TIR domain-containing protein

Overview
NameTIR domain-containing protein
Smed IDSMED30019321
Length (bp)2036
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TIR domain-containing protein (SMED30019321) t-SNE clustered cells

Violin plots show distribution of expression levels for TIR domain-containing protein (SMED30019321) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TIR domain-containing protein (SMED30019321) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TIR domain-containing protein (SMED30019321) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019321

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 15

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30019321SMESG000079659.1 SMESG000079651.1 Contig154newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30019321SMESG000079659.1 SMESG000079651.1 Contig154uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal ventral margin of the whole animalSMED30019321SMESG000079659.1 SMESG000079651.1 Contig154newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal ventral margin of the whole animalSMED30019321SMESG000079659.1 SMESG000079651.1 Contig154uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30019321SMESG000079659.1 SMESG000079651.1 Contig154newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30019321SMESG000079659.1 SMESG000079651.1 Contig154uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30019321SMESG000033382.1 Contig154newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30019321SMESG000033382.1 Contig154uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal ventral margin of the whole animalSMED30019321SMESG000033382.1 Contig154newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal ventral margin of the whole animalSMED30019321SMESG000033382.1 Contig154uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30019321SMESG000033382.1 Contig154newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30019321SMESG000033382.1 Contig154uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
protonephridiaSMED30019321SMESG000079651.1 dd_Smed_v4_1838_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30019321SMESG000079651.1 dd_Smed_v4_1838_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30019321SMESG000079651.1 dd_Smed_v4_1838_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TIR domain-containing protein vs. TrEMBL
Match: A0A210QF19 (Vacuolar protein 8 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT22612 PE=4 SV=1)

HSP 1 Score: 223.402 bits (568), Expect = 1.149e-59
Identity = 149/550 (27.09%), Postives = 290/550 (52.73%), Query Frame = 2
Query:  302 ICNSYFDWENHINKICQLFIEKHLLDTVYIYLDYFHRKLNIKDKLVNY--LYTL--LTNFSDASVEFAQNLNSSKVLPFIIDQCTKKEFINDIHDENIKEHLENCVLVVSNVARDLGNQIEYKEKELKESLIEFIKLGNE-DKLAIQSMLTLSYIINDSEVNLLVEGSNTVNGILMLIKETCSIEGRE-GNYSIPELMLGLFRISANNEIKEKINQNGGIPIIIDILHAKVENEIELTLGTIYNLCFNQEIKQKLIDEFEIENSIKLYENHVNPVIKKYHDGIMWEIRGXXXXXXXXXXXXXXXFDVFVSYAHQNKSKVMEIFNELKKWNIRIWIDKEQMTGSVLEAMARGIENSRFFIIGISPYYEKSPNCRSEAEYAYQRQKTIIPMILACRFKPEGWLGFIRGMKMYYEISERRNVEEVMEDLVHTLKTGMGDNGEQGKSEHFKEPGPH-TDENAVANKSINEK-----------IKNWSTAETASWLDDSKLGHLKKRLNDLDGKLLYVMLDIRSKSPDYFNKTLKKEFGMKFMEVLKFHNALNNL 1897
            + ++Y+ +  H  KI     E    +     L   + K   K   + +   YTL  L NF+DAS+  A+ +  S  + F    C+ + F+ ++ ++N+   +++ + ++ N+AR+      +KE +  + +++F++   E + L I +MLTLS+I+ + E + L++ + ++ G +  I +    E R    ++  ELM GL +++ N+  K+KI + G +P+ + +L +    E  +T   I+ L F++E+ QK+++  ++  S++      +  ++K  +G ++ ++G+N++ ++    KK++  VF+SY+   K  V++I   LK   + +WID E+M GS L AMA  +EN+   ++ +S  Y++SPNCR EAEY +Q +K  IP+++  +++P+GWLG I G K+Y++ S +   E+    L   L+ G+G       +     PG   TD   +A  +                   +T +  +WL   KL      L   DGKLL  +  ++ ++P+++  +L+K+  M  +E+L F  AL+ L
Sbjct:  165 LGDTYWGYRPHRKKIGDSMAEAGFGEVAMKMLKSLNAKGIFKTDSIWFPAYYTLNTLWNFTDASLRLAKTVAESDGVRFFTVNCSHEPFLTNLDNKNVYYIVKSSMSIIHNIARNPDVIHFFKENKTTDVMLKFVRSYEEHEMLKIMAMLTLSHIVEEEENDKLMDDTGSIEGTIKYIDKAIEDERRRYRGFTPQELMDGLGKLAVNDNNKKKIVEAGALPVFMKMLKSDSAEEQTVTARAIWTLSFDKEVSQKIVEHPDMMTSLEKLRESSDSDVRKNVNGALFVLKGENDVSRRPRSGKKNKGHVFISYSWNEKEIVLKIRERLKAEGVEVWIDIERMGGSTLTAMAEAVENAAVVLLCMSEKYKQSPNCRLEAEYTFQLRKDYIPLMMQKKYRPDGWLGAILGAKLYFDFSGKYPFEKPWNGLQKELR-GIGRLSTPSAT-----PGKDVTDGPIMATSACTAASSPGSLSTSSHAHKMTTEDVGNWLCQVKLDGCVPSLAQFDGKLLVQLQRMKVEAPEFYYASLEKKLNMNLVEILTFTEALDKL 708          
BLAST of TIR domain-containing protein vs. TrEMBL
Match: A0A0L8HV44 (TIR domain-containing protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22006151mg PE=4 SV=1)

HSP 1 Score: 204.527 bits (519), Expect = 2.233e-53
Identity = 131/508 (25.79%), Postives = 266/508 (52.36%), Query Frame = 2
Query:  443 YLYTLLTNFSDASVEFAQNLNSSKVLPFIIDQCTKKEFINDIHDENIKEHLENCVLVVSNVARDLGNQIEYKEKELKESLIEFIKLGNEDKLAIQSMLTLSYIINDSEVNLLVEGSNTVNGILMLIKETCSIEGREGNYSIP-ELMLGLFRISANNEIKEKINQNGGIPIIIDILHAKVENEIELTLGTIYNLCFNQEIKQKLI-DEFEIENSIKLYENHVNPVIKKYHDGIMWEIRGXXXXXX--XXXXXXXXXFDVFVSYAHQNKSKVMEIFNELKKWNIRIWIDKEQMTGSVLEAMARGIENSRFFIIGISPYYEKSPNCRSEAEYAYQRQKTIIPMILACRFKPEGWLGFIRGMKMYYEISERRNVEEVMEDLVHTLKT----GMGDNGEQGKSEHFKEPGPHTDENAVANKSINEKIK---------------NWSTAETASWLDDSKLGHLKKRLNDLDGKLLYVMLDIRSKSPDYFNKTLKKEFGMKFMEVLKFHNALNNL 1897
            Y Y  + NFSDAS + A +L  S  +  +   C  K ++N IH +N+   ++  + ++ N+AR+   +  +KE++  E +  FI    ++   + SM+T++YI+ + +   L+E + ++  +L  + +      R      P E++ GL +++  +  K KI   G + ++  +L      E       ++ L F++ ++++LI DE  +   ++  +++ + ++     G++W + G  ++ +  KE+   +++  VF+SY+  +K  V  I + LK+   ++WID + M  S L+AMA GIEN+   +I +S  Y++SP+CR+EAEY ++ +K  IPM++  ++ P+GWLG + G K++++ S +   E+    L+  L+       GD    G  +   + G  T+ +    +S ++KI                  +  E ASWL   KL    +  +  DGK+L+ + +++ ++P+YF + ++K+  M  ++ L+F  AL ++
Sbjct:  118 YAYNTMWNFSDASAQLALSLAESDAVRLLTCNCGHKPYLNAIHSKNVHYIIKASLSILHNIARNPSIKHYFKEQKTSEVIQTFIS-SKDEMFKVLSMMTMAYIVEEEDNQTLIEETGSILCMLQWLDKALDCNKRRYKGFTPYEIVQGLEKLAVTDSNKLKIVDGGILSMLSRMLQFDDVREQCSAARILWTLMFDENVRERLINDEQALVTLLESLKDNKDKLVSANVKGVLWLLNGATQVTEVDKETVRARAKTHVFISYSVVDKESVWRIRDRLKEEGYQLWIDVDCMGPSNLQAMASGIENAAVVLICMSEKYKQSPSCRTEAEYTFRLRKDYIPMMMQKKYNPDGWLGTMLGAKLFFDFSGKYPFEKSFGGLIKELRGRGQYSPGDAQVDGAEDQTNKAGTSTENSGNEQQSPSKKISIDHLVNDIGALSPIVEMTNDEIASWLHYHKLAEYSEAFSQFDGKMLFQLSEMKKEAPEYFYQCMEKKMNMSLVDTLRFTAALASI 624          
BLAST of TIR domain-containing protein vs. TrEMBL
Match: W4XMC6 (TIR domain-containing protein OS=Strongylocentrotus purpuratus OX=7668 PE=4 SV=1)

