General transcription factor IIH subunit

Overview
NameGeneral transcription factor IIH subunit
Smed IDSMED30019332
Length (bp)1249
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of General transcription factor IIH subunit (SMED30019332) t-SNE clustered cells

Violin plots show distribution of expression levels for General transcription factor IIH subunit (SMED30019332) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of General transcription factor IIH subunit (SMED30019332) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for General transcription factor IIH subunit (SMED30019332) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019332

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30019332SMESG000049453.1 SmedASXL_010034SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30019332SMESG000049453.1 SmedASXL_010034SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30019332SMESG000049453.1 dd_Smed_v4_7018_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30019332SMESG000049453.1 dd_Smed_v4_7018_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of General transcription factor IIH subunit vs. Ensembl Human
Match: GTF2H2 (general transcription factor IIH subunit 2 [Source:HGNC Symbol;Acc:HGNC:4656])

HSP 1 Score: 278.485 bits (711), Expect = 1.112e-89
Identity = 162/391 (41.43%), Postives = 216/391 (55.24%), Query Frame = 1
Query:   55 VDTDETQGYNWQNENENDFERMDREDLFSFQK------LETERKRKFQKRPNNIRLGMMRYTLLFIDMTESMRILDLKPTRLGLTIKNASIFVENYFDQNPISQLGIFTISNGTVKKLTNLGGNPRKHIDALHSLTEDKCEGELSLENILRCSETILKHIPSYATREVILVVSSLTTCDHNDIDDIIELVRQHNIRCSVISLSAEVFVYKKLTKITKGKFQLILDEVDLKFIFQNLVMPPPSLKENAASLIHMGFP-----SYKKFDRLFKLCNCHFELQNDSSQLFS---CPRCDSAYCEVPVECNNCGLILVSAPHLARSYHHLFPLDEFVESSADSIHQSCRKCSACNKTINKDDLSYKCDHCMMDFCTDCDEFLHSSVHVCPNCSEK 1185
            +D +  +   W+   E  +E +  ++  S +        + +RKR F+     +RLGMMR+  + +D + +M   DLKP RL  T+K    FVE YFDQNPISQ+GI    +   +KLT L GNPRKHI +L    +  C GE SL N L  +   LKH+P + +REV+++ SSLTTCD ++I D+I+ ++   IR SVI LSAEV V   L + T G + +ILDE   K +  + V PPP+   +  SLI MGFP     S    D        H +   +         CP+C + YCE+PVEC  CGL LVSAPHLARSYHHLFPLD F E   +  +   R C  C   + KD   Y C  C   FC DCD F+H S+H CP C  K
Sbjct:    1 MDEEPERTKRWEGGYERTWEILKEDESGSLKATIEDILFKAKRKRVFEHH-GQVRLGMMRHLYVVVDGSRTMEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQIGIIVTKSKRAEKLTELSGNPRKHITSLKKAVDMTCHGEPSLYNSLSIAMQTLKHMPGHTSREVLIIFSSLTTCDPSNIYDLIKTLKAAKIRVSVIGLSAEVRVCTVLARETGGTYHVILDESHYKELLTHHVSPPPASSSSECSLIRMGFPQHTIASLSDQDAKPSFSMAHLDGNTEPGLTLGGYFCPQCRAKYCELPVECKICGLTLVSAPHLARSYHHLFPLDAFQEIPLEEYNGE-RFCYGCQGEL-KDQHVYVCAVCQNVFCVDCDVFVHDSLHCCPGCIHK 388          
BLAST of General transcription factor IIH subunit vs. Ensembl Human
Match: GTF2H2 (general transcription factor IIH subunit 2 [Source:HGNC Symbol;Acc:HGNC:4656])

HSP 1 Score: 278.485 bits (711), Expect = 1.112e-89
Identity = 162/391 (41.43%), Postives = 216/391 (55.24%), Query Frame = 1
Query:   55 VDTDETQGYNWQNENENDFERMDREDLFSFQK------LETERKRKFQKRPNNIRLGMMRYTLLFIDMTESMRILDLKPTRLGLTIKNASIFVENYFDQNPISQLGIFTISNGTVKKLTNLGGNPRKHIDALHSLTEDKCEGELSLENILRCSETILKHIPSYATREVILVVSSLTTCDHNDIDDIIELVRQHNIRCSVISLSAEVFVYKKLTKITKGKFQLILDEVDLKFIFQNLVMPPPSLKENAASLIHMGFP-----SYKKFDRLFKLCNCHFELQNDSSQLFS---CPRCDSAYCEVPVECNNCGLILVSAPHLARSYHHLFPLDEFVESSADSIHQSCRKCSACNKTINKDDLSYKCDHCMMDFCTDCDEFLHSSVHVCPNCSEK 1185
            +D +  +   W+   E  +E +  ++  S +        + +RKR F+     +RLGMMR+  + +D + +M   DLKP RL  T+K    FVE YFDQNPISQ+GI    +   +KLT L GNPRKHI +L    +  C GE SL N L  +   LKH+P + +REV+++ SSLTTCD ++I D+I+ ++   IR SVI LSAEV V   L + T G + +ILDE   K +  + V PPP+   +  SLI MGFP     S    D        H +   +         CP+C + YCE+PVEC  CGL LVSAPHLARSYHHLFPLD F E   +  +   R C  C   + KD   Y C  C   FC DCD F+H S+H CP C  K
Sbjct:    1 MDEEPERTKRWEGGYERTWEILKEDESGSLKATIEDILFKAKRKRVFEHH-GQVRLGMMRHLYVVVDGSRTMEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQIGIIVTKSKRAEKLTELSGNPRKHITSLKKAVDMTCHGEPSLYNSLSIAMQTLKHMPGHTSREVLIIFSSLTTCDPSNIYDLIKTLKAAKIRVSVIGLSAEVRVCTVLARETGGTYHVILDESHYKELLTHHVSPPPASSSSECSLIRMGFPQHTIASLSDQDAKPSFSMAHLDGNTEPGLTLGGYFCPQCRAKYCELPVECKICGLTLVSAPHLARSYHHLFPLDAFQEIPLEEYNGE-RFCYGCQGEL-KDQHVYVCAVCQNVFCVDCDVFVHDSLHCCPGCIHK 388          
BLAST of General transcription factor IIH subunit vs. Ensembl Human
Match: GTF2H2 (general transcription factor IIH subunit 2 [Source:HGNC Symbol;Acc:HGNC:4656])

HSP 1 Score: 278.485 bits (711), Expect = 1.112e-89
Identity = 162/391 (41.43%), Postives = 216/391 (55.24%), Query Frame = 1
Query:   55 VDTDETQGYNWQNENENDFERMDREDLFSFQK------LETERKRKFQKRPNNIRLGMMRYTLLFIDMTESMRILDLKPTRLGLTIKNASIFVENYFDQNPISQLGIFTISNGTVKKLTNLGGNPRKHIDALHSLTEDKCEGELSLENILRCSETILKHIPSYATREVILVVSSLTTCDHNDIDDIIELVRQHNIRCSVISLSAEVFVYKKLTKITKGKFQLILDEVDLKFIFQNLVMPPPSLKENAASLIHMGFP-----SYKKFDRLFKLCNCHFELQNDSSQLFS---CPRCDSAYCEVPVECNNCGLILVSAPHLARSYHHLFPLDEFVESSADSIHQSCRKCSACNKTINKDDLSYKCDHCMMDFCTDCDEFLHSSVHVCPNCSEK 1185
            +D +  +   W+   E  +E +  ++  S +        + +RKR F+     +RLGMMR+  + +D + +M   DLKP RL  T+K    FVE YFDQNPISQ+GI    +   +KLT L GNPRKHI +L    +  C GE SL N L  +   LKH+P + +REV+++ SSLTTCD ++I D+I+ ++   IR SVI LSAEV V   L + T G + +ILDE   K +  + V PPP+   +  SLI MGFP     S    D        H +   +         CP+C + YCE+PVEC  CGL LVSAPHLARSYHHLFPLD F E   +  +   R C  C   + KD   Y C  C   FC DCD F+H S+H CP C  K
Sbjct:    1 MDEEPERTKRWEGGYERTWEILKEDESGSLKATIEDILFKAKRKRVFEHH-GQVRLGMMRHLYVVVDGSRTMEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQIGIIVTKSKRAEKLTELSGNPRKHITSLKKAVDMTCHGEPSLYNSLSIAMQTLKHMPGHTSREVLIIFSSLTTCDPSNIYDLIKTLKAAKIRVSVIGLSAEVRVCTVLARETGGTYHVILDESHYKELLTHHVSPPPASSSSECSLIRMGFPQHTIASLSDQDAKPSFSMAHLDGNTEPGLTLGGYFCPQCRAKYCELPVECKICGLTLVSAPHLARSYHHLFPLDAFQEIPLEEYNGE-RFCYGCQGEL-KDQHVYVCAVCQNVFCVDCDVFVHDSLHCCPGCIHK 388          
BLAST of General transcription factor IIH subunit vs. Ensembl Human
Match: GTF2H2 (general transcription factor IIH subunit 2 [Source:HGNC Symbol;Acc:HGNC:4656])

HSP 1 Score: 278.485 bits (711), Expect = 1.112e-89
Identity = 162/391 (41.43%), Postives = 216/391 (55.24%), Query Frame = 1
Query:   55 VDTDETQGYNWQNENENDFERMDREDLFSFQK------LETERKRKFQKRPNNIRLGMMRYTLLFIDMTESMRILDLKPTRLGLTIKNASIFVENYFDQNPISQLGIFTISNGTVKKLTNLGGNPRKHIDALHSLTEDKCEGELSLENILRCSETILKHIPSYATREVILVVSSLTTCDHNDIDDIIELVRQHNIRCSVISLSAEVFVYKKLTKITKGKFQLILDEVDLKFIFQNLVMPPPSLKENAASLIHMGFP-----SYKKFDRLFKLCNCHFELQNDSSQLFS---CPRCDSAYCEVPVECNNCGLILVSAPHLARSYHHLFPLDEFVESSADSIHQSCRKCSACNKTINKDDLSYKCDHCMMDFCTDCDEFLHSSVHVCPNCSEK 1185
            +D +  +   W+   E  +E +  ++  S +        + +RKR F+     +RLGMMR+  + +D + +M   DLKP RL  T+K    FVE YFDQNPISQ+GI    +   +KLT L GNPRKHI +L    +  C GE SL N L  +   LKH+P + +REV+++ SSLTTCD ++I D+I+ ++   IR SVI LSAEV V   L + T G + +ILDE   K +  + V PPP+   +  SLI MGFP     S    D        H +   +         CP+C + YCE+PVEC  CGL LVSAPHLARSYHHLFPLD F E   +  +   R C  C   + KD   Y C  C   FC DCD F+H S+H CP C  K
Sbjct:    1 MDEEPERTKRWEGGYERTWEILKEDESGSLKATIEDILFKAKRKRVFEHH-GQVRLGMMRHLYVVVDGSRTMEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQIGIIVTKSKRAEKLTELSGNPRKHITSLKKAVDMTCHGEPSLYNSLSIAMQTLKHMPGHTSREVLIIFSSLTTCDPSNIYDLIKTLKAAKIRVSVIGLSAEVRVCTVLARETGGTYHVILDESHYKELLTHHVSPPPASSSSECSLIRMGFPQHTIASLSDQDAKPSFSMAHLDGNTEPGLTLGGYFCPQCRAKYCELPVECKICGLTLVSAPHLARSYHHLFPLDAFQEIPLEEYNGE-RFCYGCQGEL-KDQHVYVCAVCQNVFCVDCDVFVHDSLHCCPGCIHK 388          
BLAST of General transcription factor IIH subunit vs. Ensembl Human
Match: GTF2H2 (general transcription factor IIH subunit 2 [Source:HGNC Symbol;Acc:HGNC:4656])

HSP 1 Score: 278.485 bits (711), Expect = 1.112e-89
Identity = 162/391 (41.43%), Postives = 216/391 (55.24%), Query Frame = 1
Query:   55 VDTDETQGYNWQNENENDFERMDREDLFSFQK------LETERKRKFQKRPNNIRLGMMRYTLLFIDMTESMRILDLKPTRLGLTIKNASIFVENYFDQNPISQLGIFTISNGTVKKLTNLGGNPRKHIDALHSLTEDKCEGELSLENILRCSETILKHIPSYATREVILVVSSLTTCDHNDIDDIIELVRQHNIRCSVISLSAEVFVYKKLTKITKGKFQLILDEVDLKFIFQNLVMPPPSLKENAASLIHMGFP-----SYKKFDRLFKLCNCHFELQNDSSQLFS---CPRCDSAYCEVPVECNNCGLILVSAPHLARSYHHLFPLDEFVESSADSIHQSCRKCSACNKTINKDDLSYKCDHCMMDFCTDCDEFLHSSVHVCPNCSEK 1185
            +D +  +   W+   E  +E +  ++  S +        + +RKR F+     +RLGMMR+  + +D + +M   DLKP RL  T+K    FVE YFDQNPISQ+GI    +   +KLT L GNPRKHI +L    +  C GE SL N L  +   LKH+P + +REV+++ SSLTTCD ++I D+I+ ++   IR SVI LSAEV V   L + T G + +ILDE   K +  + V PPP+   +  SLI MGFP     S    D        H +   +         CP+C + YCE+PVEC  CGL LVSAPHLARSYHHLFPLD F E   +  +   R C  C   + KD   Y C  C   FC DCD F+H S+H CP C  K
Sbjct:    1 MDEEPERTKRWEGGYERTWEILKEDESGSLKATIEDILFKAKRKRVFEHH-GQVRLGMMRHLYVVVDGSRTMEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQIGIIVTKSKRAEKLTELSGNPRKHITSLKKAVDMTCHGEPSLYNSLSIAMQTLKHMPGHTSREVLIIFSSLTTCDPSNIYDLIKTLKAAKIRVSVIGLSAEVRVCTVLARETGGTYHVILDESHYKELLTHHVSPPPASSSSECSLIRMGFPQHTIASLSDQDAKPSFSMAHLDGNTEPGLTLGGYFCPQCRAKYCELPVECKICGLTLVSAPHLARSYHHLFPLDAFQEIPLEEYNGE-RFCYGCQGEL-KDQHVYVCAVCQNVFCVDCDVFVHDSLHCCPGCIHK 388          
BLAST of General transcription factor IIH subunit vs. Ensembl Celegans
Match: gtf-2H2C (General transcription factor IIH subunit 2 [Source:UniProtKB/Swiss-Prot;Acc:P34567])

