Sperm associated antigen 6

Overview
NameSperm associated antigen 6
Smed IDSMED30019318
Uniprot Best hitSperm-associated antigen 6 OS=Mus musculus OX=10090 GN=Spag6 PE=1 SV=1 (E=0)
Length (bp)1664
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Sperm associated antigen 6 (SMED30019318) t-SNE clustered cells

Violin plots show distribution of expression levels for Sperm associated antigen 6 (SMED30019318) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Sperm associated antigen 6 (SMED30019318) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Sperm associated antigen 6 (SMED30019318) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019318

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30019318SMESG000018022.1 SmedASXL_008198SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30019318SMESG000018022.1 dd_Smed_v4_3991_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30019318SMESG000018022.1 dd_Smed_v4_3991_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30019318SMESG000018022.1 dd_Smed_v4_3991_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30019318SMESG000018022.1 dd_Smed_v4_3991_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30019318SMESG000018022.1 dd_Smed_v6_3991_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30019318SMESG000018022.1 OX_Smed_1.0.13651ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30019318SMESG000018022.1 dd_Smed_v4_3991_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30019318SMESG000018022.1 dd_Smed_v4_3991_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30019318SMESG000018022.1 dd_Smed_v4_3991_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Sperm associated antigen 6 vs. Ensembl Human
Match: SPAG6 (sperm associated antigen 6 [Source:HGNC Symbol;Acc:HGNC:11215])

HSP 1 Score: 825.083 bits (2130), Expect = 0.000e+0
Identity = 397/506 (78.46%), Postives = 451/506 (89.13%), Query Frame = 2
Query:   62 MSQRQVLQVFEQYQKSRTQFVQTIAELANRPQNIETLQCAGVMNLLRPLLLDVVPSIQQTAALALGRLANHSDDLALAVVKGDILPQLVYSLAEQDRFYKKAASFVLRAVAKHSPELAQSVVDCGALDALVICLEEFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPDTKLKRQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIREIAKHTPELSQLIVNAGGVAAIVDFIGETKGNISLPGIMMLGYVAAHSETLSMSVIVSRGVLQLSSIFNNDCEDHILAATAWALGQIGRHTPEHSKAVAKQNVLPKLLRCYLRPDVSEDLQNKSKKALKHILQKCVYLEALEPLLQDAPPNILKHVVAQFSKVLPNNPQARRLFVTSGGLKKVQDMKVEPGSALSEYINIINNCYPEEIVKYYSPGYSEALLERVESYQP 1579
            MSQRQVLQVFEQYQK+RTQFVQ +AELA RPQNIETLQ AGVM+LLR LLLDVVP+IQQTAALALGRLAN++DDLA AVVK DILPQLVYSLAEQ+RFYKKAA+FVLRAV KHSP+LAQ++VDCGALD LVICLE+FDP VKE +AW L YIARHNA+L+Q+VVDAGAVPLLVLC+QEP++ LKRIAASALSDI KHSP+LAQTVVDAGA+AHLAQM+LNPD KLK QI SAL+Q++KHSVDLAE+VVEAEIFP +LTCLKDKD+ VKKN +TLIREIAKHTPELSQL+VNAGGVAA++D IG  KGN  LPGIMMLGYVAAHSE L+M+VI+S+GV QLS   + + EDHI AA AWALGQIGRHTPEH++AVA  N LP LL  Y+  + SEDLQ KSKKA+K+ILQKC YL ALEP L DAPPNILKHVV QFSKVLP++ +ARRLFVTSGGLKKVQ++K EPGS L EYIN IN+CYPEEIV+YYSPGYS+ LL+RV+SYQP
Sbjct:    1 MSQRQVLQVFEQYQKARTQFVQMVAELATRPQNIETLQNAGVMSLLRTLLLDVVPTIQQTAALALGRLANYNDDLAEAVVKCDILPQLVYSLAEQNRFYKKAAAFVLRAVGKHSPQLAQAIVDCGALDTLVICLEDFDPGVKEAAAWALRYIARHNAELSQAVVDAGAVPLLVLCIQEPEIALKRIAASALSDIAKHSPELAQTVVDAGAVAHLAQMILNPDAKLKHQILSALSQVSKHSVDLAEMVVEAEIFPVVLTCLKDKDEYVKKNASTLIREIAKHTPELSQLVVNAGGVAAVIDCIGSCKGNTRLPGIMMLGYVAAHSENLAMAVIISKGVPQLSVCLSEEPEDHIKAAAAWALGQIGRHTPEHARAVAVTNTLPVLLSLYMSTESSEDLQVKSKKAIKNILQKCTYLPALEPFLYDAPPNILKHVVGQFSKVLPHDSKARRLFVTSGGLKKVQEIKAEPGSLLQEYINSINSCYPEEIVRYYSPGYSDTLLQRVDSYQP 506          
BLAST of Sperm associated antigen 6 vs. Ensembl Human
Match: SPAG6 (sperm associated antigen 6 [Source:HGNC Symbol;Acc:HGNC:11215])

