Coiled-coil domain-containing protein 102A

Overview
NameCoiled-coil domain-containing protein 102A
Smed IDSMED30019336
Length (bp)1374
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Coiled-coil domain-containing protein 102A (SMED30019336) t-SNE clustered cells

Violin plots show distribution of expression levels for Coiled-coil domain-containing protein 102A (SMED30019336) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Coiled-coil domain-containing protein 102A (SMED30019336) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Coiled-coil domain-containing protein 102A (SMED30019336) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019336

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30019336h1SMcG0018722 Contig43248uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019336h1SMcG0018722 Contig43248newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30019336h1SMcG0018722 dd_Smed_v4_13699_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Coiled-coil domain-containing protein 102A vs. Ensembl Human
Match: CCDC102B (coiled-coil domain containing 102B [Source:HGNC Symbol;Acc:HGNC:26295])

HSP 1 Score: 72.0182 bits (175), Expect = 1.535e-14
Identity = 32/47 (68.09%), Postives = 38/47 (80.85%), Query Frame = 3
Query:  399 LKFRINQMEKTMRWWSDCTAKWREKWSKTRNERNIAREEIKLLKMEI 539
            +K R  QMEKTMRWWSDCTA WREKWSK R ERN AREE + L++++
Sbjct:   81 VKARAAQMEKTMRWWSDCTANWREKWSKVRAERNSAREEGRQLRIKL 127          
BLAST of Coiled-coil domain-containing protein 102A vs. Ensembl Human
Match: CCDC102B (coiled-coil domain containing 102B [Source:HGNC Symbol;Acc:HGNC:26295])

HSP 1 Score: 70.8626 bits (172), Expect = 3.115e-14
Identity = 32/44 (72.73%), Postives = 35/44 (79.55%), Query Frame = 3
Query:  399 LKFRINQMEKTMRWWSDCTAKWREKWSKTRNERNIAREEIKLLK 530
            +K R  QMEKTMRWWSDCTA WREKWSK R ERN AREE + L+
Sbjct:   81 VKARAAQMEKTMRWWSDCTANWREKWSKVRAERNSAREEGRQLR 124          
BLAST of Coiled-coil domain-containing protein 102A vs. Ensembl Human
Match: CCDC102B (coiled-coil domain containing 102B [Source:HGNC Symbol;Acc:HGNC:26295])

HSP 1 Score: 73.1738 bits (178), Expect = 1.339e-13
Identity = 32/47 (68.09%), Postives = 38/47 (80.85%), Query Frame = 3
Query:  399 LKFRINQMEKTMRWWSDCTAKWREKWSKTRNERNIAREEIKLLKMEI 539
            +K R  QMEKTMRWWSDCTA WREKWSK R ERN AREE + L++++
Sbjct:   81 VKARAAQMEKTMRWWSDCTANWREKWSKVRAERNSAREEGRQLRIKL 127          
BLAST of Coiled-coil domain-containing protein 102A vs. Ensembl Human
Match: CCDC102B (coiled-coil domain containing 102B [Source:HGNC Symbol;Acc:HGNC:26295])

HSP 1 Score: 73.559 bits (179), Expect = 2.206e-13
Identity = 32/47 (68.09%), Postives = 38/47 (80.85%), Query Frame = 3
Query:  399 LKFRINQMEKTMRWWSDCTAKWREKWSKTRNERNIAREEIKLLKMEI 539
            +K R  QMEKTMRWWSDCTA WREKWSK R ERN AREE + L++++
Sbjct:   81 VKARAAQMEKTMRWWSDCTANWREKWSKVRAERNSAREEGRQLRIKL 127          
BLAST of Coiled-coil domain-containing protein 102A vs. Ensembl Human
Match: CCDC102B (coiled-coil domain containing 102B [Source:HGNC Symbol;Acc:HGNC:26295])