HSP 1 Score: 271.166 bits (692), Expect = 1.652e-87
Identity = 141/383 (36.81%), Postives = 224/383 (58.49%), Query Frame = 1
Query:   55 VDTDETQGYNWQN---ENENDFERMDREDLFSFQK------LETERKRKFQKRPNNIRLGMMRYTLLFIDMTESMRILDLKPTRLGLTIKNASIFVENYFDQNPISQLGIFTISNGTVKKLTNLGGNPRKHIDALHSLTEDKCEGELSLENILRCSETILKHIPSYATREVILVVSSLTTCDHNDIDDIIELVRQHNIRCSVISLSAEVFVYKKLTKITKGKFQLILDEVDLKFIFQNLVMPPPSLKENAASLIHMGFPSYKKFDRLFKLCNCHFELQNDSSQLFSCPRCDSAYCEVPVECNNCGLILVSAPHLARSYHHLFPLDEFVESSADSIHQSCRKCSACNKTINKDDLSYKCDHCMMDFCTDCDEFLHSSVHVCPNC 1176
            +D DE +GY W+    E  N  + +  ++  S +K       +++RK +  KRP  IRLG+MR+ ++ ID +  M    + P+R  + +K    F++ +F+QNPI+Q+G+ T  +    +LT + GN R   ++L++LTE  C G+ SL+N L+ +   LK +P + +REV+LV+S+L+T D  +I   IE +++ NIRCS I LSAE+FV K++ K TKG++ + LD   L+ +F    +PP S K +  + IH+GFP ++        C CH + +  SS+ F C +C + +C +P EC  C L LV+AP LAR++ HL PL  F     + I  +   C AC   ++ +   ++C  C + FC DCD  LH S+HVCP C
Sbjct:    1 MDDDEQKGYTWEAGYAEGLNINDVLVEDEGGSIEKSIAKYVADSKRKARLTKRPERIRLGIMRHVMIVIDCSRFMTSKAMPPSRFVVVMKALQTFLDRFFEQNPIAQIGLITCKDRKADRLTMMTGNIRVLKESLNTLTEAFCGGDFSLQNALQLACANLKGMPGHVSREVVLVISALSTIDPGNIYSTIETMKRMNIRCSAIGLSAEMFVCKEMAKATKGEYSVALDPDHLQLLFSKHTLPPSSAKSSECNAIHVGFPHHELITTR-SFCVCHPDTKPISSRGFICTQCGARHCSIPAECPVCKLTLVAAPQLARAFRHLQPLSAF-----EQIEVTRGFCYACETRLSGE--GFRCGSCQLVFCLDCDTLLHESLHVCPGC 375          
BLAST of General transcription factor IIH subunit vs. Ensembl Celegans
Match: gtf-2H2C (General transcription factor IIH subunit 2 [Source:UniProtKB/Swiss-Prot;Acc:P34567])

HSP 1 Score: 271.166 bits (692), Expect = 1.652e-87
Identity = 141/383 (36.81%), Postives = 224/383 (58.49%), Query Frame = 1
Query:   55 VDTDETQGYNWQN---ENENDFERMDREDLFSFQK------LETERKRKFQKRPNNIRLGMMRYTLLFIDMTESMRILDLKPTRLGLTIKNASIFVENYFDQNPISQLGIFTISNGTVKKLTNLGGNPRKHIDALHSLTEDKCEGELSLENILRCSETILKHIPSYATREVILVVSSLTTCDHNDIDDIIELVRQHNIRCSVISLSAEVFVYKKLTKITKGKFQLILDEVDLKFIFQNLVMPPPSLKENAASLIHMGFPSYKKFDRLFKLCNCHFELQNDSSQLFSCPRCDSAYCEVPVECNNCGLILVSAPHLARSYHHLFPLDEFVESSADSIHQSCRKCSACNKTINKDDLSYKCDHCMMDFCTDCDEFLHSSVHVCPNC 1176
            +D DE +GY W+    E  N  + +  ++  S +K       +++RK +  KRP  IRLG+MR+ ++ ID +  M    + P+R  + +K    F++ +F+QNPI+Q+G+ T  +    +LT + GN R   ++L++LTE  C G+ SL+N L+ +   LK +P + +REV+LV+S+L+T D  +I   IE +++ NIRCS I LSAE+FV K++ K TKG++ + LD   L+ +F    +PP S K +  + IH+GFP ++        C CH + +  SS+ F C +C + +C +P EC  C L LV+AP LAR++ HL PL  F     + I  +   C AC   ++ +   ++C  C + FC DCD  LH S+HVCP C
Sbjct:    1 MDDDEQKGYTWEAGYAEGLNINDVLVEDEGGSIEKSIAKYVADSKRKARLTKRPERIRLGIMRHVMIVIDCSRFMTSKAMPPSRFVVVMKALQTFLDRFFEQNPIAQIGLITCKDRKADRLTMMTGNIRVLKESLNTLTEAFCGGDFSLQNALQLACANLKGMPGHVSREVVLVISALSTIDPGNIYSTIETMKRMNIRCSAIGLSAEMFVCKEMAKATKGEYSVALDPDHLQLLFSKHTLPPSSAKSSECNAIHVGFPHHELITTR-SFCVCHPDTKPISSRGFICTQCGARHCSIPAECPVCKLTLVAAPQLARAFRHLQPLSAF-----EQIEVTRGFCYACETRLSGE--GFRCGSCQLVFCLDCDTLLHESLHVCPGC 375          
BLAST of General transcription factor IIH subunit vs. Ensembl Fly
Match: Ssl1 (gene:FBgn0037202 transcript:FBtr0332051)

HSP 1 Score: 301.212 bits (770), Expect = 2.061e-98
Identity = 163/404 (40.35%), Postives = 234/404 (57.92%), Query Frame = 1
Query:   58 DTDETQGYNWQNENENDFERM--DREDLFSFQKLE----TERKRKFQKRPNNIRLGMMRYTLLFIDMTESMRILDLKPTRLGLTIKNASIFVENYFDQNPISQLGIFTISNGTVKKLTNLGGNPRKHIDALHSLTEDKCEGELSLENILRCSETILKHIPSYATREVILVVSSLTTCDHNDIDDIIELVRQHNIRCSVISLSAEVFVYKKLTKITKGKFQLILDEVDLKFIFQNLVMPPPSLKENAASLIHMGFPSYK----KFDRLFKLCNCHFELQNDSSQLFS----CPRCDSAYCEVPVECNNCGLILVSAPHLARSYHHLFPLDEFVE-------SSADSIHQSCRKCSACNKTINK------DDLSYKCDHCMMDFCTDCDEFLHSSVHVCPNCSEKP 1188
            + ++ + Y W+   E  +E +  D + +      E     +R+R+ QK   N RLGMMR+  + +D +ESM + DLKPTRL  T+K   +F+E +FDQNPISQLG+  +     +K+T L G  R H+ AL SL       E SL+N L  +   LK +PS+A+RE+++++ SLTTCD  DI+  I+ +++  IRCSVISLSAE+ V + LT+ T G F  +LD+   +    + V PPP+ K    SLI MGFP  K      D    +C CH E   + S+L +    CP+C+S YCE+PVEC +CGL LVSAPHLARSYHHLFP+  F E       +S+  +    R+C  C K + +      D + ++C  C   FC DCD F+H ++H C  C+  P
Sbjct:    5 EQEDQKEYRWETGYEKTWEAIKDDEDGMLDGAIAEIIQKAKRQRQAQKSKQN-RLGMMRHMFVVLDCSESMSVPDLKPTRLRCTVKLLELFIEEFFDQNPISQLGLIALKAKRAEKVTELTGTSRVHLKALESLANVSLTSEPSLQNGLDLALKSLKVVPSHASREIVIIMGSLTTCDPVDINLTIDELKKEGIRCSVISLSAEIHVARYLTQQTMGTFGAVLDDAHFRDQLMSQVDPPPAAKTQHNSLIRMGFPHTKNEVEGKDAPLSMCMCHIENLEEPSELTTTGHHCPQCNSKYCELPVECQSCGLTLVSAPHLARSYHHLFPVPNFEELPFEAMPASSSDLTSDVRECYGCAKALGQGVDKVADKVVFRCGFCKQFFCVDCDIFIHDTLHACVGCNTIP 407          
BLAST of General transcription factor IIH subunit vs. Ensembl Fly
Match: Ssl1 (gene:FBgn0037202 transcript:FBtr0078554)

HSP 1 Score: 301.212 bits (770), Expect = 2.061e-98
Identity = 163/404 (40.35%), Postives = 234/404 (57.92%), Query Frame = 1
Query:   58 DTDETQGYNWQNENENDFERM--DREDLFSFQKLE----TERKRKFQKRPNNIRLGMMRYTLLFIDMTESMRILDLKPTRLGLTIKNASIFVENYFDQNPISQLGIFTISNGTVKKLTNLGGNPRKHIDALHSLTEDKCEGELSLENILRCSETILKHIPSYATREVILVVSSLTTCDHNDIDDIIELVRQHNIRCSVISLSAEVFVYKKLTKITKGKFQLILDEVDLKFIFQNLVMPPPSLKENAASLIHMGFPSYK----KFDRLFKLCNCHFELQNDSSQLFS----CPRCDSAYCEVPVECNNCGLILVSAPHLARSYHHLFPLDEFVE-------SSADSIHQSCRKCSACNKTINK------DDLSYKCDHCMMDFCTDCDEFLHSSVHVCPNCSEKP 1188
            + ++ + Y W+   E  +E +  D + +      E     +R+R+ QK   N RLGMMR+  + +D +ESM + DLKPTRL  T+K   +F+E +FDQNPISQLG+  +     +K+T L G  R H+ AL SL       E SL+N L  +   LK +PS+A+RE+++++ SLTTCD  DI+  I+ +++  IRCSVISLSAE+ V + LT+ T G F  +LD+   +    + V PPP+ K    SLI MGFP  K      D    +C CH E   + S+L +    CP+C+S YCE+PVEC +CGL LVSAPHLARSYHHLFP+  F E       +S+  +    R+C  C K + +      D + ++C  C   FC DCD F+H ++H C  C+  P
Sbjct:    5 EQEDQKEYRWETGYEKTWEAIKDDEDGMLDGAIAEIIQKAKRQRQAQKSKQN-RLGMMRHMFVVLDCSESMSVPDLKPTRLRCTVKLLELFIEEFFDQNPISQLGLIALKAKRAEKVTELTGTSRVHLKALESLANVSLTSEPSLQNGLDLALKSLKVVPSHASREIVIIMGSLTTCDPVDINLTIDELKKEGIRCSVISLSAEIHVARYLTQQTMGTFGAVLDDAHFRDQLMSQVDPPPAAKTQHNSLIRMGFPHTKNEVEGKDAPLSMCMCHIENLEEPSELTTTGHHCPQCNSKYCELPVECQSCGLTLVSAPHLARSYHHLFPVPNFEELPFEAMPASSSDLTSDVRECYGCAKALGQGVDKVADKVVFRCGFCKQFFCVDCDIFIHDTLHACVGCNTIP 407          
BLAST of General transcription factor IIH subunit vs. Ensembl Zebrafish
Match: gtf2h2 (general transcription factor IIH, polypeptide 2 [Source:ZFIN;Acc:ZDB-GENE-030131-1959])