HSP 1 Score: 200.29 bits (508), Expect = 5.505e-53
Identity = 130/485 (26.80%), Postives = 260/485 (53.61%), Query Frame = 2
Query:  521 PFI--IDQCTKKEFINDIHDENIKEHLENCVLVVSNVARDLGNQIEYKEKELKESLIEFIKLGNEDKLAIQSMLTLSYIINDSEVNLLVE-GSNTVNGILMLIKETC-SIEGREGNYSIPELMLGLFRISANNEIKEKINQNGGIPIIIDILHAKVENEIELTLGTIYNLCFNQEIKQKLIDEFEIENSIKLYENHVNPVIKKYHDGIMWEI----------RGXXXXXXXXXXXXXXXFDVFVSYAHQNKSKVMEIFNELKKWNIRIWIDKEQMTGSVLEAMARGIENSRFFIIGISPYYEKSPNCRSEAEYAYQRQKTIIPMILACRFKPEGWLGFIRGMKMYYEISERRNVEEVMEDLVHTLKTGMGDNGEQGKSEHFKEPGPHTDENAVANKSINEKIK-----------NWSTAETASWLDDSKLGHLKKRLNDLDGKLLYVMLDIRSKSPDYFNKTLKKEFGM-KFMEVLKFHNALNNL 1897
            P++  +   T    + +  +E + E     + ++ N+A+  GN+  Y+E+++ ES+  F++   +  L   SM+TL+YI+ + +  +L E G+NT+  ++ ++K+   S + R    S+ E+   L R++ ++  K KI + GG+P++I +LH +     E +   ++NL F+ ++ +KL    +   +++      +  + K  +G +W I          +   +         + +  + +SY    +  V+++ + L K    IW+D + M GS L+AMA  IEN+   ++ +S  Y++SPNCR+EAEYA+Q +K IIP+++   ++P+GWLG I G K Y + S R ++EE M  L+  ++    +     K +        TD+  +   SI+  ++           +WS ++   WL +++L HL+  + + +GKLL  +  +R ++PD+F  ++K++FG+ K +++L+F  AL++L
Sbjct:    9 PYLKAVSMMTLAYIVEEGQEEILAEKGTTSLNILHNLAKAPGNKHVYREEKVVESMEPFLE--GDPYLKAVSMMTLAYIVEEGQEEILAEKGTNTIEYLVEILKDAQNSKDKRCQGLSVEEVTAALGRLAVHDNNKYKIVEAGGLPLMISMLHDESVETQEASAHAVWNLAFSDDVSEKLRSNTDCMMALQDLSTSSSSEVAKAANGALWVINKEGEKKDLVKENEDDTGLGHSLSRKQPHIMLSYQWGCQPLVLKMRDVLAKAGYNIWVDVDCMYGSTLQAMAEAIENACAIVMCMSERYKESPNCRTEAEYAFQLRKRIIPVMMEEYYQPDGWLGIILGAKFYMDFSGRLDIEEEMNKLLKEVQMHSAEAKIIYKDD--------TDDGVLVGASISFPLESAGISIKMESLDWSASQVQDWLIENELEHLRPLMAEYNGKLLNQLYKMRQEAPDFFYLSIKEDFGLKKLIDILRFTEALDSL 483          
BLAST of TIR domain-containing protein vs. TrEMBL
Match: A0A2B4RLI9 (U-box domain-containing protein 4 OS=Stylophora pistillata OX=50429 GN=PUB4 PE=4 SV=1)

HSP 1 Score: 195.282 bits (495), Expect = 2.114e-49
Identity = 148/519 (28.52%), Postives = 277/519 (53.37%), Query Frame = 2
Query:  422 IKDKLVNYLYTLLTNFSDASVEFAQNLNSSKVLPFIIDQCTKKEFINDIHDENIK----------------EHLENCVLVVSNVARDLGNQIEYKEKELKESLIEFIKLGNEDKLAIQSMLTLSYIINDSEVNLLVEGSNTVNGILMLIKETCSIE-GREGNYSIPELMLGLFRISANNEIKEKINQNGGIPIIIDILH-AKVENEIELTLGTIYNLCFNQEIKQKLI-DEFEIENSIKLYENHVNPVIKKYHDGIMWEIRGXXXXX--XXXXXXXXXXFDVFVSYAHQNKSKVMEIFNELKKWNIRIWIDKEQMTGSVLEAMARGIENSRFFIIGISPYYEKSPNCRSEAEYAYQRQKTIIPMILACRFKPEGWLGFIRGMKMYYEISERRNVEEVMEDLVHTLKTGMGDNGEQGKSEHFKEPGPHTDENAVANKSINEKIKNWSTAETASWLDDSKLGHLKKRLND-----LDGKLLYVMLDIRSKSPDYFNKTLKKEFGM-KFMEVLKFHNALNNL 1897
            ++D +  +L TLL N+SD   EF    N   ++   ++   K   + D    N+K                + L   + ++ N+++ +  +  +   +   SL+  +        + +S+L L+Y+I++   +L++  +  +N ++ L+++    +  R   +S  E+  GL +I+ N+  K+ I + G IPI++++L  AK + E      T++ L F++E K+ +  DE       KL  ++ N  +KK   G +WEI GK +    K++S  K     V +SY    +  V++I N+L+    ++W+D ++M GS LE+MAR +EN+   ++ +S  Y++SPNCRSEAEY YQ  K IIP+++  +++P+GWLGFI G K + + SE+  ++  ++ LV  L       G +GK E  +E         V + S    I++W++++  +WL D  +G LK RL+      L+G++L  + D+R +SP++F  +++ +F +    +VL+F +AL+ L
Sbjct:  231 LQDIICLFLGTLL-NYSDLHDEFCLECNEVGMVQLFVEMSKK---LQDSIPHNVKYVEPKTQRLKKFTVRGKMLSRSLGILHNLSKRVPTRTNFASAQAVNSLLLPLLKAEITFYSAKSLLVLAYLIDEQNNHLIMADAEPINFLIRLLRKAIGTDYHRYLGFSAREIAEGLTQIAVNDNNKKTIVKCGAIPILVNMLQNAKDDEERVNACNTLWTLAFDEENKKNIKEDEHACAELRKLLTSN-NREVKKAAAGALWEIEGKEKHAEDKQQSVKKSDAKHVMISYQWDVQKLVIQIKNKLQSDGFKVWMDIDEMGGSTLESMARAVENASVVLVCVSQKYKESPNCRSEAEYTYQLHKDIIPLMMDGKYRPDGWLGFIVGSKFWIDFSEKHKLDSNVDKLVKEL-------GTRGKIE-LQENAMKATVMDVVDASPQSTIRSWTSSDVKAWLMD--VG-LKDRLDSNTLKRLNGQILLRLQDLRKESPEFFYSSVRTDFKLGTVFDVLEFVDALDKL 733          
BLAST of TIR domain-containing protein vs. TrEMBL
Match: W4XJB9 (TIR domain-containing protein OS=Strongylocentrotus purpuratus OX=7668 PE=4 SV=1)

