Armadillo repeat-containing protein 2

Overview
NameArmadillo repeat-containing protein 2
Smed IDSMED30019328
Length (bp)3092
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Armadillo repeat-containing protein 2 (SMED30019328) t-SNE clustered cells

Violin plots show distribution of expression levels for Armadillo repeat-containing protein 2 (SMED30019328) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Armadillo repeat-containing protein 2 (SMED30019328) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Armadillo repeat-containing protein 2 (SMED30019328) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019328

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30019328SMESG000077074.1 dd_Smed_v4_12684_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30019328SMESG000077074.1 dd_Smed_v4_12684_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30019328SMESG000077074.1 dd_Smed_v4_12684_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30019328SMESG000077074.1 dd_Smed_v4_12684_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30019328SMESG000077074.1 dd_Smed_v6_12684_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30019328SMESG000077074.1 dd_Smed_v4_12684_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Armadillo repeat-containing protein 2 vs. Ensembl Human
Match: ARMC2 (armadillo repeat containing 2 [Source:HGNC Symbol;Acc:HGNC:23045])

HSP 1 Score: 267.314 bits (682), Expect = 3.326e-75
Identity = 204/636 (32.08%), Postives = 337/636 (52.99%), Query Frame = 2
Query:  953 DIFFKDTLAPILDILSAPVEFRKQNSTEDFINLTKLLYSKLDEKGLLGKHCAFRSDILKAVFKVLDSTNPILVISAAKIILSMIVRDVNLLNICKLIFRVSKNKNNDKIFEEFEMANILIQTLSSVKPDQSHAALLYLMCTLKFLSKPEKSVGSENLSKNIISNSLINAGLLPSISNLLQKCSKINEN-EHC---VNNSFADFIIQCFSCLINLESNPNISRKYFIQNQIPVVTVLTIQQYHHNNDLIFEAFRLLSRLTQYSDCCQLIEPKLSEFCPLCLNLM-LNSRNDHLILRIAYIIGDMLTKSEEARLTLFPDKFSLDSFLKVFQVFIQKFQCCDENINKMSGDSMEKDSAS-----VDDIIVKLLRVIANAAITESVGRMICHNKSCXXXXXXXXXXXXXXDKEELLTISISALNNISFYMTSANNPEIKNNHLKIIEALYKIIANKYGKDHLGGI---IRVLGNLSRETYMRDWIVDNQLVEFLITILDSDNQDTIFFTVGVILNLMTDQNKRHLLLELNGITKLIEVLRDFASRDWQLAGLVCQTFWNYTEIISTTTEAILGGEENAEELLQLLTLFTDSDEVDNIHLNHYSDISTLDYLKNSWKSDFLPVAADLISRLELKMNRFEPL 2821
            ++F+   + PIL       E  K+ + E        L+  L+E  +LG     RS +LK + K++D  +  L +  AKIIL++ V   NLLN+CKLIF++S+N+ ND + +   +   L++ L S     +  A LY M ++KF+S         NL      N +I+ G +  + NL+++   INEN + C   + NS    ++Q  + L NL  +  +  K+   + +P +    ++QY  + D+     R+ S+LT Y DCC  +    S    L LNL+    +   L++R+ +I+G++  K+ +AR     +K S+ + L +FQ F Q     D +  K  G   E+  A       +D+++KL RV+AN AI   VG ++  N   + LLL+ +  K + D EEL+  + + +NN+S+Y     N  I++  L I E L K++ +    +++ GI   +RV GNLS++  + D+IV N +  F++ +LD+ +QD  F   GV+LNL  D++KR +L E  GI KL++ LRD    DWQLA LVC+T WN++E I+  +     G E+   LL LL+ F D +    + L+   D    +Y K  W+++F PVA  L++R++      EPL
Sbjct:  266 EVFWNTRIVPILR------ELEKEENIETVCAACTQLHHALEEGNMLGNKFKGRSILLKTLCKLVDVGSDSLSLKLAKIILALKVSRKNLLNVCKLIFKISRNEKNDSLIQNDSILESLLEVLRSEDLQTNMEAFLYCMGSIKFISG--------NLG---FLNEMISKGAVEILINLIKQ---INENIKKCGTFLPNS-GHLLVQVTATLRNLVDSSLVRSKFLNISALPQLCT-AMEQYKGDKDVCTNIARIFSKLTSYRDCCTALA-SYSRCYALFLNLINKYQKKQDLVVRVVFILGNLTAKNNQAREQFSKEKGSIQTLLSLFQTFHQ----LDLHSQKPVGQRGEQHRAQRPPSEAEDVLIKLTRVLANIAIHPGVGPVLAANPGIVGLLLTTLEYKSLDDCEELVINATATINNLSYYQV--KNSIIQDKKLYIAELLLKLLVS----NNMDGILEAVRVFGNLSQDHDVCDFIVQNNVHRFMMALLDAQHQDICFSACGVLLNLTVDKDKRVILKEGGGIKKLVDCLRDLGPTDWQLACLVCKTLWNFSENITNASSCF--GNEDTNTLLLLLSSFLDEE----LALDGSFDPDLKNYHKLHWETEFKPVAQQLLNRIQRHHTFLEPL 862          

HSP 2 Score: 75.485 bits (184), Expect = 4.508e-13
Identity = 42/87 (48.28%), Postives = 54/87 (62.07%), Query Frame = 2
Query:   71 FYETPVDRPIASS-IINETRTWLNTVQTKRPFTPQTETRSLFGNHSQRNPESRPPSVFSLGPRNFDTNPAALDSFSRPSSGPRLAPI 328
            FY+  V +   S+ II+E R  L TV+T+RPFTPQ   R LFG  S R  E+RPPS FSL   +F++      S SRP SG RL+P+
Sbjct:   15 FYQPSVSKQKTSAEIISEARNALRTVRTQRPFTPQEAQRKLFGPASSRTSENRPPSSFSLHASSFES------SDSRPISGTRLSPL 95          
BLAST of Armadillo repeat-containing protein 2 vs. Ensembl Human
Match: ARMC2 (armadillo repeat containing 2 [Source:HGNC Symbol;Acc:HGNC:23045])

HSP 1 Score: 261.536 bits (667), Expect = 2.154e-74
Identity = 205/640 (32.03%), Postives = 338/640 (52.81%), Query Frame = 2
Query:  953 DIFFKDTLAPILDILSAPVEFRKQNSTEDFINLTKLLYSKLDEKGLLGKHCAFRSDILKAVFKVLDSTNPILVISAAKIILSMIVRDVNLLNICKLIFRVSKNKNNDKIFEEFEMANILIQTLSSVKPDQSHAALLYLMCTLKFLSKPEKSVGSENLSKNIISNSLINAGLLPSISNLLQKCSKINEN-EHC---VNNSFADFIIQCFSCLINLESNPNISRKYFIQNQIPVVTVLTIQQYHHNNDLIFEAFRLLSRLTQYSDCCQLIEPKLSEFCPLCLNLMLNSRNDH-----LILRIAYIIGDMLTKSEEARLTLFPDKFSLDSFLKVFQVFIQKFQCCDENINKMSGDSMEKDSAS-----VDDIIVKLLRVIANAAITESVGRMICHNKSCXXXXXXXXXXXXXXDKEELLTISISALNNISFYMTSANNPEIKNNHLKIIEALYKIIANKYGKDHLGGI---IRVLGNLSRETYMRDWIVDNQLVEFLITILDSDNQDTIFFTVGVILNLMTDQNKRHLLLELNGITKLIEVLRDFASRDWQLAGLVCQTFWNYTEIISTTTEAILGGEENAEELLQLLTLFTDSDEVDNIHLNHYSDISTLDYLKNSWKSDFLPVAADLISRLELKMNRFEPL 2821
            ++F+   + PIL       E  K+ + E        L+  L+E  +LG     RS +LK + K++D  +  L +  AKIIL++ V   NLLN+CKLIF++S+N+ ND + +   +   L++ L S     +  A LY M ++KF+S         NL      N +I+ G +  + NL+++   INEN + C   + NS    ++Q  + L NL  +  +  K+   + +P +    ++QY  + D+     R+ S+LT Y DCC      L+ +   C  L LN  N +     L++R+ +I+G++  K+ +AR     +K S+ + L +FQ F Q     D +  K  G   E+  A       +D+++KL RV+AN AI   VG ++  N   + LLL+ +  K + D EEL+  + + +NN+S+Y     N  I++  L I E L K++ +    +++ GI   +RV GNLS++  + D+IV N +  F++ +LD+ +QD  F   GV+LNL  D++KR +L E  GI KL++ LRD    DWQLA LVC+T WN++E I+  +     G E+   LL LL+ F D +    + L+   D    +Y K  W+++F PVA  L++R++      EPL
Sbjct:  101 EVFWNTRIVPILR------ELEKEENIETVCAACTQLHHALEEGNMLGNKFKGRSILLKTLCKLVDVGSDSLSLKLAKIILALKVSRKNLLNVCKLIFKISRNEKNDSLIQNDSILESLLEVLRSEDLQTNMEAFLYCMGSIKFISG--------NLG---FLNEMISKGAVEILINLIKQ---INENIKKCGTFLPNS-GHLLVQVTATLRNLVDSSLVRSKFLNISALPQLCT-AMEQYKGDKDVCTNIARIFSKLTSYRDCC----TALASY-SRCYALFLNLINKYQKKQDLVVRVVFILGNLTAKNNQAREQFSKEKGSIQTLLSLFQTFHQ----LDLHSQKPVGQRGEQHRAQRPPSEAEDVLIKLTRVLANIAIHPGVGPVLAANPGIVGLLLTTLEYKSLDDCEELVINATATINNLSYY--QVKNSIIQDKKLYIAELLLKLLVS----NNMDGILEAVRVFGNLSQDHDVCDFIVQNNVHRFMMALLDAQHQDICFSACGVLLNLTVDKDKRVILKEGGGIKKLVDCLRDLGPTDWQLACLVCKTLWNFSENITNASSCF--GNEDTNTLLLLLSSFLDEE----LALDGSFDPDLKNYHKLHWETEFKPVAQQLLNRIQRHHTFLEPL 697          
BLAST of Armadillo repeat-containing protein 2 vs. Ensembl Human
Match: ARMC2 (armadillo repeat containing 2 [Source:HGNC Symbol;Acc:HGNC:23045])

HSP 1 Score: 67.0106 bits (162), Expect = 1.145e-11
Identity = 42/87 (48.28%), Postives = 54/87 (62.07%), Query Frame = 2
Query:   71 FYETPVDRPIASS-IINETRTWLNTVQTKRPFTPQTETRSLFGNHSQRNPESRPPSVFSLGPRNFDTNPAALDSFSRPSSGPRLAPI 328
            FY+  V +   S+ II+E R  L TV+T+RPFTPQ   R LFG  S R  E+RPPS FSL   +F++      S SRP SG RL+P+
Sbjct:   15 FYQPSVSKQKTSAEIISEARNALRTVRTQRPFTPQEAQRKLFGPASSRTSENRPPSSFSLHASSFES------SDSRPISGTRLSPL 95          
BLAST of Armadillo repeat-containing protein 2 vs. Ensembl Fly
Match: CG32668 (gene:FBgn0052668 transcript:FBtr0073469)

HSP 1 Score: 86.6557 bits (213), Expect = 6.978e-17
Identity = 85/318 (26.73%), Postives = 145/318 (45.60%), Query Frame = 2
Query: 1694 FRLLSRLTQYSDCCQLIEPKLSE----FCPLCLNL-MLNSRNDHLILRIAYIIGDMLTKSEEARLTLFPDKFSLDSFLKVFQVFIQKFQCCDENINKMSGDSMEKDSASVDDIIVKLLRVIANAAITESVGRMICHNKSCXX-------XXXXXXXXXXXXDKEELLTISISALNNISFYM--TSANNPEIKNNHLKIIE----ALYKIIANKYGKDHLGGIIRVLGNLSRETYMRDWIVDNQLVEFLITIL--DSDNQDTIFFT--VGVILNLMTDQNKRHLLLELNGITKLIEVLRDFASR-DWQLAGLVCQTFWN 2578
             R LS L++ SDCC+ +    +       P C      + R   ++ R+ Y++G++L K E AR+  F +  +++  L V            E +N+ S       S +  D  +KL+RV+AN ++   VG  + + +S               +  KK  +++ELL  ++ AL+N+ FY    +A  P  + +   +I+    +L K++ N         + RVLGNL+R    R        +  ++  L   +  QD    T  +GV++NL+ D  +R   L+L G   L  +LR    + DW LA +VCQ  WN
Sbjct:  451 VRTLSVLSEDSDCCETLHNYAARIGLLLGPSCAGGGQWSERLLAVLSRLGYMLGNILAKHESARIQYFHNDVAMEYLLNVL-----------EQLNERS-----PSSVAHLDAQIKLIRVVANMSVNPEVGAGLGNVRSLGAVLLQLLSKTSEELTKKKSPEQQELLHATLGALHNLCFYQDKQAAVQPLAEGSLQSLIDDLSASLAKVLGNCQTSVTKVELARVLGNLTRNEQARRCFCAAGGLPLMVQQLTKQAAGQDYELRTCAIGVLVNLLGDGEQRGPFLQLRGAELLSLLLRGSLEQEDWFLANIVCQALWN 752          

HSP 2 Score: 66.6254 bits (161), Expect = 9.721e-11
Identity = 30/110 (27.27%), Postives = 62/110 (56.36%), Query Frame = 2
Query: 1112 RSDILKAVFKVLDSTNPILVISAAKIILSMIVRDVNLLNICKLIFRVSKNKNNDKIFEEFEMANILIQTLSSVKPDQSHAALLYLMCTLKFLSKPEKSVGSENLSKNIIS 1441
            R  IL  ++ +++ T+P ++++ A+++L++ V   NL   CKLIF+V++++ +D +F E ++  +LI  L    P     A +Y    ++FL+        + L++N I 
Sbjct:  218 RGFILGGLYGLVECTSPRVLLAVARVVLALRVTGSNLTGACKLIFKVARHEQHDALFHEHDVLELLIDGLGHASPLDEPEACIYAYGCIRFLTASSAQERDDALNRNWIG 327          
BLAST of Armadillo repeat-containing protein 2 vs. Ensembl Zebrafish
Match: armc2 (armadillo repeat containing 2 [Source:ZFIN;Acc:ZDB-GENE-041014-7])

HSP 1 Score: 262.307 bits (669), Expect = 5.225e-74
Identity = 189/635 (29.76%), Postives = 334/635 (52.60%), Query Frame = 2
Query:  941 SDDQDIFFKDTLAPILDILSAPVEFRKQNSTEDFI-----NLTKLLYSKLDEKGLLGKHCAFRSDILKAVFKVLDSTNPILVISAAKIILSMIVRDVNLLNICKLIFRVSKNKNNDKIFEEFEMANILIQTLSSVKPDQSHAALLYLMCTLKFLSKPEKSVGSENLSKNIISNSLINAGLLPSISNLLQ---KCSKINENEHCVNNSFADFI-----IQCFSCLINLESNPNISRKYFIQNQIPVVTVLTIQQYHHNNDLIFEAFRLLSRLTQYSDCCQLIEPKLSEFCPLCLNLML-NSRNDHLILRIAYIIGDMLTKSEEARLTLFPDKFSLDSFLKVFQVFIQKFQCCDENINKMSGDSMEKDSASVDDIIVKLLRVIANAAITESVGRMICHNKSCXXXXXXXXXXXXXXDKEELLTISISALNNISFYMTSANNPEIKNNHLKIIEALYKIIANKYGKDHLGGIIRVLGNLSRETYMRDWIVDNQLVEFLITILDSDNQDTIFFTVGVILNLMTDQNKRHLLLELNGITKLIEVLRDFASRDWQLAGLVCQTFWNYTEIISTTTEAILGGE-ENAEELLQLLTLFTDSDEVDNIHLNHYSDISTLDYLKNSWKSDFLPVAADLISRLELK 2800
            S+D+ +F+   + P+L    +   F   ++  D I     N    L+  L E+G+LG+ C  RS IL+ +F+++D  +  L ++ AK+IL++ V   NLLNICKL+F++S+N NND +F    + + L+  L          A+LY + +LK LS      G+  LS+ ++    I  G+L  +S  L      +  N N H  +      I     +Q  + L N+ ++ + SR  F+ N+      L ++ + ++ D+     R+ S+L+ Y++CC  +  +    C L L L+  +SR   L++R+ + +G++  KS EAR  ++ ++  +D  L +FQ +              S    ++ S   +D++VKL+R++AN AI  +VG  +  N  C+ LLL ++  + + + EEL+  +++ +NN+SFY + ++   I++ H  I + L K++      D +    RV GNLS+   +R +++ +++ +F+IT+LDS + D  F   GV++NL  D + R +L     + KL++ LRDF  +DW LA +VCQT WN +          L GE ++A+ELL++L L+TD +      L   S+       +  W+  FLPVA  L  RL ++
Sbjct:  213 SEDESVFWNTKVLPVLQEFES---FAGGDAVSDEIVGQLCNSCNGLHDALAERGMLGRQCKKRSGILRILFRLIDVGSDRLNLTLAKLILALNVSGNNLLNICKLVFKISRNANNDALFLNGSILDSLVSLLQCEDVWSKGEAVLYCVGSLKLLS------GNSALSRLLLDKGFI--GVLMQLSKRLMHSPSATSANVNTHRSDGEGQQIITGHILVQVTAALRNI-ADQSESRPSFLSNKAFSTLCLILENHRNDLDVCINVARIFSKLSTYTECCHAL-AETPRCCSLFLELLGKHSRKQDLVVRLLFTLGNLTAKSTEAREQVYEEERGMDVLLDLFQAY-----------QNTSSPPEQRLSPEREDVLVKLIRLLANLAIHPTVGTALAANTLCVQLLLEVLECRSVQESEELVINAVATINNLSFYPSQSS--VIRSQHTHISQLLLKLLLGS-SMDAVLEATRVFGNLSQIKDVRRFVMQHKVEQFVITLLDSKSPDVCFSACGVLINLSADPDNRAMLSAEGAVQKLVDCLRDFGPQDWHLAAVVCQTLWNCS----------LDGELQHAQELLEILRLYTDREA-----LQWPSEDGVRQVQEARWELLFLPVAERLRQRLHIE 805          