HSP 1 Score: 288.5 bits (737), Expect = 7.754e-94
Identity = 161/388 (41.49%), Postives = 221/388 (56.96%), Query Frame = 1
Query:   55 VDTDETQGYNWQNENENDFERMDREDLFSFQK------LETERKRKFQKRPNNIRLGMMRYTLLFIDMTESMRILDLKPTRLGLTIKNASIFVENYFDQNPISQLGIFTISNGTVKKLTNLGGNPRKHIDALHSLTEDKCEGELSLENILRCSETILKHIPSYATREVILVVSSLTTCDHNDIDDIIELVRQHNIRCSVISLSAEVFVYKKLTKITKGKFQLILDEVDLKFIFQNLVMPPPSLKENAASLIHMGFP-----SYKKFDRLFKLCNCHFELQND---SSQLFSCPRCDSAYCEVPVECNNCGLILVSAPHLARSYHHLFPLDEFVESSADSIHQSCRKCSACNKTINKDDLSYKCDHCMMDFCTDCDEFLHSSVHVCPNC 1176
            +D +  +   W+   E  +E +  ++  S +        + +RKR F+     +RLGMMR+  + ID + SM   DLKP RL  T+K    FVE YFDQNPISQ+GI T  N   +KLT+L GNP+KHI AL    +  C GE SL N L  +   LKH+P++ +REV+++ SSLTTCD  +I ++I+ +    IR SVI LSAEV V   LT+ T G + +ILDE   K +    V PPP+   +  SLI MGFP     S    D        H +  ++   S   + CP+C + Y E+PVEC  CGL LVSAPHLARS+HHLFPL+ F E+  +  ++  R C AC   + KD   + C  C   FC +CD F+H ++H CP C
Sbjct:    1 MDEEPERTKRWEGGYERTWEVLKEDESGSLKATVEDILFQAKRKRVFESH-GQVRLGMMRHLFVIIDSSRSMEDQDLKPNRLTSTLKLMEHFVEEYFDQNPISQIGIITTKNKRAEKLTDLAGNPKKHITALRKAVDSTCVGEPSLYNSLNMALQTLKHMPAHTSREVLVIFSSLTTCDPGNIYELIKTLNGLKIRVSVIGLSAEVRVCTILTRETGGSYNVILDESHFKELLLLHVKPPPASSSSECSLIRMGFPQHVIASLSDQDAKPSFSMAHLDSSSEPELSLGGYYCPQCRAKYTELPVECKVCGLTLVSAPHLARSFHHLFPLEAFQETPLEE-YEGERFCEACQGEL-KDKSVFTCLACKKVFCVECDIFIHDTLHCCPGC 385          
BLAST of General transcription factor IIH subunit vs. Ensembl Xenopus
Match: gtf2h2 (general transcription factor IIH subunit 2 [Source:NCBI gene;Acc:496493])

HSP 1 Score: 289.656 bits (740), Expect = 3.015e-94
Identity = 162/388 (41.75%), Postives = 222/388 (57.22%), Query Frame = 1
Query:   55 VDTDETQGYNWQNENENDFERMDREDLFSFQK------LETERKRKFQKRPNNIRLGMMRYTLLFIDMTESMRILDLKPTRLGLTIKNASIFVENYFDQNPISQLGIFTISNGTVKKLTNLGGNPRKHIDALHSLTEDKCEGELSLENILRCSETILKHIPSYATREVILVVSSLTTCDHNDIDDIIELVRQHNIRCSVISLSAEVFVYKKLTKITKGKFQLILDEVDLKFIFQNLVMPPPSLKENAASLIHMGFPSYKKF---DRLFKLCNCHFELQNDSSQLFS-----CPRCDSAYCEVPVECNNCGLILVSAPHLARSYHHLFPLDEFVESSADSIHQSCRKCSACNKTINKDDLSYKCDHCMMDFCTDCDEFLHSSVHVCPNC 1176
            +D +  +   W+   E  +E +  ++  S +        + +RKR F+ R   +RLGMMR+  + +D + +M   DLKP RL  T+K    FVE YFDQNPISQ+G+    N   +KLT L GNPR+H++AL    +  C GE SL N L  +   LKH+P + +RE++++ SSLTTCD  +I DII+ ++   IR SVI LSAEV V   LT+ T G + +ILDE   K +  + V+PPP+   +  SLI MGFP +      D+  K       L N S    +     CP+C + Y E+PVEC  C L LVSAPHLARSYHHLFPLD F E S +  ++  R C  C+  + KD   Y C  C   FC +CD F+H S+H CP C
Sbjct:    1 MDEEPEKTKRWEGGYERTWEVLKEDESGSLKSTIDEILFKDKRKRIFENR-GQVRLGMMRHLYVIVDSSRTMEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQIGLIVTRNKRAEKLTELAGNPRQHLNALKKAVDMNCNGEPSLYNSLNLALQTLKHMPGHTSREILVIFSSLTTCDPTNIYDIIKCLKASKIRVSVIGLSAEVRVCTVLTRETGGVYHVILDESHYKELLMHHVIPPPASSTSECSLIRMGFPQHTMGCLSDQDAKPSFSMAHLDNTSEPGLTLGGYFCPQCRAKYSELPVECKVCRLTLVSAPHLARSYHHLFPLDAFKEVSLEE-YEGERYCRGCDGEL-KDQQVYICPVCQCVFCIECDLFIHESLHCCPGC 385          
BLAST of General transcription factor IIH subunit vs. Ensembl Xenopus
Match: gtf2h2 (general transcription factor IIH subunit 2 [Source:NCBI gene;Acc:496493])

HSP 1 Score: 285.419 bits (729), Expect = 2.399e-92
Identity = 163/398 (40.95%), Postives = 223/398 (56.03%), Query Frame = 1
Query:   55 VDTDETQGYNWQNENENDFERMDREDLFSFQK------LETERKRKFQKRPNNIRLGMMRYTLLFIDMTESMRILDLKPTRLGLTIKNASIFVENYFDQNPISQLGIFTISNGTVKKLTNLGGNPRKHIDALHSLTEDKCEGELSLENILRCSETILKHIPSYATREVILVVSSLTTCDHNDIDDIIELVRQHNIRCSVISLSAEVFVYKKLTKITKGKFQLILDEVDLKFIFQNLVMPPPSLKENAASLIHMGFPSYKKF---DRLFKLCNCHFELQNDSSQLFS-----CPRCDSAYCEVPVECNNC----------GLILVSAPHLARSYHHLFPLDEFVESSADSIHQSCRKCSACNKTINKDDLSYKCDHCMMDFCTDCDEFLHSSVHVCPNC 1176
            +D +  +   W+   E  +E +  ++  S +        + +RKR F+ R   +RLGMMR+  + +D + +M   DLKP RL  T+K    FVE YFDQNPISQ+G+    N   +KLT L GNPR+H++AL    +  C GE SL N L  +   LKH+P + +RE++++ SSLTTCD  +I DII+ ++   IR SVI LSAEV V   LT+ T G + +ILDE   K +  + V+PPP+   +  SLI MGFP +      D+  K       L N S    +     CP+C + Y E+PVEC  C          GL LVSAPHLARSYHHLFPLD F E S +  ++  R C  C+  + KD   Y C  C   FC +CD F+H S+H CP C
Sbjct:    1 MDEEPEKTKRWEGGYERTWEVLKEDESGSLKSTIDEILFKDKRKRIFENR-GQVRLGMMRHLYVIVDSSRTMEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQIGLIVTRNKRAEKLTELAGNPRQHLNALKKAVDMNCNGEPSLYNSLNLALQTLKHMPGHTSREILVIFSSLTTCDPTNIYDIIKCLKASKIRVSVIGLSAEVRVCTVLTRETGGVYHVILDESHYKELLMHHVIPPPASSTSECSLIRMGFPQHTMGCLSDQDAKPSFSMAHLDNTSEPGLTLGGYFCPQCRAKYSELPVECKVCRNVQMNIGIPGLTLVSAPHLARSYHHLFPLDAFKEVSLEE-YEGERYCRGCDGEL-KDQQVYICPVCQCVFCIECDLFIHESLHCCPGC 395          
BLAST of General transcription factor IIH subunit vs. Ensembl Xenopus
Match: gtf2h2 (general transcription factor IIH subunit 2 [Source:NCBI gene;Acc:496493])

HSP 1 Score: 268.085 bits (684), Expect = 7.724e-86
Identity = 153/388 (39.43%), Postives = 215/388 (55.41%), Query Frame = 1
Query:   55 VDTDETQGYNWQNENENDFERMDREDLFSFQK------LETERKRKFQKRPNNIRLGMMRYTLLFIDMTESMRILDLKPTRLGLTIKNASIFVENYFDQNPISQLGIFTISNGTVKKLTNLGGNPRKHIDALHSLTEDKCEGELSLENILRCSETILKHIPSYATREVILVVSSLTTCDHNDIDDIIELVRQHNIRCSVISLSAEVFVYKKLTKITKGKFQLILDEVDLKFIFQNLVMPPPSLKENAASLIHMGFPSYKKF---DRLFKLCNCHFELQNDSSQLFS-----CPRCDSAYCEVPVECNNCGLILVSAPHLARSYHHLFPLDEFVESSADSIHQSCRKCSACNKTINKDDLSYKCDHCMMDFCTDCDEFLHSSVHVCPNC 1176
            +D +  +   W+   E  +E +  ++  S +        + +RKR F+ R   +RLGMMR+  + +D + +M   DLKP RL  T+K    FVE YFDQNPISQ+G+    N   +KLT L GNPR+H++AL    +  C GE SL N L  +   LKH+P + +RE++++ SSLTTCD  +I DII+ ++   IR SVI LSAEV V   LT+ T G + +ILDE   K +  + V+PPP+   +  SLI MGFP +      D+  K       L N S    +     CP+C + Y E+PVEC           ++ARSYHHLFPLD F E S +  ++  R C  C+  + KD   Y C  C   FC +CD F+H S+H CP C
Sbjct:    1 MDEEPEKTKRWEGGYERTWEVLKEDESGSLKSTIDEILFKDKRKRIFENR-GQVRLGMMRHLYVIVDSSRTMEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQIGLIVTRNKRAEKLTELAGNPRQHLNALKKAVDMNCNGEPSLYNSLNLALQTLKHMPGHTSREILVIFSSLTTCDPTNIYDIIKCLKASKIRVSVIGLSAEVRVCTVLTRETGGVYHVILDESHYKELLMHHVIPPPASSTSECSLIRMGFPQHTMGCLSDQDAKPSFSMAHLDNTSEPGLTLGGYFCPQCRAKYSELPVECKQNVTFYSVQMNIARSYHHLFPLDAFKEVSLEE-YEGERYCRGCDGEL-KDQQVYICPVCQCVFCIECDLFIHESLHCCPGC 385          
BLAST of General transcription factor IIH subunit vs. Ensembl Xenopus
Match: gtf2h2 (general transcription factor IIH subunit 2 [Source:NCBI gene;Acc:496493])

HSP 1 Score: 265.388 bits (677), Expect = 7.767e-85
Identity = 156/389 (40.10%), Postives = 217/389 (55.78%), Query Frame = 1
Query:   55 VDTDETQGYNWQNENENDFERMDREDLFSFQK------LETERKRKFQKRPNNIRLGMMRYTLLFIDMTESMRILDLKPTRLGLTIKNASIFVENYFDQNPISQLGIFTISNGTVKKLTNLGGNPRKHIDALHSLTEDKCEGELSLENILRCSETILKHIPSYATREVILVVSSLTTCDHNDIDDIIELVRQHNIRCSVISLSAEVFVYKKLTKITKGKFQLILDEVDLKFIFQNLVMPPPSLKENAASLIHMGFPSYKKF---DRLFKLCNCHFELQNDSSQLFS-----CPRCDSAYCEVPVECNNCG-LILVSAPHLARSYHHLFPLDEFVESSADSIHQSCRKCSACNKTINKDDLSYKCDHCMMDFCTDCDEFLHSSVHVCPNC 1176
            +D +  +   W+   E  +E +  ++  S +        + +RKR F+ R   +RLGMMR+  + +D + +M   DLKP RL  T+K    FVE YFDQNPISQ+G+    N   +KLT L GNPR+H++AL    +  C GE SL N L  +   LKH+P + +RE++++ SSLTTCD  +I DII+ ++   IR SVI LSAEV V   LT+ T G + +ILDE   K +  + V+PPP+   +  SLI MGFP +      D+  K       L N S    +     CP+C +         ++C  L LVSAPHLARSYHHLFPLD F E S +  ++  R C  C+  + KD   Y C  C   FC +CD F+H S+H CP C
Sbjct:    1 MDEEPEKTKRWEGGYERTWEVLKEDESGSLKSTIDEILFKDKRKRIFENR-GQVRLGMMRHLYVIVDSSRTMEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQIGLIVTRNKRAEKLTELAGNPRQHLNALKKAVDMNCNGEPSLYNSLNLALQTLKHMPGHTSREILVIFSSLTTCDPTNIYDIIKCLKASKIRVSVIGLSAEVRVCTVLTRETGGVYHVILDESHYKELLMHHVIPPPASSTSECSLIRMGFPQHTMGCLSDQDAKPSFSMAHLDNTSEPGLTLGGYFCPQCRANL------FSDCACLTLVSAPHLARSYHHLFPLDAFKEVSLEE-YEGERYCRGCDGEL-KDQQVYICPVCQCVFCIECDLFIHESLHCCPGC 380          
BLAST of General transcription factor IIH subunit vs. Ensembl Xenopus
Match: gtf2h2 (general transcription factor IIH subunit 2 [Source:NCBI gene;Acc:496493])

