Si:ch211-193l2.10

Overview
NameSi:ch211-193l2.10
Smed IDSMED30019364
Length (bp)1185
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Si:ch211-193l2.10 (SMED30019364) t-SNE clustered cells

Violin plots show distribution of expression levels for Si:ch211-193l2.10 (SMED30019364) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Si:ch211-193l2.10 (SMED30019364) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Si:ch211-193l2.10 (SMED30019364) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019364

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30019364SMESG000062713.1 SmedASXL_068272SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30019364SMESG000062713.1 SmedASXL_009824SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30019364SMESG000062713.1 dd_Smed_v4_3203_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30019364SMESG000062713.1 dd_Smed_v4_3203_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30019364SMESG000062713.1 dd_Smed_v4_3203_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30019364SMESG000062713.1 dd_Smed_v4_3203_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30019364SMESG000062713.1 dd_Smed_v6_3203_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
body wall musculatureSMED30019364SMESG000062713.1 dd_Smed_v4_3203_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30019364SMESG000062713.1 dd_Smed_v4_3203_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Si:ch211-193l2.10 vs. Ensembl Human
Match: ATP6V1FNB (ATP6V1F neighbor [Source:HGNC Symbol;Acc:HGNC:52392])

HSP 1 Score: 51.9878 bits (123), Expect = 2.648e-7
Identity = 30/89 (33.71%), Postives = 46/89 (51.69%), Query Frame = 1
Query:  772 EKPEHFGMIPPNSKVRSFLYSGFSKEGKGRIQYLKSRNEISPEQKYTYPLLSSWYYGWGVGDYAKNQDSKNKRFGRTKVIEDSFFTRTG 1038
            E P    M P     R+ LY G S + +GR +YL +R    PE +Y +P+ +S+ YGW +G   K Q+  + +  R     +SFF + G
Sbjct:   81 EAPFQSEMYPVPPITRALLYEGISHDFQGRYRYLNTRKLDMPETRYLFPITTSFTYGWQLGPPVK-QELVSCKMCRI----ESFFRKNG 164          
BLAST of Si:ch211-193l2.10 vs. Ensembl Zebrafish
Match: si:ch211-193l2.10 (si:ch211-193l2.10 [Source:ZFIN;Acc:ZDB-GENE-160114-52])

HSP 1 Score: 77.0258 bits (188), Expect = 3.838e-16
Identity = 35/82 (42.68%), Postives = 51/82 (62.20%), Query Frame = 1
Query:  793 MIPPNSKVRSFLYSGFSKEGKGRIQYLKSRNEISPEQKYTYPLLSSWYYGWGVGDYAKNQDSKNKRFGRTKVIEDSFFTRTG 1038
            M P + +    LY G S EGKGR+ YL+ R +  PE+K+ YP+LSSW YGW +GD+    D +    GR+ V++ +F+ R G
Sbjct:   89 MRPVSPQTSGALYQGISTEGKGRLLYLRKRAQKGPEEKFDYPILSSWEYGWRLGDF--ETDCRTPANGRSGVVKSAFYARNG 168          
BLAST of Si:ch211-193l2.10 vs. Ensembl Xenopus
Match: ints4 (integrator complex subunit 4 [Source:Xenbase;Acc:XB-GENE-5841108])

HSP 1 Score: 86.6557 bits (213), Expect = 1.584e-19
Identity = 63/181 (34.81%), Postives = 91/181 (50.28%), Query Frame = 1
Query:  508 FDTQRQKALMELYEKEASAQLENYLKTQKNSGKDSVKQSKLSEALRNRAERNRIPTEGIKDRLPQIQANKQRTFTKRKPTEEIFELKNEKPEHFG---MIPPNSKVRSFLYSGFSKEGKGRIQYLKSRNEISPEQKYTYPLLSSWYYGWGVGDYAKNQDSKNKRFGRTKVIEDSFFTRTGV 1041
              T+ Q    EL EKE ++++   L+ ++   ++  ++S      R R E   +P  G    LP I   K+     + P E    L    PE  G   M     +    LY GFSKEGKGR  YL+ R E+SPEQKY +P+LSSW YGW + +     + K    GR K++ D+F++R GV
Sbjct:    5 LTTRNQNCWKELIEKETASRMYWKLRYKEEHPQNPPERS------RKRKE-GSLPNIGT-TLLPPINVPKR--LVVKPPEEPACGL----PEEGGLGEMRAATPRTSRLLYDGFSKEGKGRSLYLRRRKELSPEQKYPHPMLSSWDYGWRLDEMVG--EVKAPVQGRCKIVRDTFYSRNGV 169          
BLAST of Si:ch211-193l2.10 vs. Ensembl Xenopus
Match: ptcd3 (pentatricopeptide repeat domain 3 [Source:Xenbase;Acc:XB-GENE-961480])