HSP 1 Score: 73.559 bits (179), Expect = 2.411e-13
Identity = 32/47 (68.09%), Postives = 38/47 (80.85%), Query Frame = 3
Query:  399 LKFRINQMEKTMRWWSDCTAKWREKWSKTRNERNIAREEIKLLKMEI 539
            +K R  QMEKTMRWWSDCTA WREKWSK R ERN AREE + L++++
Sbjct:   81 VKARAAQMEKTMRWWSDCTANWREKWSKVRAERNSAREEGRQLRIKL 127          
BLAST of Coiled-coil domain-containing protein 102A vs. Ensembl Celegans
Match: F53F10.1 (pep chromosome:WBcel235:I:3834115:3837807:-1 gene:WBGene00018763.1 transcript:F53F10.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F53F10.1)

HSP 1 Score: 68.5514 bits (166), Expect = 6.412e-13
Identity = 30/49 (61.22%), Postives = 37/49 (75.51%), Query Frame = 3
Query:  387 ELEELKFRINQMEKTMRWWSDCTAKWREKWSKTRNERNIAREEIKLLKM 533
            EL+E + R  QMEKTMRWWS CTA WR +WS  R+ERN AREE + L++
Sbjct:   46 ELKEARDRAAQMEKTMRWWSSCTADWRNRWSAVRDERNRAREEAETLRL 94          
BLAST of Coiled-coil domain-containing protein 102A vs. Ensembl Fly
Match: CG31638 (gene:FBgn0051638 transcript:FBtr0079262)

HSP 1 Score: 80.4925 bits (197), Expect = 9.604e-16
Identity = 37/60 (61.67%), Postives = 44/60 (73.33%), Query Frame = 3
Query:  387 ELEELKFRINQMEKTMRWWSDCTAKWREKWSKTRNERNIAREEIKLLKMEINK-FKNPHN 563
            EL E + R  QMEKTM+WWSDCTA WREKWSK RNERN AREE K L ++++   K  H+
Sbjct:   53 ELHEARARAAQMEKTMKWWSDCTANWREKWSKVRNERNKAREESKQLSLKLDGVMKEAHS 112          
BLAST of Coiled-coil domain-containing protein 102A vs. Ensembl Fly
Match: CG31638 (gene:FBgn0051638 transcript:FBtr0113411)

HSP 1 Score: 80.1073 bits (196), Expect = 1.012e-15
Identity = 37/60 (61.67%), Postives = 44/60 (73.33%), Query Frame = 3
Query:  387 ELEELKFRINQMEKTMRWWSDCTAKWREKWSKTRNERNIAREEIKLLKMEINK-FKNPHN 563
            EL E + R  QMEKTM+WWSDCTA WREKWSK RNERN AREE K L ++++   K  H+
Sbjct:   53 ELHEARARAAQMEKTMKWWSDCTANWREKWSKVRNERNKAREESKQLSLKLDGVMKEAHS 112          
BLAST of Coiled-coil domain-containing protein 102A vs. Ensembl Zebrafish
Match: ccdc102a (coiled-coil domain containing 102A [Source:NCBI gene;Acc:325319])

HSP 1 Score: 72.0182 bits (175), Expect = 5.660e-13
Identity = 29/44 (65.91%), Postives = 35/44 (79.55%), Query Frame = 3
Query:  417 QMEKTMRWWSDCTAKWREKWSKTRNERNIAREEIKLLKMEINKF 548
            QMEKTMRWWSDCTA WREKWSK R ERN AR+E++ L+  ++  
Sbjct:   87 QMEKTMRWWSDCTANWREKWSKVRAERNRARDEVRQLRQRLDAL 130          
BLAST of Coiled-coil domain-containing protein 102A vs. Ensembl Xenopus
Match: ccdc102a (hypothetical LOC495519 like [Source:Xenbase;Acc:XB-GENE-5797018])

HSP 1 Score: 68.1662 bits (165), Expect = 1.267e-11
Identity = 29/33 (87.88%), Postives = 29/33 (87.88%), Query Frame = 3
Query:  417 QMEKTMRWWSDCTAKWREKWSKTRNERNIAREE 515
            QMEKTMRWWSDCTA WREKWSK R ERN AREE
Sbjct:   85 QMEKTMRWWSDCTANWREKWSKVRAERNKAREE 117          
BLAST of Coiled-coil domain-containing protein 102A vs. Ensembl Mouse
Match: Ccdc102a (coiled-coil domain containing 102A [Source:MGI Symbol;Acc:MGI:2686927])