HSP 1 Score: 188.348 bits (477), Expect = 6.744e-48
Identity = 133/498 (26.71%), Postives = 260/498 (52.21%), Query Frame = 2
Query:  446 LYTLLTNFSDASVEFAQNLNSSKVLPFIIDQCTKKEFINDIHDENIKEHLENCVLVVSNVARDLGNQIEYKEKELKESLIEFIKLGNEDKLAIQSMLTLSYIINDSEVNLLVEG-SNTVNGILMLIKETC-SIEGREGNYSIPELMLGLFRISANNEIKEKINQNGGIPIIIDILHAKVENEIELTLGTIYNLCFNQEIKQKLIDEFE----IENSIKLYENHVNPVIKKYHDGIMWEI-RGXXXXXXXXXXXXXXXFD------VFVSYAHQNKSKVMEIFNELKKWNIRIWIDKEQMTGSVLEAMARGIENSRFFIIGISPYYEKSPNCRSEAEYAYQRQKTIIPMILACRFKPEGWLGFIRGMKMYYEISERRNVEEVMEDLVHTLKTGMGDNGEQGKSEHFKEPGPHTDENAVANKSINEKIKNWSTAETASWLDDSKLGHLKKRLNDLDGKLLYVMLDIRSKSPDYFNKTLKKEFGM-KFMEVLKFHNALNNL 1897
            +Y  L N S+AS+  +  +    ++        K      I D  I   +   + ++ N++   GN+  ++E+ + E +  ++K   +  L    M+TL+YII + + + L+E  ++T+  ++ ++++   S   R       E+ L L R++ ++  K KI + GG+P+++ +L  K  +  E    TI+NL F+++ +QK+ +  +    +E+  +  E+HV    K    G +W I +G+ +  +KE +++  + +      + +SY   ++  V+ I + LK    ++W+D + M GS L+AMA  +E S   ++ IS  Y++SPNCR+EAEY ++  K IIP+++   ++P+GWLG I G K+Y + S + +  E M+ L+  ++T   D G+  K    KE    T  +   N     ++ +WS  +   WL +S L   +  L + DG  L+ +  +R ++P++F  +++ + G+ K  E+ KF  AL  +
Sbjct:   86 IYNHLCNLSEASLVLSIQMGEKGMVKLCSSNIVKYRGKMSIRD--ILSLIRVSLGILCNMSTTPGNRHLFREEGVAEKMQPYLK--GDPFLKTICMITLAYIIEEGQEDSLIEKETDTIEYLVGILRDAVKSPNKRFQGLCDREIALALGRLAVHDSSKCKILKAGGLPLLVKMLEDKSADTQEAAANTIWNLAFSEDGRQKIAENKDCLKLLESLTQCSESHVADAAK----GALWVITQGQAKQVEKEVEAEGMQGEEKSYSHIMISYQWGSQPVVLTIRDALKAAGYQVWLDVDHMHGSTLQAMAEAVEKSYVVLMCISEGYKESPNCRTEAEYTFKLGKCIIPVMMEEYYQPDGWLGIILGSKLYMDFSGKLDQTEEMKKLLREVQTNHADAGDTVKRAEVKEVKLLTQLSTQPNTP--SQVLSWSNEQVQDWLKNSGLDKWRPSLQEYDGTFLFNLHKLRLEAPEFFYSSIQDDQGLQKLREIFKFTAALETV 573          
BLAST of TIR domain-containing protein vs. Ensembl Nematostella
Match: EDO45030 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RU69])

HSP 1 Score: 188.348 bits (477), Expect = 1.649e-50
Identity = 140/519 (26.97%), Postives = 273/519 (52.60%), Query Frame = 2
Query:  410 RKLNIKDKLVNYLYTLLTNFSDASVEFAQNLNSSKVLPFIIDQCTKKEFINDIHDENIKEH----------------LENCVLVVSNVARDLGNQIEYKEKELKESLIEFIKLGNE-DKLAIQSMLTLSYIINDSEVNLLVEGSNTVNGILMLIKETCSIEG-REGNYSIPELMLGLFRISANNEIKEKINQNGGIPIIIDIL-HAKVENEIELTLGTIYNLCFNQEIKQKLIDEFEIENSIKLYENHVNPVIKKYHDGIMWEIRGXXXXXXXXXXXXXXXFD-VFVSYAHQNKSKVMEIFNELKKWNIRIWIDKEQMTGSVLEAMARGIENSRFFIIGISPYYEKSPNCRSEAEYAYQRQKTIIPMILACRFKPEGWLGFIRGMKMYYEISERRNVEEVMEDLVHTLKTGMGDNGEQGKSEHFKEPGPHTDENAVANKSINEKIKNWSTAETASWLD--DSKLGHLKKRLNDLDGKLLYVMLDIRSKSPDYFNKTLKKEFGMKFM-EVLKFHNALNNL 1897
            +++    KLV     +  NFSD S EF      + ++  + D  +K   + D     +K                  L   +  + N++R +  +  +K+ +  + L+    L +E  + A +++L L+Y+ ++S  +L++     +  ++ ++ ++CS    R   ++  EL  GL +I+ N+  K+ I Q+G IPI++D+L +AK + +       ++ L F+ E K+ ++        +K  ++  +  +KK   G++WEI GK     KES + +   + V +SY    +  ++++ ++L+    R+W+D EQM GS L+AMA  +EN+   ++ +S  Y++SPNCRSEAEYA+Q +K I+P+++   ++P+GWLG I G K++ + S+++ +   ++D    L+  +G  G +G+  +  E      ++ V +      I  WS  +  +W++    +LG+     + L GKLL  +  +RS+SP++F  ++K++FG   + EVL F + LN L
Sbjct:  319 KRIKAAQKLVQTATIVTINFSDRSDEFCIGCGEAGLIGELTDMVSK---LRDCTASMVKYQNPETQALKCKTQRGKILNTAMGTMHNLSRRIPCRQYFKKADTVKVLLPM--LNDEVSQFAAKALLILAYLTDESNNSLIMASEEPIQFLIHILSKSCSSNSNRYLGFTNSELAEGLSQIAVNDSNKKLIGQHGAIPILVDMLANAKNDEQRRCGAEALWVLAFDNENKEAILTTPNAVELLKELQHSEDDSVKKAAAGVLWEIEGKESHTVKESTADEPLRNHVMISYQWDVQPTMIQVKSKLQAAGYRVWMDLEQMGGSTLQAMANAVENAEVVLMCVSQKYKESPNCRSEAEYAFQLRKDIVPLMMEKSYRPDGWLGMIMGAKLWIDFSDKQTLR--VDDSFEKLQKEIGMRG-RGRG-NVVESKLVAVQHDVVDVFPKIDISKWSKDDVMNWMNGFGLRLGNDSTIASHLSGKLLQRLAKLRSESPEFFYSSVKQDFGFAHLQEVLLFVDELNKL 828          
BLAST of TIR domain-containing protein vs. Ensembl Nematostella
Match: EDO41008 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5P1])