HSP 1 Score: 72.7886 bits (177), Expect = 1.520e-14
Identity = 54/191 (28.27%), Postives = 94/191 (49.21%), Query Frame = 1
Query:  490 MSRNFPFDTQRQKALMELYEKEASAQLENYL-----KTQKNSGKDSVKQSKLSEALRNRAERNRIPTEGIKDRLPQIQANKQRTFTKRKPTEEIFELKNEKPEHFGMIPPNSKVRSFLYSGFSKEGKGRIQYLKSRNEISPEQKYTYPLLSSWYYGWGVGDYAKNQDSKNKRFGRTKVIEDSFFTRTGVPI 1047
            M R F   TQ+Q+ L E Y KE  A++ N+      + Q    K   KQS    A+   A+++ +P+  +  +       + +   +++ T    E++   P   G+          LY G S+E  GR +YL++R  I PE KY++P+ ++  YGW +G+   +Q      FGR  V+ D+F+ + G+P+
Sbjct:    1 MVREFSLTTQQQEFLKEAYGKEIQAKV-NWCSRYGKRLQVQQRKPKCKQSFKLPAI---ADQSILPSAELSKKEHFHHPGRAKEADEKESTNMAAEMRPASPCTLGL----------LYYGTSREKDGRYRYLQARYCIKPEDKYSFPITTNSTYGWKLGNIYTSQ---YPFFGRYCVVTDTFYRKNGIPL 174          
BLAST of Si:ch211-193l2.10 vs. Ensembl Mouse
Match: Gm45521 (predicted gene 45521 [Source:MGI Symbol;Acc:MGI:5791357])

HSP 1 Score: 83.5741 bits (205), Expect = 2.484e-18
Identity = 42/100 (42.00%), Postives = 58/100 (58.00%), Query Frame = 1
Query:  775 KPEHFGMIPPNSKVRSFLYSGFSKEGKGRIQYLKSRNEISPEQKYTYPLLSSWYYGWGVGDYAKNQDSKNKRFGRTKVIEDSFFTRTGV---PIRQMDGM 1065
            +PE   M PP       L+ G S++G+GR  YLK R+++ PE+KY YP++SSW YGW VGD+ K  D +     +T  I  SF+ + GV   P R  D M
Sbjct:  101 RPEDLEMKPPAPATLKLLFEGISRDGQGRTLYLKERHQVIPEKKYKYPMVSSWEYGWHVGDFMK--DYRTPAHAKTHPITKSFYIKNGVFPNPRRSDDIM 198          
BLAST of Si:ch211-193l2.10 vs. Ensembl Mouse
Match: Atp6v1fnb (Atp6v1f neighbor [Source:MGI Symbol;Acc:MGI:3644212])

HSP 1 Score: 53.1434 bits (126), Expect = 7.007e-8
Identity = 52/187 (27.81%), Postives = 81/187 (43.32%), Query Frame = 1
Query:  490 MSRNFPFDTQRQKALMELYEKEASAQLENYLKTQKNSGKDSVKQSKLSEALRNRAERNRIPTEGIKDRLPQIQANKQRTFTKRKPTEEIFELKNEKPEHF---GMIPPNSKVRSFLYSGFSKEGKGRIQYLKSRNEISPEQKYTYPLLSSWYYGWGVGDYAKNQDSKNKRFGRTKVIEDSFFTRTGV 1041
            MSR    DT RQ    E Y KE   + E     Q+  G        L +A +     +R+P + +   LPQ         +K  P++      +  PE      M P     ++ LY G S + +GR QYL +R    PE +Y +P+ +++ YGW +G   K Q+  + +  R     +SFF + G 
Sbjct:    1 MSRQLNMDTLRQNFWKEEYLKEMMLRYE----WQRKYGT-------LVKAKQKAKAASRLPRK-LPTLLPQASVAPPPPASKTTPSKA----PSPAPEPLFLSDMYPVAPNTKALLYEGISHDLQGRYQYLNTRKLDLPETRYLFPITTNFTYGWQLGPPTK-QELVSCKMCRI----ESFFRKNGA 166          
BLAST of Si:ch211-193l2.10 vs. UniProt/SwissProt
Match: sp|B9EJX3|VAFNB_MOUSE (Protein ATP6V1FNB OS=Mus musculus OX=10090 GN=ATp6v1fnb PE=2 SV=1)