HSP 1 Score: 73.559 bits (179), Expect = 1.905e-13
Identity = 30/44 (68.18%), Postives = 35/44 (79.55%), Query Frame = 3
Query:  417 QMEKTMRWWSDCTAKWREKWSKTRNERNIAREEIKLLKMEINKF 548
            QMEKTMRWWSDCTA WREKWSK R ERN AREE++ L+  ++  
Sbjct:   88 QMEKTMRWWSDCTANWREKWSKVRAERNRAREEVRQLRQRLDTL 131          
BLAST of Coiled-coil domain-containing protein 102A vs. UniProt/SwissProt
Match: sp|A0JNH6|C102A_BOVIN (Coiled-coil domain-containing protein 102A OS=Bos taurus OX=9913 GN=CCDC102A PE=2 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 1.005e-12
Identity = 30/44 (68.18%), Postives = 35/44 (79.55%), Query Frame = 3
Query:  417 QMEKTMRWWSDCTAKWREKWSKTRNERNIAREEIKLLKMEINKF 548
            QMEKTMRWWSDCTA WREKWSK R ERN AREE++ L+  ++  
Sbjct:   89 QMEKTMRWWSDCTANWREKWSKVRAERNRAREEVRQLRQRLDAL 132          
BLAST of Coiled-coil domain-containing protein 102A vs. UniProt/SwissProt
Match: sp|Q68D86|C102B_HUMAN (Coiled-coil domain-containing protein 102B OS=Homo sapiens OX=9606 GN=CCDC102B PE=1 SV=4)

HSP 1 Score: 73.559 bits (179), Expect = 1.158e-12
Identity = 32/47 (68.09%), Postives = 38/47 (80.85%), Query Frame = 3
Query:  399 LKFRINQMEKTMRWWSDCTAKWREKWSKTRNERNIAREEIKLLKMEI 539
            +K R  QMEKTMRWWSDCTA WREKWSK R ERN AREE + L++++
Sbjct:   81 VKARAAQMEKTMRWWSDCTANWREKWSKVRAERNSAREEGRQLRIKL 127          
BLAST of Coiled-coil domain-containing protein 102A vs. UniProt/SwissProt
Match: sp|Q3TMW1|C102A_MOUSE (Coiled-coil domain-containing protein 102A OS=Mus musculus OX=10090 GN=Ccdc102a PE=1 SV=2)

HSP 1 Score: 73.559 bits (179), Expect = 1.333e-12
Identity = 30/44 (68.18%), Postives = 35/44 (79.55%), Query Frame = 3
Query:  417 QMEKTMRWWSDCTAKWREKWSKTRNERNIAREEIKLLKMEINKF 548
            QMEKTMRWWSDCTA WREKWSK R ERN AREE++ L+  ++  
Sbjct:   88 QMEKTMRWWSDCTANWREKWSKVRAERNRAREEVRQLRQRLDTL 131          
BLAST of Coiled-coil domain-containing protein 102A vs. UniProt/SwissProt
Match: sp|Q6NZW0|C102A_DANRE (Coiled-coil domain-containing protein 102A OS=Danio rerio OX=7955 GN=ccdc102a PE=2 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 4.387e-12
Identity = 29/44 (65.91%), Postives = 35/44 (79.55%), Query Frame = 3
Query:  417 QMEKTMRWWSDCTAKWREKWSKTRNERNIAREEIKLLKMEINKF 548
            QMEKTMRWWSDCTA WREKWSK R ERN AR+E++ L+  ++  
Sbjct:   87 QMEKTMRWWSDCTANWREKWSKVRAERNRARDEVRQLRQRLDAL 130          
BLAST of Coiled-coil domain-containing protein 102A vs. UniProt/SwissProt
Match: sp|Q96A19|C102A_HUMAN (Coiled-coil domain-containing protein 102A OS=Homo sapiens OX=9606 GN=CCDC102A PE=1 SV=2)