HSP 2 Score: 75.485 bits (184), Expect = 2.643e-13
Identity = 42/98 (42.86%), Postives = 58/98 (59.18%), Query Frame = 2
Query:   35 IDLNSNGSKGRAFYETPVDRPIASSIINETRTWLNTVQTKRPFTPQTETRSLFGNHSQRNPESRPPSVFSLGPRNFDTNPAALDSFSRPSSGPRLAPI 328
            ++L  N S G  +  T   R  ++ I++E R  L ++ T+RPFTPQ + R LFG  S R  + RPPS FSL  R+F+    A D  SRP SG RL+P+
Sbjct:    4 MELQQNKSDG-VYMSTGHRRQTSAEIVSEARRSLRSLATQRPFTPQEKNRQLFGESSSRARDGRPPSAFSLHARHFE----APD--SRPGSGTRLSPL 94          
BLAST of Armadillo repeat-containing protein 2 vs. Ensembl Xenopus
Match: ARMC2 (armadillo repeat containing 2 [Source:NCBI gene;Acc:100496180])

HSP 1 Score: 270.011 bits (689), Expect = 3.198e-77
Identity = 191/629 (30.37%), Postives = 336/629 (53.42%), Query Frame = 2
Query:  971 TLAPI---LDILSAPVEFRKQNSTEDFINLTKLLYSKLDEKGLLGKHCAFRSDILKAVFKVLDSTNPILVISAAKIILSMIVRDVNLLNICKLIFRVSKNKNNDKIFEEFEMANILIQTLSSVKPDQSHAALLYLMCTLKFLSKPEKSVGSENLSKNIISNSLINAGLLPSISNLLQKCSKINENEHCVNNSFADFIIQCFSCLINLESNPNISRKYFIQNQIPVVTVLTIQQYHHNNDLIFEAFRLLSRLTQYSDCCQLIEPKLSEFCPLCLNLMLNSRNDH-----LILRIAYIIGDMLTKSEEARLTLFPDKFSLDSFLKVFQVFIQKFQCCDENINKMSGDSME-KDSASVDDIIVKLLRVIANAAITESVGRMICHNKSCXXXXXXXXXXXXXXDKEELLTISISALNNISFYMTSANNPEIKNNHLKIIEALYKIIANKYGKDHLGGII---RVLGNLSRETYMRDWIVDNQLVEFLITILDSDNQDTIFFTVGVILNLMTDQNKRHLLLELNGITKLIEVLRDFASRDWQLAGLVCQTFWNYTEIISTTTEAILGGEENAEELLQLLTLFTDSDEVDNIHLNHYSDISTLDYLKNSWKSDFLPVAADLISRLELKMNRFEPL 2821
            T AP+   + +LS P   + + + +D  +L   L+  L+E+ +LGK C +R  +LK +FK++D  +  L I  AK+ILS+ V   NLLNICKLIF++S+++NND +F+  E+ + L++ L S     +  A LY M ++KFLS               I N L+    +  +  L+++ ++ ++     + + +  ++Q  + L NL        K+   N +P +  L ++ Y  + D+     R+LS+L+ Y+DCC  +       C  C +L L+  N+H     L++RI + +G++  K+ + R   + ++ S+ + L++  V+ +      ++I      +ME K  +  +D+++KL+R +AN  I  +VG  +  N+ C+ LL+ ++  K I + EEL+  + + +NN+SFY    +   I    L+I + L+K++      +++ GI+   RV GNLSR   +R ++++  + +F + +LDS +Q+  F   GV++NL  + + R LL E   + K+I+ LRDFAS DWQLAGL+CQ  WN+ E +    E     +E    L  L  L  +   +DN  LN        +Y K  W+ +F PVA  L+ RL+   +  EPL
Sbjct:  130 THAPLKIRMFVLSPP---KPEKNLDDLCSLCVKLHKVLEEENMLGKRCKWRVVLLKTLFKLVDLGSDKLGIILAKLILSLKVSGRNLLNICKLIFKISRSENNDCLFQNDEIIDSLLEILQSEDVQTNSEAFLYCMGSIKFLS-----------GNTAILNDLLRKQAVEILVKLMKEVTRSSKFAETASANMSHLLVQVTATLRNLADLSQSRVKFLASNALPELCTL-LEHYVWDKDICTNVSRILSKLSVYNDCCMALAD-----CLQCYSLFLSVLNNHPEKQDLVVRIVFTLGNLTAKNNKTREMFYEEQGSIKTILRLLHVYYELDIKASQSIAIQQEKTMELKKPSETEDVLIKLIRALANLCIHPTVGAELAANRDCIALLMQILEYKSIDECEELVINTAATVNNLSFYQD--DTSVITKKKLEISKLLFKLLLC----NNMDGILEAARVFGNLSRYQDVRSFMMEKDVYKFFVALLDSKHQEVCFSACGVLINLTAEHSNRVLLQEEGAVEKMIDCLRDFASSDWQLAGLLCQALWNFHENLE-YAEPCFAAQEAVSLLELLAYLLDEQTALDN-RLNE----ELTEYHKACWEVEFKPVAFQLLERLKRHHSCLEPL 726          

HSP 2 Score: 72.0182 bits (175), Expect = 3.982e-12
Identity = 38/101 (37.62%), Postives = 58/101 (57.43%), Query Frame = 2
Query:   44 NSNGSKGRAFYETPVD-RPIASSIINETRTWLNTVQTKRPFTPQTETRSLFGNHSQRNPESRPPSVFSLGPRNFDTNPAALDSFSRPSSGPRLAPINKITL 343
            +S+      FY+     +  ++ IINE R  L T++T+RPFTP+ + R LFG  S R  ++RPPS FSL   +F++        SRP SG RL P+  +++
Sbjct:    3 HSHAKNAEPFYKPRTSAKKTSAEIINEARNSLRTLRTQRPFTPREDQRKLFGPTSSRTSDNRPPSAFSLHSCSFESPD------SRPVSGARLNPLPHVSI 97          
BLAST of Armadillo repeat-containing protein 2 vs. Ensembl Xenopus
Match: ARMC2 (armadillo repeat containing 2 [Source:NCBI gene;Acc:100496180])

HSP 1 Score: 270.011 bits (689), Expect = 3.822e-77
Identity = 191/629 (30.37%), Postives = 336/629 (53.42%), Query Frame = 2
Query:  971 TLAPI---LDILSAPVEFRKQNSTEDFINLTKLLYSKLDEKGLLGKHCAFRSDILKAVFKVLDSTNPILVISAAKIILSMIVRDVNLLNICKLIFRVSKNKNNDKIFEEFEMANILIQTLSSVKPDQSHAALLYLMCTLKFLSKPEKSVGSENLSKNIISNSLINAGLLPSISNLLQKCSKINENEHCVNNSFADFIIQCFSCLINLESNPNISRKYFIQNQIPVVTVLTIQQYHHNNDLIFEAFRLLSRLTQYSDCCQLIEPKLSEFCPLCLNLMLNSRNDH-----LILRIAYIIGDMLTKSEEARLTLFPDKFSLDSFLKVFQVFIQKFQCCDENINKMSGDSME-KDSASVDDIIVKLLRVIANAAITESVGRMICHNKSCXXXXXXXXXXXXXXDKEELLTISISALNNISFYMTSANNPEIKNNHLKIIEALYKIIANKYGKDHLGGII---RVLGNLSRETYMRDWIVDNQLVEFLITILDSDNQDTIFFTVGVILNLMTDQNKRHLLLELNGITKLIEVLRDFASRDWQLAGLVCQTFWNYTEIISTTTEAILGGEENAEELLQLLTLFTDSDEVDNIHLNHYSDISTLDYLKNSWKSDFLPVAADLISRLELKMNRFEPL 2821
            T AP+   + +LS P   + + + +D  +L   L+  L+E+ +LGK C +R  +LK +FK++D  +  L I  AK+ILS+ V   NLLNICKLIF++S+++NND +F+  E+ + L++ L S     +  A LY M ++KFLS               I N L+    +  +  L+++ ++ ++     + + +  ++Q  + L NL        K+   N +P +  L ++ Y  + D+     R+LS+L+ Y+DCC  +       C  C +L L+  N+H     L++RI + +G++  K+ + R   + ++ S+ + L++  V+ +      ++I      +ME K  +  +D+++KL+R +AN  I  +VG  +  N+ C+ LL+ ++  K I + EEL+  + + +NN+SFY    +   I    L+I + L+K++      +++ GI+   RV GNLSR   +R ++++  + +F + +LDS +Q+  F   GV++NL  + + R LL E   + K+I+ LRDFAS DWQLAGL+CQ  WN+ E +    E     +E    L  L  L  +   +DN  LN        +Y K  W+ +F PVA  L+ RL+   +  EPL
Sbjct:  131 THAPLKIRMFVLSPP---KPEKNLDDLCSLCVKLHKVLEEENMLGKRCKWRVVLLKTLFKLVDLGSDKLGIILAKLILSLKVSGRNLLNICKLIFKISRSENNDCLFQNDEIIDSLLEILQSEDVQTNSEAFLYCMGSIKFLS-----------GNTAILNDLLRKQAVEILVKLMKEVTRSSKFAETASANMSHLLVQVTATLRNLADLSQSRVKFLASNALPELCTL-LEHYVWDKDICTNVSRILSKLSVYNDCCMALAD-----CLQCYSLFLSVLNNHPEKQDLVVRIVFTLGNLTAKNNKTREMFYEEQGSIKTILRLLHVYYELDIKASQSIAIQQEKTMELKKPSETEDVLIKLIRALANLCIHPTVGAELAANRDCIALLMQILEYKSIDECEELVINTAATVNNLSFYQD--DTSVITKKKLEISKLLFKLLLC----NNMDGILEAARVFGNLSRYQDVRSFMMEKDVYKFFVALLDSKHQEVCFSACGVLINLTAEHSNRVLLQEEGAVEKMIDCLRDFASSDWQLAGLLCQALWNFHENLE-YAEPCFAAQEAVSLLELLAYLLDEQTALDN-RLNE----ELTEYHKACWEVEFKPVAFQLLERLKRHHSCLEPL 727          

HSP 2 Score: 73.559 bits (179), Expect = 1.192e-12
Identity = 39/99 (39.39%), Postives = 58/99 (58.59%), Query Frame = 2
Query:   50 NGSKGRAFYETPVD-RPIASSIINETRTWLNTVQTKRPFTPQTETRSLFGNHSQRNPESRPPSVFSLGPRNFDTNPAALDSFSRPSSGPRLAPINKITL 343
            N  + R FY+     +  ++ IINE R  L T++T+RPFTP+ + R LFG  S R  ++RPPS FSL   +F++        SRP SG RL P+  +++
Sbjct:    6 NDCQNRPFYKPRTSAKKTSAEIINEARNSLRTLRTQRPFTPREDQRKLFGPTSSRTSDNRPPSAFSLHSCSFESPD------SRPVSGARLNPLPHVSI 98          
BLAST of Armadillo repeat-containing protein 2 vs. Ensembl Xenopus
Match: ARMC2 (armadillo repeat containing 2 [Source:NCBI gene;Acc:100496180])

HSP 1 Score: 266.159 bits (679), Expect = 6.685e-77
Identity = 188/619 (30.37%), Postives = 331/619 (53.47%), Query Frame = 2
Query:  992 ILSAPVEFRKQNSTEDFINLTKLLYSKLDEKGLLGKHCAFRSDILKAVFKVLDSTNPILVISAAKIILSMIVRDVNLLNICKLIFRVSKNKNNDKIFEEFEMANILIQTLSSVKPDQSHAALLYLMCTLKFLSKPEKSVGSENLSKNIISNSLINAGLLPSISNLLQKCSKINENEHCVNNSFADFIIQCFSCLINLESNPNISRKYFIQNQIPVVTVLTIQQYHHNNDLIFEAFRLLSRLTQYSDCCQLIEPKLSEFCPLCLNLMLNSRNDH-----LILRIAYIIGDMLTKSEEARLTLFPDKFSLDSFLKVFQVFIQKFQCCDENINKMSGDSME-KDSASVDDIIVKLLRVIANAAITESVGRMICHNKSCXXXXXXXXXXXXXXDKEELLTISISALNNISFYMTSANNPEIKNNHLKIIEALYKIIANKYGKDHLGGII---RVLGNLSRETYMRDWIVDNQLVEFLITILDSDNQDTIFFTVGVILNLMTDQNKRHLLLELNGITKLIEVLRDFASRDWQLAGLVCQTFWNYTEIISTTTEAILGGEENAEELLQLLTLFTDSDEVDNIHLNHYSDISTLDYLKNSWKSDFLPVAADLISRLELKMNRFEPL 2821
            +LS P   + + + +D  +L   L+  L+E+ +LGK C +R  +LK +FK++D  +  L I  AK+ILS+ V   NLLNICKLIF++S+++NND +F+  E+ + L++ L S     +  A LY M ++KFLS               I N L+    +  +  L+++ ++ ++     + + +  ++Q  + L NL        K+   N +P +  L ++ Y  + D+     R+LS+L+ Y+DCC  +       C  C +L L+  N+H     L++RI + +G++  K+ + R   + ++ S+ + L++  V+ +      ++I      +ME K  +  +D+++KL+R +AN  I  +VG  +  N+ C+ LL+ ++  K I + EEL+  + + +NN+SFY    +   I    L+I + L+K++      +++ GI+   RV GNLSR   +R ++++  + +F + +LDS +Q+  F   GV++NL  + + R LL E   + K+I+ LRDFAS DWQLAGL+CQ  WN+ E +    E     +E    L  L  L  +   +DN  LN        +Y K  W+ +F PVA  L+ RL+   +  EPL
Sbjct:   17 VLSPP---KPEKNLDDLCSLCVKLHKVLEEENMLGKRCKWRVVLLKTLFKLVDLGSDKLGIILAKLILSLKVSGRNLLNICKLIFKISRSENNDCLFQNDEIIDSLLEILQSEDVQTNSEAFLYCMGSIKFLS-----------GNTAILNDLLRKQAVEILVKLMKEVTRSSKFAETASANMSHLLVQVTATLRNLADLSQSRVKFLASNALPELCTL-LEHYVWDKDICTNVSRILSKLSVYNDCCMALAD-----CLQCYSLFLSVLNNHPEKQDLVVRIVFTLGNLTAKNNKTREMFYEEQGSIKTILRLLHVYYELDIKASQSIAIQQEKTMELKKPSETEDVLIKLIRALANLCIHPTVGAELAANRDCIALLMQILEYKSIDECEELVINTAATVNNLSFYQD--DTSVITKKKLEISKLLFKLLLC----NNMDGILEAARVFGNLSRYQDVRSFMMEKDVYKFFVALLDSKHQEVCFSACGVLINLTAEHSNRVLLQEEGAVEKMIDCLRDFASSDWQLAGLLCQALWNFHENLE-YAEPCFAAQEAVSLLELLAYLLDEQTALDN-RLNE----ELTEYHKACWEVEFKPVAFQLLERLKRHHSCLEPL 603          
BLAST of Armadillo repeat-containing protein 2 vs. Ensembl Mouse
Match: Armc2 (armadillo repeat containing 2 [Source:MGI Symbol;Acc:MGI:1916449])