HSP 1 Score: 263.077 bits (671), Expect = 1.637e-84
Identity = 149/340 (43.82%), Postives = 196/340 (57.65%), Query Frame = 1
Query:  211 MRYTLLFIDMTESMRILDLKPTRLGLTIKNASIFVENYFDQNPISQLGIFTISNGTVKKLTNLGGNPRKHIDALHSLTEDKCEGELSLENILRCSETILKHIPSYATREVILVVSSLTTCDHNDIDDIIELVRQHNIRCSVISLSAEVFVYKKLTKITKGKFQLILDEVDLKFIFQNLVMPPPSLKENAASLIHMGFPSYKKF---DRLFKLCNCHFELQNDSSQLFS-----CPRCDSAYCEVPVECNNC----------GLILVSAPHLARSYHHLFPLDEFVESSADSIHQSCRKCSACNKTINKDDLSYKCDHCMMDFCTDCDEFLHSSVHVCPNC 1176
            MR+  + +D + +M   DLKP RL  T+K    FVE YFDQNPISQ+G+    N   +KLT L GNPR+H++AL    +  C GE SL N L  +   LKH+P + +RE++++ SSLTTCD  +I DII+ ++   IR SVI LSAEV V   LT+ T G + +ILDE   K +  + V+PPP+   +  SLI MGFP +      D+  K       L N S    +     CP+C + Y E+PVEC  C          GL LVSAPHLARSYHHLFPLD F E S +  ++  R C  C+  + KD   Y C  C   FC +CD F+H S+H CP C
Sbjct:    1 MRHLYVIVDSSRTMEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQIGLIVTRNKRAEKLTELAGNPRQHLNALKKAVDMNCNGEPSLYNSLNLALQTLKHMPGHTSREILVIFSSLTTCDPTNIYDIIKCLKASKIRVSVIGLSAEVRVCTVLTRETGGVYHVILDESHYKELLMHHVIPPPASSTSECSLIRMGFPQHTMGCLSDQDAKPSFSMAHLDNTSEPGLTLGGYFCPQCRAKYSELPVECKVCRNVQMNIGIPGLTLVSAPHLARSYHHLFPLDAFKEVSLEE-YEGERYCRGCDGEL-KDQQVYICPVCQCVFCIECDLFIHESLHCCPGC 338          
BLAST of General transcription factor IIH subunit vs. Ensembl Mouse
Match: Gtf2h2 (general transcription factor II H, polypeptide 2 [Source:MGI Symbol;Acc:MGI:1345669])

HSP 1 Score: 283.878 bits (725), Expect = 5.013e-92
Identity = 165/392 (42.09%), Postives = 224/392 (57.14%), Query Frame = 1
Query:   55 VDTDETQGYNWQNENENDFERMDREDLFSFQK------LETERKRKFQKRPNNIRLGMMRYTLLFIDMTESMRILDLKPTRLGLTIKNASIFVENYFDQNPISQLGIFTISNGTVKKLTNLGGNPRKHIDALHSLTEDKCEGELSLENILRCSETILKHIPSYATREVILVVSSLTTCDHNDIDDIIELVRQHNIRCSVISLSAEVFVYKKLTKITKGKFQLILDEVDLKFIFQNLVMPPPSLKENAASLIHMGFPSYKKF---DRLFKLCNCHFELQNDSSQL------FSCPRCDSAYCEVPVECNNCGLILVSAPHLARSYHHLFPLDEFVESSADSIHQSCRKCSACNKTINKDDLSYKCDHCMMDFCTDCDEFLHSSVHVCPNCSEK 1185
            +D +  +   W+   E  +E +  ++  S +        + +RKR F+     +RLGMMR+  + +D + +M   DLKP RL  T+K    FVE YFDQNPISQ+GI    +   +KLT L GNPRKHI +L    +  C GE SL N L  +   LKH+P + +REV+++ SSLTTCD ++I D+I+ ++   IR SVI LSAEV V   L + T G + +ILDE   K +  + V PPP+   +  SLI MGFP +      D+  K       L N+S++       + CP+C + YCE+PVEC  CGL LVSAPHLARSYHHLFPLD F E S +  ++  R C  C   + KD   Y C  C   FC DCD F+H S+H CP C  K
Sbjct:    1 MDEEPERTKRWEGGYERTWEILKEDETGSLKATIEDILFKAKRKRVFEHH-GQVRLGMMRHLYVVVDGSRTMEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQIGIIVTKSKRAEKLTELSGNPRKHITSLKKAVDMTCHGEPSLYNSLSMAMQTLKHMPGHTSREVLIIFSSLTTCDPSNIYDLIKTLKTAKIRVSVIGLSAEVRVCTVLARETGGTYHVILDETHYKELLAHHVSPPPASSSSECSLIRMGFPQHTIASLSDQDAKPSFSMAHLDNNSTEPGLTLGGYFCPQCRAKYCELPVECKICGLTLVSAPHLARSYHHLFPLDAFQEISLEE-YKGERFCYGCQGEL-KDQHVYVCTVCQNVFCVDCDVFVHDSLHCCPGCIHK 389          
BLAST of General transcription factor IIH subunit vs. Ensembl Mouse
Match: Gtf2h2 (general transcription factor II H, polypeptide 2 [Source:MGI Symbol;Acc:MGI:1345669])

HSP 1 Score: 283.878 bits (725), Expect = 5.144e-92
Identity = 165/392 (42.09%), Postives = 224/392 (57.14%), Query Frame = 1
Query:   55 VDTDETQGYNWQNENENDFERMDREDLFSFQK------LETERKRKFQKRPNNIRLGMMRYTLLFIDMTESMRILDLKPTRLGLTIKNASIFVENYFDQNPISQLGIFTISNGTVKKLTNLGGNPRKHIDALHSLTEDKCEGELSLENILRCSETILKHIPSYATREVILVVSSLTTCDHNDIDDIIELVRQHNIRCSVISLSAEVFVYKKLTKITKGKFQLILDEVDLKFIFQNLVMPPPSLKENAASLIHMGFPSYKKF---DRLFKLCNCHFELQNDSSQL------FSCPRCDSAYCEVPVECNNCGLILVSAPHLARSYHHLFPLDEFVESSADSIHQSCRKCSACNKTINKDDLSYKCDHCMMDFCTDCDEFLHSSVHVCPNCSEK 1185
            +D +  +   W+   E  +E +  ++  S +        + +RKR F+     +RLGMMR+  + +D + +M   DLKP RL  T+K    FVE YFDQNPISQ+GI    +   +KLT L GNPRKHI +L    +  C GE SL N L  +   LKH+P + +REV+++ SSLTTCD ++I D+I+ ++   IR SVI LSAEV V   L + T G + +ILDE   K +  + V PPP+   +  SLI MGFP +      D+  K       L N+S++       + CP+C + YCE+PVEC  CGL LVSAPHLARSYHHLFPLD F E S +  ++  R C  C   + KD   Y C  C   FC DCD F+H S+H CP C  K
Sbjct:    1 MDEEPERTKRWEGGYERTWEILKEDETGSLKATIEDILFKAKRKRVFEHH-GQVRLGMMRHLYVVVDGSRTMEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQIGIIVTKSKRAEKLTELSGNPRKHITSLKKAVDMTCHGEPSLYNSLSMAMQTLKHMPGHTSREVLIIFSSLTTCDPSNIYDLIKTLKTAKIRVSVIGLSAEVRVCTVLARETGGTYHVILDETHYKELLAHHVSPPPASSSSECSLIRMGFPQHTIASLSDQDAKPSFSMAHLDNNSTEPGLTLGGYFCPQCRAKYCELPVECKICGLTLVSAPHLARSYHHLFPLDAFQEISLEE-YKGERFCYGCQGEL-KDQHVYVCTVCQNVFCVDCDVFVHDSLHCCPGCIHK 389          
BLAST of General transcription factor IIH subunit vs. Ensembl Mouse
Match: Gtf2h2 (general transcription factor II H, polypeptide 2 [Source:MGI Symbol;Acc:MGI:1345669])

HSP 1 Score: 106.301 bits (264), Expect = 1.939e-27
Identity = 55/102 (53.92%), Postives = 65/102 (63.73%), Query Frame = 1
Query:  880 FSCPRCDSAYCEVPVECNNCGLILVSAPHLARSYHHLFPLDEFVESSADSIHQSCRKCSACNKTINKDDLSYKCDHCMMDFCTDCDEFLHSSVHVCPNCSEK 1185
            + CP+C + YCE+PVEC  CGL LVSAPHLARSYHHLFPLD F E S +  ++  R C  C   + KD   Y C  C   FC DCD F+H S+H CP C  K
Sbjct:   12 YFCPQCRAKYCELPVECKICGLTLVSAPHLARSYHHLFPLDAFQEISLEE-YKGERFCYGCQGEL-KDQHVYVCTVCQNVFCVDCDVFVHDSLHCCPGCIHK 111          
BLAST of General transcription factor IIH subunit vs. Ensembl Mouse
Match: Gtf2h2 (general transcription factor II H, polypeptide 2 [Source:MGI Symbol;Acc:MGI:1345669])

HSP 1 Score: 77.7962 bits (190), Expect = 1.222e-16
Identity = 43/121 (35.54%), Postives = 65/121 (53.72%), Query Frame = 1
Query:   55 VDTDETQGYNWQNENENDFERMDREDLFSFQK------LETERKRKFQKRPNNIRLGMMRYTLLFIDMTESMRILDLKPTRLGLTIKNASIFVENYFDQNPISQLGIFTISNGTVKKLTNL 399
            +D +  +   W+   E  +E +  ++  S +        + +RKR F+     +RLGMMR+  + +D + +M   DLKP RL  T+K    FVE YFDQNPISQ+GI    +   +KLT L
Sbjct:    1 MDEEPERTKRWEGGYERTWEILKEDETGSLKATIEDILFKAKRKRVFEHH-GQVRLGMMRHLYVVVDGSRTMEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQIGIIVTKSKRAEKLTEL 120          
BLAST of General transcription factor IIH subunit vs. UniProt/SwissProt
Match: sp|Q2TBV5|TF2H2_BOVIN (General transcription factor IIH subunit 2 OS=Bos taurus OX=9913 GN=GTF2H2 PE=2 SV=1)

HSP 1 Score: 293.893 bits (751), Expect = 5.174e-95
Identity = 163/391 (41.69%), Postives = 217/391 (55.50%), Query Frame = 1
Query:   55 VDTDETQGYNWQNENENDFERMDREDLFSFQK------LETERKRKFQKRPNNIRLGMMRYTLLFIDMTESMRILDLKPTRLGLTIKNASIFVENYFDQNPISQLGIFTISNGTVKKLTNLGGNPRKHIDALHSLTEDKCEGELSLENILRCSETILKHIPSYATREVILVVSSLTTCDHNDIDDIIELVRQHNIRCSVISLSAEVFVYKKLTKITKGKFQLILDEVDLKFIFQNLVMPPPSLKENAASLIHMGFP-----SYKKFDRLFKLCNCHFELQNDSSQLFS---CPRCDSAYCEVPVECNNCGLILVSAPHLARSYHHLFPLDEFVESSADSIHQSCRKCSACNKTINKDDLSYKCDHCMMDFCTDCDEFLHSSVHVCPNCSEK 1185
            +D +  +   W+   E  +E +  ++  S +        + +RKR F+     +RLGMMR+  + +D + +M   DLKP RL  T+K    FVE YFDQNPISQ+GI    +   +KLT L GNPRKHI +L    +  C GE SL N L  +   LKH+P + +REV+++ SSLTTCD ++I D+I+ ++   IR S+I LSAEV V   L + T G + +ILDE   K +  + V PPP+   +  SLI MGFP     S    D        H +   +         CP+C + YCE+PVEC  CGL LVSAPHLARSYHHLFPLD F E   +  H   R C AC   + KD   Y C  C   FC DCD F+H S+H CP C  K
Sbjct:    1 MDEEPERTKRWEGGYERTWEILKEDESGSLKATIEDILFKAKRKRVFEHH-GQVRLGMMRHLYVVVDGSRTMEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQIGIIVTKSKRAEKLTELSGNPRKHITSLKKAVDMTCHGEPSLYNSLSMAMQTLKHMPGHTSREVLIIFSSLTTCDPSNIYDLIKSLKAAKIRVSIIGLSAEVRVCTALARETGGTYHVILDESHYKELLTHHVSPPPASSNSECSLIRMGFPQHTIASLSDQDAKPSFSMAHLDSNTEPGLTLGGYFCPQCRAKYCELPVECKICGLTLVSAPHLARSYHHLFPLDAFQEIPLEE-HNGERFCYACQGEL-KDQHVYVCSVCQNVFCVDCDVFVHDSLHCCPGCIHK 388          
BLAST of General transcription factor IIH subunit vs. UniProt/SwissProt
Match: sp|A0JN27|TF2H2_RAT (General transcription factor IIH subunit 2 OS=Rattus norvegicus OX=10116 GN=Gtf2h2 PE=1 SV=1)