HSP 1 Score: 179.874 bits (455), Expect = 2.747e-47
Identity = 122/450 (27.11%), Postives = 230/450 (51.11%), Query Frame = 2
Query:  587 EHLENCVLVVSNVARDLGNQIEYKEKELKESLIEFIKLGNEDKLAIQSMLTLSYIINDSEVNLLVEGSNTVNGILMLIKETCSIEGREG-NYSIPELMLGLFRISANNEIKEKINQNGGIPIIIDIL-HAKVENEIELTLGTIYNLCFNQEIKQKLIDEFEIENSIKLYENHVNPVIKKYHDGIMWEIRGXXXXXXXXXXXXXXXFDVFVSYAHQNKSKVMEIFNELKKWNIRIWIDKEQMTGSVLEAMARGIENSRFFIIGISPYYEKSPNCRSEAEYAYQRQKTIIPMILACRFKPEGWLGFIRGMKMYYEISER--RNVEEVMEDLVHTLKTGMG--------DNGEQGKSEHFKEPGPHTDENAVANKSINEKIKNWSTAETASWLDDSKLGHLKKRLNDLDGKLLYVMLDIRSKSPDYFNKTLKKEFGMK-FMEVLKFHNALNNL 1897
            E L + +  + N++R    +  ++E    + L+ F+K G      + ++L L+Y++++   +L++     +  +L ++    S   R+   ++  E+  G+ R+++N++ K  I ++ G+ I+  ++  AK + E    L  +Y L F+ E K+ L  +    N ++  +   +  ++K   GI+WEI GK    + E   +     + +SY   N+  ++ +   LK+   ++W+D EQM GS LEAMAR +EN+   +I +S  Y+ SPNCRSEAEYA+QR+K I+P+++   ++P+GWLG I G K++ +  E     +  +M++L +     +         D      S   KE GP    + V    +++    W   + A WL D  L    K    LDG +L ++  ++ +SP+++  ++KK+      +EVL+F   L  L
Sbjct:  812 ELLSHVLGALHNLSRRPAVKRFFEESNGVKHLLLFMKCGVT-YFVMNALLCLAYLVDERNNDLIMADEEPITFLLRMLSSAISDSRRQHLGFAAWEIACGIGRVASNDKNKRLIGRHDGVSILSTLVKEAKNDAERVYGLQALYMLSFDGENKKILCKDKATVNLLRNLKQSGHKEVQKAAVGILWEIEGKVGRDRNEDSQQH----IMISYQWDNQKAMLAVNKRLKEAGHKVWMDVEQMGGSTLEAMARAVENASVILIAMSQRYQDSPNCRSEAEYAFQRRKKIVPLMMEQDYRPDGWLGMILGAKLWMDFRESVDTGIVHLMKELQYNQTAALQQPHDPVTVDTTTVISSPPDKEDGPPGPTDVVDRPDVSK----WKKEDVAKWLSDIGLSSSNKVRKKLDGSMLILLYRLKQESPEFYYASVKKDMDFPTVIEVLQFTEELRKL 1252          

HSP 2 Score: 114.39 bits (285), Expect = 3.699e-26
Identity = 52/136 (38.24%), Postives = 84/136 (61.76%), Query Frame = 2
Query: 1202 VFVSYAHQNKSKVMEIFNELKKWNIRIWIDKEQMTGSVLEAMARGIENSRFFIIGISPYYEKSPNCRSEAEYAYQRQKTIIPMILACRFKPEGWLGFIRGMKMYYEISERRNVEEVMEDLVHTLKTGMGDNGEQGK 1609
            V +SY    +  V+++ +EL+    ++WID EQM GS LEAMA  +EN+   ++ +S  Y++SPNCRSEAEY++Q +K IIP+++  ++KP+GWLG I G K++ +   +      ++ L+  L    G  G   K
Sbjct:  555 VMLSYQWGYQDVVLKVRDELRAAGYKVWIDVEQMEGSTLEAMASAVENAAAVLMCVSRAYKESPNCRSEAEYSFQLRKDIIPLMMEPQYKPDGWLGIIVGAKLWMDFRSKDATSSAVQGLIKEL----GQRGRPAK 686          
BLAST of TIR domain-containing protein vs. Ensembl Nematostella
Match: EDO33720 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRG5])

HSP 1 Score: 78.9518 bits (193), Expect = 3.353e-18
Identity = 36/75 (48.00%), Postives = 51/75 (68.00%), Query Frame = 2
Query: 1301 MTGSVLEAMARGIENSRFFIIGISPYYEKSPNCRSEAEYAYQRQKTIIPMILACRFKPEGWLGFIRGMKMYYEIS 1525
            M GS LEAMA  +ENS   ++  S  Y+ S N RSEAEYAY ++K I+P+++   +KP+GWLG I G K+Y+  +
Sbjct:    1 MGGSTLEAMANAVENSAVVLMCASRKYKDSVNYRSEAEYAYTQKKPIVPLMMENGYKPDGWLGMIMGSKLYFNFA 75          
BLAST of TIR domain-containing protein vs. Ensembl Nematostella
Match: EDO39316 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAI7])

HSP 1 Score: 66.6254 bits (161), Expect = 5.161e-12
Identity = 35/138 (25.36%), Postives = 70/138 (50.72%), Query Frame = 2
Query: 1202 VFVSYAHQNKSKVMEIFNELKKWNIRIWID-KEQMTGSVLEAMARGIENSRFFIIGISPYYEKSPNCRSEAEYAYQRQKT----IIPMILACRFKPEGWLGFIRGMKMYYEISERRNVEEVMEDLVHTLKTGMGDNGE 1600
            V +SY    +  V ++++ L+ + IR+W+D    + G +  +MA+G++ +      +S  Y +S NC+ E  YA  +       I+P++    FK +GWLG I    ++ +  +  N E  ++ L   +   +GD+ +
Sbjct:    4 VMLSYQWDIQDLVKKVYDGLRAYGIRVWMDIHGGIRGDINGSMAKGVDGAAILCCFMSTKYSESKNCKKELSYADGKTGCEEVIIVPVMCEKGFKAKGWLGIITAGLLWIDFRDEANFENSVKSLAQEIMHAVGDSSD 141          
BLAST of TIR domain-containing protein vs. Ensembl Nematostella
Match: EDO33105 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST59])

