRKQSNFASMCQTAIANLMYIN-----NGKIYFSKEKDVIPFLEENWEALTTQPKKTFAALNPSIHKTLI-SNDIF---KHHIVG------DDVIVCLKNTNLYQMKPGYDQFRILASQLKTKVTTGGGILPQSGGWHXXXXXXXXXXXXXXXXXXXXXPSATRVGEMVTNTGKPKRGIEE---TKVKLTQFNYPVDHPFNKDSYRYIYVESDPHAKGRQLWEECEATAGRIIPGFFYRVTISQQIALATNDRAHQLKLSDSQLSVTGDKGYCMIRATQPVSRGCWYFEAKIVEQPDNSHARIGWSQSLGNLQAPCGFDKFSYACRSRFGTAFHQSKGKHYMNHGYKKGDVLGCMFIASAPNIKRVSKQNLTQALFGKLPESFKERPLIKFKNXXXXXXXXXXXXXXXXLKQLENSKITFYKNGVSYGPAFTDIFDGAYYPAISIYKQASVAVNFGPNFTFPPTDVENWMPMSERHIDLEVEQTVSDMLWLTEKD 1767
            R     + QC  C KWF     G      +PFM  Y F C  C+ S    F RKQ+N   MC +A+ANL + +     + K  FSK+KD+IPF+++ WE +TT+ +        +I KT+    D+F   +H   G      D     L + +L  + P YD  +  +S +       GGI   S G                         A R  +    TG  K+   +   +  +L    YP++HPFNKD YRYI  E DPHA   +  E  +  AG+ IPG  YR  + +++ LA +DRA QLK+SD +L+V G+KGY M+RA+  V +G WYFE  + E P ++ AR+GWSQ LGNLQAP G+DKFSY+ RS+ GT FHQS GKHY + GY +GDVLG  F  + P     +K          LP+++K++ LIKFK+  Y+EEK+   KAEK LKQ  +S+                                 V++NFGP+F +PP D+  + PMS+      VE T++D+L+  E +
Sbjct:   14 RQLGEVELQCGICTKWFTADTFGIDTSSCLPFMTNYSFHCNVCHHSGNTYFLRKQANLKEMCLSALANLTWQSRTQDEHPKTMFSKDKDIIPFIDKYWECMTTRQRPGKMTWPNNIVKTMSKERDVFLVKEHPDPGSKDPEEDYPKFGLLDQDLSNIGPAYDNQK-QSSAVSASGNLNGGIAAGSSG---------------------KGRGAKRKQQDGGTTGTTKKARSDPLFSAQRLPPHGYPLEHPFNKDGYRYILAEPDPHAPDPEKLE-LDCWAGKPIPGDLYRACLYERVLLALHDRAPQLKISDDRLTVVGEKGYSMVRASHGVRKGAWYFEITVDEMPPDTAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTKFHQSIGKHY-SSGYGQGDVLG--FYINLPEDTETAKS---------LPDTYKDKALIKFKSYLYFEEKDFVDKAEKSLKQTPHSE---------------------------------VSINFGPSFKYPPKDL-TYHPMSDMGWGAVVEHTLADVLYHVETE 490          
BLAST of Set1/Ash2 histone methyltransferase complex subunit ASH2 vs. UniProt/SwissProt
Match: sp|Q94545|ASH2_DROME (Set1/Ash2 histone methyltransferase complex subunit ASH2 OS=Drosophila melanogaster OX=7227 GN=ash2 PE=1 SV=2)

HSP 1 Score: 380.948 bits (977), Expect = 6.095e-124
Identity = 213/547 (38.94%), Postives = 318/547 (58.14%), Query Frame = 1
Query:  166 CYCNTQRDFSIPDFQCSNCNKWFHKHCIGFTIGKA--IPFMIAYHFMCKKCNESCEEVFSRKQSNFASMCQTAIANLMYI--NNGK--IYFSKEKDVIPFLEENWEALTTQPKKTFAALNPSIHKTLISN--DIFKHHIVGD-DVIVCLKNTNLYQMKPGYDQFRILASQLKTKVTTGGGILPQSGGWHXXXXXXXXXXXXXXXXXXXXXPSATRVGEMVTNTGKPKRGIEETKVKLTQFNYPVDHPFNKDSYRYIYVESDPHAKGRQLWEECEATAGRIIPGFFYRVTISQQIALATNDRAHQLKLSDSQLSVTGDKGYCMIRATQPVSRGCWYFEAKIVEQPDNSHARIGWSQSLGNLQAPCGFDKFSYACRSRFGTAFHQSKGKHYMNHGYKKGDVLGCMFIASAPNIKRVSKQNLTQALFGKLPESFKERPLIKFKNXXXXXXXXXXXXXXXXLKQLENSKITFYKNGVSYGPAFTDIFDGAYYPAISIYKQASVAVNFGPNFTFPPTDVENWMP-MSERHIDLEVEQTVSDMLWLTEKDDTI 1776
            CYC  +R+ +I +  C+ C++W H+ C+ + +GK   +PF+  Y F+CK C+ S  E F + Q+  + MC  AIAN+      +G+  I FSK+K++IP++E+ WEA+TT P++   +   ++ ++L+ +   +F +    +   +  L + +L  +KP Y+              +  G L  +   +      K            S P+  +        G+P   I    VKL    YP++HPFNKD YRYI  E DPHA  RQ ++E    AG+ IPG+ YR+ +   + LA +DRA QLK+S+ +L+VTG++GYCM+RAT  V+RGCWYFE  I E PD +  R+GW +  GNLQAP G+DKF Y+ RSR GT F +S GKHY +  Y +GD LG  F+   P           +A    LP +FK+RPL+KFK+  YYE+K++ ++  K L  L+ S+I F+KNG S G AF DI+ G+Y+PAISI+K A+V+VNFGP F +P   VE+    M +R  +L  EQ ++D L+LTE D  +
Sbjct:   37 CYCGKERNLNIVELLCATCSRWVHETCVSYQLGKGKLLPFITNYVFVCKNCSASGLESFRKSQATISQMCHCAIANMQQAASRDGRRQIQFSKDKEIIPYIEQYWEAMTTMPRRLTQSWYSTVQRSLVKDVQTLFTYEEHAEHGAMYGLFHQDLRIIKPNYESM------------SKSGALRLTDDGYTQASLSKNNRQKRKFPGTDSGPTGKK--------GRPSSDIT-ANVKLPPHGYPLEHPFNKDGYRYILAEPDPHAPFRQEFDESSDWAGKPIPGWLYRILVPHSVLLALHDRAPQLKISEDRLAVTGERGYCMVRATHSVNRGCWYFEVTIEEMPDGAATRLGWGREYGNLQAPLGYDKFGYSWRSRKGTKFTESHGKHYSD-AYVEGDTLG--FLIELPE----------EASLDYLPNTFKDRPLVKFKSHLYYEDKDKITETLKNLHILQGSRIEFFKNGQSQGVAFEDIYAGSYFPAISIHKSATVSVNFGPAFKYPEVLVEHKAKGMHDRVEELITEQCLADTLYLTEHDGRL 549          
BLAST of Set1/Ash2 histone methyltransferase complex subunit ASH2 vs. UniProt/SwissProt
Match: sp|Q91X20|ASH2L_MOUSE (Set1/Ash2 histone methyltransferase complex subunit ASH2 OS=Mus musculus OX=10090 GN=Ash2l PE=1 SV=1)

HSP 1 Score: 351.288 bits (900), Expect = 1.312e-111
Identity = 216/546 (39.56%), Postives = 304/546 (55.68%), Query Frame = 1
Query:  184 RDFSIPDFQCSNCNKWFHKHCIGFTIGKAIPFMIAYHFMCKKCNESCEEVFSRKQSNFASMCQTAIANLMYIN-----NGKIYFSKEKDVIPFLEENWEALTTQPKKTFAALNPSIHKTLI-SNDIF---KHHIVG------DDVIVCLKNTNLYQMKPGYDQFRILASQLKTKVTTGGGILPQSGGWHXXXXXXXXXXXXXXXXXXXXXPSATRVGEMVTNTGKPKRGIEE---TKVKLTQFNYPVDHPFNKDSYRYIYVESDPHAKGRQLWEECEATAGRIIPGFFYRVTISQQIALATNDRAHQLKLSDSQLSVTGDKGYCMIRATQPVSRGCWYFEAKIVEQPDNSHARIGWSQSLGNLQAPCGFDKFSYACRSRFGTAFHQSKGKHYMNHGYKKGDVLGCMFIASAPNIKRVSKQNLTQALFGKLPESFKERPLIKFKNXXXXXXXXXXXXXXXXLKQLENSKITFYKNGVSYGPAFTDIFDGAYYPAISIYKQASVAVNFGPNFTFPPTDVENWMPMSERHIDLEVEQTVSDMLWLTEKD 1767
            R     + QC  C KWF     G      +PFM  Y F C  C+ S    F RKQ+N   MC +A+ANL + +     + K  FSK+KD+IPF+++ WE +TT+ +        +I KT+    D+F   +H   G      D     L + +L  + P YD  +  +S +       GGI   S G                         A R  +    TG  K+   +   +  +L    YP++HPFNKD YRYI  E DPHA   +  E  +  AG+ IPG  YR  + +++ LA +DRA QLK+SD +L+V G+KGY M+RA+  V +G WYFE  + E P ++ AR+GWSQ LGNLQAP G+DKFSY+ RS+ GT FHQS GKHY + GY +GDVLG  F  + P     +K          LP+++K++ LIKFK+  Y+EEK+   KAEK LKQ  +S+I FYKNGV+ G A+ DIF+G Y+PAIS+YK  +V++NFGP+F +PP D+  + PMS+      VE T++D+L+  E +
Sbjct:  103 RQLGEVELQCGICTKWFTADTFGIDTSSCLPFMTNYSFHCNVCHHSGNTYFLRKQANLKEMCLSALANLTWQSRTQDEHPKTMFSKDKDIIPFIDKYWECMTTRQRPGKMTWPNNIVKTMSKERDVFLVKEHPDPGSKDPEEDYPKFGLLDQDLSNIGPAYDNQK-QSSAVSASGNLNGGIAAGSSG---------------------KGRGAKRKQQDGGTTGTTKKARSDPLFSAQRLPPHGYPLEHPFNKDGYRYILAEPDPHAPDPEKLE-LDCWAGKPIPGDLYRACLYERVLLALHDRAPQLKISDDRLTVVGEKGYSMVRASHGVRKGAWYFEITVDEMPPDTAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTKFHQSIGKHY-SSGYGQGDVLG--FYINLPEDTETAKS---------LPDTYKDKALIKFKSYLYFEEKDFVDKAEKSLKQTPHSEIIFYKNGVNQGVAYRDIFEGVYFPAISLYKSCTVSINFGPSFKYPPKDL-TYHPMSDMGWGAVVEHTLADVLYHVETE 612          
BLAST of Set1/Ash2 histone methyltransferase complex subunit ASH2 vs. UniProt/SwissProt
Match: sp|Q9UBL3|ASH2L_HUMAN (Set1/Ash2 histone methyltransferase complex subunit ASH2 OS=Homo sapiens OX=9606 GN=ASH2L PE=1 SV=1)