HSP 1 Score: 293.123 bits (749), Expect = 9.360e-95
Identity = 164/392 (41.84%), Postives = 222/392 (56.63%), Query Frame = 1
Query:   55 VDTDETQGYNWQNENENDFERMDREDLFSFQK------LETERKRKFQKRPNNIRLGMMRYTLLFIDMTESMRILDLKPTRLGLTIKNASIFVENYFDQNPISQLGIFTISNGTVKKLTNLGGNPRKHIDALHSLTEDKCEGELSLENILRCSETILKHIPSYATREVILVVSSLTTCDHNDIDDIIELVRQHNIRCSVISLSAEVFVYKKLTKITKGKFQLILDEVDLKFIFQNLVMPPPSLKENAASLIHMGFPSYKKF---DRLFKLCNCHFELQNDSSQL------FSCPRCDSAYCEVPVECNNCGLILVSAPHLARSYHHLFPLDEFVESSADSIHQSCRKCSACNKTINKDDLSYKCDHCMMDFCTDCDEFLHSSVHVCPNCSEK 1185
            +D +  +   W+   E  +E +  ++  S +        + +RKR F+     +RLGMMR+  + +D + +M   DLKP RL  T+K    FVE YFDQNPISQ+GI    +   +KLT L GNPRKHI +L    +  C GE SL N L  +   LKH+P + +REV+++ SSLTTCD ++I D+I+ ++   IR SVI LSAEV V   L + T G + +ILDE   K +    V PPP+   +  SLI MGFP +      D+  K       L N+S++       + CP+C + YCE+PVEC  CGL LVSAPHLARSYHHLFPLD F E   +  ++  R C  C   + KD   Y C  C   FC DCD F+H S+H CP C  K
Sbjct:    1 MDEEPERTKRWEGGYERTWEILKEDESGSLKATIEDILFKAKRKRVFEHH-GQVRLGMMRHLYVVVDGSRTMEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQIGIIVTKSKRAEKLTELSGNPRKHITSLKKAVDMTCHGEPSLYNSLSMAMQTLKHMPGHTSREVLIIFSSLTTCDPSNIYDLIKTLKTAKIRVSVIGLSAEVRVCTVLARETGGTYHVILDETHYKELLARHVSPPPASSGSECSLIRMGFPQHTIASLSDQDAKPSFSMAHLDNNSTEPGLTLGGYFCPQCRAKYCELPVECKICGLTLVSAPHLARSYHHLFPLDAFQEIPLEE-YKGERFCYGCQGEL-KDQHVYVCTVCRNVFCVDCDVFVHDSLHCCPGCVHK 389          
BLAST of General transcription factor IIH subunit vs. UniProt/SwissProt
Match: sp|Q9JIB4|TF2H2_MOUSE (General transcription factor IIH subunit 2 OS=Mus musculus OX=10090 GN=Gtf2h2 PE=1 SV=1)

HSP 1 Score: 283.878 bits (725), Expect = 3.598e-91
Identity = 165/392 (42.09%), Postives = 224/392 (57.14%), Query Frame = 1
Query:   55 VDTDETQGYNWQNENENDFERMDREDLFSFQK------LETERKRKFQKRPNNIRLGMMRYTLLFIDMTESMRILDLKPTRLGLTIKNASIFVENYFDQNPISQLGIFTISNGTVKKLTNLGGNPRKHIDALHSLTEDKCEGELSLENILRCSETILKHIPSYATREVILVVSSLTTCDHNDIDDIIELVRQHNIRCSVISLSAEVFVYKKLTKITKGKFQLILDEVDLKFIFQNLVMPPPSLKENAASLIHMGFPSYKKF---DRLFKLCNCHFELQNDSSQL------FSCPRCDSAYCEVPVECNNCGLILVSAPHLARSYHHLFPLDEFVESSADSIHQSCRKCSACNKTINKDDLSYKCDHCMMDFCTDCDEFLHSSVHVCPNCSEK 1185
            +D +  +   W+   E  +E +  ++  S +        + +RKR F+     +RLGMMR+  + +D + +M   DLKP RL  T+K    FVE YFDQNPISQ+GI    +   +KLT L GNPRKHI +L    +  C GE SL N L  +   LKH+P + +REV+++ SSLTTCD ++I D+I+ ++   IR SVI LSAEV V   L + T G + +ILDE   K +  + V PPP+   +  SLI MGFP +      D+  K       L N+S++       + CP+C + YCE+PVEC  CGL LVSAPHLARSYHHLFPLD F E S +  ++  R C  C   + KD   Y C  C   FC DCD F+H S+H CP C  K
Sbjct:    1 MDEEPERTKRWEGGYERTWEILKEDETGSLKATIEDILFKAKRKRVFEHH-GQVRLGMMRHLYVVVDGSRTMEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQIGIIVTKSKRAEKLTELSGNPRKHITSLKKAVDMTCHGEPSLYNSLSMAMQTLKHMPGHTSREVLIIFSSLTTCDPSNIYDLIKTLKTAKIRVSVIGLSAEVRVCTVLARETGGTYHVILDETHYKELLAHHVSPPPASSSSECSLIRMGFPQHTIASLSDQDAKPSFSMAHLDNNSTEPGLTLGGYFCPQCRAKYCELPVECKICGLTLVSAPHLARSYHHLFPLDAFQEISLEE-YKGERFCYGCQGEL-KDQHVYVCTVCQNVFCVDCDVFVHDSLHCCPGCIHK 389          
BLAST of General transcription factor IIH subunit vs. UniProt/SwissProt
Match: sp|Q13888|TF2H2_HUMAN (General transcription factor IIH subunit 2 OS=Homo sapiens OX=9606 GN=GTF2H2 PE=1 SV=1)

HSP 1 Score: 278.485 bits (711), Expect = 5.340e-89
Identity = 162/391 (41.43%), Postives = 216/391 (55.24%), Query Frame = 1
Query:   55 VDTDETQGYNWQNENENDFERMDREDLFSFQK------LETERKRKFQKRPNNIRLGMMRYTLLFIDMTESMRILDLKPTRLGLTIKNASIFVENYFDQNPISQLGIFTISNGTVKKLTNLGGNPRKHIDALHSLTEDKCEGELSLENILRCSETILKHIPSYATREVILVVSSLTTCDHNDIDDIIELVRQHNIRCSVISLSAEVFVYKKLTKITKGKFQLILDEVDLKFIFQNLVMPPPSLKENAASLIHMGFP-----SYKKFDRLFKLCNCHFELQNDSSQLFS---CPRCDSAYCEVPVECNNCGLILVSAPHLARSYHHLFPLDEFVESSADSIHQSCRKCSACNKTINKDDLSYKCDHCMMDFCTDCDEFLHSSVHVCPNCSEK 1185
            +D +  +   W+   E  +E +  ++  S +        + +RKR F+     +RLGMMR+  + +D + +M   DLKP RL  T+K    FVE YFDQNPISQ+GI    +   +KLT L GNPRKHI +L    +  C GE SL N L  +   LKH+P + +REV+++ SSLTTCD ++I D+I+ ++   IR SVI LSAEV V   L + T G + +ILDE   K +  + V PPP+   +  SLI MGFP     S    D        H +   +         CP+C + YCE+PVEC  CGL LVSAPHLARSYHHLFPLD F E   +  +   R C  C   + KD   Y C  C   FC DCD F+H S+H CP C  K
Sbjct:    1 MDEEPERTKRWEGGYERTWEILKEDESGSLKATIEDILFKAKRKRVFEHH-GQVRLGMMRHLYVVVDGSRTMEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQIGIIVTKSKRAEKLTELSGNPRKHITSLKKAVDMTCHGEPSLYNSLSIAMQTLKHMPGHTSREVLIIFSSLTTCDPSNIYDLIKTLKAAKIRVSVIGLSAEVRVCTVLARETGGTYHVILDESHYKELLTHHVSPPPASSSSECSLIRMGFPQHTIASLSDQDAKPSFSMAHLDGNTEPGLTLGGYFCPQCRAKYCELPVECKICGLTLVSAPHLARSYHHLFPLDAFQEIPLEEYNGE-RFCYGCQGEL-KDQHVYVCAVCQNVFCVDCDVFVHDSLHCCPGCIHK 388          
BLAST of General transcription factor IIH subunit vs. UniProt/SwissProt
Match: sp|Q6P1K8|T2H2L_HUMAN (General transcription factor IIH subunit 2-like protein OS=Homo sapiens OX=9606 GN=GTF2H2C PE=1 SV=1)

HSP 1 Score: 276.944 bits (707), Expect = 1.640e-88
Identity = 161/391 (41.18%), Postives = 216/391 (55.24%), Query Frame = 1
Query:   55 VDTDETQGYNWQNENENDFERMDREDLFSFQK------LETERKRKFQKRPNNIRLGMMRYTLLFIDMTESMRILDLKPTRLGLTIKNASIFVENYFDQNPISQLGIFTISNGTVKKLTNLGGNPRKHIDALHSLTEDKCEGELSLENILRCSETILKHIPSYATREVILVVSSLTTCDHNDIDDIIELVRQHNIRCSVISLSAEVFVYKKLTKITKGKFQLILDEVDLKFIFQNLVMPPPSLKENAASLIHMGFP-----SYKKFDRLFKLCNCHFELQNDSSQLFS---CPRCDSAYCEVPVECNNCGLILVSAPHLARSYHHLFPLDEFVESSADSIHQSCRKCSACNKTINKDDLSYKCDHCMMDFCTDCDEFLHSSVHVCPNCSEK 1185
            +D +  +   W+   E  +E +  ++  S +        + +RKR F+     +RLGMMR+  + +D + +M   DLKP RL  T+K    FVE YFDQNPISQ+GI    +   +KLT L GNPRKHI +L    +  C GE SL N L  +   LKH+P + +REV+++ SSLTTCD ++I D+I+ ++   IR SVI LSAEV V   L + T G + +ILDE   K +  + + PPP+   +  SLI MGFP     S    D        H +   +         CP+C + YCE+PVEC  CGL LVSAPHLARSYHHLFPLD F E   +  +   R C  C   + KD   Y C  C   FC DCD F+H S+H CP C  K
Sbjct:    1 MDEEPERTKRWEGGYERTWEILKEDESGSLKATIEDILFKAKRKRVFEHH-GQVRLGMMRHLYVVVDGSRTMEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQIGIIVTKSKRAEKLTELSGNPRKHITSLKEAVDMTCHGEPSLYNSLSMAMQTLKHMPGHTSREVLIIFSSLTTCDPSNIYDLIKTLKAAKIRVSVIGLSAEVRVCTVLARETGGTYHVILDESHYKELLTHHLSPPPASSSSECSLIRMGFPQHTIASLSDQDAKPSFSMAHLDGNTEPGLTLGGYFCPQCRAKYCELPVECKICGLTLVSAPHLARSYHHLFPLDAFQEIPLEEYNGE-RFCYGCQGEL-KDQHVYVCAVCQNVFCVDCDVFVHDSLHCCPGCIHK 388          
BLAST of General transcription factor IIH subunit vs. TrEMBL
Match: V4B2E9 (General transcription factor IIH subunit OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_223172 PE=3 SV=1)

HSP 1 Score: 350.903 bits (899), Expect = 6.279e-115
Identity = 179/386 (46.37%), Postives = 248/386 (64.25%), Query Frame = 1
Query:   64 DETQGYNWQNENENDFERMDREDLFSFQK-----LETERKRKFQKRPNNIRLGMMRYTLLFIDMTESMRILDLKPTRLGLTIKNASIFVENYFDQNPISQLGIFTISNGTVKKLTNLGGNPRKHIDALHSLTEDKCEGELSLENILRCSETILKHIPSYATREVILVVSSLTTCDHNDIDDIIELVRQHNIRCSVISLSAEVFVYKKLTKITKGKFQLILDEVDLKFIFQNLVMPPPSLKENAASLIHMGFPSYK-----KFDRLFKLCNCHFELQND---SSQLFSCPRCDSAYCEVPVECNNCGLILVSAPHLARSYHHLFPLDEFVESSADSIHQSCR-KCSACNKTINKDDLSYKCDHCMMDFCTDCDEFLHSSVHVCPNCS 1179
            ++ +GY W+ E E  +E +  ++  S Q      +   ++++  ++  NIRLGMMR+  L IDM+E+M   DLKPTRL  T+K    FVE YFDQNPISQLG+    N   +K+T LGGNPR+HI+ L  L + KC+GE SL+N L  +   LKH+PS+A+REV++++ SLTTCD  DID+ I+ ++  NIRCS+I L+AE+ V KKL K T+GK+ +ILDE   K++    + PPP+    A+SLI MGFP +      K +R   +C CH + +N+   S+  + CP+C S YCE+PVEC  CGL LVSAPHLARSYHHLFPLD F E    ++    +  C +C   + KD   Y+C  CM  FC DCD F+H ++H CP CS
Sbjct:    2 EDEKGYRWETEYEKTWEAIHEDESGSLQASIDDIIHKAKRKRMLEKIGNIRLGMMRHLYLVIDMSETMSEQDLKPTRLHSTVKLLEHFVEEYFDQNPISQLGVLATRNKRAEKITELGGNPRRHINTLQGLKDRKCQGEPSLQNSLELAIQTLKHMPSHASREVLIILGSLTTCDPGDIDNTIQTLKDCNIRCSIIGLAAEISVCKKLCKQTQGKYNVILDESHYKYLLDQHISPPPATSNTASSLIKMGFPHHSLSNVNKEERP-SMCMCHLDSKNNEGFSTVGYFCPQCKSKYCELPVECKACGLTLVSAPHLARSYHHLFPLDSFKEIPRTTLEDVEKLHCFSCLSQL-KDINIYQCTQCMKMFCLDCDLFIHETLHSCPGCS 385          
BLAST of General transcription factor IIH subunit vs. TrEMBL
Match: K1RAW7 (General transcription factor IIH subunit OS=Crassostrea gigas OX=29159 GN=CGI_10026486 PE=3 SV=1)