HSP 1 Score: 68.5514 bits (166), Expect = 5.009e-11
Identity = 29/44 (65.91%), Postives = 34/44 (77.27%), Query Frame = 3
Query:  417 QMEKTMRWWSDCTAKWREKWSKTRNERNIAREEIKLLKMEINKF 548
            QMEKTMR WSDCTA WREKWSK R ERN AREE++ L+  ++  
Sbjct:   89 QMEKTMRRWSDCTANWREKWSKVRAERNRAREEVRQLRQRLDAL 132          
BLAST of Coiled-coil domain-containing protein 102A vs. TrEMBL
Match: A0A2P2I2Z0 (Coiled-coil domain-containing protein 102A-like OS=Hirondellea gigas OX=1518452 PE=2 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 6.307e-16
Identity = 40/69 (57.97%), Postives = 50/69 (72.46%), Query Frame = 3
Query:  360 KEDFINKCEELEELKFRINQMEKTMRWWSDCTAKWREKWSKTRNERNIAREEIKLLKMEINKFKNPHNR 566
            K++ + +  ELEE + R  QMEKTMRWWSDCTA WREKWSK RNERN AREE++LL+M +   +    R
Sbjct:   58 KQEVVQR--ELEEARARATQMEKTMRWWSDCTANWREKWSKVRNERNRAREEVRLLRMRLEGAEREAGR 124          
BLAST of Coiled-coil domain-containing protein 102A vs. TrEMBL
Match: H0ZG34 (Uncharacterized protein OS=Taeniopygia guttata OX=59729 PE=4 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 3.517e-15
Identity = 37/56 (66.07%), Postives = 47/56 (83.93%), Query Frame = 3
Query:  378 KCEELEELKFRINQMEKTMRWWSDCTAKWREKWSKTRNERNIAREEIKLLKMEINK 545
            K +ELEE+K R+ QMEKTMRWWSDCTA WREKWSK R ERN AREE + L++++++
Sbjct:   71 KIQELEEVKARVAQMEKTMRWWSDCTANWREKWSKVRGERNKAREEARQLRLKLDR 126          
BLAST of Coiled-coil domain-containing protein 102A vs. TrEMBL
Match: E2BR15 (Coiled-coil domain-containing protein 102A OS=Harpegnathos saltator OX=610380 GN=EAI_12310 PE=4 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 6.435e-15
Identity = 43/63 (68.25%), Postives = 49/63 (77.78%), Query Frame = 3
Query:  387 ELEELKFRINQMEKTMRWWSDCTAKWREKWSKTRNERNIAREEIKLL--KMEI-----NKFKN 554
            ELEE + R  QMEKTMRWWSDCTA WREKWSK RNERN+AREE+K+L  K+EI     N FK+
Sbjct:   41 ELEEARARAAQMEKTMRWWSDCTANWREKWSKVRNERNMAREEVKVLRAKLEIAVKDANTFKH 103          
BLAST of Coiled-coil domain-containing protein 102A vs. TrEMBL
Match: A0A482WFS8 (Uncharacterized protein OS=Laodelphax striatellus OX=195883 GN=LSTR_LSTR001853 PE=4 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 1.331e-14
Identity = 38/52 (73.08%), Postives = 43/52 (82.69%), Query Frame = 3
Query:  387 ELEELKFRINQMEKTMRWWSDCTAKWREKWSKTRNERNIAREEIKLLKMEIN 542
            ELEE + R  QMEKTMRWWSDCTA WREKWSK RNERN AREE KLL+ +++
Sbjct:   40 ELEEARARAAQMEKTMRWWSDCTANWREKWSKVRNERNKAREEAKLLRTQLD 91          
BLAST of Coiled-coil domain-containing protein 102A vs. TrEMBL
Match: A0A2J7QGA6 (Uncharacterized protein OS=Cryptotermes secundus OX=105785 GN=B7P43_G15403 PE=4 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 1.383e-14
Identity = 39/56 (69.64%), Postives = 45/56 (80.36%), Query Frame = 3
Query:  387 ELEELKFRINQMEKTMRWWSDCTAKWREKWSKTRNERNIAREEIKLLKMEI-NKFK 551
            ELEE + R  QMEKTMRWWSDCTA WREKWSK RNERN AREE K+L+ ++ + FK
Sbjct:   44 ELEEARARATQMEKTMRWWSDCTANWREKWSKVRNERNKAREESKMLRTKLESAFK 99          
BLAST of Coiled-coil domain-containing protein 102A vs. Ensembl Cavefish
Match: ccdc102a (coiled-coil domain containing 102A [Source:NCBI gene;Acc:103027896])