HSP 1 Score: 351.288 bits (900), Expect = 1.505e-111
Identity = 217/546 (39.74%), Postives = 304/546 (55.68%), Query Frame = 1
Query:  184 RDFSIPDFQCSNCNKWFHKHCIGFTIGKAIPFMIAYHFMCKKCNESCEEVFSRKQSNFASMCQTAIANLMYIN-----NGKIYFSKEKDVIPFLEENWEALTTQPKKTFAALNPSIHKTLI-SNDIF---KHHIVG------DDVIVCLKNTNLYQMKPGYDQFRILASQLKTKVTTGGGILPQSGGWHXXXXXXXXXXXXXXXXXXXXXPSATRVGEMVTNTGKPKRGIEE---TKVKLTQFNYPVDHPFNKDSYRYIYVESDPHAKGRQLWEECEATAGRIIPGFFYRVTISQQIALATNDRAHQLKLSDSQLSVTGDKGYCMIRATQPVSRGCWYFEAKIVEQPDNSHARIGWSQSLGNLQAPCGFDKFSYACRSRFGTAFHQSKGKHYMNHGYKKGDVLGCMFIASAPNIKRVSKQNLTQALFGKLPESFKERPLIKFKNXXXXXXXXXXXXXXXXLKQLENSKITFYKNGVSYGPAFTDIFDGAYYPAISIYKQASVAVNFGPNFTFPPTDVENWMPMSERHIDLEVEQTVSDMLWLTEKD 1767
            R     + QC  C KWF     G      +PFM  Y F C  C+ S    F RKQ+N   MC +A+ANL + +     + K  FSK+KD+IPF+++ WE +TT+ +        +I KT+    D+F   +H   G      D     L + +L  + P YD  +  +S + T     GGI   S G                         A R  +    TG  K+   +   +  +L    YP++HPFNKD YRYI  E DPHA   +  E  +  AG+ IPG  YR  + +++ LA +DRA QLK+SD +L+V G+KGY M+RA+  V +G WYFE  + E P ++ AR+GWSQ LGNLQAP G+DKFSY+ RS+ GT FHQS GKHY + GY +GDVLG  F  + P     +K          LP+++K++ LIKFK+  Y+EEK+   KAEK LKQ  +S+I FYKNGV+ G A+ DIF+G Y+PAIS+YK  +V++NFGP F +PP D+  + PMS+      VE T++D+L+  E +
Sbjct:  108 RQLGEVELQCGICTKWFTADTFGIDTSSCLPFMTNYSFHCNVCHHSGNTYFLRKQANLKEMCLSALANLTWQSRTQDEHPKTMFSKDKDIIPFIDKYWECMTTRQRPGKMTWPNNIVKTMSKERDVFLVKEHPDPGSKDPEEDYPKFGLLDQDLSNIGPAYDNQK-QSSAVSTSGNLNGGIAAGSSG---------------------KGRGAKRKQQDGGTTGTTKKARSDPLFSAQRLPPHGYPLEHPFNKDGYRYILAEPDPHAPDPEKLE-LDCWAGKPIPGDLYRACLYERVLLALHDRAPQLKISDDRLTVVGEKGYSMVRASHGVRKGAWYFEITVDEMPPDTAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTKFHQSIGKHY-SSGYGQGDVLG--FYINLPEDTETAKS---------LPDTYKDKALIKFKSYLYFEEKDFVDKAEKSLKQTPHSEIIFYKNGVNQGVAYKDIFEGVYFPAISLYKSCTVSINFGPCFKYPPKDL-TYRPMSDMGWGAVVEHTLADVLYHVETE 617          
BLAST of Set1/Ash2 histone methyltransferase complex subunit ASH2 vs. UniProt/SwissProt
Match: sp|G5EFZ3|ASH2_CAEEL (Set1/Ash2 histone methyltransferase complex subunit ash-2 OS=Caenorhabditis elegans OX=6239 GN=ash-2 PE=1 SV=1)