HSP 1 Score: 344.739 bits (883), Expect = 1.821e-112
Identity = 176/384 (45.83%), Postives = 241/384 (62.76%), Query Frame = 1
Query:   64 DETQGYNWQNENENDFERMDREDLFSFQK-----LETERKRKFQKRPNNIRLGMMRYTLLFIDMTESMRILDLKPTRLGLTIKNASIFVENYFDQNPISQLGIFTISNGTVKKLTNLGGNPRKHIDALHSLTEDKCEGELSLENILRCSETILKHIPSYATREVILVVSSLTTCDHNDIDDIIELVRQHNIRCSVISLSAEVFVYKKLTKITKGKFQLILDEVDLKFIFQNLVMPPPSLKENAASLIHMGFPSYK----KFDRLFKLCNCHFELQND---SSQLFSCPRCDSAYCEVPVECNNCGLILVSAPHLARSYHHLFPLDEFVESSADSIHQSCRKCSACNKTINKDDLSYKCDHCMMDFCTDCDEFLHSSVHVCPNCS 1179
            +E +GY W+ E E  +E +  ++  S Q      +   +KRK  ++  N+RLGMMR+  L IDM+E+M   DLKPTRL  T+K    FVE YFDQNPISQLGI    N   +K++ LGGNPR+HI  L SL +  C GE SL+N L  +   L+H+P +A+REV++V+ SLTTCD ++I   I ++R  N+RCSVI L+AEV V KKL K T G + +ILDE   K +    V PPP+     +SLI MGFP ++    K +R   +C CH + +N    SS  + CP+C S YCE+P+EC  CGL LVSAPHLARSYHHLFPLD+F E     +  +   C +C   + + ++ Y CD+C   +C DCD F+H ++H CP C+
Sbjct:    4 EEEKGYRWETEYERTWEAIQEDEKGSLQASVDDIISKAKKRKLLEKIKNVRLGMMRHLFLIIDMSEAMSDQDLKPTRLLSTLKLLEYFVEEYFDQNPISQLGIIITKNKRAEKVSELGGNPRRHITTLQSLADKVCHGEPSLQNSLELAHQTLRHMPGHASREVLVVMGSLTTCDPDNIISTISMLRDGNVRCSVIGLAAEVCVCKKLCKETHGSYSVILDECHFKDLLTQHVTPPPATASTESSLIRMGFPHHQLSADKEERP-SMCMCHLDSKNSQGFSSTGYFCPQCKSKYCELPIECKACGLTLVSAPHLARSYHHLFPLDQFREIPTAQVGSNVL-CFSCQTAVQELNV-YICDNCERIYCLDCDLFIHETLHSCPGCA 384          
BLAST of General transcription factor IIH subunit vs. TrEMBL
Match: A0A210PXN6 (General transcription factor IIH subunit OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT21427 PE=3 SV=1)

HSP 1 Score: 344.739 bits (883), Expect = 2.236e-112
Identity = 173/387 (44.70%), Postives = 243/387 (62.79%), Query Frame = 1
Query:   58 DTDETQGYNWQNENENDFERMDREDLFSFQK-----LETERKRKFQKRPNNIRLGMMRYTLLFIDMTESMRILDLKPTRLGLTIKNASIFVENYFDQNPISQLGIFTISNGTVKKLTNLGGNPRKHIDALHSLTEDKCEGELSLENILRCSETILKHIPSYATREVILVVSSLTTCDHNDIDDIIELVRQHNIRCSVISLSAEVFVYKKLTKITKGKFQLILDEVDLKFIFQNLVMPPPSLKENAASLIHMGFPSY-----KKFDRLFKLCNCHFEL---QNDSSQLFSCPRCDSAYCEVPVECNNCGLILVSAPHLARSYHHLFPLDEFVESSADSIHQSCRKCSACNKTINKDDLSYKCDHCMMDFCTDCDEFLHSSVHVCPNCS 1179
            D DE +GY W+ E E  +E ++ +D  + Q      +   ++R+  ++  NIRLGMMR+  L ID++++M+  DLKPTRL  T+K    FVE YFDQNPISQLGI T  N   +K+  LGGNPR+HI  L SL    C+GE SL+N L  +   L+H+PS+A+REV++V+ SLT+CD  DI + I+L++ +N+RCS+I L+AEV V K++ + T GK+ +ILDE   K +  + V PPP+     +SLI MGFP +     K       +C CH +    Q  SS  + CP+C S YCE+P+EC +CGL LVSAPHLARSYHHLFPL+ F+E+   SI      C    +   +D   Y+C  C   +C DCD F+H ++H CP C+
Sbjct:    3 DEDE-KGYRWETEYEKTWEVIEEDDDGTIQSSVDDIIHKAKRRRLMEKLGNIRLGMMRHLFLVIDLSDAMKDQDLKPTRLASTLKLLEHFVEEYFDQNPISQLGIITTRNKRAEKVAELGGNPRRHITTLQSLVNKTCQGEPSLQNSLDLANQTLRHMPSHASREVLVVLGSLTSCDPGDISETIQLLKDNNVRCSIIGLAAEVRVCKRICQETNGKYFVILDEGHYKDLLISHVTPPPATSTTESSLIKMGFPHHSLSGDKNKGEKASMCMCHLDSKVNQGFSSSGYFCPQCKSKYCELPIECKSCGLTLVSAPHLARSYHHLFPLETFMETPVSSIPTDSAVCCFSCQIAVEDPNVYQCGRCQQLYCLDCDLFIHETLHSCPGCA 388          
BLAST of General transcription factor IIH subunit vs. TrEMBL
Match: T1JJK0 (General transcription factor IIH subunit OS=Strigamia maritima OX=126957 PE=3 SV=1)

HSP 1 Score: 338.191 bits (866), Expect = 6.778e-110
Identity = 173/390 (44.36%), Postives = 247/390 (63.33%), Query Frame = 1
Query:   52 IVDTDETQGYNWQNENENDFERMDREDLFSFQK------LETERKRKFQKRPNNIRLGMMRYTLLFIDMTESMRILDLKPTRLGLTIKNASIFVENYFDQNPISQLGIFTISNGTVKKLTNLGGNPRKHIDALHSLTEDKCEGELSLENILRCSETILKHIPSYATREVILVVSSLTTCDHNDIDDIIELVRQHNIRCSVISLSAEVFVYKKLTKITKGKFQLILDEVDLKFIFQNLVMPPPSLKENAASLIHMGFPSY---KKFDRLFKLCNCHFELQNDSSQLFS-----CPRCDSAYCEVPVECNNCGLILVSAPHLARSYHHLFPLDEFVESSADSIHQSCRKCSACNKTINKDDLSYKCDHCMMDFCTDCDEFLHSSVHVCPNCS 1179
            + + D  + Y W+   E  +E + RED     +      L+  RKR+F+++  N+RLGMMR+  + +D++ESM+  DLKPTR   T+K    FVE YFDQNPISQ+GI    N   +K+T LGGNP++H++AL    +  C GE SL+N L+ +   L+H+PS+ +REV+++  SLTTCD  +I  +I+L++Q N+RCSVI LSAE+ + K + + TKG + +ILDE   K +    + PPP+L    +SLI MGFP +      D    +C CH + +N S Q FS     CP+C S YCE+PVEC  CGL LVSAPHLARSYHHLFPLD F E   ++  ++C  CSAC K +   +  ++C  C   FC DCD ++H ++HVCP+C+
Sbjct:    1 MAEEDNLKEYQWETGYEKTWEAI-REDADGHIESSIEDILQRARKRRFKEKAENVRLGMMRHLYVIVDLSESMQDQDLKPTRQICTLKLLECFVEEYFDQNPISQIGIIATRNKRAEKITELGGNPKRHVNALKKAADLACTGEPSLQNSLQMAVQTLRHLPSHVSREVVIIFGSLTTCDPGNIFTVIDLLKQTNVRCSVIGLSAELRICKYICQETKGIYGVILDETHYKELLYQHLSPPPALMNAESSLIRMGFPHHLAGGDTDAKPSMCMCHLDSKN-SGQGFSTSGYFCPQCRSKYCELPVECKACGLTLVSAPHLARSYHHLFPLDVFDE--MNTADETC--CSACEKRLASGEKGFECKLCSGIFCMDCDAYIHETLHVCPSCA 384          
BLAST of General transcription factor IIH subunit vs. TrEMBL
Match: A0A0L8GMG6 (General transcription factor IIH subunit OS=Octopus bimaculoides OX=37653 GN=OCBIM_22031240mg PE=3 SV=1)

HSP 1 Score: 337.035 bits (863), Expect = 2.651e-109
Identity = 175/391 (44.76%), Postives = 245/391 (62.66%), Query Frame = 1
Query:   52 IVDTDETQGYNWQNENENDFERMDREDLFSFQKLETE-----RKRKFQKRPNNIRLGMMRYTLLFIDMTESMRILDLKPTRLGLTIKNASIFVENYFDQNPISQLGIFTISNGTVKKLTNLGGNPRKHIDALHSLTEDKCEGELSLENILRCSETILKHIPSYATREVILVVSSLTTCDHNDIDDIIELVRQHNIRCSVISLSAEVFVYKKLTKITKGKFQLILDEVDLKFIFQNLVMPPPSLKENAASLIHMGFPSYK------KFDRLFKLCNCHFE---LQNDSSQLFSCPRCDSAYCEVPVECNNCGLILVSAPHLARSYHHLFPLDEFVESSA-DSIHQSCRKCSACNKTINKDDLSYKCDHCMMDFCTDCDEFLHSSVHVCPNCS 1179
            + D DE   Y W+   E  +E +  ++  S Q    E     ++R+  +R +N+RLGMMR+  L IDM+E+M   DLKP RL  T+K A  F+E YFDQNPISQLGI        +K+T LGGNPR+H+ AL +++++ C+GE SL+N +  +   LK +PS+A+RE++++  SLTTCD  DI + I+ V++ +IRCSVI LSAEV V ++LT  TKG +++ILDE   K +    V+PPP+     +SLI MGFP ++      K DR   +C CH +    QN SS  + CP+C S YCE+PVEC  C L LVSAPHLARSYHHLFPL  F E  A +++    + C  C  ++ + ++ Y C  C  +FC DCD F H ++H CP CS
Sbjct:    1 MADDDENL-YRWETAYERTWEAIKEDEAGSLQASVNEITQKTKRRRLLERISNVRLGMMRHLFLIIDMSEAMVDPDLKPNRLAATVKLAENFIEEYFDQNPISQLGIIVTRKKRAEKVTELGGNPRRHVAALVAVSKNPCQGEPSLQNSIEMAAQTLKQMPSHASREILIIFGSLTTCDPGDILNTIKTVKESSIRCSVIGLSAEVRVCRRLTAETKGDYRIILDESHFKDLLNGHVIPPPASGNTESSLIRMGFPHHQQSMDKDKEDRP-SMCMCHLDDKTSQNFSSGGYFCPQCRSKYCELPVECKACALTLVSAPHLARSYHHLFPLANFKEVVATEAVSDKPQFCYGCQISLKEKNI-YICTKCDQNFCIDCDLFAHETLHCCPGCS 388          
BLAST of General transcription factor IIH subunit vs. Ensembl Cavefish
Match: gtf2h2 (GTF2H2 family member C [Source:NCBI gene;Acc:103032811])

HSP 1 Score: 297.745 bits (761), Expect = 1.281e-97
Identity = 163/389 (41.90%), Postives = 221/389 (56.81%), Query Frame = 1
Query:   55 VDTDETQGYNWQNENENDFERMDREDLFSFQK------LETERKRKFQKRPNNIRLGMMRYTLLFIDMTESMRILDLKPTRLGLTIKNASIFVENYFDQNPISQLGIFTISNGTVKKLTNLGGNPRKHIDALHSLTEDKCEGELSLENILRCSETILKHIPSYATREVILVVSSLTTCDHNDIDDIIELVRQHNIRCSVISLSAEVFVYKKLTKITKGKFQLILDEVDLKFIFQNLVMPPPSLKENAASLIHMGFP-----SYKKFDRLFKLCNCHFELQNDSSQL----FSCPRCDSAYCEVPVECNNCGLILVSAPHLARSYHHLFPLDEFVESSADSIHQSCRKCSACNKTINKDDLSYKCDHCMMDFCTDCDEFLHSSVHVCPNC 1176
            +D +  +   W+   E  +E +  ++  S +        + +RKR F+     +RLGMMR+  + ID + +M   DLKP RL  T+K    FVE YFDQNPISQ+GI T  N   +KLT+L GNP+KH+ AL       C GE SL N L  +   LKH+P + +RE++++ SSLTTCD  +I ++I+ +++  IR SVI LSAEV V   LT+ T G + +ILDE   K +    V PPP+   +  SLI MGFP     S    D        H E  ++   L    + CP+C + Y E+PVEC  CGL LVSAPHLARS+HHLFPLD F ES  +  H   R C AC   + KD   + C  C   FCT+CD F+H ++H CP C
Sbjct:    1 MDEEPERAKRWEGGYERTWEVLKEDESGSLKATVEDILFQAKRKRVFESH-GQVRLGMMRHLYVVIDSSRTMEDQDLKPNRLTSTLKLMEFFVEEYFDQNPISQIGIITTKNKRAEKLTDLAGNPKKHVAALKKAVGSTCLGEPSLYNALNIAMQTLKHMPGHTSREILIIFSSLTTCDPANIYELIKTLKELKIRVSVIGLSAEVRVCTILTRETGGSYNVILDESHFKELLMLHVKPPPASSSSECSLIRMGFPQHIIASVSDQDAKPSFSMSHLESVDEGPGLTLGGYYCPQCRAKYTELPVECKVCGLTLVSAPHLARSFHHLFPLDAFQESPLEE-HTGDRFCQACQGEL-KDKSVFTCPACSSVFCTECDLFIHDTLHCCPAC 386          
BLAST of General transcription factor IIH subunit vs. Ensembl Cavefish
Match: gtf2h2 (GTF2H2 family member C [Source:NCBI gene;Acc:103032811])