HSP 1 Score: 72.0182 bits (175), Expect = 4.719e-13
Identity = 29/44 (65.91%), Postives = 35/44 (79.55%), Query Frame = 3
Query:  417 QMEKTMRWWSDCTAKWREKWSKTRNERNIAREEIKLLKMEINKF 548
            QMEKTMRWWSDCTA WREKWSK R ERN AR+E++ L+  ++  
Sbjct:   88 QMEKTMRWWSDCTANWREKWSKVRAERNRARDEVRQLRQRLDAL 131          
BLAST of Coiled-coil domain-containing protein 102A vs. Ensembl Sea Lamprey
Match: ccdc102a (coiled-coil domain containing 102A [Source:NCBI gene;Acc:325319])

HSP 1 Score: 67.781 bits (164), Expect = 1.884e-12
Identity = 29/41 (70.73%), Postives = 32/41 (78.05%), Query Frame = 3
Query:  408 RINQMEKTMRWWSDCTAKWREKWSKTRNERNIAREEIKLLK 530
            R  Q+EKTMRWWSDCTA WREKW+K R ERN AREE   L+
Sbjct:   49 RALQLEKTMRWWSDCTASWREKWAKVRAERNRAREEASSLR 89          
BLAST of Coiled-coil domain-containing protein 102A vs. Ensembl Medaka
Match: ccdc102a (coiled-coil domain containing 102A [Source:NCBI gene;Acc:101166684])

HSP 1 Score: 73.559 bits (179), Expect = 1.505e-13
Identity = 30/44 (68.18%), Postives = 35/44 (79.55%), Query Frame = 3
Query:  417 QMEKTMRWWSDCTAKWREKWSKTRNERNIAREEIKLLKMEINKF 548
            QMEKTMRWWSDCTA WREKWSK R ERN AR+EI+ L+  ++  
Sbjct:  102 QMEKTMRWWSDCTANWREKWSKVRAERNRARDEIRQLRQRLDAL 145          
BLAST of Coiled-coil domain-containing protein 102A vs. Ensembl Medaka
Match: ccdc102a (coiled-coil domain containing 102A [Source:NCBI gene;Acc:101166684])

HSP 1 Score: 73.559 bits (179), Expect = 1.505e-13
Identity = 30/44 (68.18%), Postives = 35/44 (79.55%), Query Frame = 3
Query:  417 QMEKTMRWWSDCTAKWREKWSKTRNERNIAREEIKLLKMEINKF 548
            QMEKTMRWWSDCTA WREKWSK R ERN AR+EI+ L+  ++  
Sbjct:  102 QMEKTMRWWSDCTANWREKWSKVRAERNRARDEIRQLRQRLDAL 145          
BLAST of Coiled-coil domain-containing protein 102A vs. Ensembl Medaka
Match: ccdc102a (coiled-coil domain containing 102A [Source:NCBI gene;Acc:101166684])

HSP 1 Score: 73.559 bits (179), Expect = 1.505e-13
Identity = 30/44 (68.18%), Postives = 35/44 (79.55%), Query Frame = 3
Query:  417 QMEKTMRWWSDCTAKWREKWSKTRNERNIAREEIKLLKMEINKF 548
            QMEKTMRWWSDCTA WREKWSK R ERN AR+EI+ L+  ++  
Sbjct:  102 QMEKTMRWWSDCTANWREKWSKVRAERNRARDEIRQLRQRLDAL 145          
BLAST of Coiled-coil domain-containing protein 102A vs. Planmine SMEST
Match: SMESG000026019.1 (SMESG000026019.1)