HSP 1 Score: 54.6842 bits (130), Expect = 1.031e-7
Identity = 30/84 (35.71%), Postives = 49/84 (58.33%), Query Frame = 2
Query: 1196 FDVFVSYAHQNKSKVMEIFNELKKWNIRIWID-KEQMTGSVLEAMARGIENSRFFIIGISPYYEKSPNCRSEAEYAYQRQKTII 1444
            FD+ +SY    +S V E++ EL +   + W+D    M G++ EAMA  +ENS   +  ++  Y++S NC  E +YA  ++K II
Sbjct:  411 FDIMLSYNWGIQSFVREVYMELSQQTFQTWMDIWGGMQGNINEAMATAVENSTMLVAFLTEKYQQSVNCNLELKYATMKEKPII 494          
BLAST of TIR domain-containing protein vs. Planmine SMEST
Match: SMESG000079651.1 (SMESG000079651.1)

HSP 1 Score: 1130.93 bits (2924), Expect = 0.000e+0
Identity = 571/580 (98.45%), Postives = 576/580 (99.31%), Query Frame = 2
Query:  167 MNNLPERSICLKFSEAEIIDYLTTVITILDNNQENVDVINDMLIRICNSYFDWENHINKICQLFIEKHLLDTVYIYLDYFHRKLNIKDKLVNYLYTLLTNFSDASVEFAQNLNSSKVLPFIIDQCTKKEFINDIHDENIKEHLENCVLVVSNVARDLGNQIEYKEKELKESLIEFIKLGNEDKLAIQSMLTLSYIINDSEVNLLVEGSNTVNGILMLIKETCSIEGREGNYSIPELMLGLFRISANNEIKEKINQNGGIPIIIDILHAKVENEIELTLGTIYNLCFNQEIKQKLIDEFEIENSIKLYENHVNPVIKKYHDGIMWEIRGXXXXXXXXXXXXXXXFDVFVSYAHQNKSKVMEIFNELKKWNIRIWIDKEQMTGSVLEAMARGIENSRFFIIGISPYYEKSPNCRSEAEYAYQRQKTIIPMILACRFKPEGWLGFIRGMKMYYEISERRNVEEVMEDLVHTLKTGMGDNGEQGKSEHFKEPGPHTDENAVANKSINEKIKNWSTAETASWLDDSKLGHLKKRLNDLDGKLLYVMLDIRSKSPDYFNKTLKKEFGMKFMEVLKFHNALNNLAYI 1906
            MNNLPERSICLKFSEAEIIDYLTTVITILDNN+ENVDVINDMLIRICNSYFDWENHINKICQLFIEKHLLDTVYIYLDYFHRKLNIKDKLVNYLYTLLTNFSDASVEFAQNLNSSKVLPFIIDQCTKKEFINDIHDENIKEHLENCVLV+SNVARDLGNQIEYKEKELKESLIEFIKLGNEDKLAIQSMLTLSYIINDSEVNLLVEGSNTVNGILMLIKETCSIEGREGNYSIPELMLGLFRISANNEIKEKI +NGGIPIIIDILHAKVENEIELTLGTIYNLCFNQEIKQKLIDEFEIE SIKLYENHVNP IKKYHDGIMWEIRGKNEIKKK SDSKKSEFDVFVSYAHQNKSKVMEIFNELKKWNIRIWIDKEQMTGSVLEAMARGIENSRFFIIGISPYYEKSPNCRSEAEYAYQRQKTIIPMILACRFKPEGWLGFIRGMKMYYEISERRNVEEV+EDLVHTLKTGMGDNGEQGKSEHFKEPGPHTDENAVANKSINEKIKNWSTAETASWLDDSKLG+LKKRLNDLDGKLLYVMLDIRSKSPDYFNKTLKKEFGMKFMEVLKFHNALNNLAYI
Sbjct:    1 MNNLPERSICLKFSEAEIIDYLTTVITILDNNRENVDVINDMLIRICNSYFDWENHINKICQLFIEKHLLDTVYIYLDYFHRKLNIKDKLVNYLYTLLTNFSDASVEFAQNLNSSKVLPFIIDQCTKKEFINDIHDENIKEHLENCVLVISNVARDLGNQIEYKEKELKESLIEFIKLGNEDKLAIQSMLTLSYIINDSEVNLLVEGSNTVNGILMLIKETCSIEGREGNYSIPELMLGLFRISANNEIKEKIYKNGGIPIIIDILHAKVENEIELTLGTIYNLCFNQEIKQKLIDEFEIEKSIKLYENHVNPEIKKYHDGIMWEIRGKNEIKKKGSDSKKSEFDVFVSYAHQNKSKVMEIFNELKKWNIRIWIDKEQMTGSVLEAMARGIENSRFFIIGISPYYEKSPNCRSEAEYAYQRQKTIIPMILACRFKPEGWLGFIRGMKMYYEISERRNVEEVIEDLVHTLKTGMGDNGEQGKSEHFKEPGPHTDENAVANKSINEKIKNWSTAETASWLDDSKLGYLKKRLNDLDGKLLYVMLDIRSKSPDYFNKTLKKEFGMKFMEVLKFHNALNNLAYI 580          
BLAST of TIR domain-containing protein vs. Planmine SMEST
Match: SMESG000079659.1 (SMESG000079659.1)

HSP 1 Score: 940.643 bits (2430), Expect = 0.000e+0
Identity = 481/582 (82.65%), Postives = 521/582 (89.52%), Query Frame = 2
Query:  167 MNNLPERSICLKFSEAEIIDYLTTVITILDNNQENVDV--INDMLIRICNSYFDWENHINKICQLFIEKHLLDTVYIYLDYFHRKLNIKDKLVNYLYTLLTNFSDASVEFAQNLNSSKVLPFIIDQCTKKEFINDIHDENIKEHLENCVLVVSNVARDLGNQIEYKEKELKESLIEFIKLGNEDKLAIQSMLTLSYIINDSEVNLLVEGSNTVNGILMLIKETCSIEGREGNYSIPELMLGLFRISANNEIKEKINQNGGIPIIIDILHAKVENEIELTLGTIYNLCFNQEIKQKLIDEFEIENSIKLYENHVNPVIKKYHDGIMWEIRGXXXXXXXXXXXXXXXFDVFVSYAHQNKSKVMEIFNELKKWNIRIWIDKEQMTGSVLEAMARGIENSRFFIIGISPYYEKSPNCRSEAEYAYQRQKTIIPMILACRFKPEGWLGFIRGMKMYYEISERRNVEEVMEDLVHTLKTGMGDNGEQGKSEHFKEPGPHTDENAVANKSINEKIKNWSTAETASWLDDSKLGHLKKRLNDLDGKLLYVMLDIRSKSPDYFNKTLKKEFGMKFMEVLKFHNALNNLAYI 1906
            M  LP+ S C +F E +II+YL  VI IL++N+  +D+    D+L RI  +YF+W+NH++KICQLFIEK+LL+T+Y+YL +F  +  + D+ ++ L   L NFSDASVEFA  +  S++L F+IDQC +K+ I D      KE +  CV+V+SNVARDLGNQI+YK  ELKESLIEFIK+GNEDKLA+QSML LSYII DSEVNLLVEGSNTVN ILMLIK+T S   R+GNYSIPELMLGLFRISANNEIKEKINQNGGIPIIIDILHAKVENEIELTLGTIYNLCFNQEIKQKLIDEFEIE SIKLYENHVNPVIKKYHDGIMWEIRGKNEIKKK SDSKKSEFDVFVSYAHQNKSKVMEIFNELKKWNIRIWIDKEQMTGSVLEAMARGIENSRFFIIGISPYYEKSPNCRSEAEYAYQRQKTIIPMILACRFKPEGWLGFIRGMKMYYEISERRNVEEVMEDLVHTLKTGMGDNGEQGKSEHFKE GPHTDENAVANKSINEKIKNWSTAETASWLDDSKLG+LKKRLNDLDGKLLYVM DIRSKSPDYFNKTLKKEFGMKFMEVLKFHNALNNLAYI
Sbjct:    1 MEKLPDESDCAEFEEPQIIEYLNEVIKILEDNKNEIDINIAGDLLNRIICAYFNWDNHVDKICQLFIEKNLLETLYLYLKHFLLEFQLDDERLDALLKSLMNFSDASVEFAHKIYCSEILKFLIDQCIEKKVITD----ETKEFVRCCVIVISNVARDLGNQIDYKANELKESLIEFIKIGNEDKLAVQSMLMLSYIIKDSEVNLLVEGSNTVNSILMLIKKTASFNKRKGNYSIPELMLGLFRISANNEIKEKINQNGGIPIIIDILHAKVENEIELTLGTIYNLCFNQEIKQKLIDEFEIEKSIKLYENHVNPVIKKYHDGIMWEIRGKNEIKKKGSDSKKSEFDVFVSYAHQNKSKVMEIFNELKKWNIRIWIDKEQMTGSVLEAMARGIENSRFFIIGISPYYEKSPNCRSEAEYAYQRQKTIIPMILACRFKPEGWLGFIRGMKMYYEISERRNVEEVMEDLVHTLKTGMGDNGEQGKSEHFKEAGPHTDENAVANKSINEKIKNWSTAETASWLDDSKLGYLKKRLNDLDGKLLYVMFDIRSKSPDYFNKTLKKEFGMKFMEVLKFHNALNNLAYI 578          
BLAST of TIR domain-containing protein vs. Planmine SMEST
Match: SMESG000035587.1 (SMESG000035587.1)