HSP 1 Score: 53.1434 bits (126), Expect = 4.901e-7
Identity = 52/187 (27.81%), Postives = 81/187 (43.32%), Query Frame = 1
Query:  490 MSRNFPFDTQRQKALMELYEKEASAQLENYLKTQKNSGKDSVKQSKLSEALRNRAERNRIPTEGIKDRLPQIQANKQRTFTKRKPTEEIFELKNEKPEHF---GMIPPNSKVRSFLYSGFSKEGKGRIQYLKSRNEISPEQKYTYPLLSSWYYGWGVGDYAKNQDSKNKRFGRTKVIEDSFFTRTGV 1041
            MSR    DT RQ    E Y KE   + E     Q+  G        L +A +     +R+P + +   LPQ         +K  P++      +  PE      M P     ++ LY G S + +GR QYL +R    PE +Y +P+ +++ YGW +G   K Q+  + +  R     +SFF + G 
Sbjct:    1 MSRQLNMDTLRQNFWKEEYLKEMMLRYE----WQRKYGT-------LVKAKQKAKAASRLPRK-LPTLLPQASVAPPPPASKTTPSKA----PSPAPEPLFLSDMYPVAPNTKALLYEGISHDLQGRYQYLNTRKLDLPETRYLFPITTNFTYGWQLGPPTK-QELVSCKMCRI----ESFFRKNGA 166          
BLAST of Si:ch211-193l2.10 vs. UniProt/SwissProt
Match: sp|A0A1B0GUX0|VAFNB_HUMAN (Protein ATP6V1FNB OS=Homo sapiens OX=9606 GN=ATP6V1FNB PE=4 SV=1)