HSP 1 Score: 720.309 bits (1858), Expect = 0.000e+0
Identity = 384/385 (99.74%), Postives = 384/385 (99.74%), Query Frame = 3
Query:   75 MQPLNERKLSSSKMVNDRKTLPIQCYEKQHETFLSQDHCYSMDINEMHHHTDNYMDSHPXXXXXXXXXXXXXXXXXXPVYKRFTVSPESINVDTLKEDFINKCEELEELKFRINQMEKTMRWWSDCTAKWREKWSKTRNERNIAREEIKLLKMEINKFKNPHNRNSKTEKSIRSAGMPNNSDETANQDELVNLSKNNDKLIGKRISISSSGWEEAFQMLQEENDNLTTALKEAQNEIIRLVNDRDSHLDPVPDETIKKIESIIQQDKSAIGTSQKLNDDINIKILSTDIDIECTNELYNKQIFTAFDYTPAPNRTNCCPEENYCFSHQXXXXXXXXXXXXXDKIQNLTVSLSDCRFQLENEKLKNNHSKRGSSTLDRRKQHSESC 1229
            MQPLNERKLSSSKMVNDRKTLPIQCYEKQHETFLSQDHCYSMDINEMHHHTDNYMDSHPRLRSQSNQRSSENNQINNPVYKRFTVSPESINVDTLKEDFINKCEELEELKFRINQMEKTMRWWSDCTAKWREKWSKTRNERNIAREEIKLLKMEINKFKNPHNRNSKTEKSIRSAGMPNNSDETANQDELVNLSKNNDKLIGKRISISSSGWEEAFQMLQEENDNLTTALKEAQNEIIRLVNDRDSHLDPVPDETIKKIESIIQQDKSAIGTSQKLNDDINIKILSTDIDIEC NELYNKQIFTAFDYTPAPNRTNCCPEENYCFSHQRLRLLEMEMSELRDKIQNLTVSLSDCRFQLENEKLKNNHSKRGSSTLDRRKQHSESC
Sbjct:    1 MQPLNERKLSSSKMVNDRKTLPIQCYEKQHETFLSQDHCYSMDINEMHHHTDNYMDSHPRLRSQSNQRSSENNQINNPVYKRFTVSPESINVDTLKEDFINKCEELEELKFRINQMEKTMRWWSDCTAKWREKWSKTRNERNIAREEIKLLKMEINKFKNPHNRNSKTEKSIRSAGMPNNSDETANQDELVNLSKNNDKLIGKRISISSSGWEEAFQMLQEENDNLTTALKEAQNEIIRLVNDRDSHLDPVPDETIKKIESIIQQDKSAIGTSQKLNDDINIKILSTDIDIECPNELYNKQIFTAFDYTPAPNRTNCCPEENYCFSHQRLRLLEMEMSELRDKIQNLTVSLSDCRFQLENEKLKNNHSKRGSSTLDRRKQHSESC 385          
BLAST of Coiled-coil domain-containing protein 102A vs. Planmine SMEST
Match: SMESG000074485.1 (SMESG000074485.1)