HSP 1 Score: 270.396 bits (690), Expect = 1.690e-76
Identity = 199/639 (31.14%), Postives = 341/639 (53.36%), Query Frame = 2
Query:  917 NKFSSNSQSDD---QDIFFKDTLAPILDILSAPVEFRKQNSTEDFINLTKLLYSKLDEKGLLGKHCAFRSDILKAVFKVLDSTNPILVISAAKIILSMIVRDVNLLNICKLIFRVSKNKNNDKIFEEFEMANILIQTLSSVKPDQSHAALLYLMCTLKFLSKPEKSVGSENLSKNIISNSLINAGLLPSISNLLQKCSKINENEHCVNNSFADFIIQCFSCLINLESNPNISRKYFIQNQIPVVTVLTIQQYHHNNDLIFEAFRLLSRLTQYSDCCQLIEPKLSEFCPLCLNLM-LNSRNDHLILRIAYIIGDMLTKSEEARLTLFPDKFSLDSFLKVFQVFIQKFQCCDENINKMSGDSMEKDSASVDDIIVKLLRVIANAAITESVGRMICHNKSCXXXXXXXXXXXXXXDKEELLTISISALNNISFYMTSANNPEIKNNHLKIIEALYKIIANKYGKDHLGGIIRVLGNLSRETYMRDWIVDNQLVEFLITILDSDNQDTIFFTVGVILNLMTDQNKRHLLLELNGITKLIEVLRDFASRDWQLAGLVCQTFWNYTEIISTTTEAILGGEENAEELLQLLTLFTDSDEVDNIHLNHYSDISTLDYLKNSWKSDFLPVAADLISRLELKMNRFEPL 2821
            ++ SS  Q  D    ++F+K  + PIL  L        +   E+       L+  L+E  +LGK    R+ +LKA++K++D+ +  L +  AK+IL++ V   NLLN+CKLIF++S+N+ ND + +E  +   L++ L + +   +  A LY M  LKF+S      GS           ++N G +  ++ L+++ ++  E            ++Q  + L NL  +P    K       P +  + ++Q+  + D+     R+ S+LT Y DCC  +    S    L L+L+    +N  L++RI +I+G++  KS +AR     +  S+++ L +FQ F        EN  K+   S  K  A  +D++VKL RV+AN AI   +G ++  N   + LLL  + SK + D EEL+  +I+A+NN+SFY   ++   +++  L + E L +++ +    + +   +RV GNLS++  + ++++   + +F+IT+L++ +QD  F   GV+LNL  D+ KR +L E  GI KL++ LRDF   DWQLA LVC+T WN++E I+  +E    G++ A  LL LL+ F D    + + LN   D     Y +  W+++F PVA  L+ R++   +  EPL
Sbjct:  244 SRASSQEQETDTEVDEVFWKARIVPILHELEN------EEDIEEMCAACTQLHRTLEEARMLGKKFKRRTVLLKALYKLVDADSDPLSLKLAKLILALKVSGKNLLNVCKLIFKISRNEKNDTLMQEDNILESLLEVLRAEELQSNTEAFLYCMGALKFVS------GSPGFL-----TEMVNKGAVEILAQLIKEMTEDTEKHGVCLPDSGHLLVQTTATLRNLVDSPLTRSKLLNMGAFPHLCTV-MEQHADDKDICTNIARIFSKLTSYRDCCAALA-SYSRCYALFLSLLNKYQKNQDLVIRIVFILGNLTAKSNQARELFSRETGSVETLLTLFQSFYHH----KENSPKLQL-SEAKPQAEAEDVLVKLTRVLANIAIHPRIGPVLAANPRVVGLLLRTLESKSLGDCEELVINTIAAINNLSFYQVKSS--VLQHRKLYVAELLLRLLVSN-NMERILEAVRVFGNLSQDHDVCNFLMQKNVHKFMITLLEAKHQDICFSACGVLLNLTVDKEKRAILKEGGGIKKLVDCLRDFGPSDWQLACLVCKTLWNFSENITNASECF--GDDVANTLLILLSTFLD----EELALNGSFDQDLESYHRLHWETEFKPVAQQLLQRIQSHHSLLEPL 849          

HSP 2 Score: 77.7962 bits (190), Expect = 4.734e-14
Identity = 46/97 (47.42%), Postives = 60/97 (61.86%), Query Frame = 2
Query:   68 AFYETPVDRPIASS-IINETRTWLNTVQTKRPFTPQTETRSLFGNHSQRNPESRPPSVFSLGPRNFDTNPAALDSFSRPSSGPRLAPINKITLKDKA 355
            +FY  PV +   S+ II+E R  L TV+T+RPFTP+ + R LFG  S R+PE+RPPS FSL   +F+       S S+P SG RL P+    LK KA
Sbjct:   14 SFYRPPVSKQRTSAEIISEARNALRTVRTQRPFTPREDQRKLFGPASSRSPENRPPSSFSLHASSFEL------SDSKPISGTRLRPLE---LKPKA 101          
BLAST of Armadillo repeat-containing protein 2 vs. Ensembl Mouse
Match: Armc2 (armadillo repeat containing 2 [Source:MGI Symbol;Acc:MGI:1916449])

HSP 1 Score: 270.396 bits (690), Expect = 1.690e-76
Identity = 199/639 (31.14%), Postives = 341/639 (53.36%), Query Frame = 2
Query:  917 NKFSSNSQSDD---QDIFFKDTLAPILDILSAPVEFRKQNSTEDFINLTKLLYSKLDEKGLLGKHCAFRSDILKAVFKVLDSTNPILVISAAKIILSMIVRDVNLLNICKLIFRVSKNKNNDKIFEEFEMANILIQTLSSVKPDQSHAALLYLMCTLKFLSKPEKSVGSENLSKNIISNSLINAGLLPSISNLLQKCSKINENEHCVNNSFADFIIQCFSCLINLESNPNISRKYFIQNQIPVVTVLTIQQYHHNNDLIFEAFRLLSRLTQYSDCCQLIEPKLSEFCPLCLNLM-LNSRNDHLILRIAYIIGDMLTKSEEARLTLFPDKFSLDSFLKVFQVFIQKFQCCDENINKMSGDSMEKDSASVDDIIVKLLRVIANAAITESVGRMICHNKSCXXXXXXXXXXXXXXDKEELLTISISALNNISFYMTSANNPEIKNNHLKIIEALYKIIANKYGKDHLGGIIRVLGNLSRETYMRDWIVDNQLVEFLITILDSDNQDTIFFTVGVILNLMTDQNKRHLLLELNGITKLIEVLRDFASRDWQLAGLVCQTFWNYTEIISTTTEAILGGEENAEELLQLLTLFTDSDEVDNIHLNHYSDISTLDYLKNSWKSDFLPVAADLISRLELKMNRFEPL 2821
            ++ SS  Q  D    ++F+K  + PIL  L        +   E+       L+  L+E  +LGK    R+ +LKA++K++D+ +  L +  AK+IL++ V   NLLN+CKLIF++S+N+ ND + +E  +   L++ L + +   +  A LY M  LKF+S      GS           ++N G +  ++ L+++ ++  E            ++Q  + L NL  +P    K       P +  + ++Q+  + D+     R+ S+LT Y DCC  +    S    L L+L+    +N  L++RI +I+G++  KS +AR     +  S+++ L +FQ F        EN  K+   S  K  A  +D++VKL RV+AN AI   +G ++  N   + LLL  + SK + D EEL+  +I+A+NN+SFY   ++   +++  L + E L +++ +    + +   +RV GNLS++  + ++++   + +F+IT+L++ +QD  F   GV+LNL  D+ KR +L E  GI KL++ LRDF   DWQLA LVC+T WN++E I+  +E    G++ A  LL LL+ F D    + + LN   D     Y +  W+++F PVA  L+ R++   +  EPL
Sbjct:  244 SRASSQEQETDTEVDEVFWKARIVPILHELEN------EEDIEEMCAACTQLHRTLEEARMLGKKFKRRTVLLKALYKLVDADSDPLSLKLAKLILALKVSGKNLLNVCKLIFKISRNEKNDTLMQEDNILESLLEVLRAEELQSNTEAFLYCMGALKFVS------GSPGFL-----TEMVNKGAVEILAQLIKEMTEDTEKHGVCLPDSGHLLVQTTATLRNLVDSPLTRSKLLNMGAFPHLCTV-MEQHADDKDICTNIARIFSKLTSYRDCCAALA-SYSRCYALFLSLLNKYQKNQDLVIRIVFILGNLTAKSNQARELFSRETGSVETLLTLFQSFYHH----KENSPKLQL-SEAKPQAEAEDVLVKLTRVLANIAIHPRIGPVLAANPRVVGLLLRTLESKSLGDCEELVINTIAAINNLSFYQVKSS--VLQHRKLYVAELLLRLLVSN-NMERILEAVRVFGNLSQDHDVCNFLMQKNVHKFMITLLEAKHQDICFSACGVLLNLTVDKEKRAILKEGGGIKKLVDCLRDFGPSDWQLACLVCKTLWNFSENITNASECF--GDDVANTLLILLSTFLD----EELALNGSFDQDLESYHRLHWETEFKPVAQQLLQRIQSHHSLLEPL 849          

HSP 2 Score: 77.7962 bits (190), Expect = 4.734e-14
Identity = 46/97 (47.42%), Postives = 60/97 (61.86%), Query Frame = 2
Query:   68 AFYETPVDRPIASS-IINETRTWLNTVQTKRPFTPQTETRSLFGNHSQRNPESRPPSVFSLGPRNFDTNPAALDSFSRPSSGPRLAPINKITLKDKA 355
            +FY  PV +   S+ II+E R  L TV+T+RPFTP+ + R LFG  S R+PE+RPPS FSL   +F+       S S+P SG RL P+    LK KA
Sbjct:   14 SFYRPPVSKQRTSAEIISEARNALRTVRTQRPFTPREDQRKLFGPASSRSPENRPPSSFSLHASSFEL------SDSKPISGTRLRPLE---LKPKA 101          
BLAST of Armadillo repeat-containing protein 2 vs. Ensembl Mouse
Match: Armc2 (armadillo repeat containing 2 [Source:MGI Symbol;Acc:MGI:1916449])

HSP 1 Score: 69.707 bits (169), Expect = 2.172e-13
Identity = 46/97 (47.42%), Postives = 60/97 (61.86%), Query Frame = 2
Query:   68 AFYETPVDRPIASS-IINETRTWLNTVQTKRPFTPQTETRSLFGNHSQRNPESRPPSVFSLGPRNFDTNPAALDSFSRPSSGPRLAPINKITLKDKA 355
            +FY  PV +   S+ II+E R  L TV+T+RPFTP+ + R LFG  S R+PE+RPPS FSL   +F+       S S+P SG RL P+    LK KA
Sbjct:   14 SFYRPPVSKQRTSAEIISEARNALRTVRTQRPFTPREDQRKLFGPASSRSPENRPPSSFSLHASSFEL------SDSKPISGTRLRPLE---LKPKA 101          
BLAST of Armadillo repeat-containing protein 2 vs. Ensembl Mouse
Match: Armc2 (armadillo repeat containing 2 [Source:MGI Symbol;Acc:MGI:1916449])

HSP 1 Score: 58.151 bits (139), Expect = 5.905e-10
Identity = 35/71 (49.30%), Postives = 46/71 (64.79%), Query Frame = 2
Query:   41 LNSNGSKGR---AFYETPVDRPIASS-IINETRTWLNTVQTKRPFTPQTETRSLFGNHSQRNPESRPPSVF 241
            L+SN  K     +FY  PV +   S+ II+E R  L TV+T+RPFTP+ + R LFG  S R+PE+RPPS F
Sbjct:    2 LSSNDQKLEKLDSFYRPPVSKQRTSAEIISEARNALRTVRTQRPFTPREDQRKLFGPASSRSPENRPPSSF 72          
BLAST of Armadillo repeat-containing protein 2 vs. Ensembl Mouse
Match: Armc2 (armadillo repeat containing 2 [Source:MGI Symbol;Acc:MGI:1916449])

HSP 1 Score: 58.151 bits (139), Expect = 5.905e-10
Identity = 35/71 (49.30%), Postives = 46/71 (64.79%), Query Frame = 2
Query:   41 LNSNGSKGR---AFYETPVDRPIASS-IINETRTWLNTVQTKRPFTPQTETRSLFGNHSQRNPESRPPSVF 241
            L+SN  K     +FY  PV +   S+ II+E R  L TV+T+RPFTP+ + R LFG  S R+PE+RPPS F
Sbjct:    2 LSSNDQKLEKLDSFYRPPVSKQRTSAEIISEARNALRTVRTQRPFTPREDQRKLFGPASSRSPENRPPSSF 72          
BLAST of Armadillo repeat-containing protein 2 vs. UniProt/SwissProt
Match: sp|P0C6R2|ARMC2_BOVIN (Armadillo repeat-containing protein 2 OS=Bos taurus OX=9913 GN=ARMC2 PE=3 SV=1)

HSP 1 Score: 280.026 bits (715), Expect = 6.684e-79
Identity = 214/676 (31.66%), Postives = 350/676 (51.78%), Query Frame = 2
Query:  833 QSRHDCSEESETPRPQKNGSGEIDKSLKNKFSSNSQSDDQDIFFKDTLAPILDILSAPVEFRKQNSTEDFINLTKLLYSKLDEKGLLGKHCAFRSDILKAVFKVLDSTNPILVISAAKIILSMIVRDVNLLNICKLIFRVSKNKNNDKIFEEFEMANILIQTLSSVKPDQSHAALLYLMCTLKFLSK-PEKSVGSENLSKNIISNSLINAGLLPSISNLLQKCSKINENEH----CVNNSFADFIIQCFSCLINLESNPNISRKYFIQNQIPVVTVLTIQQYHHNNDLIFEAFRLLSRLTQYSDCCQLIEPKLSEFCPLCLNLM-LNSRNDHLILRIAYIIGDMLTKSEEARLTLFPDKFSLDSFLKVFQVFIQKFQCCDENINKMSGDSMEKDSA----SVDDIIVKLLRVIANAAITESVGRMICHNKSCXXXXXXXXXXXXXXDKEELLTISISALNNISFYMTSANNPEIKNNHLKIIEALYKIIANKYGKDHLGGI---IRVLGNLSRETYMRDWIVDNQLVEFLITILDSDNQDTIFFTVGVILNLMTDQNKRHLLLELNGITKLIEVLRDFASRDWQLAGLVCQTFWNYTEIISTTTEAILGGEENAEELLQLLTLFTDSDEVDNIHLNHYSDISTLDYLKNSWKSDFLPVAADLISRLELKMNRFEPL 2821
            QSR D    S+    +KN   E+D                ++F+   + PIL       +  K+ + E        L+  L+E  +LG     RS +LK ++K++D  + +L +  AKIIL++ V   NLLN+CKLIF++S+++ ND +     +   L++ L S     +  A LY M T+KF+S  PE              + ++  G +  + +L+++   +NEN      C+ NS    ++Q  + L NL  +P    K    N +P +  + ++Q+  + D+     R+ S+LT Y DCC  +    S    L LNL+    +   L++R+ +I+G++  K+ +AR     +K S+ + L +F  F +     D +  K  G+  E+  A      +D+++KL RV+AN AI   VG  I  +   + LLL+ + SK I D EEL+  + + +NN+S+Y     N  I++  L I E L K++ +    +++ GI   +RV GNLS++  + D+IV   + +F+I +LD+ +QD  F   GV+LNL  D++KR +L E  GI KL++ LRDF   DWQLA LVC+T WN++E I  T  A   G+E A  LL LL+ F D    + + LN   D    +Y K  W+++F PVA  L++R++      EPL
Sbjct:  241 QSRLDIRAGSKADLQEKNTEIEVD----------------EVFWNTRIVPILH------DLEKEENIEMVCATCTQLHHALEEGNMLGNKFKRRSVLLKTLYKLVDVGSDLLSLKLAKIILALKVSGKNLLNVCKLIFKISRSEKNDSLIRNDSILESLLEVLRSEDLQANTEAFLYCMGTIKFISGNPE------------FLHEMMGKGAVEILMSLIKQ---VNENTKKSGTCLPNS-GHLLVQMTATLRNLVDSPLARSKLLSINALPQLCTV-MEQHIGDKDVCTNIARIFSKLTSYHDCCVALA-SYSRCYALFLNLINKYQKKQDLVVRVVFILGNLTAKNNQAREQFSKEKGSIPTLLSLFHTFYK----LDLHSGKRWGEGDERPEARRPAQAEDVLIKLTRVLANLAIHPGVGPAIAAHSHIVGLLLATLESKSIDDCEELVINTTATINNLSYY--KVKNSIIQDRKLYIAELLLKLLVS----NNMDGILEAVRVFGNLSQDHDICDFIVQKNVHKFMIALLDAKHQDICFSACGVLLNLTVDRDKRLILKEGGGIKKLVDCLRDFGPTDWQLASLVCKTLWNFSENI--TNAASCFGDEAANTLLALLSSFLD----EELALNGSFDQDLKNYHKLHWETEFRPVAQQLLNRIKNHHTFLEPL 860          