HSP 1 Score: 51.9878 bits (123), Expect = 1.272e-6
Identity = 30/89 (33.71%), Postives = 46/89 (51.69%), Query Frame = 1
Query:  772 EKPEHFGMIPPNSKVRSFLYSGFSKEGKGRIQYLKSRNEISPEQKYTYPLLSSWYYGWGVGDYAKNQDSKNKRFGRTKVIEDSFFTRTG 1038
            E P    M P     R+ LY G S + +GR +YL +R    PE +Y +P+ +S+ YGW +G   K Q+  + +  R     +SFF + G
Sbjct:   81 EAPFQSEMYPVPPITRALLYEGISHDFQGRYRYLNTRKLDMPETRYLFPITTSFTYGWQLGPPVK-QELVSCKMCRI----ESFFRKNG 164          
BLAST of Si:ch211-193l2.10 vs. TrEMBL
Match: A0A1I8GBX4 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig005090g1 PE=4 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 2.151e-35
Identity = 81/212 (38.21%), Postives = 122/212 (57.55%), Query Frame = 1
Query:  490 MSRNFPFDTQRQKALMELYEKEASAQLENYLK--------TQKNSGKDSVKQSKLSEALRNRAERNRIPTEGIKDRLPQIQANKQRTFTKRKPTEEIFE----LKNEKPE-HFGMIPPNSKVRSFLYSGFSKEGKGRIQYLKSRNEISPEQKYTYPLLSSWYYGWGVGDYAKNQDSKNKRFGRTKVIEDSFFTRTGVPIRQMDGMIQRSVTM 1086
            MSRN+P D   QK+L E Y KE  +QL  Y+K          +  G+    +S+  E  R + E     TE +++++ + ++ K     KR   +E+ +    L+ +  E    M P + K +  LY GFS+EGKGR QYLK R + +PE K+ +P++SSW YGW +GD  K +D K   FGRT++I D+F+TRTGVP +Q +G + RS T+
Sbjct:    1 MSRNYPADIAAQKSLEERYTKETDSQLHWYMKKKAERERLAAEQGGQPVEHKSRQMEVFRKKLEMAPTMTEELREQVDKFKSQKHLK-PKRDENQEVLDAIDRLQGDSQELCVEMRPISPKTKQLLYEGFSREGKGRRQYLKQRTDKAPEDKFQFPIVSSWEYGWKLGDVIKIEDIKKPPFGRTRLINDTFYTRTGVPSKQGEGTMSRSKTV 211          
BLAST of Si:ch211-193l2.10 vs. TrEMBL
Match: A0A267F8Z0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig029066g1 PE=4 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 3.006e-34
Identity = 81/207 (39.13%), Postives = 118/207 (57.00%), Query Frame = 1
Query:  490 MSRNFPFDTQRQKALMELYEKEASAQLENYLKTQKNSGK---DSVKQSKLSEALRNRAERNRIPTEGIKDRLPQIQANKQRTFTKRKPTEEIFE----LKNEKPE-HFGMIPPNSKVRSFLYSGFSKEGKGRIQYLKSRNEISPEQKYTYPLLSSWYYGWGVGDYAKNQDSKNKRFGRTKVIEDSFFTRTGVPIRQMDGMIQRSVTM 1086
            M+RN+P D   QK+L E Y KE  AQL  Y+  ++ SGK    +  +S+  E  + R E     T+ ++  + + +  K  T  KR   +E+ +    LK   P     M P + + R  LY GFS+EG+GR  YLK R   +PE KY +P++SSW YGW +G+  K  D K   FGRT++I D+F+TRTG+P RQ  G++ RS T+
Sbjct:    1 MARNYPADIAAQKSLEERYTKERDAQLHWYM-ARRASGKVGGGTETRSRQMEVFKRRLELAPTMTDDLRQSVEKFKTQKH-TKPKRNENQEVLDAISRLKESDPSLCVEMRPISPRTRGLLYQGFSREGRGRGLYLKERAAKAPEDKYQFPIVSSWEYGWKLGEVIKVADIKKPPFGRTRLINDTFYTRTGIPDRQTQGLLIRSKTV 205          
BLAST of Si:ch211-193l2.10 vs. TrEMBL
Match: A0A1I8HII7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 4.856e-34
Identity = 79/206 (38.35%), Postives = 116/206 (56.31%), Query Frame = 1