HSP 1 Score: 74.7146 bits (182), Expect = 1.307e-14
Identity = 54/145 (37.24%), Postives = 74/145 (51.03%), Query Frame = 3
Query:  360 KEDFINKCEELEELKFRINQMEKTMRWWSDCTAKWREKWSKTRNERNIAREEIKLLKMEINKFKNPHNRNSKTEKSIRSAGMPNNSDETANQDELVNLSKNNDKLIGKRISISSSGWEEAFQMLQEENDNLTTALKEAQNEIIRL 794
            KE+++ +  ELEELK R +Q+EK+MRWW+DCTA WREKW   + ERN   EEI   +  I K +  + +  ++ K  R   M + SD   N D  VN    N  L                  LQEE   L+  L +A+ EI R+
Sbjct:   42 KEEYLKR--ELEELKLRYHQVEKSMRWWADCTANWREKWGNVKTERNKLLEEILKYQTIIKKLEKENQQFKESVKMHRHLSM-DPSDIVVNTD--VNFCVENRIL-----------------FLQEEIKRLSDLLNDARVEISRI 164          
The following BLAST results are available for this feature:
BLAST of Coiled-coil domain-containing protein 102A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CCDC102B1.535e-1468.09coiled-coil domain containing 102B [Source:HGNC Sy... [more]
CCDC102B3.115e-1472.73coiled-coil domain containing 102B [Source:HGNC Sy... [more]
CCDC102B1.339e-1368.09coiled-coil domain containing 102B [Source:HGNC Sy... [more]
CCDC102B2.206e-1368.09coiled-coil domain containing 102B [Source:HGNC Sy... [more]
CCDC102B2.411e-1368.09coiled-coil domain containing 102B [Source:HGNC Sy... [more]
back to top
BLAST of Coiled-coil domain-containing protein 102A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
F53F10.16.412e-1361.22pep chromosome:WBcel235:I:3834115:3837807:-1 gene:... [more]
back to top
BLAST of Coiled-coil domain-containing protein 102A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG316389.604e-1661.67gene:FBgn0051638 transcript:FBtr0079262[more]
CG316381.012e-1561.67gene:FBgn0051638 transcript:FBtr0113411[more]
back to top
BLAST of Coiled-coil domain-containing protein 102A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ccdc102a5.660e-1365.91coiled-coil domain containing 102A [Source:NCBI ge... [more]
back to top
BLAST of Coiled-coil domain-containing protein 102A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ccdc102a1.267e-1187.88hypothetical LOC495519 like [Source:Xenbase;Acc:XB... [more]
back to top
BLAST of Coiled-coil domain-containing protein 102A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Ccdc102a1.905e-1368.18coiled-coil domain containing 102A [Source:MGI Sym... [more]
back to top
BLAST of Coiled-coil domain-containing protein 102A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A0JNH6|C102A_BOVIN1.005e-1268.18Coiled-coil domain-containing protein 102A OS=Bos ... [more]
sp|Q68D86|C102B_HUMAN1.158e-1268.09Coiled-coil domain-containing protein 102B OS=Homo... [more]
sp|Q3TMW1|C102A_MOUSE1.333e-1268.18Coiled-coil domain-containing protein 102A OS=Mus ... [more]
sp|Q6NZW0|C102A_DANRE4.387e-1265.91Coiled-coil domain-containing protein 102A OS=Dani... [more]
sp|Q96A19|C102A_HUMAN5.009e-1165.91Coiled-coil domain-containing protein 102A OS=Homo... [more]
back to top
BLAST of Coiled-coil domain-containing protein 102A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2P2I2Z06.307e-1657.97Coiled-coil domain-containing protein 102A-like OS... [more]
H0ZG343.517e-1566.07Uncharacterized protein OS=Taeniopygia guttata OX=... [more]
E2BR156.435e-1568.25Coiled-coil domain-containing protein 102A OS=Harp... [more]
A0A482WFS81.331e-1473.08Uncharacterized protein OS=Laodelphax striatellus ... [more]
A0A2J7QGA61.383e-1469.64Uncharacterized protein OS=Cryptotermes secundus O... [more]
back to top
BLAST of Coiled-coil domain-containing protein 102A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ccdc102a4.719e-1365.91coiled-coil domain containing 102A [Source:NCBI ge... [more]
back to top
BLAST of Coiled-coil domain-containing protein 102A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ccdc102a1.884e-1270.73coiled-coil domain containing 102A [Source:NCBI ge... [more]
back to top
BLAST of Coiled-coil domain-containing protein 102A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Coiled-coil domain-containing protein 102A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Coiled-coil domain-containing protein 102A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ccdc102a1.505e-1368.18coiled-coil domain containing 102A [Source:NCBI ge... [more]
ccdc102a1.505e-1368.18coiled-coil domain containing 102A [Source:NCBI ge... [more]
ccdc102a1.505e-1368.18coiled-coil domain containing 102A [Source:NCBI ge... [more]
back to top
BLAST of Coiled-coil domain-containing protein 102A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000026019.10.000e+099.74SMESG000026019.1[more]
SMESG000074485.11.307e-1437.24SMESG000074485.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019336 ID=SMED30019336|Name=Coiled-coil domain-containing protein 102A|organism=Schmidtea mediterranea sexual|type=transcript|length=1374bp
CCAAAATAACATTTAAAAATTCGAAATTGTCGAATTTATTTAAATAATTA
GACTTAAATTAAAATATATTGTAAATGCAGCCATTAAATGAAAGAAAACT
TTCAAGTTCAAAGATGGTAAATGATAGAAAAACATTACCTATTCAATGCT
ATGAAAAACAACATGAAACATTTCTGAGCCAAGATCATTGTTATTCCATG
GATATAAATGAAATGCATCATCATACAGATAATTATATGGATAGTCATCC
TAGATTGCGTTCTCAGTCAAACCAACGTAGCAGTGAGAATAATCAAATAA
ATAATCCCGTCTACAAGAGATTCACCGTTTCACCCGAGTCAATAAATGTG
GATACACTAAAAGAGGATTTCATCAACAAATGCGAAGAGCTGGAAGAGTT
GAAATTTCGAATTAATCAAATGGAAAAGACTATGAGATGGTGGTCAGATT
GCACGGCAAAATGGCGCGAAAAGTGGTCAAAGACCCGTAACGAACGAAAC
ATAGCTCGAGAAGAAATCAAGTTATTGAAAATGGAAATAAATAAATTTAA
AAATCCTCACAATCGGAATAGCAAAACTGAAAAATCCATTCGGTCGGCTG
GAATGCCTAATAATAGTGATGAAACGGCTAATCAGGATGAGTTGGTAAAT
TTGTCGAAAAATAATGATAAGCTCATTGGAAAACGGATTAGTATTTCAAG
TTCTGGTTGGGAAGAGGCGTTTCAAATGTTACAGGAAGAAAATGATAATT
TGACTACTGCCCTCAAAGAAGCTCAGAACGAAATCATTCGATTGGTGAAT
GACAGAGACAGTCACCTTGATCCGGTTCCCGATGAAACAATTAAAAAAAT
TGAGTCAATTATCCAGCAGGATAAATCTGCCATTGGGACATCACAAAAGC
TAAATGATGATATCAATATCAAAATTTTGTCCACTGATATTGATATAGAA
TGCACTAACGAATTGTATAACAAACAGATTTTCACTGCTTTCGATTACAC
TCCTGCTCCAAATCGAACCAATTGTTGCCCAGAAGAAAATTATTGTTTTT
CGCACCAGAGATTACGTTTATTAGAAATGGAAATGTCGGAACTTCGTGAT
AAAATCCAAAATCTCACTGTATCATTATCAGATTGTCGATTTCAGCTTGA
AAATGAGAAATTGAAAAATAATCATTCAAAGCGTGGGTCCAGCACTCTTG
ACAGACGCAAGCAGCACTCAGAAAGCTGTAAATGAATTCAAATTAATCTC
ATTTTAAAGATAATCAGTCAAAATAAATATTCAAAAATGTATACTGCTTA
AAAAAACGAATCTCAGATTTTATTTTTATTTGTAGATTTTATTTTTTTGT
GTATATATTTCGATTTGTTTACGA
back to top