HSP 2 Score: 72.4034 bits (176), Expect = 1.807e-11
Identity = 36/76 (47.37%), Postives = 50/76 (65.79%), Query Frame = 2
Query:  101 ASSIINETRTWLNTVQTKRPFTPQTETRSLFGNHSQRNPESRPPSVFSLGPRNFDTNPAALDSFSRPSSGPRLAPI 328
            ++ I++E R  L TV+T+RPFTP+ + R LFG  S R PE+RPPS FS+   +F+       S SRP SG RL+P+
Sbjct:   26 SAEIVSEARNALRTVRTQRPFTPREDQRKLFGPASSRTPENRPPSSFSVHASSFEF------SDSRPISGTRLSPL 95          
BLAST of Armadillo repeat-containing protein 2 vs. UniProt/SwissProt
Match: sp|Q3URY6|ARMC2_MOUSE (Armadillo repeat-containing protein 2 OS=Mus musculus OX=10090 GN=Armc2 PE=2 SV=3)

HSP 1 Score: 270.396 bits (690), Expect = 1.182e-75
Identity = 199/639 (31.14%), Postives = 341/639 (53.36%), Query Frame = 2
Query:  917 NKFSSNSQSDD---QDIFFKDTLAPILDILSAPVEFRKQNSTEDFINLTKLLYSKLDEKGLLGKHCAFRSDILKAVFKVLDSTNPILVISAAKIILSMIVRDVNLLNICKLIFRVSKNKNNDKIFEEFEMANILIQTLSSVKPDQSHAALLYLMCTLKFLSKPEKSVGSENLSKNIISNSLINAGLLPSISNLLQKCSKINENEHCVNNSFADFIIQCFSCLINLESNPNISRKYFIQNQIPVVTVLTIQQYHHNNDLIFEAFRLLSRLTQYSDCCQLIEPKLSEFCPLCLNLM-LNSRNDHLILRIAYIIGDMLTKSEEARLTLFPDKFSLDSFLKVFQVFIQKFQCCDENINKMSGDSMEKDSASVDDIIVKLLRVIANAAITESVGRMICHNKSCXXXXXXXXXXXXXXDKEELLTISISALNNISFYMTSANNPEIKNNHLKIIEALYKIIANKYGKDHLGGIIRVLGNLSRETYMRDWIVDNQLVEFLITILDSDNQDTIFFTVGVILNLMTDQNKRHLLLELNGITKLIEVLRDFASRDWQLAGLVCQTFWNYTEIISTTTEAILGGEENAEELLQLLTLFTDSDEVDNIHLNHYSDISTLDYLKNSWKSDFLPVAADLISRLELKMNRFEPL 2821
            ++ SS  Q  D    ++F+K  + PIL  L        +   E+       L+  L+E  +LGK    R+ +LKA++K++D+ +  L +  AK+IL++ V   NLLN+CKLIF++S+N+ ND + +E  +   L++ L + +   +  A LY M  LKF+S      GS           ++N G +  ++ L+++ ++  E            ++Q  + L NL  +P    K       P +  + ++Q+  + D+     R+ S+LT Y DCC  +    S    L L+L+    +N  L++RI +I+G++  KS +AR     +  S+++ L +FQ F        EN  K+   S  K  A  +D++VKL RV+AN AI   +G ++  N   + LLL  + SK + D EEL+  +I+A+NN+SFY   ++   +++  L + E L +++ +    + +   +RV GNLS++  + ++++   + +F+IT+L++ +QD  F   GV+LNL  D+ KR +L E  GI KL++ LRDF   DWQLA LVC+T WN++E I+  +E    G++ A  LL LL+ F D    + + LN   D     Y +  W+++F PVA  L+ R++   +  EPL
Sbjct:  244 SRASSQEQETDTEVDEVFWKARIVPILHELEN------EEDIEEMCAACTQLHRTLEEARMLGKKFKRRTVLLKALYKLVDADSDPLSLKLAKLILALKVSGKNLLNVCKLIFKISRNEKNDTLMQEDNILESLLEVLRAEELQSNTEAFLYCMGALKFVS------GSPGFL-----TEMVNKGAVEILAQLIKEMTEDTEKHGVCLPDSGHLLVQTTATLRNLVDSPLTRSKLLNMGAFPHLCTV-MEQHADDKDICTNIARIFSKLTSYRDCCAALA-SYSRCYALFLSLLNKYQKNQDLVIRIVFILGNLTAKSNQARELFSRETGSVETLLTLFQSFYHH----KENSPKLQL-SEAKPQAEAEDVLVKLTRVLANIAIHPRIGPVLAANPRVVGLLLRTLESKSLGDCEELVINTIAAINNLSFYQVKSS--VLQHRKLYVAELLLRLLVSN-NMERILEAVRVFGNLSQDHDVCNFLMQKNVHKFMITLLEAKHQDICFSACGVLLNLTVDKEKRAILKEGGGIKKLVDCLRDFGPSDWQLACLVCKTLWNFSENITNASECF--GDDVANTLLILLSTFLD----EELALNGSFDQDLESYHRLHWETEFKPVAQQLLQRIQSHHSLLEPL 849          

HSP 2 Score: 77.7962 bits (190), Expect = 3.311e-13
Identity = 46/97 (47.42%), Postives = 60/97 (61.86%), Query Frame = 2
Query:   68 AFYETPVDRPIASS-IINETRTWLNTVQTKRPFTPQTETRSLFGNHSQRNPESRPPSVFSLGPRNFDTNPAALDSFSRPSSGPRLAPINKITLKDKA 355
            +FY  PV +   S+ II+E R  L TV+T+RPFTP+ + R LFG  S R+PE+RPPS FSL   +F+       S S+P SG RL P+    LK KA
Sbjct:   14 SFYRPPVSKQRTSAEIISEARNALRTVRTQRPFTPREDQRKLFGPASSRSPENRPPSSFSLHASSFEL------SDSKPISGTRLRPLE---LKPKA 101          
BLAST of Armadillo repeat-containing protein 2 vs. UniProt/SwissProt
Match: sp|Q8NEN0|ARMC2_HUMAN (Armadillo repeat-containing protein 2 OS=Homo sapiens OX=9606 GN=ARMC2 PE=1 SV=4)

HSP 1 Score: 267.314 bits (682), Expect = 1.597e-74
Identity = 204/636 (32.08%), Postives = 337/636 (52.99%), Query Frame = 2
Query:  953 DIFFKDTLAPILDILSAPVEFRKQNSTEDFINLTKLLYSKLDEKGLLGKHCAFRSDILKAVFKVLDSTNPILVISAAKIILSMIVRDVNLLNICKLIFRVSKNKNNDKIFEEFEMANILIQTLSSVKPDQSHAALLYLMCTLKFLSKPEKSVGSENLSKNIISNSLINAGLLPSISNLLQKCSKINEN-EHC---VNNSFADFIIQCFSCLINLESNPNISRKYFIQNQIPVVTVLTIQQYHHNNDLIFEAFRLLSRLTQYSDCCQLIEPKLSEFCPLCLNLM-LNSRNDHLILRIAYIIGDMLTKSEEARLTLFPDKFSLDSFLKVFQVFIQKFQCCDENINKMSGDSMEKDSAS-----VDDIIVKLLRVIANAAITESVGRMICHNKSCXXXXXXXXXXXXXXDKEELLTISISALNNISFYMTSANNPEIKNNHLKIIEALYKIIANKYGKDHLGGI---IRVLGNLSRETYMRDWIVDNQLVEFLITILDSDNQDTIFFTVGVILNLMTDQNKRHLLLELNGITKLIEVLRDFASRDWQLAGLVCQTFWNYTEIISTTTEAILGGEENAEELLQLLTLFTDSDEVDNIHLNHYSDISTLDYLKNSWKSDFLPVAADLISRLELKMNRFEPL 2821
            ++F+   + PIL       E  K+ + E        L+  L+E  +LG     RS +LK + K++D  +  L +  AKIIL++ V   NLLN+CKLIF++S+N+ ND + +   +   L++ L S     +  A LY M ++KF+S         NL      N +I+ G +  + NL+++   INEN + C   + NS    ++Q  + L NL  +  +  K+   + +P +    ++QY  + D+     R+ S+LT Y DCC  +    S    L LNL+    +   L++R+ +I+G++  K+ +AR     +K S+ + L +FQ F Q     D +  K  G   E+  A       +D+++KL RV+AN AI   VG ++  N   + LLL+ +  K + D EEL+  + + +NN+S+Y     N  I++  L I E L K++ +    +++ GI   +RV GNLS++  + D+IV N +  F++ +LD+ +QD  F   GV+LNL  D++KR +L E  GI KL++ LRD    DWQLA LVC+T WN++E I+  +     G E+   LL LL+ F D +    + L+   D    +Y K  W+++F PVA  L++R++      EPL
Sbjct:  266 EVFWNTRIVPILR------ELEKEENIETVCAACTQLHHALEEGNMLGNKFKGRSILLKTLCKLVDVGSDSLSLKLAKIILALKVSRKNLLNVCKLIFKISRNEKNDSLIQNDSILESLLEVLRSEDLQTNMEAFLYCMGSIKFISG--------NLG---FLNEMISKGAVEILINLIKQ---INENIKKCGTFLPNS-GHLLVQVTATLRNLVDSSLVRSKFLNISALPQLCT-AMEQYKGDKDVCTNIARIFSKLTSYRDCCTALA-SYSRCYALFLNLINKYQKKQDLVVRVVFILGNLTAKNNQAREQFSKEKGSIQTLLSLFQTFHQ----LDLHSQKPVGQRGEQHRAQRPPSEAEDVLIKLTRVLANIAIHPGVGPVLAANPGIVGLLLTTLEYKSLDDCEELVINATATINNLSYYQV--KNSIIQDKKLYIAELLLKLLVS----NNMDGILEAVRVFGNLSQDHDVCDFIVQNNVHRFMMALLDAQHQDICFSACGVLLNLTVDKDKRVILKEGGGIKKLVDCLRDLGPTDWQLACLVCKTLWNFSENITNASSCF--GNEDTNTLLLLLSSFLDEE----LALDGSFDPDLKNYHKLHWETEFKPVAQQLLNRIQRHHTFLEPL 862          

HSP 2 Score: 75.485 bits (184), Expect = 2.165e-12
Identity = 42/87 (48.28%), Postives = 54/87 (62.07%), Query Frame = 2
Query:   71 FYETPVDRPIASS-IINETRTWLNTVQTKRPFTPQTETRSLFGNHSQRNPESRPPSVFSLGPRNFDTNPAALDSFSRPSSGPRLAPI 328
            FY+  V +   S+ II+E R  L TV+T+RPFTPQ   R LFG  S R  E+RPPS FSL   +F++      S SRP SG RL+P+
Sbjct:   15 FYQPSVSKQKTSAEIISEARNALRTVRTQRPFTPQEAQRKLFGPASSRTSENRPPSSFSLHASSFES------SDSRPISGTRLSPL 95          
BLAST of Armadillo repeat-containing protein 2 vs. TrEMBL
Match: A0A267FPF4 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig029829g1 PE=4 SV=1)

HSP 1 Score: 353.984 bits (907), Expect = 1.860e-103
Identity = 234/701 (33.38%), Postives = 377/701 (53.78%), Query Frame = 2
Query:  818 QKARSQSRHDCSEESETPRPQKNGS-----------GEIDKSLKNKFSSNSQSDDQDI-FFKDTLAPILDILSAPVEFRKQNSTEDFINLTKLLYSKLDEKGLLGKHCA-FRSDILKAVFKVLDSTNPILVISAAKIILSMIVRDVNLLNICKLIFRVSKNKNNDKIF--EEFEMANILIQTLSSVKPDQSHAALLYLMCTLKFLSKPEKSVGSENLSKNIISNSLINAGLLPSISNLLQKCSKINENEHC-VNNSFADFIIQCFSCLINLESNPNISRKYFIQNQIPVVTVLTIQQYHHNNDLIFEAFRLLSRLTQYSDCCQLI-----------EPKLSEFCPLCLNLML---NSRNDHLILRIAYIIGDMLTKSEEARLTLFPDKFSLDSFLKVFQVFIQKFQCCDENINKMSGD--SMEKDSASVDDIIVKLLRVIANAAITESVGRMICHNKSCXXXXXXXXXXXXXXDKEELLTISISALNNISFYMTSANNPEIKNNHLKIIEALYKIIANKYGKDHLGGIIRVLGNLSRETYMRDWIVDNQLVEFLITILDSDNQDTIFFTVGVILNLMTDQNKRHLLLELNGITKLIEVLRDFASRDWQLAGLVCQTFWNYTEIISTTTEAILGGEENAEELLQLLTLFTDSDEVDNI-HLNHYSDISTLDYLKNSWKSDFLPVAADLISRLELKMNRFEPL 2821
            Q+  SQ  H  S  S   R Q+NGS           G+  +   +     + S+D +  +F  TLAP +D+LS  V  +   S ++ + L + L+S+L   G+LG++C   RS IL+AVF++LD   P L ++ A + L M V   NL  + KL+FRV+K + ND +F  +   +A I   TL+   P  SH AL+YL   LKFL+      G+  +S+      L+ +G   +++  L +  + N         S A  ++Q    L NL   P   +++             +QQY  + +L   A RLLS+L+Q++D C  +               S   P     +L    SR D L+LR+A+++G++  ++EEAR  +FPDK +LDS L V + + Q+ +              +  +D   V D +VKL+R++ANAAI+  VGRM   +++CL LL++ + SK I D  EL++ S++A+NN+++YM++    ++    L++ +AL  +I  +   D L   IR  GNLSRE  +RDWIV +++ E LIT+LDS + + ++   G++LNL+ D +KR +L +  G+ KLI  L D    DWQLA ++CQ  WN+TE +++  ++  G E+ A+EL+  L LFTD + V+    L   SD  T  +L++ W+SDF  +   L+ RL    ++FEPL
Sbjct:  167 QQRSSQQPHRSSAGS---RVQRNGSVGELPAEDSAAGDPGRRRDSAPQPPAMSEDAETEWFNKTLAPAVDLLS--VAEQTPESADNTLELVRHLHSELQAAGMLGRNCRRHRSRILRAVFRLLDWPQPRLQLALAGLCLDMRVSAGNLACVAKLLFRVAKLEANDALFLAQPGLLAGI-SDTLAGADPAASHEALVYLAGALKFLTG-----GAAGVSRE-----LLRSGCFEALTTCLGRAVEWNRQTGGRAAESLAHVLVQVLGSLRNLAEQPGTRQQFVATPACLAGVCAAMQQYPADYELQLNASRLLSKLSQHADVCAALCSNDDGGGGVGSSGQSALLPSAARELLARHRSRED-LVLRLAFVLGNLAGRAEEARTAMFPDKPALDSVLAVLKFYQQESEAAAAAAASGEASQPAPRRDPGKVRDCLVKLVRLLANAAISAEVGRMCAGSRTCLRLLVTFVESKSIADNRELVSNSVAAINNLTYYMSTELASDMPERMLRVAQALSLLI-QRADTDLLVEAIRPFGNLSREKAVRDWIVTSRIDEVLITLLDS-SHEAVYSAAGILLNLVADPDKRQVLKKDGGVEKLISALTDLGQSDWQLACVICQALWNFTEGMTSCADS-FGSEQTAQELISCLELFTDEEAVEESNRLAAGSDEDTFRHLQDVWESDFAYIGTHLLKRLRRHQSQFEPL 847          