Query:  490 MSRNFPFDTQRQKALMELYEKEASAQLENYLKTQKNS--GKDSVKQSKLSEALRNRAERNRIPTEGIKDRLPQIQANKQRTFTKRKPTEEIFE----LKNEKPE-HFGMIPPNSKVRSFLYSGFSKEGKGRIQYLKSRNEISPEQKYTYPLLSSWYYGWGVGDYAKNQDSKNKRFGRTKVIEDSFFTRTGVPIRQMDGMIQRSVTM 1086
            M+RN+P D   QK+L E Y KE  AQL  Y+  + +   G  +  +S+  E  + R E     T+ ++  + + +  K  T  KR   +E+ +    LK   P     M P + + R  LY GFS+EG+GR  YLK R   +PE KY +P++SSW YGW +G+  K  D K   FGRT++I D+F+TRTG+P RQ  G++ RS T+
Sbjct:   27 MARNYPADIAAQKSLEERYTKERDAQLHWYMARRASGKVGGGTETRSRQMEVFKRRLELAPTMTDDLRQSVEKFKTQKH-TKPKRNENQEVLDAISRLKESDPSLCVEMRPISPRTRGLLYQGFSREGRGRGLYLKERAAKAPEDKYQFPIVSSWEYGWKLGEVIKVADIKKPPFGRTRLINDTFYTRTGIPDRQTQGLLIRSKTV 231          
BLAST of Si:ch211-193l2.10 vs. TrEMBL
Match: A0A210PDY2 (Uncharacterized protein OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT11451 PE=4 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 5.191e-34
Identity = 77/188 (40.96%), Postives = 112/188 (59.57%), Query Frame = 1
Query:  490 MSRNFPFDTQRQKALMELYEKEASAQLENYLKTQKNSGKDSVKQSKLSEALRNRAERNRIPTEGIKDRLPQIQANKQRTFTKRKPTEEIFELKNEKPEHF---GMIPPNSKVRSFLYSGFSKEGKGRIQYLKSRNEISPEQKYTYPLLSSWYYGWGVGDYAKNQDSKNKRFGRTKVIEDSFFTRTGVP 1044
            M+RN+P +TQ QK L E Y KE   +L  Y ++ K +   S+ +SK SE  R + +    P E + ++LP+ +  K + F K+K   +    + +         M P  ++VRS LY GF+KEGKGR QYL  R + SPE K+ +PLLSSW YGW +GD  K  + K   FGRT+++ D+F+TRTG+P
Sbjct:    1 MARNYPANTQIQKFLEESYNKERDTRLSWYFRSNKTT---SLAESKQSEVARRKIQCAPKPAEDLFNKLPEDR--KPQKFNKKKSNFQDVPFREKDSGEMLSVAMHPVTTQVRSKLYDGFTKEGKGRYQYLCDRYKESPEDKFQFPLLSSWEYGWRLGDVVKKSEIKKPPFGRTRIVADTFYTRTGIP 183          
BLAST of Si:ch211-193l2.10 vs. TrEMBL
Match: A0A1I8G644 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 1.221e-33
Identity = 79/206 (38.35%), Postives = 116/206 (56.31%), Query Frame = 1
Query:  490 MSRNFPFDTQRQKALMELYEKEASAQLENYLKTQKNS--GKDSVKQSKLSEALRNRAERNRIPTEGIKDRLPQIQANKQRTFTKRKPTEEIFE----LKNEKPE-HFGMIPPNSKVRSFLYSGFSKEGKGRIQYLKSRNEISPEQKYTYPLLSSWYYGWGVGDYAKNQDSKNKRFGRTKVIEDSFFTRTGVPIRQMDGMIQRSVTM 1086
            M+RN+P D   QK+L E Y KE  AQL  Y+  + +   G  +  +S+  E  + R E     T+ ++  + + +  K  T  KR   +E+ +    LK   P     M P + + R  LY GFS+EG+GR  YLK R   +PE KY +P++SSW YGW +G+  K  D K   FGRT++I D+F+TRTG+P RQ  G++ RS T+
Sbjct:   59 MARNYPADIAAQKSLEERYTKERDAQLHWYMARRASGKVGGGTETRSRQMEVFKRRLELAPTMTDDLRQSVEKFKTQKH-TKPKRNENQEVLDAISRLKESDPSLCVEMRPISPRTRGLLYQGFSREGRGRGLYLKERAAKAPEDKYQFPIVSSWEYGWKLGEVIKVADIKKPPFGRTRLINDTFYTRTGIPDRQTQGLLIRSKTV 263          
BLAST of Si:ch211-193l2.10 vs. Ensembl Cavefish
Match: si:ch211-193l2.10 (uncharacterized LOC107197672 [Source:NCBI gene;Acc:107197672])