HSP 1 Score: 278.87 bits (712), Expect = 1.612e-84
Identity = 187/561 (33.33%), Postives = 290/561 (51.69%), Query Frame = 1
Query:  166 CYCNTQRDFSIPDFQCSNCNKWFHKHCIGF---TIGKAIPFMIAYHFMCKKCNESCEEVFSRKQSNFASMCQTAIANL---MYINNGKI----------YFSKEKDVIPFLEENWEALTT--QPKKTFAALNPSIHKTLISNDIFKHHIVGDDVIVCLKNTNLYQMKPGYDQFRILAS---QLKTKVTTGGGILPQSGGWHXXXXXXXXXXXXXXXXXXXXXPSATRVGEMVTNTGKPKRGIEETKVKLTQFNYPVDHPFNKDSYRYIYVESDPHAKGRQLWEECEATAGRIIPGFFYRVTISQQIALATNDRAHQLKLSDSQLSVTGDKGYCMIRATQPVSRGCWYFEAKIVEQPDNSHARIGWSQSLGNLQAPCGFDKFSYACRSRFGTAFHQSKGKHYMNHGYKKGDVLGCMFIASAPNIKRVS-KQNLTQALFGKLPESFKERPLIKFKNXXXXXXXXXXXXXXXXLKQLENSKITFYKNGVSYGPAFTDIFDGAYYPAISIYKQASVAVNFGPNFTFPPTDVENWMPMSERHIDLEVEQTVSDMLWLTEKDDTIEQ 1782
            CYC+ +R+    +  CS C KWFH  C+          +PFMI Y F CK+C  + E+ +  K+++   MC T +A L       +GK+          Y S + +++P++ ENW  LT   Q K+    L P++   L   +IF  H   DD +  L   NL  + P ++  +++     + + +      + P  G                      +  ++ R       TGK ++   +           +D PF+KD+YRY   E DP+      W + +++A  +IP F YR  ++  + +++NDRA QL ++ +  S+TG +GY M RA+  VS+G WYFE    +QPD+SH RIGWSQS  +LQA  G++KFSY  RS+ GT FH++KGK Y   G+K+GDVLGC+     P  K++    NL    +  LP S K   LI FK +Y++E +EE++   K L ++  S I F+ NG S G A+ +I+ GAYYP+ISI+K A+  +N GP F   P        +  R  + + EQT+SDML+L  K+  ++ 
Sbjct:   22 CYCDGKRELGSVEVVCSTCLKWFHGRCLKEFHELNSNGVPFMICYTFTCKQCRPTAED-WKAKKADLVQMCVTVLATLSAERLKADGKLSAEHVPEDFTYLSLKDEIVPYMNENWYMLTAIKQKKEWHQNLAPTL---LKEKNIFVQH-NDDDDLFALAEKNLSLLGPLHEAVKLIGKRPIERENREPRHIELPPIEG--------------------PKTRGASKRRHAEAPVTGKKQKLAADYSSTAAPNGVQIDIPFSKDNYRYYLTEVDPNVPEDPAWNQNQSSA-YVIPSFHYRELLNPTVNVSSNDRAFQLSINGN--SITGFEGYSMARASHGVSKGTWYFEVNFDDQPDDSHIRIGWSQSYASLQACVGYNKFSYGWRSKHGTKFHEAKGKKYHFGGFKQGDVLGCLI--HLPVDKKLQIPANLPSEKY--LPVSHKGFNLISFKANYFFEVQEESADIAKTLVEMPGSYIEFFHNGKSCGKAYENIYAGAYYPSISIFKSATATMNLGPKFRNLPRGATG---IHARADEQQHEQTLSDMLYLVSKEVNLDH 547          
BLAST of Set1/Ash2 histone methyltransferase complex subunit ASH2 vs. UniProt/SwissProt
Match: sp|O60070|ASH2_SCHPO (Set1 complex component ash2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ash2 PE=4 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 2.782e-36
Identity = 147/586 (25.09%), Postives = 234/586 (39.93%), Query Frame = 1
Query:  166 CYCNTQRDFSIPDFQCSNCNKWFHKHCIGFTIGKAIPFMIAYHFMCKKCNESCEEVFSRKQSNFASMCQTAIANLMY--------------INNGKI--------YFSKEKDVIPFLEENWEALTTQPKKTFAALNPSIHKTLISN-DIFK---HHIVGDDVIVCLKNTNLYQMKPGY--DQFRILASQLKTKVTTGGGILPQSGGWHXXXXXXXXXXXXXXXXXXXXXPSATRVGEMVTNTGKP--KRGIEETKVKLTQFNYPVDHPFNKDSYRYIYVESDPHAKGRQLWEECEATAGRIIPGFFYRVTISQQIALATN--DRAHQLKLSDSQLSVTGDKGYCMIRATQPVSRGCWYFEAKIVEQ--PDNSHARIGWSQSLGNLQAPCGFDKFSYACRSRFGTAFHQSKGKHYMNHGYKKGDVLGCMFIASAPNIKRVSKQNLTQALFGKLPESFK-----ERPLIKFKNXXXXXXXXXXXXXXXXLKQLENSKITFYKNGVSYGPAFTDIFDG------------------AYYPAISIYKQASVAVNFGPNFTFPPTDV-ENWMPMSERHIDLEVEQTVSDML 1749
            CYC   R+   PD QCS C   FH  C+       + F   Y F+CK C E   E F R  S + ++  TA+ANL+                N  K+        +F K++D+IPF+EE+W+ L    +K       ++   L++N D ++     +   +    L N NL+  + GY     R+ A+  K ++       P S     + +  K     +      ++     V  +      P  +    ET  KL  F YP     N  S  +  +   P  +    +  CEA   + +P   YR           N  D +  + +  S L  T +KG+ M R+   ++ G WYFE KI +    D +H RIG S+    L AP G+D +SY  R   G   H S+ +++M+  +  GD++G       P+    ++     +   ++P  +K     E+P                     +L  +  S I  YKNG   G AF ++ D                    YYP+IS+Y        FGP F+  P  +  N  P+SER+ +   E  + D+L
Sbjct:   43 CYCGKDRNLRFPDLQCSVCLNMFHLSCLSPPCTSMMGFSTNYQFVCKHCTEDGFERFERGVSAWKAITATAMANLVVKRYVETNPDVPVDSFNAEKMRNFQANTYFFKKKEDLIPFIEEHWQLLCPDREKV-QTWQATLGSCLVANRDTYRAKDETMRNQNSEYALNNPNLFDFRSGYIFPFQRVGATVPKKRLVETETPPPSSSKLKEDYKDSKREMKRSNTPWSNASIKKNEVPTVPIRYKPPPWRDSDFETVPKLPIF-YP-----NSSSPNFFSLSEIPFNRRGFRYSPCEA--AKDLPNVMYREIELPPFTSRINWHDISTPVFIDHSALCATVEKGFRMARSNVFMTSGEWYFEIKIEKGGGDDGAHVRIGVSRREAPLDAPVGYDAYSYGLRDLGGQKVHMSRPRNFMD-SFGTGDIIGLHISLPKPSF---AQHTTLPSCHDRIPIRYKGQLYFEQPDYVPSKMMDELMIPSKHNRYIDLPYIPGSFIKVYKNGSYMGTAFENLLDFNPPNSINSNHYSFDDGSLGYYPSISMYGGGIARFQFGPQFSHRPLVLGSNVRPVSERYNEQIAEDVLCDIL 615          
BLAST of Set1/Ash2 histone methyltransferase complex subunit ASH2 vs. TrEMBL
Match: A0A0X9ERK4 (ASH2 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 967.992 bits (2501), Expect = 0.000e+0
Identity = 500/507 (98.62%), Postives = 503/507 (99.21%), Query Frame = 1
Query:  280 MIAYHFMCKKCNESCEEVFSRKQSNFASMCQTAIANLMYINNGKIYFSKEKDVIPFLEENWEALTTQPKKTFAALNPSIHKTLISNDIFKHHIVGDDVIVCLKNTNLYQMKPGYDQFRILASQLKTKVTTGGGILPQSGGWHXXXXXXXXXXXXXXXXXXXXXPSATRVGEMVTNTGKPKRGIEETKVKLTQFNYPVDHPFNKDSYRYIYVESDPHAKGRQLWEECEATAGRIIPGFFYRVTISQQIALATNDRAHQLKLSDSQLSVTGDKGYCMIRATQPVSRGCWYFEAKIVEQPDNSHARIGWSQSLGNLQAPCGFDKFSYACRSRFGTAFHQSKGKHYMNHGYKKGDVLGCMFIASAPNIKRVSKQNLTQALFGKLPESFKERPLIKFKNXXXXXXXXXXXXXXXXLKQLENSKITFYKNGVSYGPAFTDIFDGAYYPAISIYKQASVAVNFGPNFTFPPTDVENWMPMSERHIDLEVEQTVSDMLWLTEKDDTIEQIIMNPQ 1800
            MIAYHFMCKKCNESCEEVFSRKQSNFASMCQTAIANLMYINNGKIYFSKEKDVIPFLEENWEALTTQPKKTFAALNPSIHKTLISNDIFKHHIVGDDVIVCLKNTNLYQMKPGY QFRILA QLKTKVTTGGGILPQSGGWHANNRKRKATNNNATITTGASTPSATRVGEMVTNTGKPKRGIEETKVKLTQFNYPVDHPFNKDSYRYIYVESDPHAKGRQLWEECEATAGRIIPGFFYRVTISQQIALATNDRAHQLKLSDSQLSVTGDKGYCMIRATQPVSRGCWYFEAKIVEQPDNSHARIGWSQSLGNLQAPCGFDKFSYACRSRFGTAF+QSKGKHYMNHGYKKGDVLGCM IASAPN KRVSKQNLTQALFGKLPESFKERPLIKFKNSYYYEEKEEAS+AEKELKQLENSKITFYKNGVSYGPAFTDIFDGAYYPAISIYKQASVAVNFGPNFTFPPTDVENW+PMSERHIDLEVEQTVSDMLWLTEKDDTIEQIIMNPQ
Sbjct:    1 MIAYHFMCKKCNESCEEVFSRKQSNFASMCQTAIANLMYINNGKIYFSKEKDVIPFLEENWEALTTQPKKTFAALNPSIHKTLISNDIFKHHIVGDDVIVCLKNTNLYQMKPGYHQFRILARQLKTKVTTGGGILPQSGGWHANNRKRKATNNNATITTGASTPSATRVGEMVTNTGKPKRGIEETKVKLTQFNYPVDHPFNKDSYRYIYVESDPHAKGRQLWEECEATAGRIIPGFFYRVTISQQIALATNDRAHQLKLSDSQLSVTGDKGYCMIRATQPVSRGCWYFEAKIVEQPDNSHARIGWSQSLGNLQAPCGFDKFSYACRSRFGTAFNQSKGKHYMNHGYKKGDVLGCMLIASAPNTKRVSKQNLTQALFGKLPESFKERPLIKFKNSYYYEEKEEASEAEKELKQLENSKITFYKNGVSYGPAFTDIFDGAYYPAISIYKQASVAVNFGPNFTFPPTDVENWIPMSERHIDLEVEQTVSDMLWLTEKDDTIEQIIMNPQ 507          
BLAST of Set1/Ash2 histone methyltransferase complex subunit ASH2 vs. TrEMBL
Match: A0A5K3EH23 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 570.466 bits (1469), Expect = 0.000e+0
Identity = 293/621 (47.18%), Postives = 388/621 (62.48%), Query Frame = 1
Query:  109 KISKLLTERIVIEKPTIPQCYCNTQRDFSIPDFQCSNCNKWFHKHCIGFTIGKAIPFMIAYHFMCKKCNESCEEVFSRKQSNFASMCQTAIANLMYINNGKIYFSKEKDVIPFLEENWEALTTQPKKTFAALNPSIHKTLISNDIFKHHIVGDDVIVCLKNTNLYQMKPGYDQFRILASQLKTKV--------------TTGGGILPQSGGWHXXXXXXXXXXXXXX----------------XXXXXXXPSATRVGEMVTNTG-KPKRGIEETKVKLTQFNYPVDHPFNKDSYRYIYVESDPHAKGRQLWEECEATAGRIIPGFFYRVTISQQIALATNDRAHQLKLSDSQLSVTGDKGYCMIRATQPVSRGCWYFEAKIVEQPDNSHARIGWSQSLGNLQAPCGFDKFSYACRSRFGTAFHQSKGKHYMNHGYKKGDVLGCMF----IASAPNIKRVSKQNLTQA--------------------------LFGKLPESFKERPLIKFKNXXXXXXXXXXXXXXXXLKQLENSKITFYKNGVSYGPAFTDIFDGAYYPAISIYKQASVAVNFGPNFTFPPTDVENWMPMSERHIDLEVEQTVSDMLWLTEKDDTIEQII 1788
            K+ +L+++ I IE  +  QCYC   RD+S+P+FQCS C +WFH HCI F IG ++PFM AYHFMCKKCN + EEVFS+KQ+NFASMCQTA+ANLM I+NG++YFS+EK++IP+LE+NWE LT+QP++T  + + +IHKTL+SN++F    V     VCL   ++  + P Y++FR L SQLKT V              + GG   P +G        +      +                         +A  V     N G       ++T+ K+ +F  P+DHP N ++YRYI VE DPHA+GRQ W+ECE+TAG+ IPG+FYRV +  ++ L+ +DRAHQ+KL DSQ S+TGDKGYCM RAT  V  G WY+EA I +QP+ S  RIGWSQ +GNLQAPCG+DKF Y+ RSR GT FH S+GKHY + GY KGDV+GC+      A A  I  ++  N                              LF  LPE++K+RPLIKF+N YY+EEK +    EK+L+ L  SKI FY+NG   G AF +I+ GAY+PAISIYK A+V VNFGPNF +PP D +NW PMS R    EVEQ ++DML+L   D  IE ++
Sbjct:   21 KLQELMSKTIRIEVASGQQCYCGNPRDYSVPEFQCSFCYRWFHHHCINFDIGPSLPFMTAYHFMCKKCNNANEEVFSKKQANFASMCQTALANLMCIHNGRVYFSEEKELIPYLEQNWELLTSQPRRTNDSWHTNIHKTLVSNELFHVIDVDPQHAVCLSCQDVSTIGPSYERFRALTSQLKTSVSKRGPPPSSGQLTDSVGGDGSPLTGDGSDGAPGKSRKGVQSGSSSASLASTGGGGTGGNVRSTRRSTAAAVASSCGNGGLYGANPHDDTRAKVNEFGIPIDHPVNTENYRYILVEPDPHAQGRQQWDECESTAGKPIPGYFYRVCLCPKVVLSLHDRAHQMKLQDSQTSLTGDKGYCMARATHSVHTGTWYYEATITDQPEGSATRIGWSQLMGNLQAPCGYDKFGYSWRSRLGTVFHDSRGKHYADTGYSKGDVIGCLIELPKAARADMIPSMTALNSASTGSSKAGGGSKAGGRGDSAKAKTPEVPLFNYLPETYKDRPLIKFRNFYYFEEKGDPQALEKQLRPLPASKIVFYRNGECLGAAFQNIYAGAYFPAISIYKSATVCVNFGPNFKYPPADFDNWQPMSARRESAEVEQAMADMLYLNVNDRLIENLM 641          
BLAST of Set1/Ash2 histone methyltransferase complex subunit ASH2 vs. TrEMBL
Match: A0A564XUN0 (B30.2/SPRY domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS161 PE=4 SV=1)

HSP 1 Score: 533.872 bits (1374), Expect = 7.091e-180
Identity = 290/628 (46.18%), Postives = 374/628 (59.55%), Query Frame = 1
Query:  106 DKISKLLTERIVIEKPTIPQCYCNTQRDFSIPDFQCSNCNKWFHKHCIGFTIGKAIPFMIAYHFMCKKCNESCEEVFSRKQSNFASMCQTAIANLMYINNGKIYFSKEKDVIPFLEENWEALTTQPKKTFAALNPSIHKTLISNDIFKHHIVGDDVIVCLKNTNLYQMKPGYDQFRIL-------ASQLKTKVTTGGGILPQSGGWHXXXXXXXXXXXXXXXXXXXXXPSATRVGEMVTNT------------------------GKPKRGIEE---TKVKLTQFNYPVDHPFNKDSYRYIYVESDPHAKGRQLWEECEATAGRIIPGFFYRVTISQQIALATNDRAHQLKLSDSQLSVTGDKGYCMIRATQPVSRGCWYFEAKIVEQPDNSHARIGWSQSLGNLQAPCGFDKFSYACRSRFGTAFHQSKGKHYMNHGYKKGDVLGCMF-------------------IASAP-------------NIKRVSKQNLTQALFGKLPESFKERPLIKFKNXXX-XXXXXXXXXXXXXLKQLENSKITFYKNGVSYGPAFTDIFDGAYYPAISIYKQASVAVNFGPNFTFPPTDVENWMPMSERHIDLEVEQTVSDMLWLTEKDDTIEQII 1788
            DK+ +L++  I IE  +  QCYC   RD+S+ +FQCS+C  WFH+ CI F +G AIPFM AYHFMCKKCN S EEVF++KQ+N+ASMCQT IANLM  +NG+IYFS EK+VIPFL+ NW+  T+QP+++ ++    +HK L+ N++F     G + +VCL    L  + P Y++FR L        S+     T G  +  Q  G   +     +  N+  +       S T  G                              G    G+ E    K KLTQF +PVDHP N ++YRY  VE DPHAK R+ WEE E TAG+ IPG+FYRV +  ++ L+ +DRA Q+KLSDSQ  VTG+KGY MIR T  V  G WYFEA IVEQP+ S  RIGWSQ L  LQAPCGFDKFSY+ RSR GT FH S+GKHY   GY KGDV+GC                     I + P              +K  S+ +LT      L +S+K+RP+I+FK+ YY  +   +A K EK+LK L  SKI FY+NG   G AF DI+ G Y+P ISIYK ASVAVNFGP+F +PP + ENW+PMSER   ++VEQT+SDM++L   D  IE II
Sbjct:   20 DKLKELMSRTIHIEVASGQQCYCGKCRDYSVAEFQCSHCYHWFHQQCINFDVGPAIPFMTAYHFMCKKCNNSQEEVFTKKQANYASMCQTVIANLMCASNGRIYFSLEKEVIPFLDRNWDIFTSQPRRSGSSWPGVLHKALVGNELFSLVDEGSESVVCLSCQELSTIGPSYERFRALTSQLKTSVSKRSAHSTLGSDVPLQRVGDGPSLITGDSLENSLGLGKSLRKGSGTGAGSQTGQGREGGGTGGNVRSTRRATAAAVAAGGSGIFGVSEKDDAKTKLTQFGFPVDHPLNTENYRYSLVEVDPHAKYRKQWEESEYTAGKPIPGYFYRVVLYPKVVLSLHDRAQQMKLSDSQTVVTGEKGYSMIRGTHSVHTGTWYFEATIVEQPEGSATRIGWSQILATLQAPCGFDKFSYSWRSRKGTVFHNSRGKHYAEEGYTKGDVIGCFIHLPKVSSSDMIPSSKCIYGIPTGPVKHGKAGTKNEFVKVKPSSEGSLTHY----LTDSYKDRPVIRFKHIYYFEDILGDAKKVEKQLKPLPQSKIVFYRNGECMGTAFQDIYAGVYFPTISIYKSASVAVNFGPDFKYPPPESENWLPMSERRESMQVEQTISDMMYLLANDKHIEHII 643          
BLAST of Set1/Ash2 histone methyltransferase complex subunit ASH2 vs. TrEMBL
Match: A0A158QTR6 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS5198 PE=4 SV=1)