protein sequence of SMED30019336-orf-1

>SMED30019336-orf-1 ID=SMED30019336-orf-1|Name=SMED30019336-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=387bp
MQPLNERKLSSSKMVNDRKTLPIQCYEKQHETFLSQDHCYSMDINEMHHH
TDNYMDSHPRLRSQSNQRSSENNQINNPVYKRFTVSPESINVDTLKEDFI
NKCEELEELKFRINQMEKTMRWWSDCTAKWREKWSKTRNERNIAREEIKL
LKMEINKFKNPHNRNSKTEKSIRSAGMPNNSDETANQDELVNLSKNNDKL
IGKRISISSSGWEEAFQMLQEENDNLTTALKEAQNEIIRLVNDRDSHLDP
VPDETIKKIESIIQQDKSAIGTSQKLNDDINIKILSTDIDIECTNELYNK
QIFTAFDYTPAPNRTNCCPEENYCFSHQRLRLLEMEMSELRDKIQNLTVS
LSDCRFQLENEKLKNNHSKRGSSTLDRRKQHSESCK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002056medial muscle cell
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 216..243
NoneNo IPR availableCOILSCoilCoilcoord: 330..350
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 158..185
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 365..386
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 170..185
NoneNo IPR availablePANTHERPTHR46292FAMILY NOT NAMEDcoord: 64..369