HSP 1 Score: 81.2629 bits (199), Expect = 1.270e-17
Identity = 39/83 (46.99%), Postives = 51/83 (61.45%), Query Frame = 1
Query:  793 MIPPNSKVRSFLYSGFSKEGKGRIQYLKSRNEISPEQKYTYPLLSSWYYGWGVGDYAKNQDSKNKRFGRTKVIEDSFFTRTGV 1041
            M P +   +  LY G SKEGKGR  YL+ R +  PE+K+ YP+LSSW YGW +GDY  N  S     GR+ V+  SF+ R G+
Sbjct:  102 MRPVSPHTKDALYQGLSKEGKGRSMYLRRRVQKMPEEKFDYPILSSWEYGWRLGDYDHNYKSPAN--GRSGVVRSSFYARNGI 182          
BLAST of Si:ch211-193l2.10 vs. Ensembl Medaka
Match: si:ch211-193l2.10 (si:ch211-193l2.10 [Source:ZFIN;Acc:ZDB-GENE-160114-52])

HSP 1 Score: 65.4698 bits (158), Expect = 1.434e-12
Identity = 30/75 (40.00%), Postives = 45/75 (60.00%), Query Frame = 1
Query:  817 RSFLYSGFSKEGKGRIQYLKSRNEISPEQKYTYPLLSSWYYGWGVGDYAKNQDSKNKRFGRTKVIEDSFFTRTGV 1041
            R+ L      +G GR  YL+ R  I PE+K+ +PLLSSW YGW +GD+    D +     R+ V+E +F+++ GV
Sbjct:   64 RAMLQDSSHHQGIGRSLYLQRRGHIRPEEKFDFPLLSSWDYGWRLGDF--TLDYRTPSHARSAVVEKTFYSKNGV 136          
BLAST of Si:ch211-193l2.10 vs. Planmine SMEST
Match: SMESG000062713.1 (SMESG000062713.1)