HSP 1 Score: 268.855 bits (686), Expect = 2.806e-86
Identity = 156/390 (40.00%), Postives = 215/390 (55.13%), Query Frame = 1
Query:   55 VDTDETQGYNWQNENENDFERMDREDLFSFQK------LETERKRKFQKRPNNIRLGMMRYTLLFIDMTESMRILDLKPTRLGLTIKNASIFVENYFDQNPI-SQLGIFTISNGTVKKLTNLGGNPRKHIDALHSLTEDKCEGELSLENILRCSETILKHIPSYATREVILVVSSLTTCDHNDIDDIIELVRQHNIRCSVISLSAEVFVYKKLTKITKGKFQLILDEVDLKFIFQNLVMPPPSLKENAASLIHMGFP-----SYKKFDRLFKLCNCHFELQNDSSQL----FSCPRCDSAYCEVPVECNNCGLILVSAPHLARSYHHLFPLDEFVESSADSIHQSCRKCSACNKTINKDDLSYKCDHCMMDFCTDCDEFLHSSVHVCPNC 1176
            +D +  +   W+   E  +E +  ++  S +        + +RKR F+     +RLGMMR+  + ID + +M   DLKP RL  T+K    FVE YFDQNPI   + +F I+  T   +    GNP+KH+ AL       C GE SL N L  +   LKH+P + +RE++++ SSLTTCD  +I ++I+ +++  IR SVI LSAEV V   LT+ T G + +ILDE   K +    V PPP+   +  SLI MGFP     S    D        H E  ++   L    + CP+C + Y E+PVEC  CGL LVSAPHLARS+HHLFPLD F ES  +  H   R C AC   + KD   + C  C   FCT+CD F+H ++H CP C
Sbjct:    1 MDEEPERAKRWEGGYERTWEVLKEDESGSLKATVEDILFQAKRKRVFESH-GQVRLGMMRHLYVVIDSSRTMEDQDLKPNRLTSTLKLMEFFVEEYFDQNPIIGNVLLFEIN--TFFYICFDAGNPKKHVAALKKAVGSTCLGEPSLYNALNIAMQTLKHMPGHTSREILIIFSSLTTCDPANIYELIKTLKELKIRVSVIGLSAEVRVCTILTRETGGSYNVILDESHFKELLMLHVKPPPASSSSECSLIRMGFPQHIIASVSDQDAKPSFSMSHLESVDEGPGLTLGGYYCPQCRAKYTELPVECKVCGLTLVSAPHLARSFHHLFPLDAFQESPLEE-HTGDRFCQACQGEL-KDKSVFTCPACSSVFCTECDLFIHDTLHCCPAC 385          
BLAST of General transcription factor IIH subunit vs. Ensembl Sea Lamprey
Match: gtf2h2 (general transcription factor IIH, polypeptide 2 [Source:ZFIN;Acc:ZDB-GENE-030131-1959])

HSP 1 Score: 189.889 bits (481), Expect = 3.780e-58
Identity = 101/243 (41.56%), Postives = 142/243 (58.44%), Query Frame = 1
Query:   85 WQNENENDFERMDREDLFSFQK-----LETERKRKFQKRPNNIRLGMMRYTLLFIDMTESMRILDLKPTRLGLTIKNASIFVENYFDQNPISQLGIFTISNGTVKKLTNLGGNPRKHIDALHSLTEDKCEGELSLENILRCSETILKHIPSYATREVILVVSSLTTCDHNDIDDIIELVRQHNIRCSVISLSAEVFVYKKLTKITKGKFQLILDEVDLKFIFQNLVMPPPSLKENAASLIHMG 798
            W+ + E  +E +  ++  S +      +   ++RK  +    +RLGMMR+  + +DM+  M   DLKP RL   +K    FVE YF QNPISQ+G+ T  N   +KLT LGG P+KHI AL   T+  C GE SL N L+ +   LKH+PS+ +RE+++V  SLTTCD  +I D+I+ ++   +R S+I LSAEV V   LTK T G + +ILDE   K +    V PPP      +SLI MG
Sbjct:   11 WEGDYERTWEVLKEDESGSLKASVDDLIFQAKRRKVSEFHGQVRLGMMRHLFVVVDMSRGMEDQDLKPNRLTCALKLLEHFVEEYFYQNPISQIGLITTKNKRAEKLTELGGTPKKHITALKKATQSTCLGEPSLYNSLQLAMETLKHMPSHTSREILVVFGSLTTCDPANIYDLIQTLKAGKVRVSIIGLSAEVHVCTALTKETGGSYHVILDESHFKELLLYHVTPPPVSANMDSSLIRMG 253          
BLAST of General transcription factor IIH subunit vs. Ensembl Yeast
Match: SSL1 (Subunit of the core form of RNA polymerase transcription factor TFIIH; has both protein kinase and DNA-dependent ATPase/helicase activities; essential for transcription and nucleotide excision repair; interacts with Tfb4p [Source:SGD;Acc:S000003995])

HSP 1 Score: 241.891 bits (616), Expect = 5.758e-76
Identity = 141/392 (35.97%), Postives = 215/392 (54.85%), Query Frame = 1
Query:   76 GYNWQNENENDFERM---DREDLFSFQK--LETERKRKFQKRPNNIRLGMMRYTLLFIDMTESMRILDLKPTRLGLTIKNASIFVENYFDQNPISQLGIFTISNGTVKKLTNLGGNPRKHIDALHSLTEDKCEGELSLENILRCSETILKHIPSYATREVILVVSSLTTCDHNDIDDIIELVRQHNIRCSVISLSAEVFVYKKLTKIT----KGKFQLILDEVDLKFIFQNLVMPPPSLKENAA-SLIHMGFPSYKKFDRLFKLCNCHFELQNDSSQLFSCPRCDSAYCEVPVECNNCGLILVSAPHLARSYHHLFPLDEFVESSADSIHQSCRKCSACNKTI-------NKDDLS---YKCDHCMMDFCTDCDEFLHSSVHVCPNCSEKPI 1191
            GY W++E +  ++ +   D  D+ S     +E  +KR  +K     + G++R  +L +D +E+M   DL+P R  + I+ A  FV  +FDQNPISQ+GI  + NG  + ++ + GNP+ HIDAL S+ + + +G  SL+N L  +  +L  +P++ TREV++V  SL+T D  DI   I+ +    IR  V+ LSA+V + K+L K T    +  ++++LDE  LK +F   V P P  K N   +L+ MGFP+ + F+     C+CH +L       + CP C S  C +P  C  C L+L+ + HLARSYHHL PL  F E       +S   C +C           N   L+   Y+C+ C  +FC DCD F+H  +H CP C  KP+
Sbjct:   73 GYAWEDEIKRSWDLVKVDDEGDMASLVASIVEARKKRTAKKNITPYQRGIIRSLILTLDCSEAMLEKDLRPNRHAMIIQYAIDFVHEFFDQNPISQMGIIIMRNGLAQLVSQVSGNPQDHIDALKSIRKQEPKGNPSLQNALEMARGLLLPVPAHCTREVLIVFGSLSTTDPGDIHQTIDSLVSEKIRVKVLGLSAQVAICKELCKATNYGDESFYKILLDETHLKELFNEAVTPLPVNKINKGFTLVKMGFPT-RIFEDTPTFCSCHSKLVYGG---YFCPNCHSKVCSLPTVCPCCDLMLILSTHLARSYHHLMPLKTFAEVPTTEKFRS-EDCFSCQSRFPILKNHKNGKLLTSSRYRCEDCKQEFCVDCDVFIHEILHNCPGCESKPV 459          
BLAST of General transcription factor IIH subunit vs. Ensembl Nematostella
Match: EDO42386 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1M7])

HSP 1 Score: 291.197 bits (744), Expect = 2.056e-95
Identity = 149/389 (38.30%), Postives = 227/389 (58.35%), Query Frame = 1
Query:   64 DETQGYNWQNENENDFERMDREDLFSFQKLETE-----RKRKFQKRPNNIRLGMMRYTLLFIDMTESMRILDLKPTRLGLTIKNASIFVENYFDQNPISQLGIFTISNGTVKKLTNLGGNPRKHIDALHSLTEDKCEGELSLENILRCSETILKHIPSYATREVILVVSSLTTCDHNDIDDIIELVRQHNIRCSVISLSAEVFVYKKLTKITKGKFQLILDEVDLKFIFQNLVMPPPSLKENAASLIHMGFPSYKKFDRLFKLCNCHFELQND---SSQLFSCPRCDSAYCEVPVECNNCGLILVSAPHLARSYHHLFPLDEFVESS--ADSIHQSCRKCSACNKTINKDDLSYKCDHCMMDFCTDCDEFLHSSVHVCPNCSEKPIRVS 1200
            D+  GY W ++ E  +E +  +D  S Q L  E     ++++   RP N+RLGMMR+  + IDM+++M   DLKP RL  + K    F+  YFDQNPISQLG+    N   +KL+ L GNP+ HI  + S     C GE SL+N L  +   LKH+P + +REV++++ SLT+CD  DI + ++ ++  N+RCS++ L+AE+ V K++   T G ++++LDE   K +    V+PP +       L ++ F SY  +  +F +   H + +N    +++ + CP+C S YC++PVEC  CGL LVSAPHLARSY HLFPL ++ E +  A    Q    C AC  T+  +  +  C  C   FC DCD ++H S+H CP C+   + V+
Sbjct:    8 DDESGYRWLSQYEKTWEAIREDDEGSLQTLVDELVHRSKRQRVAARPGNVRLGMMRHLYIIIDMSKAMEEADLKPNRLSCSAKLLENFITEYFDQNPISQLGLIITKNKRAEKLSELSGNPKLHISTIQSACSKPCVGEPSLQNALVLAMQSLKHMPGHVSREVLVLMGSLTSCDPGDITETVKSLKNMNVRCSIVGLAAEMRVCKQICSSTNGSYRVVLDERHFKDLLMEHVIPPTATVRICLVLWYVIFESY-CYIHVFSVIRSHMDNKNIKEFTTKGYFCPQCRSKYCDLPVECKVCGLTLVSAPHLARSYQHLFPLQQYTEVNVPAQIPGQPPWTCQACQITLT-EKTACSCPECRHVFCLDCDIYIHESLHTCPGCTAHQVTVA 394          
BLAST of General transcription factor IIH subunit vs. Ensembl Nematostella
Match: EDO28550 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T657])

HSP 1 Score: 70.4774 bits (171), Expect = 2.635e-15
Identity = 37/87 (42.53%), Postives = 52/87 (59.77%), Query Frame = 1
Query:  112 ERMDREDLFSFQKLETE-----RKRKFQKRPNNIRLGMMRYTLLFIDMTESMRILDLKPTRLGLTIKNASIFVENYFDQNPISQLGI 357
            E +  +D  S Q L  E     ++++   RP N+RLGMMR+  + IDM+++M   DLKP RL  + K    F+  YFDQNPISQ+ I
Sbjct:    1 EAIREDDEGSLQTLVDELVHRSKRQRVAARPGNVRLGMMRHLYIIIDMSKAMEEADLKPNRLSCSAKLLENFITEYFDQNPISQVRI 87          
BLAST of General transcription factor IIH subunit vs. Ensembl Medaka
Match: gtf2h2 (general transcription factor IIH subunit 2 [Source:NCBI gene;Acc:101167715])

HSP 1 Score: 293.123 bits (749), Expect = 8.023e-96
Identity = 156/387 (40.31%), Postives = 221/387 (57.11%), Query Frame = 1
Query:   55 VDTDETQGYNWQNENENDFERMDREDLFSFQK-----LETERKRKFQKRPNNIRLGMMRYTLLFIDMTESMRILDLKPTRLGLTIKNASIFVENYFDQNPISQLGIFTISNGTVKKLTNLGGNPRKHIDALHSLTEDKCEGELSLENILRCSETILKHIPSYATREVILVVSSLTTCDHNDIDDIIELVRQHNIRCSVISLSAEVFVYKKLTKITKGKFQLILDEVDLKFIFQNLVMPPPSLKENAASLIHMGFPSYKKFDRLFKLCNCHFELQNDSS--------QLFSCPRCDSAYCEVPVECNNCGLILVSAPHLARSYHHLFPLDEFVESSADSIHQSCRKCSACNKTINKDDLSYKCDHCMMDFCTDCDEFLHSSVHVCPNC 1176
            +D +  +   W+   E  +E +  ++  S +      L   ++R+  +    +RLGMMR+  + +D + SM   DLKP RL  T+K    FV+ YFDQNPISQ+G+ T  N   +KLT+L GNP+KHI AL    +  C GE SL N L  +   LKH+P + +REV++++SSLTTCD  +I D+I+ ++   +R SVI LSAEV V   LT+ T G + +ILDE   K +    V PPP+   +  SLI MGFP +       +     F + +  S          + CP+C + Y E+PVEC  CGL LVSAPHLARS+HHLFP+  F+ESS + + Q  R C  C   + +D  +Y C  C   FC +CD F+H S+H CP C
Sbjct:    1 MDEEPERTKRWEGGYERTWEVLKEDESGSLKATVEDILFQSKRRRVVESHGQVRLGMMRHLYVVVDCSRSMEDQDLKPNRLAATLKLLEGFVDEYFDQNPISQVGVITTKNKRAEKLTDLAGNPKKHITALKKAVDSACVGEPSLYNALNLAVQTLKHMPGHTSREVLIILSSLTTCDPANIYDLIQTLKGLKVRVSVIGLSAEVRVCTVLTRETGGSYHVILDESHFKELLMLHVKPPPASSSSECSLIRMGFPQHAIASVSERDARPSFSMSHLDSGTGPGLTLGGYFCPQCHAKYSELPVECKVCGLTLVSAPHLARSFHHLFPMVPFLESSVEEL-QGSRFCEGCQGEL-RDKSAYVCPSCRGVFCVECDLFIHDSLHCCPCC 385          
BLAST of General transcription factor IIH subunit vs. Planmine SMEST
Match: SMESG000049453.1 (SMESG000049453.1)