HSP 1 Score: 347.821 bits (891), Expect = 3.820e-111
Identity = 209/582 (35.91%), Postives = 344/582 (59.11%), Query Frame = 2
Query:  176 LPERSICLKFSEAEIIDYLTTVITILDNNQENVDV-----INDMLIRICNSYFDWENH-INKICQLFIEKHLLDTVYIYLDYFHRKLNIKDKLVNYLYTLLTNFSDASVEFAQNLNSSKVLPFIIDQCTKKEFINDIHDENIKEHLENCVLVVSNVARDLGNQIEYKEKELKESLIEFIKLGNEDKLAIQSMLTLSYIINDSEVNLLVEGSNTVNGILMLIKETCSIEGREGNYSIPELMLGLFRISANNEIKEKINQNGGIPIIIDILHAKV-ENEIELTLGTIYNLCFNQEIKQKLIDEFEIENSIKLYENHVNPVIKKYHDGIMWEIRGXXXXXXX-XXXXXXXXFDVFVSYAHQNKSKVMEIFNELKKWNIRIWIDKEQMTGSVLEAMARGIENSRFFIIGISPYYEKSPNCRSEAEYAYQRQKTIIPMILACRFKPEGWLGFIRGMKMYYEISERRNVEEVMEDLVHTLKTGMGDNGEQGKSEHFKEPGPHTDENAVANKSINEKIKNWSTAETASWLDDSKLGHLKKRLNDLDGKLLYVMLDIRSKSPDYFNKTLKKEFGMKFMEVLKFHNALNNL 1897
            LP+ ++C   +    I YL+ VI  L    E + +     I ++++RI N+++D+ N  I+K+C  F +++L++ ++ +L   ++  + K+  +  +Y +L NFS+   EFA  L SS  + +IID+  + +  N I +    ++ ++ + ++ N A    ++I Y+  E+K++ +  + L  +D   + S++TLSY+I+++E+NL     N V  ++  IK     + R   ++I EL+ GL R+SAN+EIK  I+   GI ++IDIL++   EN IE TL  I  LCFN +IK KLI+ ++I  ++  + NH N  I ++++GI+W +  K E   K  ++     FD F+SY+  NK KV+EI + LK +N+ +WID+E+M  S LEAMA GIENS+  +I  S  Y+ S NCR EAEYA + +K IIP+++  ++KP  WLG + G K+Y E S+RRN  E ++ L+  +K  +    +  +       G     N+     + +++KNWS      WLD   +G+LK++   +DG ++ VMLDIR  S DYFN  LK EF M F+EV+KFH ALN+L
Sbjct:   13 LPDETMCKILNLENAIKYLSDVIDFL----EKIKIADEYNIYNLILRISNAFYDYYNKFIDKVCYEFKKRNLVNLIHFFLQNQNKISSQKENTIYLMYIILANFSEHDYEFAGMLESSNTINYIIDKYLQFDSSN-IKNCKENKNFKSLITIIHNFASHKLDKINYRVDEIKKTFLNIVNLNCDDYYGLISLVTLSYLIDENEINLFDGHENIVKELIKKIKLINENKLRSEGFTIKELIHGLRRLSANDEIKTIIDTENGIQVLIDILNSTNNENVIEPTLDVIKQLCFNNDIKIKLINHYKIGETLTKFSNHSNAKICQHYNGILWILDNKLESLPKGNTEKTAIVFDAFMSYSWANKDKVLEICSILKSYNVNVWIDQEEMISSTLEAMATGIENSKVVVIAASTAYKNSSNCRLEAEYAQKIKKPIIPLVMEHKYKPSNWLGILFGTKVYIEFSDRRNANEQVQQLIKNIKFHLNRPVKLAEKIDL-NAGEKNRSNSRTRIVLVDEVKNWSCENVGDWLDKFGIGYLKEKFIGVDGSMIEVMLDIRINSGDYFNNCLKNEFKMNFIEVVKFHKALNDL 588          
BLAST of TIR domain-containing protein vs. Planmine SMEST
Match: SMESG000015387.1 (SMESG000015387.1)