HSP 2 Score: 79.337 bits (194), Expect = 3.818e-11
Identity = 45/101 (44.55%), Postives = 53/101 (52.48%), Query Frame = 2
Query:   71 FYETPVDRPIASSIINETRTWLNTVQTKRPFTPQTETRSLFGNH-----------SQRNPESRPPSVFSLGPRNFDTNPAALDSFSRPSSGP----RLAPI 328
            FYE P  RP ++ II ETRTWL  V+TKRPFTP+   RSLF +                P  RPPS  SLG R F++        SRP SG     RL+PI
Sbjct:   36 FYEAPESRPTSAQIIEETRTWLREVKTKRPFTPRDGERSLFASRQVSADFSEIGAGVAAPVGRPPSAVSLGGRQFESE-------SRPVSGSAVATRLSPI 129          
BLAST of Armadillo repeat-containing protein 2 vs. TrEMBL
Match: A0A1I8HSM5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 354.369 bits (908), Expect = 2.439e-103
Identity = 234/701 (33.38%), Postives = 374/701 (53.35%), Query Frame = 2
Query:  818 QKARSQSRHDCSEESETPRPQKNGS-----------GEIDKSLKNKFSSNSQSDDQDI-FFKDTLAPILDILSAPVEFRKQNSTEDFINLTKLLYSKLDEKGLLGKHCA-FRSDILKAVFKVLDSTNPILVISAAKIILSMIVRDVNLLNICKLIFRVSKNKNNDKIF--EEFEMANILIQTLSSVKPDQSHAALLYLMCTLKFLSKPEKSVGSENLSKNIISNSLINAGLLPSISNLLQKCSKINENEHC-VNNSFADFIIQCFSCLINLESNPNISRKYFIQNQIPVVTVLTIQQYHHNNDLIFEAFRLLSRLTQYSDCCQLI-----------EPKLSEFCPLCLNLML---NSRNDHLILRIAYIIGDMLTKSEEARLTLFPDKFSLDSFLKVFQVFIQKFQCCDENINKMSGD--SMEKDSASVDDIIVKLLRVIANAAITESVGRMICHNKSCXXXXXXXXXXXXXXDKEELLTISISALNNISFYMTSANNPEIKNNHLKIIEALYKIIANKYGKDHLGGIIRVLGNLSRETYMRDWIVDNQLVEFLITILDSDNQDTIFFTVGVILNLMTDQNKRHLLLELNGITKLIEVLRDFASRDWQLAGLVCQTFWNYTEIISTTTEAILGGEENAEELLQLLTLFTDSDEVDNI-HLNHYSDISTLDYLKNSWKSDFLPVAADLISRLELKMNRFEPL 2821
            Q+  SQ  H  S  S   R Q+NGS           G+  +   +     + S+D +  +F  TLAP +D+LS  V  +   S ++ + L + L+S+L   G+LG++C   RS IL+AVF++LD   P L ++ A + L M V   NL  + KL+FRV+K + ND +F  +   +A I   TL+   P  SH AL+YL   LKFL+     V          S  L+ +G   +++  L +  + N         S A  ++Q    L NL   P   +++             +QQY  + +L   A RLLS+L+Q++D C  +               S   P     +L    SR D L+LR+A+++G++  ++EEAR  +FPDK +LDS L V + + Q+ +              +  +D   V D +VKL+R++ANAAI+  VGRM   +++CL LL++ + SK I D  EL++ S++A+NN+++YM++    ++    L++ +AL  +I  +   D L   IR  GNLSRE  +RDWIV +++ E LIT+LDS + + ++   G++LNL+ D +KR +L +  G+ KLI  L D    DWQLA ++CQ  WN+TE +++  ++  G E+ A+EL+  L LFTD + V+    L   SD  T  +L++ W+SDF  +   L+ RL    ++FEPL
Sbjct:  195 QQRSSQQPHRSSAGS---RVQRNGSVGELPAEDSAAGDPGRRRDSAPQPPAMSEDAETEWFNKTLAPAVDLLS--VAEQTPESADNTLELVRHLHSELQAAGMLGRNCRRHRSRILRAVFRLLDWPQPRLQLALAGLCLDMRVSAGNLACVAKLLFRVAKLEANDALFLAQPGLLAGI-SDTLAGADPAASHEALVYLAGALKFLTGGAAGV----------SRELLRSGCFEALTTCLGRAVEWNRQTGGRAAESLAHVLVQVLGSLRNLAEQPGTRQQFVATPACLAGVCAAMQQYPADYELQLNASRLLSKLSQHADVCAALCSNDDGGGGVGSSGQSALLPSAARELLARHRSRED-LVLRLAFVLGNLAGRAEEARTAMFPDKPALDSVLAVLKFYQQESEAAAAAAASGEASQPAPRRDPGKVRDCLVKLVRLLANAAISAEVGRMCAGSRTCLRLLVTFVESKSIADNRELVSNSVAAINNLTYYMSTELASDMPERMLRVAQALSLLI-QRADTDLLVEAIRPFGNLSREKAVRDWIVTSRIDEVLITLLDS-SHEAVYSAAGILLNLVADPDKRQVLKKDGGVEKLISALTDLGQSDWQLACVICQALWNFTEGMTSCADS-FGSEQTAQELISCLELFTDEEAVEESNRLAAGSDEDTFQHLQDVWESDFAYIGTHLLKRLRRHQSQFEPL 875          

HSP 2 Score: 79.337 bits (194), Expect = 3.487e-11
Identity = 45/101 (44.55%), Postives = 53/101 (52.48%), Query Frame = 2
Query:   71 FYETPVDRPIASSIINETRTWLNTVQTKRPFTPQTETRSLFGNH-----------SQRNPESRPPSVFSLGPRNFDTNPAALDSFSRPSSGP----RLAPI 328
            FYE P  RP ++ II ETRTWL  V+TKRPFTP+   RSLF +                P  RPPS  SLG R F++        SRP SG     RL+PI
Sbjct:   64 FYEAPESRPTSAQIIEETRTWLREVKTKRPFTPRDGERSLFASRQVSADFSEIGAGVAAPVGRPPSAVSLGGRQFESE-------SRPVSGSAVATRLSPI 157          
BLAST of Armadillo repeat-containing protein 2 vs. TrEMBL
Match: A0A1I8IZG4 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 352.058 bits (902), Expect = 5.324e-103
Identity = 234/701 (33.38%), Postives = 374/701 (53.35%), Query Frame = 2
Query:  818 QKARSQSRHDCSEESETPRPQKNGS-----------GEIDKSLKNKFSSNSQSDDQDI-FFKDTLAPILDILSAPVEFRKQNSTEDFINLTKLLYSKLDEKGLLGKHCA-FRSDILKAVFKVLDSTNPILVISAAKIILSMIVRDVNLLNICKLIFRVSKNKNNDKIF--EEFEMANILIQTLSSVKPDQSHAALLYLMCTLKFLSKPEKSVGSENLSKNIISNSLINAGLLPSISNLLQKCSKINENEHC-VNNSFADFIIQCFSCLINLESNPNISRKYFIQNQIPVVTVLTIQQYHHNNDLIFEAFRLLSRLTQYSDCCQLI-----------EPKLSEFCPLCLNLML---NSRNDHLILRIAYIIGDMLTKSEEARLTLFPDKFSLDSFLKVFQVFIQKFQCCDENINKMSGD--SMEKDSASVDDIIVKLLRVIANAAITESVGRMICHNKSCXXXXXXXXXXXXXXDKEELLTISISALNNISFYMTSANNPEIKNNHLKIIEALYKIIANKYGKDHLGGIIRVLGNLSRETYMRDWIVDNQLVEFLITILDSDNQDTIFFTVGVILNLMTDQNKRHLLLELNGITKLIEVLRDFASRDWQLAGLVCQTFWNYTEIISTTTEAILGGEENAEELLQLLTLFTDSDEVDNI-HLNHYSDISTLDYLKNSWKSDFLPVAADLISRLELKMNRFEPL 2821
            Q+  SQ  H  S  S   R Q+NGS           G+  +   +     + S+D +  +F  TLAP +D+LS  V  +   S ++ + L + L+S+L   G+LG++C   RS IL+AVF++LD   P L ++ A + L M V   NL  + KL+FRV+K + ND +F  +   +A I   TL+   P  SH AL+YL   LKFL+     V          S  L+ +G   +++  L +  + N         S A  ++Q    L NL   P   +++             +QQY  + +L   A RLLS+L+Q++D C  +               S   P     +L    SR D L+LR+A+++G++  ++EEAR  +FPDK +LDS L V + + Q+ +              +  +D   V D +VKL+R++ANAAI+  VGRM   +++CL LL++ + SK I D  EL++ S++A+NN+++YM++    ++    L++ +AL  +I  +   D L   IR  GNLSRE  +RDWIV +++ E LIT+LDS + + ++   G++LNL+ D +KR +L +  G+ KLI  L D    DWQLA ++CQ  WN+TE +++  ++  G E+ A+EL+  L LFTD + V+    L   SD  T  +L++ W+SDF  +   L+ RL    ++FEPL
Sbjct:  145 QQRSSQQPHRSSAGS---RVQRNGSVGELPAEDSAAGDPGRRRDSAPQPPAMSEDAETEWFNKTLAPAVDLLS--VAEQTPESADNTLELVRHLHSELQAAGMLGRNCRRHRSRILRAVFRLLDWPQPRLQLALAGLCLDMRVSAGNLACVAKLLFRVAKLEANDALFLAQPGLLAGI-SDTLAGADPAASHEALVYLAGALKFLTGGAAGV----------SRELLRSGCFEALTTCLGRAVEWNRQTGGRAAESLAHVLVQVLGSLRNLAEQPGTRQQFVATPACLAGVCAAMQQYPADYELQLNASRLLSKLSQHADVCAALCSNDDGGGGVGSSGQSALLPSAARELLARHRSRED-LVLRLAFVLGNLAGRAEEARTAMFPDKPALDSVLAVLKFYQQESEAAAAAAASGEASQPAPRRDPGKVRDCLVKLVRLLANAAISAEVGRMCAGSRTCLRLLVTFVESKSIADNRELVSNSVAAINNLTYYMSTELASDMPERMLRVAQALSLLI-QRADTDLLVEAIRPFGNLSREKAVRDWIVTSRIDEVLITLLDS-SHEAVYSAAGILLNLVADPDKRQVLKKDGGVEKLISALTDLGQSDWQLACVICQALWNFTEGMTSCADS-FGSEQTAQELISCLELFTDEEAVEESNRLAAGSDEDTFRHLQDVWESDFAYIGTHLLKRLRRHQSQFEPL 825          

HSP 2 Score: 79.7221 bits (195), Expect = 3.136e-11
Identity = 45/101 (44.55%), Postives = 53/101 (52.48%), Query Frame = 2
Query:   71 FYETPVDRPIASSIINETRTWLNTVQTKRPFTPQTETRSLFGNH-----------SQRNPESRPPSVFSLGPRNFDTNPAALDSFSRPSSGP----RLAPI 328
            FYE P  RP ++ II ETRTWL  V+TKRPFTP+   RSLF +                P  RPPS  SLG R F++        SRP SG     RL+PI
Sbjct:   14 FYEAPESRPTSAQIIEETRTWLREVKTKRPFTPRDGERSLFASRQVSADFSEIGAGVAAPVGRPPSAVSLGGRQFESE-------SRPVSGSAVATRLSPI 107          
BLAST of Armadillo repeat-containing protein 2 vs. TrEMBL
Match: A0A210QY65 (Armadillo repeat-containing protein 2 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT07673 PE=4 SV=1)

HSP 1 Score: 348.591 bits (893), Expect = 2.761e-101
Identity = 283/949 (29.82%), Postives = 468/949 (49.32%), Query Frame = 2
Query:   35 IDLNSNGSKG-RAFYETPVDRPIASSIINETR-----TWLNTVQTKRPFTPQTETRSLFGNHSQRNPESRPPSVFSLGPRNFDTNPAALDSFSRPSSGPRLAPINKITLKDKAITDNKFSNEIRRNSSAWEDTKEQHDSERHQFQNVENFIKSRTNSLSNISNINEKQSNAKRKKGVLHSELNST-GLPPTSPTRTKPKLKPSVSIQHLSTEKRIXXXXXXXXXXXAEQTTRMSSPKPSRQRFMNSNRPDXXXXXXXXXXAKAYRTQSQKARSQSRHDCSEESETPRPQKNGSGEIDKSLKNKFSSNSQSDDQDIFFKDTLAPILDILSAPVEFRKQNSTEDFINLTKLLYSKLDEKGLLGKHCAFRSDILKAVFKVLDSTNPILVISAAKIILSMIVRDVNLLNICKLIFRVSKNKNNDKIFEEFEMANILIQTLSSVKPDQSHAALLYLMCTLKFLSKPEKSVGSENLSKNIISNSLINAGLLPSISNLLQKCSKINENEHCVNNSFADFIIQCFSCLINLESNPNISRKYFIQNQIPVVTVLTIQQYHHNNDLIFEAFRLLSRLTQYSDCCQLIEPKLSEFCPLCLNLMLNSRNDHL-----ILRIAYIIGDMLTKSEEARLTLFPDKFSLDSFLKVFQVFIQ---KFQCCDENINKMS-GDSMEKDSASVDDIIVKLLRVIANAAITESVGRMICHNKSCXXXXXXXXXXXXXXDKEELLTISISALNNISFYMTSANNPEIKNNHLKIIEALYKIIANKYGKDHLGGII---RVLGNLSRETYMRDWIVDNQLVEFLITILDSDNQDTIFFTVGVILNLMTDQNKRHLLLELNGITKLIEVLRDFASRDWQLAGLVCQTFWNYTEIISTTTEAILGGEENAEELLQLLTLFTDSDE-VDNIHLNHYSDISTLDYLKNSWKSDFLPVAADLISRLELKMNRFEPL 2821
            +D  S  +KG R FY+   + P ++ I+N  R     + L  VQTKRP+TP+   RSLFG          P S      RN DT P +  +FS                    +T   F     R +S  + +   H        +VE  +  +  +  N      K +    +  V+HS  NS  G  P S    K     S S+  LS   R + G  +          +  +P P  +R       D         S  + R+  + A S+          T R    GS     S   + +  SQ  ++ +F+   +AP L+ L+      K+   +        LY  L ++ LLGK C  RS ILK+VFK+LD   P +++  A++ILS  V   NLLN+CKL+F+VS+N+ ND  F    +  +L +TLS      S  AL+Y +  +KFL+      G+  + K ++  + I       +  LL   +K N     VN      ++Q  + L NL ++ N SR  F+   I       +  Y  + DL+    R+ S++T ++DCC ++  + S +    +NL+    N HL     ++R+ +++G++  K++EAR+ L+ +  + D  L V +++++   K Q  +E   +   G+ + K     +D+++K++RVIAN +I E+VG +I  N  C++LLLS++  K+I   EEL+  +++ +NN+S+Y  S     I  + +++IEAL K++      +++ G+I   RV GNL+R+  +RD++V +++ + ++T+LDS N++ ++ + GV++N M D+ KR  L +  G+ KLIEVLRDF   DW+LA LVCQ  WNY+  I++T      GE+ A++LL LL  +TD D  +D+   +  +D     Y   +W+ +F PVA  L+ RLE   + FEPL
Sbjct:    2 MDQASKRNKGDRPFYQPKENIPTSAEIVNNARQSIGRSELQAVQTKRPYTPRDGRRSLFG----------PAST-----RNPDTRPPS--AFS--------------------LTSRHFDGVDSRPASGTKLSPLPHTPRLPTEPDVEVLLPPKPPTDPN------KATRKVPRARVIHS--NSVDGSSPDSLGINK-----SGSLTDLSGSSRQTDGNTTDSTRRTHSGPKDRTPIPKEER----GEGDGKEMPPRAPSQASVRSPPRSASSREVESRVSSGGTNRTSSAGSTGRAGSAGKRDAEESQ--EETMFYTQNIAPRLEELAL---LGKKREGDKLCECADNLYKLLQKENLLGKSCKQRSTILKSVFKLLDLEEPKVLLRVARLILSFRVSGNNLLNVCKLVFKVSRNEKNDPEFLRGNILELLSKTLSCTDHTSSCEALIYCVGAIKFLT------GNTTIVKQLVKENCIEG-----LGQLLDGINKTNRENGKVNEQLGHILVQLTATLRNL-ADANSSRDKFLSCHIVEGLCTVVDMYALDGDLMLNISRIFSKITLHTDCCTVLADQPSSYKSF-INLL----NKHLQKSDMVVRVCFVLGNITAKNDEARVRLYQENKAFDVLLSVLKLYLEMDIKAQGKEEKSEEGERGNKLNKR----EDVMIKVVRVIANLSINETVGPLIASNAQCIDLLLSILEYKEISASEELVLNTVATINNLSYY--SVKTSMITQHQMRVIEALLKLVL----ANNMEGMIESSRVFGNLTRQKAVRDFLVQHKVDQMMVTMLDSGNREVVYISCGVLINFMVDEEKRSALKKEGGVKKLIEVLRDFGRSDWELASLVCQILWNYSGKITSTNACF--GEQEAQDLLDLLIEYTDQDSALDSSFKDEETDEEMKKYYYETWR-EFYPVAEQLLHRLETHQSDFEPL 861          
BLAST of Armadillo repeat-containing protein 2 vs. TrEMBL
Match: A0A1S3HIR4 (armadillo repeat-containing protein 2 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106155625 PE=4 SV=1)