HSP 1 Score: 525.398 bits (1352), Expect = 5.046e-177
Identity = 281/621 (45.25%), Postives = 369/621 (59.42%), Query Frame = 1
Query:  109 KISKLLTERIVIEKPTIPQCYCNTQRDFSIPDFQCSNCNKWFHKHCIGFTIGKAIPFMIAYHFMCKKCNESCEEVFSRKQSNFASMCQTAIANLMYINNGKIYFSKEKDVIPFLEENWEALTTQPKKTFAALNPSIHKTLISNDIFKHHIVGDDVIVCLKNTNLYQMKPGYDQFRILASQLKTKV--------------TTGGGILPQSGGWHXXXXXXXXXXXXXX----------------XXXXXXXPSATRVGEMVTNTG-KPKRGIEETKVKLTQFNYPVDHPFNKDSYRYIYVESDPHAKGRQLWEECEATAGRIIPGFFYRVTISQQIALATNDRAHQLKLSDSQLSVTGDKGYCMIRATQPVSRGCWYFEAKIVEQPDNSHARIGWSQSLGNLQAPCGFDKFSYACRSRFGTAFHQSKGKHYMNHGYKKGDVLGCMF----IASAPNIKRVSKQNLTQA--------------------------LFGKLPESFKERPLIKFKNXXXXXXXXXXXXXXXXLKQLENSKITFYKNGVSYGPAFTDIFDGAYYPAISIYKQASVAVNFGPNFTFPPTDVENWMPMSERHIDLEVEQTVSDMLWLTEKDDTIEQII 1788
            K+ +L+++ I IE  T    +    RD+S+P+FQCS C +WFH HCI F IG ++PFM AYHFMCKKCN + EEVFS+KQ+NFASMCQTA+ANLM I+NG++YFS+EK++IP+LE+NWE LT+QP++T  + + +IHKTL                                +FR L SQLKT V              + GG   P +G        +      +                         +A  V     N G       ++T+ K+ +F  P+DHP N ++YRYI VE DPHA+GRQ W+ECE+TAG+ IPG+FYRV +  ++ L+ +DRAHQ+KL DSQ S+TGDKGYCM RAT  V  G WY+EA I +QP+ S  RIGWSQ +GNLQAPCG+DKF Y+ RSR GT FH S+GKHY + GY KGDV+GC+      A A  I  ++  N                              LF  LPE++K+RPLIKF+N YY+EEK +    EK+L+ L  SKI FY+NG   G AF +I+ GAY+PAISIYK A+V VNFGPNF +PP D +NW PMS R    EVEQ ++DML+L   D  IE ++
Sbjct:   17 KLQELMSKTIRIEYNT----FSGNPRDYSVPEFQCSFCYRWFHHHCINFDIGPSLPFMTAYHFMCKKCNNANEEVFSKKQANFASMCQTALANLMCIHNGRVYFSEEKELIPYLEQNWELLTSQPRRTNDSWHTNIHKTL--------------------------------RFRALTSQLKTSVSKRGPPPSSGQLTDSVGGDGSPLTGDGSDGAPGKSRKGVQSGSSSASLASTGGGGTGGNVRSTRRSTAAAVASSCGNGGLYGANPHDDTRAKVNEFGIPIDHPVNTENYRYILVEPDPHAQGRQQWDECESTAGKPIPGYFYRVCLCPKVVLSLHDRAHQMKLQDSQTSLTGDKGYCMARATHSVHTGTWYYEATITDQPEGSATRIGWSQLMGNLQAPCGYDKFGYSWRSRLGTVFHDSRGKHYADTGYSKGDVIGCLIELPKAARADMIPSMTALNSASTGSSKAGGGSKAGGRGDSAKAKTPEVPLFNYLPETYKDRPLIKFRNFYYFEEKGDPQALEKQLRPLPASKIVFYRNGECLGAAFQNIYAGAYFPAISIYKSATVCVNFGPNFKYPPADFDNWQPMSARRESAEVEQAMADMLYLNVNDRLIENLM 601          
BLAST of Set1/Ash2 histone methyltransferase complex subunit ASH2 vs. TrEMBL
Match: G4VRI0 (Putative trithorax protein ash2 OS=Schistosoma mansoni OX=6183 GN=Smp_142170 PE=4 SV=1)

HSP 1 Score: 510.375 bits (1313), Expect = 8.131e-172
Identity = 278/576 (48.26%), Postives = 356/576 (61.81%), Query Frame = 1
Query:  184 RDFSIPDFQCSNCNKWFHKHCIGFTIGKAIPFMIAYHFMCKKCNESCEEVFSRKQSNFASMCQTAIANLMYINNGKIYFSKEKDVIPFLEENWEALTTQPKKTFAALNPSIHKTLISNDIFKHHIVGDDVIVCLKNTNLYQMKPGYDQFRILASQLKTKVTTGGGILPQSGGWHXXXXXXXXXXXXXXXXXXXXXPSATRVGEMVTNTGKPKRGIEETKVKLTQFNYPVDHPFNKDSYRYIYVESDPHAKGRQLWEECEATAGRIIPGFFYRVTISQQIALATNDRAHQLKLSDSQLSVTGDKGYCMIRATQPVSRGCWYFEAKIVEQPDNSHARIGWSQSLGNLQAPCGFDKFSYACRSRFGTAFHQSKGKHYMNHGYKKGDVLGCMF---------------------IASAPNIKRVS------KQNLTQALFGK--------------LPESFKERPLIKFKNXXXXXXXXXXXXXXXXLKQLENSKITFYKNGVSYGPAFTDIFDGAYYPAISIYKQASVAVNFGPNFTFPPTDVENWMPMSERHIDLEVEQTVSDMLWLTEKDDTIEQII 1788
            RDFS PDFQCS C KWFH  CI F IGKA+PF+ AYHFMCKKCN   EEVFSRKQ+NF  MCQTA+ANLM  + G++YF + K++IPFLEE WE LTTQP+++  +  P+IHKTL+   +      G      L       + PG+   R       T  ++ G +                  ++  + +     SA+ +G     +G    G +E + KL    +P+DH  NK+ YRYI VE D HA GR+ W+ECE TAG+ IPGFFYRV +  Q+ L+ +DRA+ LK+ +SQLSVTG+KGYCM+RAT  V+ G WYFEA I EQP+ S  RIGWSQ  GNLQAPCG+DKFSY+ RSR GTAFH+S+GKHY++ GYKK D++GCM                      +   P     S      K NL     G+              LPE++K+RPLI+F+NS+Y+EEK+E +K EK L  L  SKITFY NG   G AFT+I+ GAYYPAISIYK A+V+VNFGP F +PP+D+ +W PMS R I   VEQTV+DM+ L EKD  IE+ I
Sbjct:    4 RDFSRPDFQCSVCYKWFHLECIAFNIGKALPFLTAYHFMCKKCNPIGEEVFSRKQANFTVMCQTALANLMLKHGGRLYFMEMKELIPFLEEYWEELTTQPRRSNNSWYPNIHKTLVCY-VISTVPSGSSESAALGAVTSADV-PGFPGTR-------TATSSNGDV--------------NNGLSSGLVRSTRRATSASVLGGTTPLSGT--SGSDEGRAKLNSLGFPIDHALNKEGYRYILVEPDKHASGREQWDECEFTAGKPIPGFFYRVFLCSQVVLSLSDRANHLKVHESQLSVTGEKGYCMVRATHSVNSGTWYFEATITEQPEGSATRIGWSQMYGNLQAPCGYDKFSYSWRSRLGTAFHESRGKHYVDEGYKKDDIIGCMIHLPSTTGPFTSLENQCAESSGLFKTPQANSFSSVAGDIKSNLNNTSNGQNPNKYKTLFSTSNYLPETYKDRPLIRFRNSFYFEEKDEPTKVEKLLHPLPGSKITFYHNGKCMGAAFTNIYAGAYYPAISIYKSATVSVNFGPYFKYPPSDITDWEPMSSRVISAAVEQTVADMICLVEKDGFIERTI 554          
BLAST of Set1/Ash2 histone methyltransferase complex subunit ASH2 vs. Ensembl Cavefish
Match: ash2l (ASH2 like, histone lysine methyltransferase complex subunit [Source:NCBI gene;Acc:103033518])

HSP 1 Score: 342.043 bits (876), Expect = 2.442e-109
Identity = 213/548 (38.87%), Postives = 302/548 (55.11%), Query Frame = 1
Query:  184 RDFSIPDFQCSNCNKWFHKHCIGFTIGKAIPFMIAYHFMCKKCNESCEEVFSRKQSNFASMCQTAIANLMYIN-----NGKIYFSKEKDVIPFLEENWEALTTQPKKTFAALNPSIHKTLI-SNDIF---KHHIVGDD------VIVCLKNTNLYQMKPGYDQFR-----ILASQLKTKVTTGGGILPQSGGWHXXXXXXXXXXXXXXXXXXXXXPSATRVGEMVTNTGKPKRGIEETKVKLTQFNYPVDHPFNKDSYRYIYVESDPHAKGRQLWEECEATAGRIIPGFFYRVTISQQIALATNDRAHQLKLSDSQLSVTGDKGYCMIRATQPVSRGCWYFEAKIVEQPDNSHARIGWSQSLGNLQAPCGFDKFSYACRSRFGTAFHQSKGKHYMNHGYKKGDVLGCMFIASAPNIKRVSKQNLTQALFGKLPESFKERPLIKFKNXXXXXXXXXXXXXXXXLKQLENSKITFYKNGVSYGPAFTDIFDGAYYPAISIYKQASVAVNFGPNFTFPPTDVENWMPMSERHIDLEVEQTVSDMLWLTEKD 1767
            R     + QC+ C KWF            +PFM  Y F C  C+ S    F RKQ+N   MC TA+ANL + +     + K  FSK+KD+IPF+++ WE +TT+ +        +I KT+    D+F   +H   G            L + +L  + P YD  +       A  L    +  GG+ P S G     R  K           A     TR   + +    P  G            YP++HPFNKD YRYI  E DPHA   +  E  +  AG+ IPG  YR  + +++ LA +DRA QLK+SD +L+VTG+KGY M+RA+  V +G WYFE  + E P  + AR+GWSQ LGNLQAP G+DKFSY+ RS+ GT FHQS GKHY + GY +GD+LG  F    P+   +++          LP+++K++ LIKFK+  Y+EEK+   KAEK LK +  S++ FYKNG S G A+ ++F+G Y+PAIS+YK  +V+VNFGP+F +PP DV+ + PMS+      +E +++D+L+  E D
Sbjct:   65 RQLGEVELQCALCMKWFTADTFSIDTATCLPFMTNYVFHCNVCHHSGNTYFLRKQANLKEMCLTALANLTWRSRTQEEHPKTMFSKDKDIIPFIDKYWECMTTRQRPGKLTWPNNIVKTMSKERDVFLVKEHPDPGSKDPEEEYPKFGLLDQDLANIGPSYDNQKQTTTVTAAGNLNGGSSFSGGLPPPSTG---KGRGAKRKQQQQQDGASAGAAKRTRSDPLFSAQRLPPHG------------YPLEHPFNKDGYRYILAEPDPHAPDPEKLE-LDCWAGKPIPGDLYRACLYERVLLALHDRAPQLKISDDRLTVTGEKGYSMVRASHGVRKGSWYFEVTVDEMPPETAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTRFHQSIGKHYSD-GYGQGDILG--FFIELPDGTEIARS---------LPDTYKDKALIKFKSYLYFEEKDYVDKAEKNLKPVSESRMIFYKNGKSQGVAYDNLFEGMYFPAISLYKSCTVSVNFGPHFKYPPKDVK-FQPMSDMGWGAVIEHSLADILYHVETD 583          
BLAST of Set1/Ash2 histone methyltransferase complex subunit ASH2 vs. Ensembl Cavefish
Match: ash2l (ASH2 like, histone lysine methyltransferase complex subunit [Source:NCBI gene;Acc:103033518])