HSP 1 Score: 328.561 bits (841), Expect = 1.314e-103
Identity = 198/585 (33.85%), Postives = 332/585 (56.75%), Query Frame = 2
Query:  203 FSEAEIIDYLTTVITILDNNQE--NVDVINDMLIRICNSYFDWENHINKICQLFIEKHLLDTVYIYLDYFHRK-LNIKDKL---VNYLYTLLTNFSDASVEFAQNLNSSKVLPFIIDQCTKKEFINDIHDENIKEHLENCVLVVSNVARDLGNQIEYKEKELKESLIEFIKLGNEDKLAIQSMLTLSYIINDSEVNLLVEGSNTVNGILMLIKETCSIEGREGN-YSIPELMLGLFRISANNEIKEKINQNGGIPIIIDIL-HAKVENEIELTLGTIYNLCFNQEIKQKLIDEFEIENSIKLYENHVNPVIKKYHDGIMWEIRG---------XXXXXXXXXXXXXXXFDVFVSYAHQNKSKVMEIFNELKKWNIRIWIDKEQMTGSVLEAMARGIENSRFFIIGISPYYEKSPNCRSEAEYAYQRQKTIIPMILACRFKPEGWLGFIRGMKMYYEISERRNVEEVMEDLVHTLKTGMGDNGEQGKSEHFKEPGPHTDENAVANKSINE--KIKNWSTAETASWLDDSKLGHLKKRLNDLDGKLLYVMLDIRSKSPDYFNKTLKKEFGMKFMEVLKFHNALNNLA 1900
            F+E + +DY+   +  L   Q+  N ++I  +   I  SYFD ++H+N +  + +    +     Y+  F ++   + D +     Y    L N+ D   E A  +  + +  ++I     + +++++ + NI   ++  + ++ N+ R  GN+ +++  ELK  L+  IK  + D + + SMLTLS ++N+SE++LL EG N++  ++M I+     + ++ N ++I EL+ GL  +SAN+ +K+ I    GI +I DIL +   +N+IE  LG ++NLCF+++IK  L+++F+++  I  ++NH    IK+ ++GI+W I              + K ++     +FDVF+SY   NK  V+ I + L + NI+IWID +QM GS LEAMA GIENS  FI+ IS  Y  SPNCR+EAEYA+   K IIP+I+  ++KP  WLG I G KMYYE S+RRN EE +  L+  + T +  N E+        P    +    ++    +   + +WS      WL  + LGH+K R  + DGKLL+ ++D+++KS  Y    LK E+GMKF+++LK H+A+N + 
Sbjct:   13 FTEPQAVDYMKKALEKLKELQDSLNFNIIYKIFKGISQSYFDLKSHLNALSNVLLNLKYVSITSNYVGKFSKEGYFVNDDVWFATYYALNSLWNYCDGFQEIANEIVVTDLPQYLIANLLHRPYLDNMKNTNIFYLIKASISIIHNIVRCPGNEEKFQIIELKNVLVGLIKRNDSDFIVLISMLTLSCLVNESELHLLDEGKNSIKALIMKIRTAFENDSKKVNGFAIWELVNGLKCVSANDNVKKTIVTENGIKLIFDILKNPTCDNDIEKCLGVLWNLCFDKDIKAILVNDFDLKLFINRFKNHKLSTIKRCYNGILWLIDEKIQSKERILSAHLSKVKASKTHWKFDVFISYCWANKQMVLSIRDFLVQSNIKIWIDLDQMKGSTLEAMADGIENSNIFIMAISEAYRTSPNCRTEAEYAFSLNKPIIPLIVEMKYKPTSWLGIIMGSKMYYEFSKRRNFEESIHSLLANVNT-IIQNVERKIVTEIIVPVAQNESYQSSDGGTPKILSVHSWSNKIVEKWLVKNGLGHVKSRFMNFDGKLLFSLIDVKNKSRKYLIDALKVEYGMKFIDLLKLHSAINEIC 596          
BLAST of TIR domain-containing protein vs. Planmine SMEST
Match: SMESG000035607.1 (SMESG000035607.1)

HSP 1 Score: 325.479 bits (833), Expect = 5.281e-103
Identity = 215/570 (37.72%), Postives = 322/570 (56.49%), Query Frame = 2
Query:  296 IRICNSYFDWENH-INKICQLFIEKHLLDTVYIYLDYFHRKLNIKDKLVNYLYTLLTNFSDASVEFAQNLNSSKVLPFIIDQCTKKEFINDIHDENIKEHLENC---------VLVVSNVARDLGNQIEYKEKELKESLIEFIKLGNEDKLAIQSMLTLSYIINDSEVNLLVEGSNTVNGILMLIKETCSIEGREGNYSIPELMLGLFRISANNEIKEKINQNGGIPIIIDIL--HAKVENEIELTLGTIYNLCFNQEIKQKLIDEFEIENSIKLYENHVNPVIKKYHDGIMWEIRGXXXXXXXXXXXXXXXFDVFVSYAHQNKSKVMEIFNELKKWNIRIWIDKEQMTGSVLEAMARGIENSRFFIIGISPYYEKSPNCRSEAEYAYQRQKTIIPMILACRFKPEGWLGFIRGMKMYYEISERRNVEEVMEDLVHTLKTGMG--DNGEQGKSEHFKEPGPHTD--------ENAVANKSINE-------------KIKNWSTAETASWLDDSKLGHLKKRLNDLDGKLLYVMLDIRSKSPDYFNKTLKKEFGMKFMEVLKFHNALNNLA 1900
            +R+ NSYFD+ N  I+K+C+ +I K ++  +Y  L     KL   +  ++Y+ T L NFS+ S   A  + SS++L ++ID    K F  ++ D       E C         V ++ N  R   N+ EYK  ++K+S  + I+L ++D   I SML LSY+I+  EV++L++G N ++ +L  IK T +   R   +++ ELM GL  I+AN+ +K++I  + GI I+I+++  H   ++ IE TLG I +LCF+ EIK KLI+  +I+N IK Y    +  IK+ +DGI+WE+    +    ++ S   +FDVF+SY   NK ++ EI   LK   IR WIDKEQM+GS +EAMA+GIENS  FIIG+S  Y+KS NCR EAEYA++ +K IIP+I+  ++KP  WLGF+ G K+Y+E S+RRN  E ++ L+  +   +   DN  Q KS   K      D        +N   NK I++             KIK W+  +   WLD  ++   K    DL G  L  M +I  K P      LKK F M  +E++KF  AL NL+
Sbjct:    1 MRLSNSYFDYYNKFIDKVCEHYISKCIITNLYRLL----LKLT-NESTIDYILTFLVNFSEHSEIMACEIGSSEILKYVID----KYFGMNLSDP------EECKSSRIFKLYVTIIHNFFRYPHNRSEYKIDDIKQSFFKMIQLDSDDYFGIISMLILSYVIDGKEVDMLIKGQNILHNLLQKIKFTSTSTKRIEGFNLQELMHGLRFIAANDTMKKRI-YDEGIEILINVIKFHKDDKDVIESTLGVIEHLCFDNEIKLKLINSCKIKNLIKPYAKCKSVKIKEIYDGILWEL--DKKSVDLKTKSDNMKFDVFISYCWANKEQIEEILESLKIHKIRAWIDKEQMSGSSIEAMAKGIENSAVFIIGVSSSYKKSCNCRHEAEYAFRIKKPIIPLIMEMKYKPTEWLGFLLGNKIYFEFSDRRNPNEEVKGLIVEINRNLHPIDNEVQSKSNSVKNTQKSHDLPNSNSETKNEDCNKVISKSNFPVPSDSDTLGKIKMWTNEDVLKWLDKIQMSGFKTHFKDLSGSHLLTMQEICLKDPSLIRDDLKKTFNMNIIEIVKFETALKNLS 552          
The following BLAST results are available for this feature:
BLAST of TIR domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TIR domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TIR domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TIR domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TIR domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TIR domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TIR domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TIR domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A210QF191.149e-5927.09Vacuolar protein 8 OS=Mizuhopecten yessoensis OX=6... [more]
A0A0L8HV442.233e-5325.79TIR domain-containing protein OS=Octopus bimaculoi... [more]
W4XMC65.505e-5326.80TIR domain-containing protein OS=Strongylocentrotu... [more]
A0A2B4RLI92.114e-4928.52U-box domain-containing protein 4 OS=Stylophora pi... [more]
W4XJB96.744e-4826.71TIR domain-containing protein OS=Strongylocentrotu... [more]
back to top
BLAST of TIR domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TIR domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TIR domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TIR domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO450301.649e-5026.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO410082.747e-4727.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO337203.353e-1848.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO393165.161e-1225.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO331051.031e-735.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TIR domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TIR domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000079651.10.000e+098.45SMESG000079651.1[more]
SMESG000079659.10.000e+082.65SMESG000079659.1[more]
SMESG000035587.13.820e-11135.91SMESG000035587.1[more]
SMESG000015387.11.314e-10333.85SMESG000015387.1[more]
SMESG000035607.15.281e-10337.72SMESG000035607.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019321 ID=SMED30019321|Name=TIR domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2036bp
AAAAAAATTAAGTATAAGTGAATATTTAATATATAAAAATTATTAATTAA
AAACTGTCTGAGGCCTTATTTTACACCGCTTTCTGCTAACATGTAAGTCA
AATGTAACCTTGTATCAATAATTTTCTAGAAAATTAAGTCAATCCAGAAA
AATTCGTAACTTTGAAATGAATAATCTCCCTGAAAGATCGATTTGCCTAA
AGTTTTCGGAGGCGGAAATTATCGATTATCTTACAACAGTTATTACAATA
TTGGACAATAATCAGGAAAATGTGGATGTTATTAATGACATGCTTATTAG
AATTTGCAATTCTTATTTTGATTGGGAAAATCATATCAATAAAATTTGTC
AGTTGTTCATTGAAAAACATTTGTTGGATACAGTTTACATTTATTTGGAT
TATTTTCATCGTAAATTGAATATAAAAGATAAACTTGTGAATTATCTGTA
TACGTTATTAACGAATTTTTCTGATGCCTCTGTTGAGTTCGCTCAAAATC
TAAATTCTTCCAAGGTTCTTCCTTTCATTATCGATCAGTGCACAAAGAAA
GAATTCATTAATGATATTCACGATGAAAATATTAAAGAACATTTAGAAAA
CTGTGTCCTTGTTGTCAGTAATGTCGCTAGAGATTTGGGAAATCAGATTG
AATATAAAGAAAAGGAATTAAAGGAAAGTTTAATTGAGTTTATTAAGCTT
GGAAATGAAGATAAATTAGCTATTCAATCAATGCTGACGTTGTCATACAT
TATAAATGATAGTGAAGTGAATTTATTAGTAGAAGGTTCAAATACCGTAA
ATGGCATATTAATGTTAATTAAAGAAACGTGTAGTATTGAAGGTCGTGAA
GGAAATTATTCCATTCCAGAATTAATGCTGGGTTTATTCCGTATTTCCGC
TAACAATGAAATAAAAGAAAAAATCAATCAAAATGGCGGAATTCCAATTA
TAATTGATATTCTTCATGCAAAAGTGGAAAATGAAATTGAGTTGACTTTA
GGAACGATTTATAATTTATGCTTCAATCAGGAAATAAAACAGAAATTAAT
TGACGAATTTGAAATAGAAAATTCAATTAAATTGTATGAAAATCACGTAA
ACCCAGTGATCAAAAAGTACCACGATGGAATTATGTGGGAAATCAGGGGT
AAAAATGAAATTAAGAAAAAAGAAAGTGATTCGAAAAAATCGGAATTTGA
CGTGTTTGTAAGTTATGCACACCAGAATAAATCGAAAGTCATGGAAATAT
TTAATGAACTGAAAAAGTGGAACATTCGAATTTGGATTGATAAAGAACAA
ATGACCGGATCGGTTCTTGAAGCGATGGCTCGTGGGATAGAAAATTCTCG
CTTCTTCATTATTGGGATATCGCCGTATTACGAGAAGAGTCCAAATTGTC
GCAGTGAAGCGGAATATGCGTATCAACGACAGAAAACGATTATTCCGATG
ATATTGGCATGTCGATTCAAGCCGGAAGGTTGGCTGGGATTTATTCGGGG
AATGAAAATGTATTACGAAATCAGCGAGAGAAGAAATGTCGAAGAAGTAA
TGGAAGATTTGGTACATACGTTAAAAACGGGAATGGGAGACAATGGAGAG
CAGGGTAAATCAGAACATTTCAAAGAGCCTGGACCACACACAGATGAAAA
CGCAGTTGCCAACAAGTCGATAAATGAGAAGATCAAAAATTGGAGTACTG
CTGAAACTGCTTCGTGGTTAGACGATTCGAAACTAGGTCATTTGAAGAAG
CGATTGAATGATCTTGACGGAAAATTGCTCTATGTGATGCTTGATATCAG
ATCGAAGTCGCCGGATTATTTTAATAAAACTCTGAAAAAAGAATTCGGAA
TGAAATTTATGGAAGTATTGAAATTTCACAATGCTCTCAATAATTTGGCA
TATATTTGATTACCATTGCTAGTCCTTTAATTTATTGATTTTTATCACCA
TAATTTACAATTAATTACTATATTTCATACTGTTTTATTATTTTATTTTC
ATTTTGACATTTTTTATAAAATATAAACATTTTGTC
back to top