HSP 1 Score: 338.576 bits (867), Expect = 1.320e-97
Identity = 200/628 (31.85%), Postives = 352/628 (56.05%), Query Frame = 2
Query:  959 FFKDTLAPILDILSAPVEFRKQNSTEDFINLTKLLYSKLDEKGLLGKHCAFRSDILKAVFKVLDSTNPILVISAAKIILSMIVRDVNLLNICKLIFRVSKNKNNDKIFEEFEMANILIQTLSSVKPDQSHAALLYLMCTLKFLSKPEKSVGSENLSKNIISNSLINAGLLPSISNLLQKCSKINENEHCVNNSFADFIIQCFSCLINLESNPNISRKYFIQNQIPVVTVLTIQQYHHNNDLIFEAFRLLSRLTQYSDCCQLIEPKLSEFCPLCLNLMLNSRNDHLILRIAYIIGDMLTKSEEARLTLFPDKFSLDSFLKVFQVFIQ----KFQCCDENINKMSGDSMEKDSASVDDIIVKLLRVIANAAITESVGRMICHNKSCXXXXXXXXXXXXXXDKEELLTISISALNNISFYMTSANNPEIKNNHLKIIEALYKIIANKYGKDHLGGII---RVLGNLSRETYMRDWIVDNQLVEFLITILDSDNQDTIFFTVGVILNLMTDQNKRHLLLELNGITKLIEVLRDFASRDWQLAGLVCQTFWNYTEIISTTTEAILGGEENAEELLQLLTLFTDSDEVDNIHLNHYSDISTLDYLKNSWKSDFLPVAADLISRLELKMNRFEPL 2821
            FF   +APIL+ ++A    RK+    +  NL  +LY  L++  +LG+ C  RS ILK +FK+LDS +P+L +  AK+IL + +   NL ++CKLIF++S+ ++ND +F E EM   L+ T+ +     S  AL+YL+  LKFLS      G+  + +++  +  + A        LL+    IN           + ++Q  + L NL  N   +R+  + + +      + Q Y  +++++    R+ S++T +SDCC  +    S +      L    +   LI+R+ ++IG++  KS++ARL  F ++ +  + L +F+ +++     F    E + +    S   D+  V+DI++K++RVIAN +I E VG+ +  N+ C+  LL +I++K +   EEL+  S++ +NN+SFY    +   +     ++ E+  K++       H+ G +   RV GNL+R   +RD++  N++ E ++ +LDS +++ ++   GV++NLM D+NKRH+L E  GI+KLI+VLRDF   DWQL  +VCQ  WNY+  I+++T+    GE+ A+EL  LL  + D +   +       + + L +L++ W+ +F PVA  L++R+E   + FEPL
Sbjct:  268 FFNKNIAPILEQMAA---LRKEKDATELSNLCSMLYCTLEQGNMLGRACKRRSAILKTIFKLLDSESPVLRVRLAKLILGLKITGNNLTSVCKLIFKISREESNDMLFIEEEMIAPLLDTMCTTDLSTSQDALVYLLGALKFLS------GNTTVGQHLTRHRAVEA-----YGKLLKA---INTATADSKEKMGNVLVQLTAGLRNLVDNEE-NREDMVSSHVIEEMERSTQLYSADSEVVHNIIRIFSKVTLHSDCCNALNSIPSTYKSFLYLLNQYIQKQDLIVRLTFVIGNLTAKSDDARLRFFQEENAFKTILNIFKTYLELDMKSFSKHKEEVKESGTGSKHPDT--VEDIMIKVVRVIANLSINEEVGKQLATNEKCVEWLLHIIDTKDMSTSEELVLNSVATINNLSFYHVPGS--AVVKKQQQVTESFLKLL----NVQHMEGFVEASRVYGNLTRHKAVRDFLAANKVPEMMVALLDSGSREVVYTACGVLINLMADENKRHILKEEGGISKLIDVLRDFGRSDWQLGSMVCQILWNYSARITSSTDCY--GEKEAQELADLLIDYLDEETALDSSDTAGVEEAMLAFLRDVWEEEFCPVANKLLNRIESHQSDFEPL 867          

HSP 2 Score: 93.9745 bits (232), Expect = 1.013e-15
Identity = 43/83 (51.81%), Postives = 58/83 (69.88%), Query Frame = 2
Query:   68 AFYETPVDRPIASSIINETRTWLNTVQTKRPFTPQTETRSLFGNHSQRNPESRPPSVFSLGPRNFDTNPAALDSFSRPSSGPR 316
            AFYETP     ++ I+NE R+ L TV+T RPFTP+ E R+LFG+ S R+P++RPPS FSLG  +FD + +   S +RP SG R
Sbjct:   18 AFYETPEHVKTSAKIVNEARSSLRTVKTNRPFTPKPEERTLFGSASNRDPQNRPPSAFSLGSHHFDGSESRPTSGTRPVSGTR 100          
BLAST of Armadillo repeat-containing protein 2 vs. Ensembl Cavefish
Match: armc2 (armadillo repeat containing 2 [Source:NCBI gene;Acc:103047623])

HSP 1 Score: 267.314 bits (682), Expect = 1.370e-75
Identity = 195/695 (28.06%), Postives = 346/695 (49.78%), Query Frame = 2
Query:  794 AKAYRTQSQKARSQSRHDCSEESETPRPQKNGSGEIDKSLKNKFSSNSQSD--DQDIFFKDTLAPILDILSA--PVEFRKQNSTEDFINLTKLLYSKLDEKGLLGKHCAFRSDILKAVFKVLDSTNPILVISAAKIILSMIVRDVNLLNICKLIFRVSKNKNNDKIFEEFEMANILIQTLSSVKPDQSHAALLYLMCTLKFLSKPEKSVGSENLSKNIISNSLINAGLLPSISNLLQKCSKINENEHCVN----------NSFADFIIQCFSCLINLESNPNISRKYFIQNQIPVVTVLTIQQYHHNNDLIFEAFRLLSRLTQYSDCCQLIEPKLSEFCPLCLNLMLN-----SRNDHLILRIAYIIGDMLTKSEEARLTLFPDKFSLDSFLKVFQVFIQKFQCCDENINKMSGDSMEKDSASVDDIIVKLLRVIANAAITESVGRMICHNKSCXXXXXXXXXXXXXXDKEELLTISISALNNISFYMTSANNPEIKNNHLKIIEALYKIIANKYGKDHLGGIIRVLGNLSRETYMRDWIVDNQLVEFLITILDSDNQDTIFFTVGVILNLMTDQNKRHLLLELNGITKLIEVLRDFASRDWQLAGLVCQTFWNYTEIISTTTEAILGGEENAEELLQLLTLFTDSDEVDNIHLNHYSDISTLDYLKNSWKSDFLPVAADLISRLELKMNRFEPL 2821
            A+  RT++    S ++H   ++     PQK    E D    +     +  D  D+ +F+   + P+L    A  P     + + E   +    L+  L E+G LG+    RS +L+A+F+++D  +  L ++  K+IL++ V   NLLNICKLIF++S++ +ND +F++  + + L+  L       +  A+LY + +LK LS      G+  LS+ +++   I+  L      L QK  ++ + +   +          N  A  I+   +  +   ++ + SR  F  N +       +  Y  + D+     R+LS+L+ Y+ CC  +   L      C  L L+     SR  +L++R+ + +G++  +S EAR  ++ ++ + D  + +FQ + +      +N                +D++VKL+RV+AN +I  +VGR +  N  C+ LLL ++  + + +  EL+  + + +NN+S+Y         ++ H+  +     + +N    D +    RV GNLS+  Y+R +I++N++ +F++T+LDS N D  F   GV++NL  D   R +L +   I KL++ LRDF  +DWQLAGLVCQT WN  E          G  +N +ELL++L+L++     D   L   S     +Y  + W+ DFLPVA  L  R++  MN  EP+
Sbjct:  181 ARRDRTEAPPELS-TKHSGMQQPSRATPQKK---ETDTEADSGHGDMTGRDATDESVFWNFEVLPVLQEFEAVMPGGSVSEETIEQLCDACTALHCVLAERGKLGRRLKKRSTLLRALFRLIDLGSDQLNLALGKLILALNVSGNNLLNICKLIFKISRSSSNDVLFQKNSIIDSLLPLLQCEDLYSNGEAVLYTVGSLKLLS------GNCALSRLLLAKDFISVLL-----QLAQKLLRLTDPDALPDHNPTVAGRDQNPIAGHILVQLTAALRNMADLSESRPMFTSNDVFSTLCKIMDLYQDDQDVCLNVARILSKLSSYAGCCYALSETLC-----CYRLFLDLLSKHSRKQNLVVRLLFTLGNLAARSSEARERVYEEEGAADILIGLFQHYHRAAFLASKNPQHEE-----------EDVLVKLIRVLANLSIHPTVGRALAANALCVQLLLEVMEVRSVEESTELVVNASATINNLSYYQEEGTVVRAQHTHISKLLLRLLLSSNM---DVVLEATRVFGNLSQIKYVRHFIIENKVHQFIVTLLDSKNPDVCFSACGVLMNLSVDPEYRTILRKEGAIQKLMDCLRDFGPKDWQLAGLVCQTLWNCMED---------GETQNMQELLEILSLYS-----DQTFLQWPSCDDVKEYQNSCWEQDFLPVAQKLKKRIQSNMNLMEPI 827          

HSP 2 Score: 78.1814 bits (191), Expect = 3.054e-14
Identity = 39/79 (49.37%), Postives = 50/79 (63.29%), Query Frame = 2
Query:   92 RPIASSIINETRTWLNTVQTKRPFTPQTETRSLFGNHSQRNPESRPPSVFSLGPRNFDTNPAALDSFSRPSSGPRLAPI 328
            RP ++ I+ E R  L  + T+RPFTP+ E R LFG+ S R  + RPPS FSL  RNF+       S SRPSSG RL+P+
Sbjct:   20 RPTSAEIVTEARRSLRILGTQRPFTPRDEQRQLFGDASARTRDRRPPSSFSLHARNFEA------SDSRPSSGTRLSPL 92          
BLAST of Armadillo repeat-containing protein 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008172.1 (pep scaffold:Pmarinus_7.0:GL483636:726:13521:1 gene:ENSPMAG00000007380.1 transcript:ENSPMAT00000008172.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 186.422 bits (472), Expect = 3.719e-49
Identity = 154/626 (24.60%), Postives = 301/626 (48.08%), Query Frame = 2
Query:  959 FFKDTLAPILDILSAPVEFRKQNSTEDFINLTKLLYSKLDEKGLLGKHCAF-RSDILKAVFKVLDSTNPILVISAAKIILSMIVRDVNLLNICKLIFRVSKNKNNDKIFEEFEMANILIQTLSSVKPDQSHAALLYLMCTLKFLSKPEKSVGSENLSKNIISNSLINAGLLPSISNLLQKCSKINENEHCVNNSFADFIIQCFSCLINLESNPNISRKYFIQNQIPVVTVLTIQQYHHNNDLIFEAFRLLSRLTQYSDCCQLIEPKLSEFCPLCLNLMLN--SRNDHLILRIAYIIGDMLTKSEEARLTLFPDKFSLDSFLKVFQVFIQKFQCCDENINKMSGDSME-----KDSASVDDIIVKLLRVIANAAITESVGRMICHNKSCXXXXXXXXXXXXXXDKEELLTISISALNNISFYMTSANNPEIKNNHLKIIEALYKIIANKYGKDHLGGIIRVLGNLSRETYMRDWIVDNQLVEFLITILDSDNQDTIFFTVGVILNL-MTDQNKRHLLLELNGITKLIEVLRDFASRDWQLAGLVCQTFWNYTE-IISTTTEAILGGEENAEELLQLLTLFTDSDE---VDNIHLNHYSDISTL-DYLKNSWKSDFLPVAADLISRLE 2794
            F+   +AP+L  L    E  +         + + L + L   G+L +     R+ +L+ +++++D  +  L++   K+ILS+ V+D NLLN+CKL+F++S+ +NND +F +  +  +L+  L       +  AL Y    +KFL+    S          +   L+  G L ++  LL +      N    + + A  ++Q  + +  L   P     +     +P +   T+++Y  +  +     R  S++T  S+ C+  E    +  P  L  +L+   R   L++R+ Y +G++  +SE  R  L+     LD  L V+ + +Q+      +   ++  S       + +   +D++VKLLRV+AN ++   +G  +  +  C+ LL+  + S  + ++EE++  +++ +NN+S++M       ++   L+I E L   +     +  L   +R LGNLS+   +R+ +  + +   L+ +L   +QD  +   GV+LN+  TD      LL+L  + +L+  L+ +   DWQL GL+C+  WN+++   +T T    GG + ++    L TL    DE   + +  L       T+  Y +  W+++F+PVA  L  R++
Sbjct:  146 FWSSHVAPLLTQL----EEERAEVVGRLCGVCEDLGAVLARGGMLAQRGGHGRAALLRVLYRLVDVNSDRLLLHVIKLILSIQVKDKNLLNVCKLVFKISRTENNDLLFLQVGIVELLLGVLGDPDLAANVEALTYCAGAVKFLANSGGS--DGGDGGGALGAELLARGALDTLLGLLAR-----ANTALADKAMAHLLVQVTAAVRGLADAPGACGFFRAARALPTLCT-TLERYECDACVCTNVLRTFSKVTDRSEGCR--ELAAVDSSPNILIALLHKFPRKQDLVVRVCYTLGNLAARSEAVRERLWRHASCLDVLLHVYALQLQR----QPDTGAVASHSFTCSRGLQRADLAEDVLVKLLRVLANLSLHPGLGAALASHPRCIQLLICTLESPGVREREEIVLNAVATVNNLSYHMGPGAT--LQGQQLRIAELLLMPLLGPGEEGVLEA-LRALGNLSQSAAVRELLHQHHVPGLLLELLSEGSQDVCYSAGGVLLNMSSTDDGGAGRLLQLGAMERLLSCLQRYCRGDWQLGGLLCKVLWNFSQGPAATGTSGKGGGLDPSDTTRLLATLHLLLDERTALVSAPLGGGEPGETVQGYHRQLWEAEFVPVARRLQKRVQ 750          
BLAST of Armadillo repeat-containing protein 2 vs. Ensembl Nematostella
Match: EDO32819 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SU01])

HSP 1 Score: 258.07 bits (658), Expect = 2.177e-75
Identity = 183/571 (32.05%), Postives = 315/571 (55.17%), Query Frame = 2
Query: 1112 RSDILKAVFKVLDSTNPILVISAAKIILSMIVRDVNLLNICKLIFRVSKNKNNDKIFEEFEMANILIQTLSSVKPDQSHAALLYLMCTLKFLSKPEKSVGSENLSKNIISNSLINAGLLPSISNLLQKCSKINENEHCVNNSFADFIIQCFSCLINLESNPNISRKYFIQNQIPVVTVLTIQQYHHNNDLIFEAFRLLSRLTQYSDCC-QLIEPKLSEFCPLCLNLMLNSRNDH-------LILRIAYIIGDMLTKSEEARLTLFPDKFSLDSFLKVFQVFIQKFQCCDENINKMSGDSMEKDSASVDDIIVKLLRVIANAAITESVGRMICHNKSCXXXXXXXXXXXXXXDKEELLTISISALNNISFYMTSANNPE--IKNNHLKIIEALYKIIANKYGKDHLGGIIRVLGNLSRETYMRDWIVDNQLVEFLITILDSDNQDTIFFTVGVILNLMTDQNKRHLLLELNGITKLIEVLRDFASRDWQLAGLVCQTFWNYTEIISTTTEAILGGEENAEELLQLLTLFTDSDEVDNIHLNHYSDISTLDYLKNSWKSDFLPVAADLISRLE 2794
            R +ILK VFK LD  +P L++   ++ILSM V   N+ NIC +++R++K + ND++F E +M   L+QTL +        ALLY+  TLK LS        E LS + +           +++ +L+   + ++ +       +  ++Q    + NL ++ N +R+ +I +    +    ++ +  + DL++   R+LS+LT Y +CC QL        C  C   +L    DH       +++R+ +I+G++ +KS+EAR  LF  K  L + L +   +       D  ++  + D  E  S +++D++VK++RVIAN +I   VG+ I  ++ C+++LL ++N K++ D EEL+  +++ LNN+SFY    NN    I    L+I ++L  ++  +   D +    RV GNLSR+  +R  + +N++ E LI +LD+  ++T+F   GV++NLMTD   R  L E  GI KLI+VL DF   DWQL+ +VCQT WNY+  I+T++     GEE   EL+ +L+ + D + V     N   + + ++ L+++W   F PVA  L+ R++
Sbjct:    3 RGEILKTVFKFLDINDPKLILRLGRLILSMKVTGNNITNICMVVYRLAKTEKNDQMFMEEDMLKCLVQTLQTADILTCRDALLYISGTLKHLSNTNSDAQRELLSLDTVQ----------ALAKVLEAIPQFSKPDL----QISSMLVQVTGVVRNL-ADVNGAREMYIDHNFVQLLTQIMEPFSQDEDLVYNISRILSKLTLYHECCVQLCS------CSTCYKALLKVLRDHQKKQASLIVVRVCFILGNLTSKSDEARSQLFNTKGCLSTLLSILVAYFS----LDAKVS--NKDKSESRSENIEDVLVKVIRVIANLSIHYEVGQAIADSQQCISVLLDILNVKQVEDSEELVLNTVATLNNLSFY----NNGTSLITQRKLQITQSLMSMLLPE-NMDAMVEACRVFGNLSRDRDVRMLLAENKVDEILIALLDAGERETVFTACGVLINLMTDGVTRPKLKEEGGIKKLIDVLGDFGKNDWQLSAMVCQTLWNYSGEITTSSATF--GEEETLELIDILSEYLDEELVFGETCNL--EPALIEALRSTWLQSFYPVAEHLLERIQ 537          
BLAST of Armadillo repeat-containing protein 2 vs. Ensembl Nematostella
Match: EDO28776 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T5I5])