HSP 1 Score: 341.273 bits (874), Expect = 4.089e-109
Identity = 214/546 (39.19%), Postives = 302/546 (55.31%), Query Frame = 1
Query:  184 RDFSIPDFQCSNCNKWFHKHCIGFTIGKAIPFMIAYHFMCKKCNESCEEVFSRKQSNFASMCQTAIANLMYIN-----NGKIYFSKEKDVIPFLEENWEALTTQPKKTFAALNPSIHKTLI-SNDIF---KHHIVGDD------VIVCLKNTNLYQMKPGYDQFRILASQLKTKVTTG---GGILPQSGGWHXXXXXXXXXXXXXXXXXXXXXPSATRVGEMVTNTGKPKRGIEETKVKLTQFNYPVDHPFNKDSYRYIYVESDPHAKGRQLWEECEATAGRIIPGFFYRVTISQQIALATNDRAHQLKLSDSQLSVTGDKGYCMIRATQPVSRGCWYFEAKIVEQPDNSHARIGWSQSLGNLQAPCGFDKFSYACRSRFGTAFHQSKGKHYMNHGYKKGDVLGCMFIASAPNIKRVSKQNLTQALFGKLPESFKERPLIKFKNXXXXXXXXXXXXXXXXLKQLENSKITFYKNGVSYGPAFTDIFDGAYYPAISIYKQASVAVNFGPNFTFPPTDVENWMPMSERHIDLEVEQTVSDMLWLTEKD 1767
            R     + QC+ C KWF            +PFM  Y F C  C+ S    F RKQ+N   MC TA+ANL + +     + K  FSK+KD+IPF+++ WE +TT+ +        +I KT+    D+F   +H   G            L + +L  + P YD  +    Q  T    G   GG+ P S G     R  K           A     TR   + +    P  G            YP++HPFNKD YRYI  E DPHA   +  E  +  AG+ IPG  YR  + +++ LA +DRA QLK+SD +L+VTG+KGY M+RA+  V +G WYFE  + E P  + AR+GWSQ LGNLQAP G+DKFSY+ RS+ GT FHQS GKHY + GY +GD+LG  F    P+   +++          LP+++K++ LIKFK+  Y+EEK+   KAEK LK +  S++ FYKNG S G A+ ++F+G Y+PAIS+YK  +V+VNFGP+F +PP DV+ + PMS+      +E +++D+L+  E D
Sbjct:   65 RQLGEVELQCALCMKWFTADTFSIDTATCLPFMTNYVFHCNVCHHSGNTYFLRKQANLKEMCLTALANLTWRSRTQEEHPKTMFSKDKDIIPFIDKYWECMTTRQRPGKLTWPNNIVKTMSKERDVFLVKEHPDPGSKDPEEEYPKFGLLDQDLANIGPSYDNQK----QTTTVTAAGNLNGGLPPPSTG---KGRGAKRKQQQQQDGASAGAAKRTRSDPLFSAQRLPPHG------------YPLEHPFNKDGYRYILAEPDPHAPDPEKLE-LDCWAGKPIPGDLYRACLYERVLLALHDRAPQLKISDDRLTVTGEKGYSMVRASHGVRKGSWYFEVTVDEMPPETAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTRFHQSIGKHYSD-GYGQGDILG--FFIELPDGTEIARS---------LPDTYKDKALIKFKSYLYFEEKDYVDKAEKNLKPVSESRMIFYKNGKSQGVAYDNLFEGMYFPAISLYKSCTVSVNFGPHFKYPPKDVK-FQPMSDMGWGAVIEHSLADILYHVETD 577          
BLAST of Set1/Ash2 histone methyltransferase complex subunit ASH2 vs. Ensembl Cavefish
Match: mtf2 (metal response element binding transcription factor 2 [Source:NCBI gene;Acc:103032496])

HSP 1 Score: 54.6842 bits (130), Expect = 2.149e-7
Identity = 30/102 (29.41%), Postives = 49/102 (48.04%), Query Frame = 1
Query:  166 CYCNTQRDFSIPDFQCSNCNKWFHKHCIGFTIGKAIPFMIAYHFMCKKCNESCEEVFSRKQSNFASMCQTAIANLMYINNGKIYFSKEKDVIPFLEENWEAL 471
            CYC    D+ +   QC+ C +WFH+ CI       +     Y F+C  C+ S  E   R    +  +   ++ NL  I+  K YF  E +++ ++ +NWE L
Sbjct:  204 CYCGGPGDWFLKMLQCNRCKQWFHEACIQCFERPMLNGDRFYLFICSVCS-SGPEYLKRLPLRWVDVAHLSLYNLSVIHKKK-YFDSELELMYYINDNWEEL 303          
BLAST of Set1/Ash2 histone methyltransferase complex subunit ASH2 vs. Ensembl Sea Lamprey
Match: ash2l (ash2 like, histone lysine methyltransferase complex subunit [Source:ZFIN;Acc:ZDB-GENE-030131-494])

HSP 1 Score: 343.199 bits (879), Expect = 4.338e-111
Identity = 216/570 (37.89%), Postives = 302/570 (52.98%), Query Frame = 1
Query:  130 ERIVIEKPTIPQCYCNTQRDFSIPDFQCSNCNKWFHKHCIGFTIGKAIPFMIAYHFMCKKCNESCEEVFSRKQSNFASMCQTAIANL-----MYINNGKIYFSKEKDVIPFLEENWEALTTQPKKTFAALNPSIHKTLISNDIFKHHIVGDDVIVCLKNTNLYQMKPG-------YDQFRILASQL---------KTKVTTGGGILPQSGGWHXXXXXXXXXXXXXXXXXXXXXPSATRVGEMVTNTGKPKRGIEETKVKLTQFNYPVDHPFNKDSYRYIYVESDPHAKGRQLWEECEATAGRIIPGFFYRVTISQQIALATNDR---AHQLKLSDSQLSVTGDKGYCMIRATQPVSRGCWYFEAKIVEQPDNSHARIGWSQSLGNLQAPCGFDKFSYACRSRFGTAFHQSKGKHYMNHGYKKGDVLGCMFIASAPNIKRVSKQNLTQALFGKLPESFKERPLIKFKNXXXXXXXXXXXXXXXXLKQLENSKITFYKNGVSYGPAFTDIFDGAYYPAISIYKQASVAVNFGPNFTFPPTDVENWMPMSERHIDLEVEQTVSDMLWLTEKD 1767
            + + + + T+       +R     + QC  C KWF            +PF+  Y F C  C+ S    F RK +    MC TA+ANL     M  ++ K  FSK+KD+IPF++ +WE +TT+ +          +K    N+I K      DV +  +N +     PG       Y +F +L   L         + +  T       +GG+  +   +              T   TR   +  +   P  G            YP++HPFNKD YRY+  E DPHA   +   E ++ AG+ IPG  YR  + +++ LA +DR   A QLK+SD +L+VTGDKGY M+RA+    RG WYFEA + E P  S ARIGWSQSLGNLQAP G+DKFSY+ RS+ GT FHQS+G+HY + GY +GD LG  F  S P     +           LP+++K++ LIKFK+  Y+EEK+   KAEK LK   +SK+ FYKNG+  G AF D+++G Y+PA+S+YK  SV+VNFGPNF  PP DV  + PMS+      VE T+SD+L+  E D
Sbjct:    2 QEVSVVEATLSAVEVEEERRQGHVELQCGICMKWFTAESFSIDTSTCVPFITNYVFHCNICHHSGNTYFLRKPATLKEMCLTALANLTWTSRMQDDHPKTMFSKDKDIIPFIDRHWECMTTRQRP---------NKLTWQNNIVKTMTKERDVFLVKENPD-----PGSKDSQDEYPKFGLLDQDLTNIGPSYEGQKQPGTPAAAASSNGGFGISGSGKGRGAKRRQEGVTPPTAKRTRHDPLFQSQRLPPHG------------YPLEHPFNKDGYRYVLAEPDPHAPDPER-VELDSWAGKPIPGDLYRSCLYERVLLALHDRGLLAPQLKISDDRLTVTGDKGYSMVRASHGARRGAWYFEATVDEMPTGSAARIGWSQSLGNLQAPLGYDKFSYSWRSKKGTRFHQSRGRHYAD-GYAQGDTLG--FFISLPEHTHTATC---------LPDTYKDKALIKFKSYLYFEEKDFVDKAEKSLKPAHDSKVVFYKNGIGQGTAFEDVYEGVYFPAVSLYKSCSVSVNFGPNFKHPPKDV-TYQPMSDMGWYAVVEHTLSDLLYHVETD 531          
BLAST of Set1/Ash2 histone methyltransferase complex subunit ASH2 vs. Ensembl Sea Lamprey
Match: ash2l (ash2 like, histone lysine methyltransferase complex subunit [Source:ZFIN;Acc:ZDB-GENE-030131-494])