protein sequence of SMED30019321-orf-1

>SMED30019321-orf-1 ID=SMED30019321-orf-1|Name=SMED30019321-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=581bp
MNNLPERSICLKFSEAEIIDYLTTVITILDNNQENVDVINDMLIRICNSY
FDWENHINKICQLFIEKHLLDTVYIYLDYFHRKLNIKDKLVNYLYTLLTN
FSDASVEFAQNLNSSKVLPFIIDQCTKKEFINDIHDENIKEHLENCVLVV
SNVARDLGNQIEYKEKELKESLIEFIKLGNEDKLAIQSMLTLSYIINDSE
VNLLVEGSNTVNGILMLIKETCSIEGREGNYSIPELMLGLFRISANNEIK
EKINQNGGIPIIIDILHAKVENEIELTLGTIYNLCFNQEIKQKLIDEFEI
ENSIKLYENHVNPVIKKYHDGIMWEIRGKNEIKKKESDSKKSEFDVFVSY
AHQNKSKVMEIFNELKKWNIRIWIDKEQMTGSVLEAMARGIENSRFFIIG
ISPYYEKSPNCRSEAEYAYQRQKTIIPMILACRFKPEGWLGFIRGMKMYY
EISERRNVEEVMEDLVHTLKTGMGDNGEQGKSEHFKEPGPHTDENAVANK
SINEKIKNWSTAETASWLDDSKLGHLKKRLNDLDGKLLYVMLDIRSKSPD
YFNKTLKKEFGMKFMEVLKFHNALNNLAYI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000043dorsal ventral margin of the whole animal
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR035897Toll_tir_struct_dom_sf
IPR011989ARM-like
IPR000157TIR_dom
IPR016024ARM-type_fold
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005488binding
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR035897Toll/interleukin-1 receptor homology (TIR) domain superfamilyGENE3DG3DSA:3.40.50.10140coord: 335..471
e-value: 2.2E-20
score: 74.7
IPR035897Toll/interleukin-1 receptor homology (TIR) domain superfamilySUPERFAMILYSSF52200Toll/Interleukin receptor TIR domaincoord: 337..470
IPR011989Armadillo-like helicalGENE3DG3DSA:1.25.10.10coord: 58..330
e-value: 1.0E-7
score: 32.9
IPR000157Toll/interleukin-1 receptor homology (TIR) domainPFAMPF13676TIR_2coord: 346..440
e-value: 7.4E-19
score: 68.5
IPR000157Toll/interleukin-1 receptor homology (TIR) domainPROSITEPS50104TIRcoord: 342..419
score: 8.932
NoneNo IPR availablePANTHERPTHR46270FAMILY NOT NAMEDcoord: 48..577
NoneNo IPR availablePANTHERPTHR46270:SF2coord: 48..577
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 95..319