HSP 1 Score: 153.68 bits (387), Expect = 1.326e-41
Identity = 103/289 (35.64%), Postives = 173/289 (59.86%), Query Frame = 2
Query: 1808 HLILRIAYIIGDMLTKSEEARLTLFPDKFSLDSFLKVFQVFIQKFQCCDENINKMSGDSMEKDSASVDDIIVKLLRVIANAAITESVGRMICHNKSCXXXXXXXXXXXXXXDKEELLTISISALNNISFYMTSANNPE--IKNNHLKIIEALYKIIANKYGKDHLGGIIRVLGNLSRETYMRDWIVDNQLVEFLITILDSDNQDTIFFTVGVILNLMTDQNKRHLLLELNGITKLIEVLRDFASRDWQLAGLV-CQTFWNYTEIISTTTEAILGGEENAEELLQLLTLF 2665
             +++R+ +I+G++ +KS+EAR  LF  K  L + L +   +   F    +  NK   D  E  S +++D++VK++RVIAN +I   VG+ I  ++ C+++LL ++N K++ D EEL+  +++ LNN+SFY    NN    I    L+I ++L  ++  +   D +    RV GNLSR+  +R  + +N++ E LI +LD+  ++T+F   GV++NLMTD   R  L E  GI KLI+VL D+   DWQL+ +V  +  WNY+  I+T++     GEE   EL+ +L+ +
Sbjct:    1 EIVVRVCFILGNLTSKSDEARSQLFNTKGCLSTLLSILVAY---FSLDAKVSNK---DKSESRSENIEDVLVKVIRVIANLSIHYEVGQAIADSQQCISVLLDILNVKQVEDSEELVLNTVATLNNLSFY----NNGTSLITQRKLQITQSLMSMLLPE-NMDAMVEACRVFGNLSRDRDVRMLLAENKVDEILIALLDAGERETVFTACGVLINLMTDGVTRPKLKEEGGIKKLIDVLGDYGKNDWQLSAMVEIELMWNYSGEITTSSATF--GEEETLELIDILSEY 276          
BLAST of Armadillo repeat-containing protein 2 vs. Ensembl Medaka
Match: armc2 (armadillo repeat containing 2 [Source:NCBI gene;Acc:101162178])

HSP 1 Score: 261.922 bits (668), Expect = 6.532e-74
Identity = 188/670 (28.06%), Postives = 344/670 (51.34%), Query Frame = 2
Query:  800 AYRTQSQKA--RSQSRHDCSEESETPRPQKNGSGEIDKSLKNKFSSNSQSDDQD-IFFKDTLAPILDILSAPVEFRKQNSTEDFINLTKLLYSKLDEKGLLGKHCAFRSDILKAVFKVLDSTNPILVISAAKIILSMIVRDVNLLNICKLIFRVSKNKNNDKIFEEFEMANILIQTLSSVKPDQSHAALLYLMCTLKFLSKPEKSVGSENLSKNIISNSLINAGLLPSISNLLQKCSKINENEHCVNNSFADFI-IQCFSCLINLESNPNISRKYFIQNQIPVVTVLTIQQYHHNNDLIFEAFRLLSRLTQYSDCCQLIEPKLSEFCPLCLNLM-LNSRNDHLILRIAYIIGDMLTKSEEARLTLFPDKFSLDSFLKVFQVFIQKFQCCDENINKMSGDSMEKDSASVDDIIVKLLRVIANAAITESVGRMICHNKSCXXXXXXXXXXXXXXDKEELLTISISALNNISFYMTSANNPEIKNNHLKIIEALYKIIANKYGKDHLGGIIRVLGNLSRETYMRDWIVDNQLVEFLITILDSDNQDTIFFTVGVILNLMTDQNKRHLLLELNGITKLIEVLRDFASRDWQLAGLVCQTFWNYTEIISTTTEAILGGEENAEELLQLLTLFTDSDEVDNIHLNHYSDISTLDYLKNSWKSDFLPVAADLISRLE 2794
            A RT   +   +  +    S+ S+T +P  + + E           NS ++D D + FK+ +  +L  L +        S      L + L+  L E  +LG+HC  RS+IL+ +F+++D  +  L +  AK+ L++ V   NLLNICKLI+++S++++ND +F    +  +L+  L++     S  ALLY + T KFLS      G+ ++ K ++  + +       +  L+ K  K  E    VN + A  I +Q  + L NL  +P  +R  FI   I     + +  +  + D+     R+ S+L+ YS+CC L   ++ E  P  L ++  + +   L++R+ + +G++  KS E+R  L+     +D+ ++++ ++ ++    D+   +   D+        DD++VKL+R++AN +I  +VG ++  N +C++LL+  +  + + + EELL    + +NN+SFY+  ++  EI+ NHL   + + K++ +    D      R+ GNLS    +RD+I+ N++  F++T+LDS + +  F   GV+ NL  D   R  L     + KL++ L DF   DWQLAG  C+  WN T      +E +L  +E  E LL++LT + D   ++ I          ++     W+ +FLP+A +L+  L+
Sbjct:  159 ARRTTPHRGPVKPGTHRPASDSSKTVQPVGDKTTEQSHHKTGLNDGNSSTEDADALMFKNKVILLLQELESEAAGSSTASLTHLCELCERLHGTLSEARMLGRHCKTRSEILRILFRLIDLRSAQLSLHIAKLCLALSVSGNNLLNICKLIYKISRSESNDILFRHTSIIELLLGVLNTEDVCLSGEALLYCVATFKFLS------GNTSVLKVLLDQNFVAV-----VQTLIYKLCKAEE----VNLTTAGHILVQLTATLRNLADHPE-ARTLFISISILPTLCMVLSLHWDDQDVCTNISRIFSKLSSYSECC-LALAQIPESYPTTLEVLSKHPQKQDLVVRLLFTLGNLTAKSSESRQQLYECDGCMDTVIQLYNIYQRR----DQLAPQKDPDAPSISLKEADDVLVKLVRLLANMSIHPAVGPLLAANTACIHLLMETLELRSMQESEELLVKVAATINNLSFYLEESS--EIRCNHLTTAKLMLKLMLSS-SMDATLEATRIFGNLSHHKDVRDFIMQNKVHRFVVTLLDSGSAEMCFSACGVLTNLALDPLNRVRLASEGALAKLVDCLGDFGPCDWQLAGQACRAVWNLT---GGGSEELLDTQER-EMLLRILTTYLDEGGLEKIEKE-----VKMEPHSACWELEFLPIAEELMKALQ 795          

HSP 2 Score: 63.929 bits (154), Expect = 7.875e-10
Identity = 37/83 (44.58%), Postives = 47/83 (56.63%), Query Frame = 2
Query:   86 VDRPIASSIINETRTWLNTVQTKRPFTPQTETRSLFGNHSQR-NPESRPPSVFSLGPRNFDTNPAALDSFSRPSSGPRLAPIN 331
            + +   S II E R  L    T+RPFTP+   R LFG +S R   ++RP S FS+  RNFD       S SRP+SG RL P+N
Sbjct:   17 MSKKTCSEIIREARQSLRVQSTQRPFTPKESHRQLFGANSVRAGHDNRPSSTFSVCARNFDA------SNSRPASGNRLPPLN 93          
BLAST of Armadillo repeat-containing protein 2 vs. Planmine SMEST
Match: SMESG000077074.1 (SMESG000077074.1)

HSP 1 Score: 1815.05 bits (4700), Expect = 0.000e+0
Identity = 929/934 (99.46%), Postives = 930/934 (99.57%), Query Frame = 2
Query:   20 ENKGTIDLNSNGSKGRAFYETPVDRPIASSIINETRTWLNTVQTKRPFTPQTETRSLFGNHSQRNPESRPPSVFSLGPRNFDTNPAALDSFSRPSSGPRLAPINKITLKDKAITDNKFSNEIRRNSSAWEDTKEQHDSERHQFQNVENFIKSRTNSLSNISNINEKQSNAKRKKGVLHSELNSTGLPPTSPTRTKPKLKPSVSIQHLSTEKRIXXXXXXXXXXXAEQTTRMSSPKPSRQRFMNSNRPDXXXXXXXXXXAKAYRTQSQKARSQSRHDCSEESETPRPQKNGSGEIDKSLKNKFSSNSQSDDQDIFFKDTLAPILDILSAPVEFRKQNSTEDFINLTKLLYSKLDEKGLLGKHCAFRSDILKAVFKVLDSTNPILVISAAKIILSMIVRDVNLLNICKLIFRVSKNKNNDKIFEEFEMANILIQTLSSVKPDQSHAALLYLMCTLKFLSKPEKSVGSENLSKNIISNSLINAGLLPSISNLLQKCSKINENEHCVNNSFADFIIQCFSCLINLESNPNISRKYFIQNQIPVVTVLTIQQYHHNNDLIFEAFRLLSRLTQYSDCCQLIEPKLSEFCPLCLNLMLNSRNDHLILRIAYIIGDMLTKSEEARLTLFPDKFSLDSFLKVFQVFIQKFQCCDENINKMSGDSMEKDSASVDDIIVKLLRVIANAAITESVGRMICHNKSCXXXXXXXXXXXXXXDKEELLTISISALNNISFYMTSANNPEIKNNHLKIIEALYKIIANKYGKDHLGGIIRVLGNLSRETYMRDWIVDNQLVEFLITILDSDNQDTIFFTVGVILNLMTDQNKRHLLLELNGITKLIEVLRDFASRDWQLAGLVCQTFWNYTEIISTTTEAILGGEENAEELLQLLTLFTDSDEVDNIHLNHYSDISTLDYLKNSWKSDFLPVAADLISRLELKMNRFEPL 2821
            ENKGTIDLNSNGSKGRAFYETPVDRPIASSIINETRTWLNTVQTKRPFTPQTETRSLFGNHSQRNPESRPPSVFSLGPRNFDTNPAALDSFSRPSSGPRLAPINKITLKDKAITDNKF NEIRRNSSAWEDTKEQHDSERHQFQNVENFIKSRTNSLSNISNINEKQSNAKRKK V HSELNSTGLPPTSPTRTKPKLKPSVSIQHLSTEKRISSGELSSRGSSAEQTTRMSSPKPSRQRFMNSNRPDSGSSCSSTSSAKAYRTQSQKARSQSRHDCSEESETPRPQKNGSGEIDKSLKNKFSSNSQSDDQDIFFKDTLAPILDILSAPVEFRKQNSTEDFINLTKLLYSKLDEKGLLGKHCAFRSDILKAVFKVLDSTNPILVISAAKIILSMIVRDVNLLNICKLIFRVSKNKNNDKIFEEFEMANILIQTLSSVKPDQSHAALLYLMCTLKFLSKPEKSVGSENLSKNIISNSLINAGLLPSISNLLQKCSKINENEHCVNNSFADFIIQCFSCLINLESNPNISRKYFIQNQIPVVTVLTIQQYHHNNDLIFEAFRLLSRLTQYSDCCQLIEPKLSEFCPLCLNLMLNSRNDHLILRIAYIIGDMLTKSEEARLTLFPDKFSLDSFLKVFQVFIQKFQCCDENINKMSGDSMEKDSASVDDIIVKLLRVIANAAITE VGRMIC+NKSCLNLLLSLINSKKILDKEELLTISISALNNISFYMTSANNPEIKNNHLKIIEALYKIIANKYGKDHLGGIIRVLGNLSRETYMRDWIVDNQLVEFLITILDSDNQDTIFFTVGVILNLMTDQNKRHLLLELNGITKLIEVLRDFASRDWQLAGLVCQTFWNYTEIISTTTEAILGGEENAEELLQLLTLFTDSDEVDNIHLNHYSDISTLDYLKNSWKSDFLPVAADLISRLELKMNRFEPL
Sbjct:   20 ENKGTIDLNSNGSKGRAFYETPVDRPIASSIINETRTWLNTVQTKRPFTPQTETRSLFGNHSQRNPESRPPSVFSLGPRNFDTNPAALDSFSRPSSGPRLAPINKITLKDKAITDNKFFNEIRRNSSAWEDTKEQHDSERHQFQNVENFIKSRTNSLSNISNINEKQSNAKRKKEVPHSELNSTGLPPTSPTRTKPKLKPSVSIQHLSTEKRISSGELSSRGSSAEQTTRMSSPKPSRQRFMNSNRPDSGSSCSSTSSAKAYRTQSQKARSQSRHDCSEESETPRPQKNGSGEIDKSLKNKFSSNSQSDDQDIFFKDTLAPILDILSAPVEFRKQNSTEDFINLTKLLYSKLDEKGLLGKHCAFRSDILKAVFKVLDSTNPILVISAAKIILSMIVRDVNLLNICKLIFRVSKNKNNDKIFEEFEMANILIQTLSSVKPDQSHAALLYLMCTLKFLSKPEKSVGSENLSKNIISNSLINAGLLPSISNLLQKCSKINENEHCVNNSFADFIIQCFSCLINLESNPNISRKYFIQNQIPVVTVLTIQQYHHNNDLIFEAFRLLSRLTQYSDCCQLIEPKLSEFCPLCLNLMLNSRNDHLILRIAYIIGDMLTKSEEARLTLFPDKFSLDSFLKVFQVFIQKFQCCDENINKMSGDSMEKDSASVDDIIVKLLRVIANAAITEPVGRMICYNKSCLNLLLSLINSKKILDKEELLTISISALNNISFYMTSANNPEIKNNHLKIIEALYKIIANKYGKDHLGGIIRVLGNLSRETYMRDWIVDNQLVEFLITILDSDNQDTIFFTVGVILNLMTDQNKRHLLLELNGITKLIEVLRDFASRDWQLAGLVCQTFWNYTEIISTTTEAILGGEENAEELLQLLTLFTDSDEVDNIHLNHYSDISTLDYLKNSWKSDFLPVAADLISRLELKMNRFEPL 953          
BLAST of Armadillo repeat-containing protein 2 vs. Planmine SMEST
Match: SMESG000077074.1 (SMESG000077074.1)