HSP 1 Score: 335.88 bits (860), Expect = 2.376e-108
Identity = 208/537 (38.73%), Postives = 301/537 (56.05%), Query Frame = 1
Query:  184 RDFSIPDFQCSNCNKWFHKHCIGFTIGKAIPFMIAYHFMCKKCNESCEEVFSRKQSNFASMCQTAIANLMYIN-----NGKIYFSKEKDVIPFLEENWEALTTQPKKTFAALNPSIHKTLISNDIFKHHIVGDDVIVCLKNTN--LYQMKPGYDQFRILASQLKTKVTTGGGILPQSGGWHXXXXXXXXXXXXXXXXXXXXXPSATRVGEMVT-NTGKPKRGIEETKV-KLTQFNYPVDHPFNKDSYRYIYVESDPHAKGRQLWEECEATAGRIIPGFFYRVTISQQIALATNDRAHQLKLSDSQLSVTGDKGYCMIRATQPVSRGCWYFEAKIVEQPDNSHARIGWSQSLGNLQAPCGFDKFSYACRSRFGTAFHQSKGKHYMNHGYKKGDVLGCMFIASAPNIKRVSKQNLTQALFGKLPESFKERPLIKFKNXXXXXXXXXXXXXXXXLKQLENSKITFYKNGVSYGPAFTDIFDGAYYPAISIYKQASVAVNFGPNFTFPPTDVENWMPMSERHIDLEVEQTVSDMLWLTEKD 1767
            R+    + QC  C KWF            +PF+  Y F C  C+ S    F RKQ+    MC T++ANL + +     + K  FSKEKD+IPF++  WE LT +P+          +K    N+I K      DV +  +  +    +++  Y +F +L   L       G I P                N +          A R  E  T NT K  R     +  +L    YP++HPFNKD YRYI  E DPHA   +  E  ++ AG+ IPG  YR  + +++ LA +DRA QLK+SD +L+VTG+KGY  +RA+  V RG W+FE ++   P ++ AR+GWSQSLGNLQAP GFDKFSY+ RS+ GT FHQS+GKHY + GY++GD LG  F    P+    +           LP+++K++ LIKFK+  Y+EEK+   KAEK+L+Q   SKITF+KNG S G A+ D+F+G Y+PAIS+Y+  +V++NFGP+F +PP  + ++ P+S+      VE +++D+L+ TE +
Sbjct:   16 RNLGQVELQCGICLKWFTAESFDIDTSNCLPFITNYVFHCNICHHSGNTYFLRKQATLKEMCLTSLANLTWKSRTQDEHPKTMFSKEKDIIPFIDNYWECLTIRPRP---------NKLTWPNNIVKAMSKERDVFLVKEGPDPGSRELEGDYPKFGLLDQDL-------GSIGPTYDTQKQVVPVASGGVNGSVQVGVGKGRGAKRKQEGATGNTSKRTRNDPLFQSQRLPPHGYPLEHPFNKDGYRYILAEPDPHAPDPERIE-LDSWAGKPIPGDLYRACLYERVLLALHDRAPQLKISDDRLTVTGEKGYATVRASHGVRRGAWFFEVRVDTLPADTAARLGWSQSLGNLQAPLGFDKFSYSWRSKKGTKFHQSRGKHY-SEGYEQGDTLG--FYIDLPDDTVTANA---------LPDTYKDKALIKFKSYLYFEEKDLVEKAEKDLRQTPGSKITFFKNGKSQGVAWEDVFEGVYFPAISLYRNCTVSINFGPHFKYPPKGL-DFQPVSDMGRRAVVEHSLADLLFHTETE 522          
BLAST of Set1/Ash2 histone methyltransferase complex subunit ASH2 vs. Ensembl Sea Lamprey
Match: phf1 (PHD finger protein 1 [Source:ZFIN;Acc:ZDB-GENE-100922-277])

HSP 1 Score: 57.7658 bits (138), Expect = 2.773e-9
Identity = 31/103 (30.10%), Postives = 54/103 (52.43%), Query Frame = 1
Query:  166 CYCNTQRDFSIPDFQCSNCNKWFHKHCIGFTIGKAIPFMIAYH-FMCKKCNESCEEVFSRKQSNFASMCQTAIANLMYINNGKIYFSKEKDVIPFLEENWEAL 471
            CYC    ++ +   QC +C +WFH+ C    + + + F   ++ F+C  CN    E   R    +  + Q  + NL  ++  K YF  EK+V+PF+ +NW++L
Sbjct:  176 CYCGGPGEWYLKMLQCCSCRQWFHEACTQ-CLERPMHFGDRFYLFVCSVCNAG-PEYIKRLPLRWVDITQLCMYNLTVVHKKK-YFDFEKEVMPFVHDNWDSL 275          
BLAST of Set1/Ash2 histone methyltransferase complex subunit ASH2 vs. Ensembl Medaka
Match: ash2l (ASH2 like, histone lysine methyltransferase complex subunit [Source:NCBI gene;Acc:101168557])

HSP 1 Score: 337.421 bits (864), Expect = 1.189e-107
Identity = 213/543 (39.23%), Postives = 296/543 (54.51%), Query Frame = 1
Query:  184 RDFSIPDFQCSNCNKWFHKHCIGFTIGKAIPFMIAYHFMCKKCNESCEEVFSRKQSNFASMCQTAIANLMYIN-----NGKIYFSKEKDVIPFLEENWEALTTQPKKTFAALNPSIHKTLI-SNDIF---KHHIVGDDVI------VCLKNTNLYQMKPGYDQFRILASQLKTKVTTGGGILPQSGGWHXXXXXXXXXXXXXXXXXXXXXPSATRVGEMVTNTGKPKRGIEETKVKLTQFNYPVDHPFNKDSYRYIYVESDPHAKGRQLWEECEATAGRIIPGFFYRVTISQQIALATNDRAHQLKLSDSQLSVTGDKGYCMIRATQPVSRGCWYFEAKIVEQPDNSHARIGWSQSLGNLQAPCGFDKFSYACRSRFGTAFHQSKGKHYMNHGYKKGDVLGCMFIASAPNIKRVSKQNLTQALFGKLPESFKERPLIKFKNXXXXXXXXXXXXXXXXLKQLENSKITFYKNGVSYGPAFTDIFDGAYYPAISIYKQASVAVNFGPNFTFPPTDVENWMPMSERHIDLEVEQTVSDMLWLTEKD 1767
            R     + QC+ C KWF            +PFM  Y F C  C+ S    F RKQ+N   MC TA+ANL + +     + K  FSK+KD+IPF+++ WE +TT+ +        +I KT+    D+F   +H   G   +        L + +L  + P YD       +  T   T GG+           R  K           A     TR   + +    P  G            YP++HPFNKD YRYI  E DPHA   +  E  +  AG+ IPG  YR  + +++ LA +DRA QLK+SD +L+VTG+KGY M+RA+  V +G W+FE  + E P  + AR+GWSQ LGNLQAP G+DKFSY+ RS+ GT FHQS GKHY + GY +GD LG  F    P+    ++          LP+++K++ LIKFK+  Y+EEK+   KAEK LK    S++ FYKNGVS G AF ++F+G YYPAIS+YK  +V+VNFGP+F F P DV+ + P+S+      +E T++DML+  E D
Sbjct:   65 RQLGDVELQCALCMKWFTADTFSIDTATCLPFMTNYVFHCNVCHHSGNTYFLRKQANLKEMCLTALANLTWRSRTQDEHPKTMFSKDKDIIPFIDKFWECMTTRQRPGKLTWPNNIVKTMSKERDVFLVKEHPDPGSKDLEEEFPKFGLLDQDLGTIGPSYD-----TQKQSTGTPTAGGLNGALAPGPGKGRGAKRKQQQQQEGAAAGAAKRTRSDPLFSAQRLPPHG------------YPLEHPFNKDGYRYILAEPDPHAPDPEKLE-LDCWAGKPIPGDLYRSCLYEKVLLALHDRAPQLKISDDRLTVTGEKGYSMVRASHGVRKGAWFFEVTVDEMPAETAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTRFHQSIGKHY-SSGYGQGDTLG--FFIELPDGTETARS---------LPDTYKDKALIKFKSYLYFEEKDYVDKAEKALKATSPSRMIFYKNGVSQGVAFENLFEGIYYPAISLYKSCTVSVNFGPHFKFAPKDVQ-YQPISDMGWGAVIEHTLADMLYHVETD 576          
BLAST of Set1/Ash2 histone methyltransferase complex subunit ASH2 vs. Ensembl Medaka
Match: ash2l (ASH2 like, histone lysine methyltransferase complex subunit [Source:NCBI gene;Acc:101168557])

HSP 1 Score: 337.035 bits (863), Expect = 1.997e-107
Identity = 214/547 (39.12%), Postives = 301/547 (55.03%), Query Frame = 1
Query:  175 NTQRDFSIPDFQCSNCNKWFHKHCIGFTIGKAIPFMIAYHFMCKKCNESCEEVFSRKQSNFASMCQTAIANLMYIN-----NGKIYFSKEKDVIPFLEENWEALTTQPKKTFAALNPSIHKTLI-SNDIF---KHHIVGDDVI------VCLKNTNLYQMKPGYDQFRILASQLKTKVTTGGGILPQSGGWHXXXXXXXXXXXXXXXXXXXXXPSATRVGEMVTNTGKPKRGIEE-TKVKLTQFNYPVDHPFNKDSYRYIYVESDPHAKGRQLWEECEATAGRIIPGFFYRVTISQQIALATNDRAHQLKLSDSQLSVTGDKGYCMIRATQPVSRGCWYFEAKIVEQPDNSHARIGWSQSLGNLQAPCGFDKFSYACRSRFGTAFHQSKGKHYMNHGYKKGDVLGCMFIASAPNIKRVSKQNLTQALFGKLPESFKERPLIKFKNXXXXXXXXXXXXXXXXLKQLENSKITFYKNGVSYGPAFTDIFDGAYYPAISIYKQASVAVNFGPNFTFPPTDVENWMPMSERHIDLEVEQTVSDMLWLTEKD 1767
             + R     + QC+ C KWF            +PFM  Y F C  C+ S    F RKQ+N   MC TA+ANL + +     + K  FSK+KD+IPF+++ WE +TT+ +        +I KT+    D+F   +H   G   +        L + +L  + P YD           K +TG    P +GG +  +    A         GA      +         K  R     +  +L    YP++HPFNKD YRYI  E DPHA   +  E  +  AG+ IPG  YR  + +++ LA +DRA QLK+SD +L+VTG+KGY M+RA+  V +G W+FE  + E P  + AR+GWSQ LGNLQAP G+DKFSY+ RS+ GT FHQS GKHY + GY +GD LG  F    P+    ++          LP+++K++ LIKFK+  Y+EEK+   KAEK LK    S++ FYKNGVS G AF ++F+G YYPAIS+YK  +V+VNFGP+F F P DV+ + P+S+      +E T++DML+  E D
Sbjct:   62 ESGRQLGDVELQCALCMKWFTADTFSIDTATCLPFMTNYVFHCNVCHHSGNTYFLRKQANLKEMCLTALANLTWRSRTQDEHPKTMFSKDKDIIPFIDKFWECMTTRQRPGKLTWPNNIVKTMSKERDVFLVKEHPDPGSKDLEEEFPKFGLLDQDLGTIGPSYDT---------QKQSTG---TPTAGGLNGGSSFSGALAPGPGKGRGAKRKQQQQQEGAAAGAAKRTRSDPLFSAQRLPPHGYPLEHPFNKDGYRYILAEPDPHAPDPEKLE-LDCWAGKPIPGDLYRSCLYEKVLLALHDRAPQLKISDDRLTVTGEKGYSMVRASHGVRKGAWFFEVTVDEMPAETAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTRFHQSIGKHY-SSGYGQGDTLG--FFIELPDGTETARS---------LPDTYKDKALIKFKSYLYFEEKDYVDKAEKALKATSPSRMIFYKNGVSQGVAFENLFEGIYYPAISLYKSCTVSVNFGPHFKFAPKDVQ-YQPISDMGWGAVIEHTLADMLYHVETD 582          
BLAST of Set1/Ash2 histone methyltransferase complex subunit ASH2 vs. Ensembl Medaka
Match: ash2l (ASH2 like, histone lysine methyltransferase complex subunit [Source:NCBI gene;Acc:101168557])