HSP 1 Score: 806.209 bits (2081), Expect = 0.000e+0
Identity = 391/392 (99.74%), Postives = 391/392 (99.74%), Query Frame = 1
Query:   34 MSSQKFIVDTDETQGYNWQNENENDFERMDREDLFSFQKLETERKRKFQKRPNNIRLGMMRYTLLFIDMTESMRILDLKPTRLGLTIKNASIFVENYFDQNPISQLGIFTISNGTVKKLTNLGGNPRKHIDALHSLTEDKCEGELSLENILRCSETILKHIPSYATREVILVVSSLTTCDHNDIDDIIELVRQHNIRCSVISLSAEVFVYKKLTKITKGKFQLILDEVDLKFIFQNLVMPPPSLKENAASLIHMGFPSYKKFDRLFKLCNCHFELQNDSSQLFSCPRCDSAYCEVPVECNNCGLILVSAPHLARSYHHLFPLDEFVESSADSIHQSCRKCSACNKTINKDDLSYKCDHCMMDFCTDCDEFLHSSVHVCPNCSEKPIRVSECE 1209
            MSSQKFIVDTDETQGYNWQNENENDFERMDREDLFS QKLETERKRKFQKRPNNIRLGMMRYTLLFIDMTESMRILDLKPTRLGLTIKNASIFVENYFDQNPISQLGIFTISNGTVKKLTNLGGNPRKHIDALHSLTEDKCEGELSLENILRCSETILKHIPSYATREVILVVSSLTTCDHNDIDDIIELVRQHNIRCSVISLSAEVFVYKKLTKITKGKFQLILDEVDLKFIFQNLVMPPPSLKENAASLIHMGFPSYKKFDRLFKLCNCHFELQNDSSQLFSCPRCDSAYCEVPVECNNCGLILVSAPHLARSYHHLFPLDEFVESSADSIHQSCRKCSACNKTINKDDLSYKCDHCMMDFCTDCDEFLHSSVHVCPNCSEKPIRVSECE
Sbjct:    1 MSSQKFIVDTDETQGYNWQNENENDFERMDREDLFSSQKLETERKRKFQKRPNNIRLGMMRYTLLFIDMTESMRILDLKPTRLGLTIKNASIFVENYFDQNPISQLGIFTISNGTVKKLTNLGGNPRKHIDALHSLTEDKCEGELSLENILRCSETILKHIPSYATREVILVVSSLTTCDHNDIDDIIELVRQHNIRCSVISLSAEVFVYKKLTKITKGKFQLILDEVDLKFIFQNLVMPPPSLKENAASLIHMGFPSYKKFDRLFKLCNCHFELQNDSSQLFSCPRCDSAYCEVPVECNNCGLILVSAPHLARSYHHLFPLDEFVESSADSIHQSCRKCSACNKTINKDDLSYKCDHCMMDFCTDCDEFLHSSVHVCPNCSEKPIRVSECE 392          
The following BLAST results are available for this feature:
BLAST of General transcription factor IIH subunit vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GTF2H21.112e-8941.43general transcription factor IIH subunit 2 [Source... [more]
GTF2H21.112e-8941.43general transcription factor IIH subunit 2 [Source... [more]
GTF2H21.112e-8941.43general transcription factor IIH subunit 2 [Source... [more]
GTF2H21.112e-8941.43general transcription factor IIH subunit 2 [Source... [more]
GTF2H21.112e-8941.43general transcription factor IIH subunit 2 [Source... [more]
back to top
BLAST of General transcription factor IIH subunit vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
gtf-2H2C1.652e-8736.81General transcription factor IIH subunit 2 [Sourc... [more]
gtf-2H2C1.652e-8736.81General transcription factor IIH subunit 2 [Sourc... [more]
back to top
BLAST of General transcription factor IIH subunit vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Ssl12.061e-9840.35gene:FBgn0037202 transcript:FBtr0332051[more]
Ssl12.061e-9840.35gene:FBgn0037202 transcript:FBtr0078554[more]
back to top
BLAST of General transcription factor IIH subunit vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
gtf2h27.754e-9441.49general transcription factor IIH, polypeptide 2 [S... [more]
back to top
BLAST of General transcription factor IIH subunit vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gtf2h23.015e-9441.75general transcription factor IIH subunit 2 [Source... [more]
gtf2h22.399e-9240.95general transcription factor IIH subunit 2 [Source... [more]
gtf2h27.724e-8639.43general transcription factor IIH subunit 2 [Source... [more]
gtf2h27.767e-8540.10general transcription factor IIH subunit 2 [Source... [more]
gtf2h21.637e-8443.82general transcription factor IIH subunit 2 [Source... [more]
back to top
BLAST of General transcription factor IIH subunit vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Gtf2h25.013e-9242.09general transcription factor II H, polypeptide 2 [... [more]
Gtf2h25.144e-9242.09general transcription factor II H, polypeptide 2 [... [more]
Gtf2h21.939e-2753.92general transcription factor II H, polypeptide 2 [... [more]
Gtf2h21.222e-1635.54general transcription factor II H, polypeptide 2 [... [more]
back to top
BLAST of General transcription factor IIH subunit vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q2TBV5|TF2H2_BOVIN5.174e-9541.69General transcription factor IIH subunit 2 OS=Bos ... [more]
sp|A0JN27|TF2H2_RAT9.360e-9541.84General transcription factor IIH subunit 2 OS=Ratt... [more]
sp|Q9JIB4|TF2H2_MOUSE3.598e-9142.09General transcription factor IIH subunit 2 OS=Mus ... [more]
sp|Q13888|TF2H2_HUMAN5.340e-8941.43General transcription factor IIH subunit 2 OS=Homo... [more]
sp|Q6P1K8|T2H2L_HUMAN1.640e-8841.18General transcription factor IIH subunit 2-like pr... [more]
back to top
BLAST of General transcription factor IIH subunit vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V4B2E96.279e-11546.37General transcription factor IIH subunit OS=Lottia... [more]
K1RAW71.821e-11245.83General transcription factor IIH subunit OS=Crasso... [more]
A0A210PXN62.236e-11244.70General transcription factor IIH subunit OS=Mizuho... [more]
T1JJK06.778e-11044.36General transcription factor IIH subunit OS=Striga... [more]
A0A0L8GMG62.651e-10944.76General transcription factor IIH subunit OS=Octopu... [more]
back to top
BLAST of General transcription factor IIH subunit vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
gtf2h21.281e-9741.90GTF2H2 family member C [Source:NCBI gene;Acc:10303... [more]
gtf2h22.806e-8640.00GTF2H2 family member C [Source:NCBI gene;Acc:10303... [more]
back to top
BLAST of General transcription factor IIH subunit vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
gtf2h23.780e-5841.56general transcription factor IIH, polypeptide 2 [S... [more]
back to top
BLAST of General transcription factor IIH subunit vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
SSL15.758e-7635.97Subunit of the core form of RNA polymerase transcr... [more]
back to top
BLAST of General transcription factor IIH subunit vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO423862.056e-9538.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO285502.635e-1542.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of General transcription factor IIH subunit vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
gtf2h28.023e-9640.31general transcription factor IIH subunit 2 [Source... [more]
back to top
BLAST of General transcription factor IIH subunit vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000049453.10.000e+099.74SMESG000049453.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019332 ID=SMED30019332|Name=General transcription factor IIH subunit|organism=Schmidtea mediterranea sexual|type=transcript|length=1249bp
CTTGTTTAAATAATATATTAAAATTATTCGAACATGTCTTCACAAAAATT
TATAGTTGATACCGATGAAACACAAGGATACAATTGGCAGAATGAAAATG
AAAATGACTTCGAACGTATGGATAGGGAAGATTTATTTAGTTTCCAAAAG
CTTGAGACCGAGCGTAAACGTAAATTCCAAAAGCGTCCAAATAATATTCG
TTTAGGCATGATGAGATACACTTTACTTTTTATTGATATGACTGAATCAA
TGAGAATTCTTGATCTCAAACCTACTAGATTAGGATTGACGATTAAAAAT
GCATCAATATTTGTCGAAAATTATTTTGATCAAAATCCTATTAGTCAACT
CGGAATTTTTACTATTAGCAATGGAACTGTTAAGAAATTAACTAATTTAG
GAGGAAATCCAAGAAAGCATATTGATGCTTTGCATTCATTAACTGAAGAT
AAATGCGAAGGTGAATTATCATTGGAAAATATTTTACGGTGTTCTGAGAC
AATTCTTAAGCATATTCCTTCTTATGCTACACGAGAGGTAATTTTAGTTG
TGTCAAGTTTAACAACTTGTGATCACAATGACATTGATGATATTATTGAA
CTAGTTCGACAGCATAACATTCGATGCTCAGTCATTTCGCTGTCAGCGGA
AGTTTTTGTTTATAAAAAGCTAACAAAAATAACAAAAGGCAAGTTCCAGT
TGATTCTTGATGAGGTGGATTTGAAGTTTATTTTCCAGAATTTAGTGATG
CCACCACCGAGTTTGAAAGAGAACGCAGCTAGCCTCATCCATATGGGGTT
CCCTAGCTATAAGAAATTCGATCGATTGTTTAAATTGTGCAACTGTCATT
TTGAATTGCAGAACGATTCATCACAGCTTTTCTCTTGTCCCAGATGTGAC
TCGGCTTACTGTGAGGTCCCGGTTGAATGCAACAATTGCGGTCTGATTCT
TGTGTCTGCCCCTCATCTCGCTCGATCTTATCATCACCTGTTTCCATTGG
ATGAATTTGTCGAATCCTCAGCTGATTCAATTCATCAATCTTGCAGAAAA
TGTTCCGCATGTAACAAAACAATCAATAAGGATGATTTGAGTTACAAATG
TGATCATTGCATGATGGATTTTTGCACGGATTGCGATGAATTCCTTCACA
GCTCGGTACATGTCTGTCCGAATTGCTCGGAAAAGCCGATTCGGGTCTCG
GAATGTGAATAGATTGGATTTAATAAAATGTAAAATGACTTGAAAAAAA
back to top

protein sequence of SMED30019332-orf-1

>SMED30019332-orf-1 ID=SMED30019332-orf-1|Name=SMED30019332-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=393bp
MSSQKFIVDTDETQGYNWQNENENDFERMDREDLFSFQKLETERKRKFQK
RPNNIRLGMMRYTLLFIDMTESMRILDLKPTRLGLTIKNASIFVENYFDQ
NPISQLGIFTISNGTVKKLTNLGGNPRKHIDALHSLTEDKCEGELSLENI
LRCSETILKHIPSYATREVILVVSSLTTCDHNDIDDIIELVRQHNIRCSV
ISLSAEVFVYKKLTKITKGKFQLILDEVDLKFIFQNLVMPPPSLKENAAS
LIHMGFPSYKKFDRLFKLCNCHFELQNDSSQLFSCPRCDSAYCEVPVECN
NCGLILVSAPHLARSYHHLFPLDEFVESSADSIHQSCRKCSACNKTINKD
DLSYKCDHCMMDFCTDCDEFLHSSVHVCPNCSEKPIRVSECE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0008270zinc ion binding
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005675holo TFIIH complex
GO:0000439core TFIIH complex
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR036465vWFA_dom_sf
IPR013083Znf_RING/FYVE/PHD
IPR013087Znf_C2H2_type
IPR004595TFIIH_C1-like_dom
IPR012170TFIIH_SSL1/p44
IPR007198Ssl1-like
IPR007087Znf_C2H2
IPR002035VWF_A
Vocabulary: biological process
TermDefinition
GO:0006281DNA repair
GO:0006289nucleotide-excision repair
GO:0006351transcription, DNA-templated
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004595TFIIH C1-like domainSMARTSM01047C1_4_2coord: 339..382
e-value: 3.8E-7
score: 37.7
IPR036465von Willebrand factor A-like domain superfamilyGENE3DG3DSA:3.40.50.410coord: 56..243
e-value: 6.0E-63
score: 213.8
IPR036465von Willebrand factor A-like domain superfamilySUPERFAMILYSSF53300vWA-likecoord: 65..229
IPR012170TFIIH subunit Ssl1/p44TIGRFAMTIGR00622TIGR00622coord: 283..383
e-value: 8.3E-27
score: 92.1
IPR012170TFIIH subunit Ssl1/p44PIRSFPIRSF015919TFIIH_SSL1coord: 2..384
e-value: 4.0E-112
score: 372.7
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 322..382
e-value: 3.6E-11
score: 45.0
IPR007198Ssl1-likePFAMPF04056Ssl1coord: 67..257
e-value: 8.5E-68
score: 228.0
NoneNo IPR availablePANTHERPTHR12695GENERAL TRANSCRIPTION FACTOR IIH SUBUNIT 2coord: 11..384
NoneNo IPR availableSUPERFAMILYSSF57889Cysteine-rich domaincoord: 317..381
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 356..376