HSP 1 Score: 1813.89 bits (4697), Expect = 0.000e+0
Identity = 929/934 (99.46%), Postives = 930/934 (99.57%), Query Frame = 2
Query:   20 ENKGTIDLNSNGSKGRAFYETPVDRPIASSIINETRTWLNTVQTKRPFTPQTETRSLFGNHSQRNPESRPPSVFSLGPRNFDTNPAALDSFSRPSSGPRLAPINKITLKDKAITDNKFSNEIRRNSSAWEDTKEQHDSERHQFQNVENFIKSRTNSLSNISNINEKQSNAKRKKGVLHSELNSTGLPPTSPTRTKPKLKPSVSIQHLSTEKRIXXXXXXXXXXXAEQTTRMSSPKPSRQRFMNSNRPDXXXXXXXXXXAKAYRTQSQKARSQSRHDCSEESETPRPQKNGSGEIDKSLKNKFSSNSQSDDQDIFFKDTLAPILDILSAPVEFRKQNSTEDFINLTKLLYSKLDEKGLLGKHCAFRSDILKAVFKVLDSTNPILVISAAKIILSMIVRDVNLLNICKLIFRVSKNKNNDKIFEEFEMANILIQTLSSVKPDQSHAALLYLMCTLKFLSKPEKSVGSENLSKNIISNSLINAGLLPSISNLLQKCSKINENEHCVNNSFADFIIQCFSCLINLESNPNISRKYFIQNQIPVVTVLTIQQYHHNNDLIFEAFRLLSRLTQYSDCCQLIEPKLSEFCPLCLNLMLNSRNDHLILRIAYIIGDMLTKSEEARLTLFPDKFSLDSFLKVFQVFIQKFQCCDENINKMSGDSMEKDSASVDDIIVKLLRVIANAAITESVGRMICHNKSCXXXXXXXXXXXXXXDKEELLTISISALNNISFYMTSANNPEIKNNHLKIIEALYKIIANKYGKDHLGGIIRVLGNLSRETYMRDWIVDNQLVEFLITILDSDNQDTIFFTVGVILNLMTDQNKRHLLLELNGITKLIEVLRDFASRDWQLAGLVCQTFWNYTEIISTTTEAILGGEENAEELLQLLTLFTDSDEVDNIHLNHYSDISTLDYLKNSWKSDFLPVAADLISRLELKMNRFEPL 2821
            ENKGTIDLNSNGSKGRAFYETPVDRPIASSIINETRTWLNTVQTKRPFTPQTETRSLFGNHSQRNPESRPPSVFSLGPRNFDTNPAALDSFSRPSSGPRLAPINKITLKDKAITDNKF NEIRRNSSAWEDTKEQHDSERHQFQNVENFIKSRTNSLSNISNINEKQSNAKRKK V HSELNSTGLPPTSPTRTKPKLKPSVSIQHLSTEKRISSGELSSRGSSAEQTTRMSSPKPSRQRFMNSNRPDSGSSCSSTSSAKAYRTQSQKARSQSRHDCSEESETPRPQKNGSGEIDKSLKNKFSSNSQSDDQDIFFKDTLAPILDILSAPVEFRKQNSTEDFINLTKLLYSKLDEKGLLGKHCAFRSDILKAVFKVLDSTNPILVISAAKIILSMIVRDVNLLNICKLIFRVSKNKNNDKIFEEFEMANILIQTLSSVKPDQSHAALLYLMCTLKFLSKPEKSVGSENLSKNIISNSLINAGLLPSISNLLQKCSKINENEHCVNNSFADFIIQCFSCLINLESNPNISRKYFIQNQIPVVTVLTIQQYHHNNDLIFEAFRLLSRLTQYSDCCQLIEPKLSEFCPLCLNLMLNSRNDHLILRIAYIIGDMLTKSEEARLTLFPDKFSLDSFLKVFQVFIQKFQCCDENINKMSGDSMEKDSASVDDIIVKLLRVIANAAITE VGRMIC+NKSCLNLLLSLINSKKILDKEELLTISISALNNISFYMTSANNPEIKNNHLKIIEALYKIIANKYGKDHLGGIIRVLGNLSRETYMRDWIVDNQLVEFLITILDSDNQDTIFFTVGVILNLMTDQNKRHLLLELNGITKLIEVLRDFASRDWQLAGLVCQTFWNYTEIISTTTEAILGGEENAEELLQLLTLFTDSDEVDNIHLNHYSDISTLDYLKNSWKSDFLPVAADLISRLELKMNRFEPL
Sbjct:   25 ENKGTIDLNSNGSKGRAFYETPVDRPIASSIINETRTWLNTVQTKRPFTPQTETRSLFGNHSQRNPESRPPSVFSLGPRNFDTNPAALDSFSRPSSGPRLAPINKITLKDKAITDNKFFNEIRRNSSAWEDTKEQHDSERHQFQNVENFIKSRTNSLSNISNINEKQSNAKRKKEVPHSELNSTGLPPTSPTRTKPKLKPSVSIQHLSTEKRISSGELSSRGSSAEQTTRMSSPKPSRQRFMNSNRPDSGSSCSSTSSAKAYRTQSQKARSQSRHDCSEESETPRPQKNGSGEIDKSLKNKFSSNSQSDDQDIFFKDTLAPILDILSAPVEFRKQNSTEDFINLTKLLYSKLDEKGLLGKHCAFRSDILKAVFKVLDSTNPILVISAAKIILSMIVRDVNLLNICKLIFRVSKNKNNDKIFEEFEMANILIQTLSSVKPDQSHAALLYLMCTLKFLSKPEKSVGSENLSKNIISNSLINAGLLPSISNLLQKCSKINENEHCVNNSFADFIIQCFSCLINLESNPNISRKYFIQNQIPVVTVLTIQQYHHNNDLIFEAFRLLSRLTQYSDCCQLIEPKLSEFCPLCLNLMLNSRNDHLILRIAYIIGDMLTKSEEARLTLFPDKFSLDSFLKVFQVFIQKFQCCDENINKMSGDSMEKDSASVDDIIVKLLRVIANAAITEPVGRMICYNKSCLNLLLSLINSKKILDKEELLTISISALNNISFYMTSANNPEIKNNHLKIIEALYKIIANKYGKDHLGGIIRVLGNLSRETYMRDWIVDNQLVEFLITILDSDNQDTIFFTVGVILNLMTDQNKRHLLLELNGITKLIEVLRDFASRDWQLAGLVCQTFWNYTEIISTTTEAILGGEENAEELLQLLTLFTDSDEVDNIHLNHYSDISTLDYLKNSWKSDFLPVAADLISRLELKMNRFEPL 958          
The following BLAST results are available for this feature:
BLAST of Armadillo repeat-containing protein 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ARMC23.326e-7532.08armadillo repeat containing 2 [Source:HGNC Symbol;... [more]
ARMC22.154e-7432.03armadillo repeat containing 2 [Source:HGNC Symbol;... [more]
ARMC21.145e-1148.28armadillo repeat containing 2 [Source:HGNC Symbol;... [more]
back to top
BLAST of Armadillo repeat-containing protein 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Armadillo repeat-containing protein 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG326686.978e-1726.73gene:FBgn0052668 transcript:FBtr0073469[more]
back to top
BLAST of Armadillo repeat-containing protein 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
armc25.225e-7429.76armadillo repeat containing 2 [Source:ZFIN;Acc:ZDB... [more]
back to top
BLAST of Armadillo repeat-containing protein 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ARMC23.198e-7730.37armadillo repeat containing 2 [Source:NCBI gene;Ac... [more]
ARMC23.822e-7730.37armadillo repeat containing 2 [Source:NCBI gene;Ac... [more]
ARMC26.685e-7730.37armadillo repeat containing 2 [Source:NCBI gene;Ac... [more]
back to top
BLAST of Armadillo repeat-containing protein 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Armc21.690e-7631.14armadillo repeat containing 2 [Source:MGI Symbol;A... [more]
Armc21.690e-7631.14armadillo repeat containing 2 [Source:MGI Symbol;A... [more]
Armc22.172e-1347.42armadillo repeat containing 2 [Source:MGI Symbol;A... [more]
Armc25.905e-1049.30armadillo repeat containing 2 [Source:MGI Symbol;A... [more]
Armc25.905e-1049.30armadillo repeat containing 2 [Source:MGI Symbol;A... [more]
back to top
BLAST of Armadillo repeat-containing protein 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|P0C6R2|ARMC2_BOVIN6.684e-7931.66Armadillo repeat-containing protein 2 OS=Bos tauru... [more]
sp|Q3URY6|ARMC2_MOUSE1.182e-7531.14Armadillo repeat-containing protein 2 OS=Mus muscu... [more]
sp|Q8NEN0|ARMC2_HUMAN1.597e-7432.08Armadillo repeat-containing protein 2 OS=Homo sapi... [more]
back to top
BLAST of Armadillo repeat-containing protein 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267FPF41.860e-10333.38Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A1I8HSM52.439e-10333.38Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8IZG45.324e-10333.38Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A210QY652.761e-10129.82Armadillo repeat-containing protein 2 OS=Mizuhopec... [more]
A0A1S3HIR41.320e-9731.85armadillo repeat-containing protein 2 isoform X1 O... [more]
back to top
BLAST of Armadillo repeat-containing protein 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
armc21.370e-7528.06armadillo repeat containing 2 [Source:NCBI gene;Ac... [more]
back to top
BLAST of Armadillo repeat-containing protein 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000008172.13.719e-4924.60pep scaffold:Pmarinus_7.0:GL483636:726:13521:1 gen... [more]
back to top
BLAST of Armadillo repeat-containing protein 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Armadillo repeat-containing protein 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO328192.177e-7532.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO287761.326e-4135.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Armadillo repeat-containing protein 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
armc26.532e-7428.06armadillo repeat containing 2 [Source:NCBI gene;Ac... [more]
back to top
BLAST of Armadillo repeat-containing protein 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000077074.10.000e+099.46SMESG000077074.1[more]
SMESG000077074.10.000e+099.46SMESG000077074.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019328 ID=SMED30019328|Name=Armadillo repeat-containing protein 2|organism=Schmidtea mediterranea sexual|type=transcript|length=3092bp
TTTTATATAAAATTGAATGGAAAATAAAGGTACAATAGATTTAAATTCAA
ATGGGAGTAAAGGAAGAGCATTTTATGAAACTCCTGTTGACAGACCTATT
GCTTCATCTATTATAAATGAAACAAGAACTTGGTTAAATACAGTTCAAAC
TAAACGACCATTTACACCTCAAACTGAAACTCGATCCTTATTTGGAAATC
ATAGTCAACGTAATCCAGAAAGTAGACCACCAAGTGTTTTTAGTTTAGGT
CCAAGAAATTTTGACACAAACCCTGCTGCCTTAGATTCATTCAGCCGTCC
TAGTTCTGGCCCTAGATTGGCTCCAATAAATAAAATCACACTGAAAGATA
AAGCAATAACAGACAACAAATTTTCTAATGAAATTAGACGCAACAGCAGT
GCATGGGAGGATACAAAGGAACAACATGATTCAGAAAGGCATCAGTTTCA
AAATGTGGAAAACTTTATAAAATCTAGAACTAATTCTCTTTCAAATATAT
CCAATATCAACGAAAAACAATCTAATGCAAAAAGGAAAAAAGGAGTTCTG
CATTCTGAATTAAATTCAACTGGATTACCACCAACATCCCCTACAAGAAC
AAAGCCTAAACTCAAACCTTCGGTATCCATTCAACACCTGAGTACTGAGA
AAAGAATCAGCTCAGGCGAACTTTCTAGTAGAGGATCATCTGCTGAACAA
ACCACTCGAATGTCTTCCCCAAAACCTAGTAGACAAAGGTTTATGAATAG
CAATCGTCCCGATAGCGGTTCATCGTGTTCATCTACATCAAGCGCCAAAG
CTTACAGAACTCAGTCACAGAAAGCAAGGAGCCAGAGTCGTCACGATTGT
TCAGAAGAATCTGAAACTCCTCGACCTCAAAAGAATGGTAGTGGAGAAAT
TGATAAATCCCTCAAAAATAAATTTAGTAGTAACAGTCAGAGTGACGATC
AAGATATATTTTTTAAAGATACACTGGCTCCCATATTAGATATTTTAAGT
GCCCCTGTTGAATTCAGAAAGCAAAATAGTACCGAAGACTTCATTAATTT
GACTAAATTACTTTATTCCAAACTTGATGAAAAAGGCTTGTTGGGAAAAC
ATTGTGCTTTCCGTTCAGATATTTTGAAAGCAGTCTTCAAAGTCCTCGAT
TCAACGAATCCAATCCTAGTCATTTCTGCAGCAAAGATCATTTTATCAAT
GATAGTTCGAGATGTAAATTTACTAAATATCTGCAAACTTATATTCCGAG
TATCAAAAAATAAAAACAATGACAAAATATTTGAGGAATTCGAAATGGCA
AACATCTTAATTCAGACACTTTCAAGTGTGAAGCCAGATCAATCACATGC
CGCTCTTTTATATTTGATGTGTACATTAAAATTTTTATCAAAACCAGAAA
AGTCAGTCGGATCTGAAAACCTGTCTAAAAATATTATTTCAAATTCTTTA
ATTAATGCTGGATTACTTCCTTCGATTTCTAATCTTCTTCAGAAATGTAG
TAAAATTAATGAAAATGAACATTGTGTAAATAATTCATTTGCCGATTTTA
TTATTCAGTGCTTTAGTTGCCTTATAAATCTGGAAAGTAATCCAAATATT
TCCCGAAAATATTTCATTCAGAATCAAATTCCTGTGGTCACAGTGCTGAC
AATTCAGCAATATCACCATAATAATGATCTAATATTTGAAGCCTTCCGTT
TATTAAGCCGATTAACACAATATAGTGATTGTTGTCAATTGATTGAACCG
AAATTATCAGAATTTTGCCCTCTGTGCTTAAATTTGATGCTAAATTCACG
AAATGATCATCTTATTCTGCGAATCGCATATATTATCGGGGATATGCTTA
CCAAATCAGAAGAAGCTCGACTTACCTTATTTCCAGATAAATTTAGTCTT
GATAGTTTCTTAAAAGTGTTTCAAGTATTTATTCAAAAATTTCAATGTTG
TGATGAAAATATAAATAAAATGTCTGGAGATTCAATGGAAAAAGACTCAG
CATCTGTTGATGATATAATCGTAAAACTGTTGCGAGTCATTGCAAATGCT
GCCATAACAGAATCTGTCGGTCGAATGATATGTCACAATAAATCATGCTT
AAATCTTCTGCTATCTCTTATTAATTCAAAAAAAATTCTAGATAAAGAAG
AGCTTTTGACGATTTCAATATCAGCGCTGAATAATATTTCATTTTATATG
ACATCAGCTAACAATCCTGAAATAAAAAACAATCATTTAAAAATAATTGA
AGCACTTTATAAAATTATTGCTAATAAATATGGTAAAGATCATTTGGGTG
GAATTATACGAGTGTTGGGAAATCTGTCAAGAGAAACGTATATGAGAGAT
TGGATAGTTGATAATCAACTTGTCGAGTTCCTCATAACGATTCTAGATTC
AGACAATCAAGATACTATTTTCTTTACAGTTGGGGTTATACTTAACCTTA
TGACCGATCAAAATAAAAGACATTTATTACTCGAATTAAATGGAATCACA
AAGCTGATAGAAGTTCTCAGAGACTTTGCTTCAAGAGATTGGCAACTAGC
TGGACTTGTTTGTCAAACATTTTGGAACTATACTGAAATCATCAGTACAA
CAACAGAAGCTATTTTAGGAGGAGAAGAAAATGCTGAAGAACTATTACAA
CTTCTAACTCTGTTTACCGACTCGGATGAAGTGGATAATATTCATTTGAA
CCACTATAGCGATATTAGCACACTTGATTATTTGAAAAACAGTTGGAAAA
GTGATTTTCTTCCCGTAGCAGCTGATCTTATATCAAGACTTGAACTGAAA
ATGAATCGTTTTGAACCGTTGTAATTAAGATAGAAAAAATGGTTTAAAGC
TGCAATTTGTCCAGTCAACTAAGATCTCTTATAACAACGGCCTGTAGACT
AATGTCCAGCAAATACACATATATAAATATATATATCATTGAATACATTT
ATTAAGTTTGACAGTGTGTTCAAAAGAAAATGAATTTTTAAATTAAGACA
AAATATTTACAAGTTTTAATTTTTTGAATATTTACAAAATTTGTTAATAA
ATATCAATGAAATTGTCAAATATCTCATCGAATTGTTGATTA
back to top

protein sequence of SMED30019328-orf-1

>SMED30019328-orf-1 ID=SMED30019328-orf-1|Name=SMED30019328-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=936bp
MENKGTIDLNSNGSKGRAFYETPVDRPIASSIINETRTWLNTVQTKRPFT
PQTETRSLFGNHSQRNPESRPPSVFSLGPRNFDTNPAALDSFSRPSSGPR
LAPINKITLKDKAITDNKFSNEIRRNSSAWEDTKEQHDSERHQFQNVENF
IKSRTNSLSNISNINEKQSNAKRKKGVLHSELNSTGLPPTSPTRTKPKLK
PSVSIQHLSTEKRISSGELSSRGSSAEQTTRMSSPKPSRQRFMNSNRPDS
GSSCSSTSSAKAYRTQSQKARSQSRHDCSEESETPRPQKNGSGEIDKSLK
NKFSSNSQSDDQDIFFKDTLAPILDILSAPVEFRKQNSTEDFINLTKLLY
SKLDEKGLLGKHCAFRSDILKAVFKVLDSTNPILVISAAKIILSMIVRDV
NLLNICKLIFRVSKNKNNDKIFEEFEMANILIQTLSSVKPDQSHAALLYL
MCTLKFLSKPEKSVGSENLSKNIISNSLINAGLLPSISNLLQKCSKINEN
EHCVNNSFADFIIQCFSCLINLESNPNISRKYFIQNQIPVVTVLTIQQYH
HNNDLIFEAFRLLSRLTQYSDCCQLIEPKLSEFCPLCLNLMLNSRNDHLI
LRIAYIIGDMLTKSEEARLTLFPDKFSLDSFLKVFQVFIQKFQCCDENIN
KMSGDSMEKDSASVDDIIVKLLRVIANAAITESVGRMICHNKSCLNLLLS
LINSKKILDKEELLTISISALNNISFYMTSANNPEIKNNHLKIIEALYKI
IANKYGKDHLGGIIRVLGNLSRETYMRDWIVDNQLVEFLITILDSDNQDT
IFFTVGVILNLMTDQNKRHLLLELNGITKLIEVLRDFASRDWQLAGLVCQ
TFWNYTEIISTTTEAILGGEENAEELLQLLTLFTDSDEVDNIHLNHYSDI
STLDYLKNSWKSDFLPVAADLISRLELKMNRFEPL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR038905ARMC2
IPR011989ARM-like
IPR016024ARM-type_fold
Vocabulary: molecular function
TermDefinition
GO:0005488binding
GO:0016491oxidoreductase activity
GO:0016614oxidoreductase activity, acting on CH-OH group of donors
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR011989Armadillo-like helicalGENE3DG3DSA:1.25.10.10coord: 659..890
e-value: 2.4E-9
score: 38.4
IPR011989Armadillo-like helicalGENE3DG3DSA:1.25.10.10coord: 301..658
e-value: 1.4E-7
score: 32.5
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..21
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..16
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 269..283
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 182..268
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 157..294
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 47..76
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 47..70
IPR038905Armadillo repeat-containing protein 2PANTHERPTHR21356ARMADILLO REPEAT CONTAINING 2coord: 26..925
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 663..873
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 291..634