HSP 1 Score: 275.404 bits (703), Expect = 3.431e-85
Identity = 190/537 (35.38%), Postives = 268/537 (49.91%), Query Frame = 1
Query:  202 DFQCSNCNKWFHKHCIGFTIGKAIPFMIAYHFMCKKCNESCEEVFSRKQSNFASMCQTAIANLMYIN-----NGKIYFSKEKDVIPFLEENWEALTTQPKKTFAALNPSIHKTLI-SNDIF---KHHIVGDDVI------VCLKNTNLYQMKPGYDQFRILASQLKTKVTTGGGILPQSGGWHXXXXXXXXXXXXXXXXXXXXXPSATRVGEMVTNTGKPKRGIEETKVKLTQFNYPVDHPFNKDSYRYIYVESDPHAKGRQLWEECEATAGRIIPGFFYRVTISQQIALATNDRAHQLKLSDSQLSVTGDKGYCMIRATQPVSRGCWYFEAKIVEQPDNSHARIGWSQSLGNLQAPCGFDKFSYACRSRFGTAFHQSKGKHYMNHGYKKGDVLGCMFIASAPNIKRVSKQNLTQALFGKLPESFKERPLIKFKNXXXXXXXXXXXXXXXXLKQLENSKITFYKNGVSYGPAFTDIFDGAYYPAISIYKQASVAVNFGPNFTFPPTDVENWMPMSERHIDLEVEQTVSDMLWLTEKD 1767
            + QC+ C KWF            +PFM  Y F C  C+ S    F RKQ+N   MC TA+ANL + +     + K  FSK+KD+IPF+++ WE +TT+ +        +I KT+    D+F   +H   G   +        L + +L  + P YD       +  T   T GG+  +         K                 SA     + +    P  G            YP++HPFNKD YRYI  E DPHA   +  E  +  AG+ IPG  YR  + +++ LA +DRA QLK+SD +L+VTG+KGY M+RA+  V +G W+FE  + E P  + AR+GWSQ LGNLQAP G+DKFSY+ RS+ GT FHQS GKHY + GY +GD LG  F    P+    ++          LP+++K++ LIKFK+  Y+EEK+   KAEK LK    S+                                 V+VNFGP+F F P DV+ + P+S+      +E T++DML+  E D
Sbjct:    3 ELQCALCMKWFTADTFSIDTATCLPFMTNYVFHCNVCHHSGNTYFLRKQANLKEMCLTALANLTWRSRTQDEHPKTMFSKDKDIIPFIDKFWECMTTRQRPGKLTWPNNIVKTMSKERDVFLVKEHPDPGSKDLEEEFPKFGLLDQDLGTIGPSYD-----TQKQSTGTPTAGGLNGEDPNLQTFKPKTL---------------SARMDDPLFSAQRLPPHG------------YPLEHPFNKDGYRYILAEPDPHAPDPEKLE-LDCWAGKPIPGDLYRSCLYEKVLLALHDRAPQLKISDDRLTVTGEKGYSMVRASHGVRKGAWFFEVTVDEMPAETAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTRFHQSIGKHY-SSGYGQGDTLG--FFIELPDGTETARS---------LPDTYKDKALIKFKSYLYFEEKDYVDKAEKALKATSPSR---------------------------------VSVNFGPHFKFAPKDVQ-YQPISDMGWGAVIEHTLADMLYHVETD 460          
BLAST of Set1/Ash2 histone methyltransferase complex subunit ASH2 vs. Ensembl Medaka
Match: mtf2 (metal response element binding transcription factor 2 [Source:NCBI gene;Acc:101161190])

HSP 1 Score: 55.8398 bits (133), Expect = 9.572e-8
Identity = 30/105 (28.57%), Postives = 50/105 (47.62%), Query Frame = 1
Query:  166 CYCNTQRDFSIPDFQCSNCNKWFHKHCIGFTIGKAIPFMIA---YHFMCKKCNESCEEVFSRKQSNFASMCQTAIANLMYINNGKIYFSKEKDVIPFLEENWEAL 471
            CYC    D+ +   QC  C +WFH+ C+       +P +     Y F+C  CN    E  SR   ++  +   ++ N+  I+  K YF  E  ++ ++ +NWE L
Sbjct:  215 CYCGDPGDWYLKMLQCKQCQQWFHEACLHCL---PMPMLYGDRFYLFICSVCNGG-PEFVSRLPLSWKDVAHLSLYNMSVIHKKK-YFDSENHLLEYINDNWELL 314          
BLAST of Set1/Ash2 histone methyltransferase complex subunit ASH2 vs. Planmine SMEST
Match: SMESG000051162.1 (SMESG000051162.1)