HSP 1 Score: 412.535 bits (1059), Expect = 6.519e-146
Identity = 200/200 (100.00%), Postives = 200/200 (100.00%), Query Frame = 1
Query:  490 MSRNFPFDTQRQKALMELYEKEASAQLENYLKTQKNSGKDSVKQSKLSEALRNRAERNRIPTEGIKDRLPQIQANKQRTFTKRKPTEEIFELKNEKPEHFGMIPPNSKVRSFLYSGFSKEGKGRIQYLKSRNEISPEQKYTYPLLSSWYYGWGVGDYAKNQDSKNKRFGRTKVIEDSFFTRTGVPIRQMDGMIQRSVTMS 1089
            MSRNFPFDTQRQKALMELYEKEASAQLENYLKTQKNSGKDSVKQSKLSEALRNRAERNRIPTEGIKDRLPQIQANKQRTFTKRKPTEEIFELKNEKPEHFGMIPPNSKVRSFLYSGFSKEGKGRIQYLKSRNEISPEQKYTYPLLSSWYYGWGVGDYAKNQDSKNKRFGRTKVIEDSFFTRTGVPIRQMDGMIQRSVTMS
Sbjct:    1 MSRNFPFDTQRQKALMELYEKEASAQLENYLKTQKNSGKDSVKQSKLSEALRNRAERNRIPTEGIKDRLPQIQANKQRTFTKRKPTEEIFELKNEKPEHFGMIPPNSKVRSFLYSGFSKEGKGRIQYLKSRNEISPEQKYTYPLLSSWYYGWGVGDYAKNQDSKNKRFGRTKVIEDSFFTRTGVPIRQMDGMIQRSVTMS 200          
The following BLAST results are available for this feature:
BLAST of Si:ch211-193l2.10 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ATP6V1FNB2.648e-733.71ATP6V1F neighbor [Source:HGNC Symbol;Acc:HGNC:5239... [more]
back to top
BLAST of Si:ch211-193l2.10 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Si:ch211-193l2.10 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Si:ch211-193l2.10 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
si:ch211-193l2.103.838e-1642.68si:ch211-193l2.10 [Source:ZFIN;Acc:ZDB-GENE-160114... [more]
back to top
BLAST of Si:ch211-193l2.10 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ints41.584e-1934.81integrator complex subunit 4 [Source:Xenbase;Acc:X... [more]
ptcd31.520e-1428.27pentatricopeptide repeat domain 3 [Source:Xenbase;... [more]
back to top
BLAST of Si:ch211-193l2.10 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Gm455212.484e-1842.00predicted gene 45521 [Source:MGI Symbol;Acc:MGI:57... [more]
Atp6v1fnb7.007e-827.81Atp6v1f neighbor [Source:MGI Symbol;Acc:MGI:364421... [more]
back to top
BLAST of Si:ch211-193l2.10 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|B9EJX3|VAFNB_MOUSE4.901e-727.81Protein ATP6V1FNB OS=Mus musculus OX=10090 GN=ATp6... [more]
sp|A0A1B0GUX0|VAFNB_HUMAN1.272e-633.71Protein ATP6V1FNB OS=Homo sapiens OX=9606 GN=ATP6V... [more]
back to top
BLAST of Si:ch211-193l2.10 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8GBX42.151e-3538.21Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267F8Z03.006e-3439.13Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8HII74.856e-3438.35Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A210PDY25.191e-3440.96Uncharacterized protein OS=Mizuhopecten yessoensis... [more]
A0A1I8G6441.221e-3338.35Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Si:ch211-193l2.10 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
si:ch211-193l2.101.270e-1746.99uncharacterized LOC107197672 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Si:ch211-193l2.10 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Si:ch211-193l2.10 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Si:ch211-193l2.10 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Si:ch211-193l2.10 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
si:ch211-193l2.101.434e-1240.00si:ch211-193l2.10 [Source:ZFIN;Acc:ZDB-GENE-160114... [more]
back to top
BLAST of Si:ch211-193l2.10 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000062713.16.519e-146100.00SMESG000062713.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019364 ID=SMED30019364|Name=Si:ch211-193l2.10|organism=Schmidtea mediterranea sexual|type=transcript|length=1185bp
GAGGTTACAGTTTTACAGCTACAGCTGAATGAGATTTTGCAAAATGGATG
ACAATGAAACATTAATTATATTGGTTAAATTTTAATTAATTGTCATTGAA
TGTCATAACTTAATTATGAATATTGTAAAATATTTATGAGTGAATCTGTA
GAGATATGCATAATAATTTCGCTGCATTAATTTCGCAAACTGAATGACTC
TAAAACTGCAATATTCTGTAACATGATGTTGCTTGGCAACCAGTTCATAC
ACCTTGGTAACAATTAAATGCTTGTGTGCTGAGACTAAAATTATTAAATG
AATGTAATACTTGTCGCAGAATACAAATGCATCTCTAGAAAATTTCCTTT
TTGAATCAATCAACGACAAAAAATGTGAAGAAATTTTCCTAGGAAAATGT
CGGATGGCTCAAGTGGACAACAATAACATAAGCACCGCCAGTGAGGCTCT
GGAAAATTTTCATTTTTGAATCAATCAACAACATAAAAAATGTCGAGAAA
TTTTCCATTTGATACTCAGCGACAGAAAGCACTGATGGAATTATATGAGA
AAGAAGCTTCAGCACAGCTAGAAAATTATTTGAAAACTCAAAAAAACTCT
GGTAAAGATTCAGTGAAACAATCAAAATTGAGCGAAGCCCTAAGAAATCG
AGCCGAGAGAAACCGGATACCCACTGAAGGAATCAAGGACCGATTGCCAC
AAATTCAAGCAAACAAACAGAGAACTTTCACCAAACGGAAACCAACAGAA
GAAATATTTGAATTGAAAAATGAAAAACCAGAACATTTTGGAATGATTCC
GCCGAATTCAAAAGTTCGCTCATTTCTCTACAGTGGATTTTCCAAGGAAG
GCAAAGGAAGAATTCAATATTTAAAAAGCCGAAACGAGATTTCACCGGAA
CAGAAATATACTTATCCCTTACTGAGCTCTTGGTATTACGGTTGGGGTGT
CGGGGACTATGCGAAAAATCAAGACTCGAAAAATAAGAGATTCGGCAGAA
CGAAAGTTATTGAAGATTCTTTCTTTACAAGAACTGGTGTTCCAATCCGA
CAAATGGACGGAATGATTCAGAGATCTGTTACTATGTCATAGATATGAAT
TCTTCGCTATTATTTGTTTTGATGTTCTACTTATGTTCTTTATCTATTCG
AAATATGAGAAGGTTTTGTGAGTTTTTAAAAAAAA
back to top

protein sequence of SMED30019364-orf-1

>SMED30019364-orf-1 ID=SMED30019364-orf-1|Name=SMED30019364-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=201bp
MSRNFPFDTQRQKALMELYEKEASAQLENYLKTQKNSGKDSVKQSKLSEA
LRNRAERNRIPTEGIKDRLPQIQANKQRTFTKRKPTEEIFELKNEKPEHF
GMIPPNSKVRSFLYSGFSKEGKGRIQYLKSRNEISPEQKYTYPLLSSWYY
GWGVGDYAKNQDSKNKRFGRTKVIEDSFFTRTGVPIRQMDGMIQRSVTMS
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000240body wall musculature
PLANA:0000418head
PLANA:0002032epidermal cell
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR35826FAMILY NOT NAMEDcoord: 1..185