HSP 1 Score: 1129.39 bits (2920), Expect = 0.000e+0
Identity = 577/577 (100.00%), Postives = 577/577 (100.00%), Query Frame = 1
Query:   70 MIDNIRVNDLDPDKISKLLTERIVIEKPTIPQCYCNTQRDFSIPDFQCSNCNKWFHKHCIGFTIGKAIPFMIAYHFMCKKCNESCEEVFSRKQSNFASMCQTAIANLMYINNGKIYFSKEKDVIPFLEENWEALTTQPKKTFAALNPSIHKTLISNDIFKHHIVGDDVIVCLKNTNLYQMKPGYDQFRILASQLKTKVTTGGGILPQSGGWHXXXXXXXXXXXXXXXXXXXXXPSATRVGEMVTNTGKPKRGIEETKVKLTQFNYPVDHPFNKDSYRYIYVESDPHAKGRQLWEECEATAGRIIPGFFYRVTISQQIALATNDRAHQLKLSDSQLSVTGDKGYCMIRATQPVSRGCWYFEAKIVEQPDNSHARIGWSQSLGNLQAPCGFDKFSYACRSRFGTAFHQSKGKHYMNHGYKKGDVLGCMFIASAPNIKRVSKQNLTQALFGKLPESFKERPLIKFKNXXXXXXXXXXXXXXXXLKQLENSKITFYKNGVSYGPAFTDIFDGAYYPAISIYKQASVAVNFGPNFTFPPTDVENWMPMSERHIDLEVEQTVSDMLWLTEKDDTIEQIIMNPQ 1800
            MIDNIRVNDLDPDKISKLLTERIVIEKPTIPQCYCNTQRDFSIPDFQCSNCNKWFHKHCIGFTIGKAIPFMIAYHFMCKKCNESCEEVFSRKQSNFASMCQTAIANLMYINNGKIYFSKEKDVIPFLEENWEALTTQPKKTFAALNPSIHKTLISNDIFKHHIVGDDVIVCLKNTNLYQMKPGYDQFRILASQLKTKVTTGGGILPQSGGWHANNRKRKATNNNATITTGASTPSATRVGEMVTNTGKPKRGIEETKVKLTQFNYPVDHPFNKDSYRYIYVESDPHAKGRQLWEECEATAGRIIPGFFYRVTISQQIALATNDRAHQLKLSDSQLSVTGDKGYCMIRATQPVSRGCWYFEAKIVEQPDNSHARIGWSQSLGNLQAPCGFDKFSYACRSRFGTAFHQSKGKHYMNHGYKKGDVLGCMFIASAPNIKRVSKQNLTQALFGKLPESFKERPLIKFKNSYYYEEKEEASKAEKELKQLENSKITFYKNGVSYGPAFTDIFDGAYYPAISIYKQASVAVNFGPNFTFPPTDVENWMPMSERHIDLEVEQTVSDMLWLTEKDDTIEQIIMNPQ
Sbjct:    1 MIDNIRVNDLDPDKISKLLTERIVIEKPTIPQCYCNTQRDFSIPDFQCSNCNKWFHKHCIGFTIGKAIPFMIAYHFMCKKCNESCEEVFSRKQSNFASMCQTAIANLMYINNGKIYFSKEKDVIPFLEENWEALTTQPKKTFAALNPSIHKTLISNDIFKHHIVGDDVIVCLKNTNLYQMKPGYDQFRILASQLKTKVTTGGGILPQSGGWHANNRKRKATNNNATITTGASTPSATRVGEMVTNTGKPKRGIEETKVKLTQFNYPVDHPFNKDSYRYIYVESDPHAKGRQLWEECEATAGRIIPGFFYRVTISQQIALATNDRAHQLKLSDSQLSVTGDKGYCMIRATQPVSRGCWYFEAKIVEQPDNSHARIGWSQSLGNLQAPCGFDKFSYACRSRFGTAFHQSKGKHYMNHGYKKGDVLGCMFIASAPNIKRVSKQNLTQALFGKLPESFKERPLIKFKNSYYYEEKEEASKAEKELKQLENSKITFYKNGVSYGPAFTDIFDGAYYPAISIYKQASVAVNFGPNFTFPPTDVENWMPMSERHIDLEVEQTVSDMLWLTEKDDTIEQIIMNPQ 577          
The following BLAST results are available for this feature:
BLAST of Set1/Ash2 histone methyltransferase complex subunit ASH2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ASH2L4.513e-11339.74ASH2 like, histone lysine methyltransferase comple... [more]
ASH2L3.135e-11239.74ASH2 like, histone lysine methyltransferase comple... [more]
ASH2L3.968e-10540.27ASH2 like, histone lysine methyltransferase comple... [more]
ASH2L9.782e-9136.08ASH2 like, histone lysine methyltransferase comple... [more]
ASH2L2.085e-5551.72ASH2 like, histone lysine methyltransferase comple... [more]
back to top
BLAST of Set1/Ash2 histone methyltransferase complex subunit ASH2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ash-21.267e-8533.33Set1/Ash2 histone methyltransferase complex subuni... [more]
ash-21.988e-8533.39Set1/Ash2 histone methyltransferase complex subuni... [more]
ash-21.603e-8433.45Set1/Ash2 histone methyltransferase complex subuni... [more]
ash-22.594e-8433.86Set1/Ash2 histone methyltransferase complex subuni... [more]
back to top
BLAST of Set1/Ash2 histone methyltransferase complex subunit ASH2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ash26.080e-12538.94gene:FBgn0000139 transcript:FBtr0084660[more]
ash22.497e-9448.46gene:FBgn0000139 transcript:FBtr0084659[more]
ash27.286e-5848.43gene:FBgn0000139 transcript:FBtr0306171[more]
back to top
BLAST of Set1/Ash2 histone methyltransferase complex subunit ASH2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ash2l4.619e-11039.16ash2 like, histone lysine methyltransferase comple... [more]
ash2l2.386e-7836.78ash2 like, histone lysine methyltransferase comple... [more]
ash2l5.233e-1832.04ash2 like, histone lysine methyltransferase comple... [more]
mtf26.153e-830.39metal response element binding transcription facto... [more]
mtf27.266e-830.39metal response element binding transcription facto... [more]
back to top
BLAST of Set1/Ash2 histone methyltransferase complex subunit ASH2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab3c4.070e-11040.15RAB3C, member RAS oncogene family [Source:Xenbase;... [more]
rab3c4.329e-10038.28RAB3C, member RAS oncogene family [Source:Xenbase;... [more]
rab3c4.544e-9136.79RAB3C, member RAS oncogene family [Source:Xenbase;... [more]
rab3c5.254e-9136.98RAB3C, member RAS oncogene family [Source:Xenbase;... [more]
rab3c7.906e-9136.98RAB3C, member RAS oncogene family [Source:Xenbase;... [more]
back to top
BLAST of Set1/Ash2 histone methyltransferase complex subunit ASH2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ash2l3.523e-11339.56ASH2 like histone lysine methyltransferase complex... [more]
Ash2l3.523e-11339.56ASH2 like histone lysine methyltransferase complex... [more]
Ash2l3.523e-11339.56ASH2 like histone lysine methyltransferase complex... [more]
Ash2l1.875e-11239.56ASH2 like histone lysine methyltransferase complex... [more]
Ash2l1.060e-9035.90ASH2 like histone lysine methyltransferase complex... [more]
back to top
BLAST of Set1/Ash2 histone methyltransferase complex subunit ASH2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q94545|ASH2_DROME6.095e-12438.94Set1/Ash2 histone methyltransferase complex subuni... [more]
sp|Q91X20|ASH2L_MOUSE1.312e-11139.56Set1/Ash2 histone methyltransferase complex subuni... [more]
sp|Q9UBL3|ASH2L_HUMAN1.505e-11139.74Set1/Ash2 histone methyltransferase complex subuni... [more]
sp|G5EFZ3|ASH2_CAEEL1.612e-8433.33Set1/Ash2 histone methyltransferase complex subuni... [more]
sp|O60070|ASH2_SCHPO2.782e-3625.09Set1 complex component ash2 OS=Schizosaccharomyces... [more]
back to top
BLAST of Set1/Ash2 histone methyltransferase complex subunit ASH2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X9ERK40.000e+098.62ASH2 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1[more]
A0A5K3EH230.000e+047.18Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A564XUN07.091e-18046.18B30.2/SPRY domain-containing protein OS=Hymenolepi... [more]
A0A158QTR65.046e-17745.25Uncharacterized protein OS=Mesocestoides corti OX=... [more]
G4VRI08.131e-17248.26Putative trithorax protein ash2 OS=Schistosoma man... [more]
back to top
BLAST of Set1/Ash2 histone methyltransferase complex subunit ASH2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ash2l2.442e-10938.87ASH2 like, histone lysine methyltransferase comple... [more]
ash2l4.089e-10939.19ASH2 like, histone lysine methyltransferase comple... [more]
mtf22.149e-729.41metal response element binding transcription facto... [more]
back to top
BLAST of Set1/Ash2 histone methyltransferase complex subunit ASH2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ash2l4.338e-11137.89ash2 like, histone lysine methyltransferase comple... [more]
ash2l2.376e-10838.73ash2 like, histone lysine methyltransferase comple... [more]
phf12.773e-930.10PHD finger protein 1 [Source:ZFIN;Acc:ZDB-GENE-100... [more]
back to top
BLAST of Set1/Ash2 histone methyltransferase complex subunit ASH2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Set1/Ash2 histone methyltransferase complex subunit ASH2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Set1/Ash2 histone methyltransferase complex subunit ASH2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ash2l1.189e-10739.23ASH2 like, histone lysine methyltransferase comple... [more]
ash2l1.997e-10739.12ASH2 like, histone lysine methyltransferase comple... [more]
ash2l3.431e-8535.38ASH2 like, histone lysine methyltransferase comple... [more]
mtf29.572e-828.57metal response element binding transcription facto... [more]
back to top
BLAST of Set1/Ash2 histone methyltransferase complex subunit ASH2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000051162.10.000e+0100.00SMESG000051162.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019367 ID=SMED30019367|Name=Set1/Ash2 histone methyltransferase complex subunit ASH2|organism=Schmidtea mediterranea sexual|type=transcript|length=1885bp
GTTTAAATTAATCTGAATTTTGTGCAATTTTGAAATTTTATTGAAATTTT
ATTTTGTATTCGCATTGAAATGATTGATAACATTCGTGTAAATGATTTAG
ATCCTGATAAAATTTCTAAATTATTAACTGAAAGAATTGTCATTGAAAAG
CCTACTATTCCTCAATGTTATTGCAACACCCAGAGAGATTTTAGTATTCC
AGATTTTCAATGCAGCAACTGTAATAAATGGTTCCATAAACACTGTATAG
GCTTTACAATAGGCAAGGCCATTCCGTTTATGATTGCATATCATTTTATG
TGCAAAAAATGTAACGAAAGTTGCGAAGAAGTTTTTTCTAGAAAGCAAAG
TAATTTTGCTAGCATGTGTCAAACAGCAATAGCAAATTTGATGTATATTA
ATAATGGGAAAATCTATTTTTCTAAAGAAAAAGATGTCATCCCATTCTTA
GAAGAGAACTGGGAAGCTCTAACTACTCAACCGAAAAAAACGTTTGCAGC
ACTTAACCCCAGTATCCATAAAACATTGATCAGCAACGATATATTCAAGC
ATCATATAGTCGGAGATGATGTGATCGTTTGCCTGAAAAATACGAATTTA
TATCAAATGAAACCAGGTTATGATCAATTTCGAATTCTTGCTAGTCAACT
GAAAACTAAGGTAACAACTGGCGGAGGAATTCTTCCTCAGTCAGGAGGCT
GGCATGCTAATAACAGAAAACGAAAAGCTACCAATAATAATGCAACAATA
ACTACTGGGGCTTCGACTCCGTCTGCAACGAGAGTTGGAGAAATGGTTAC
CAATACCGGTAAACCGAAACGTGGAATTGAAGAGACAAAAGTCAAACTTA
CCCAATTCAATTACCCTGTCGATCATCCTTTTAATAAGGATAGTTATCGA
TATATTTATGTGGAATCTGATCCCCATGCTAAAGGCAGACAACTCTGGGA
GGAATGTGAAGCTACAGCTGGCCGAATCATACCCGGATTCTTTTACCGGG
TGACGATTAGCCAGCAAATTGCATTAGCTACAAATGATAGAGCTCACCAG
TTAAAGTTATCAGACAGTCAGTTGTCGGTTACCGGTGATAAAGGCTACTG
TATGATCCGAGCTACTCAGCCGGTTTCTCGAGGCTGTTGGTATTTTGAAG
CCAAAATCGTAGAGCAGCCAGATAATTCACACGCCAGAATCGGCTGGTCT
CAATCTCTCGGTAATTTACAAGCACCATGTGGATTTGATAAATTCAGTTA
CGCATGTCGATCACGATTCGGAACTGCTTTTCACCAATCGAAAGGAAAAC
ATTACATGAACCACGGTTATAAGAAGGGCGATGTCCTTGGGTGCATGTTC
ATTGCGAGTGCTCCCAATATTAAACGAGTATCGAAGCAAAACCTTACACA
GGCATTATTCGGTAAACTGCCCGAATCGTTTAAAGAACGCCCTCTTATTA
AATTCAAAAATAGTTATTACTATGAAGAGAAGGAGGAAGCATCTAAAGCG
GAAAAAGAATTGAAGCAATTAGAAAATAGTAAAATAACTTTCTACAAAAA
TGGAGTTTCATATGGGCCAGCTTTTACCGATATATTTGACGGTGCGTATT
ACCCGGCAATATCGATTTATAAGCAGGCGTCAGTTGCTGTGAATTTCGGG
CCGAATTTCACCTTCCCTCCCACTGATGTGGAAAATTGGATGCCGATGTC
AGAAAGGCACATCGATTTAGAGGTTGAGCAGACCGTGTCGGATATGCTCT
GGTTGACGGAAAAGGATGATACAATCGAGCAAATCATCATGAATCCCCAA
TGATATATATATATATATTACCATGTTTATTTATATTTGTATAAATATTG
TCTCCTTGAATTTTTGTGAAAGGTTTTTAGATCAG
back to top

protein sequence of SMED30019367-orf-1

>SMED30019367-orf-1 ID=SMED30019367-orf-1|Name=SMED30019367-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=578bp
MIDNIRVNDLDPDKISKLLTERIVIEKPTIPQCYCNTQRDFSIPDFQCSN
CNKWFHKHCIGFTIGKAIPFMIAYHFMCKKCNESCEEVFSRKQSNFASMC
QTAIANLMYINNGKIYFSKEKDVIPFLEENWEALTTQPKKTFAALNPSIH
KTLISNDIFKHHIVGDDVIVCLKNTNLYQMKPGYDQFRILASQLKTKVTT
GGGILPQSGGWHANNRKRKATNNNATITTGASTPSATRVGEMVTNTGKPK
RGIEETKVKLTQFNYPVDHPFNKDSYRYIYVESDPHAKGRQLWEECEATA
GRIIPGFFYRVTISQQIALATNDRAHQLKLSDSQLSVTGDKGYCMIRATQ
PVSRGCWYFEAKIVEQPDNSHARIGWSQSLGNLQAPCGFDKFSYACRSRF
GTAFHQSKGKHYMNHGYKKGDVLGCMFIASAPNIKRVSKQNLTQALFGKL
PESFKERPLIKFKNSYYYEEKEEASKAEKELKQLENSKITFYKNGVSYGP
AFTDIFDGAYYPAISIYKQASVAVNFGPNFTFPPTDVENWMPMSERHIDL
EVEQTVSDMLWLTEKDDTIEQIIMNPQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0048188Set1C/COMPASS complex
Vocabulary: biological process
TermDefinition
GO:0051568histone H3-K4 methylation
GO:0032259methylation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000044cephalic ganglia
PLANA:0000422tail stripe
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR037353ASH2
IPR003877SPRY_dom
IPR013083Znf_RING/FYVE/PHD
IPR019786Zinc_finger_PHD-type_CS
IPR001870B30.2/SPRY
IPR013320ConA-like_dom_sf
IPR011011Znf_FYVE_PHD
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0008168methyltransferase activity
GO:0008270zinc ion binding
GO:0016740transferase activity
GO:0046872metal ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 467..494
NoneNo IPR availableGENE3DG3DSA:1.10.10.2760coord: 37..195
e-value: 1.8E-44
score: 153.6
NoneNo IPR availableCDDcd12872SPRY_Ash2coord: 328..530
e-value: 1.45324E-66
score: 211.222
IPR003877SPRY domainSMARTSM00449SPRY_3coord: 354..530
e-value: 2.6E-26
score: 103.4
IPR003877SPRY domainPFAMPF00622SPRYcoord: 357..428
e-value: 7.3E-7
score: 29.3
coord: 485..528
e-value: 3.7E-5
score: 23.8
IPR037353Histone methyltransferase complex subunit ASH2PANTHERPTHR10598SET1/ASH2 HISTONE METHYLTRANSFERASE COMPLEX SUBUNIT ASH2coord: 44..560
IPR019786Zinc finger, PHD-type, conserved sitePROSITEPS01359ZF_PHD_1coord: 33..81
IPR001870B30.2/SPRY domainPROSITEPS50188B302_SPRYcoord: 296..531
score: 10.759
IPR013320Concanavalin A-like lectin/glucanase domain superfamilySUPERFAMILYSSF49899Concanavalin A-like lectins/glucanasescoord: 313..532
IPR011011Zinc finger, FYVE/PHD-typeSUPERFAMILYSSF57903FYVE/PHD zinc fingercoord: 30..89