HSP 1 Score: 751.895 bits (1940), Expect = 0.000e+0
Identity = 363/467 (77.73%), Postives = 415/467 (88.87%), Query Frame = 2
Query:  179 AGVMNLLRPLLLDVVPSIQQTAALALGRLANHSDDLALAVVKGDILPQLVYSLAEQDRFYKKAASFVLRAVAKHSPELAQSVVDCGALDALVICLEEFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPDTKLKRQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIREIAKHTPELSQLIVNAGGVAAIVDFIGETKGNISLPGIMMLGYVAAHSETLSMSVIVSRGVLQLSSIFNNDCEDHILAATAWALGQIGRHTPEHSKAVAKQNVLPKLLRCYLRPDVSEDLQNKSKKALKHILQKCVYLEALEPLLQDAPPNILKHVVAQFSKVLPNNPQARRLFVTSGGLKKVQDMKVEPGSALSEYINIINNCYPEEIVKYYSPGYSEALLERVESYQP 1579
            AGVM+LLR LLLDVVP+IQQTAALALGRLAN++DDLA AVVK DILPQLVYSLAEQ+RFYKKAA+FVLRAV KHSP+LAQ++VDCGALD LVICLE+FDP VKE +AW L YIARHNA+L+Q+VVDAGAVPLLVLC+QEP++ LKRIAASALSDI KHSP+LAQTVVDAGA+AHLAQM+LNPD KLK QI SAL+Q++KHSVDLAE+VVEAEIFP +LTCLKDKD+ VKKN +TLIREIAKHTPELSQL+VNAGGVAA++D IG  KGN  LPGIMMLGYVAAHSE L+M+VI+S+GV QLS   + + EDHI AA AWALGQIGRHTPEH++AVA  N LP LL  Y+  + SEDLQ KSKKA+K+ILQKC YL ALEP L DAPPNILKHVV QFSKVLP++ +ARRLFVTSGGLKKVQ++K EPGS L EYIN IN+CYPEEIV+YYSPGYS+ LL+RV+SYQP
Sbjct:   15 AGVMSLLRTLLLDVVPTIQQTAALALGRLANYNDDLAEAVVKCDILPQLVYSLAEQNRFYKKAAAFVLRAVGKHSPQLAQAIVDCGALDTLVICLEDFDPGVKEAAAWALRYIARHNAELSQAVVDAGAVPLLVLCIQEPEIALKRIAASALSDIAKHSPELAQTVVDAGAVAHLAQMILNPDAKLKHQILSALSQVSKHSVDLAEMVVEAEIFPVVLTCLKDKDEYVKKNASTLIREIAKHTPELSQLVVNAGGVAAVIDCIGSCKGNTRLPGIMMLGYVAAHSENLAMAVIISKGVPQLSVCLSEEPEDHIKAAAAWALGQIGRHTPEHARAVAVTNTLPVLLSLYMSTESSEDLQVKSKKAIKNILQKCTYLPALEPFLYDAPPNILKHVVGQFSKVLPHDSKARRLFVTSGGLKKVQEIKAEPGSLLQEYINSINSCYPEEIVRYYSPGYSDTLLQRVDSYQP 481          

HSP 2 Score: 130.568 bits (327), Expect = 5.233e-32
Identity = 84/273 (30.77%), Postives = 152/273 (55.68%), Query Frame = 2
Query:   98 YQKSRTQFVQTIAELANRPQNIETLQCAGVMNLLRPLLLDVVPSIQQTAALALGRLANHSDDLALAVVKGDILPQLVYSLAEQDRFYKKAASFVLRAVAKHSPELAQSVVDCGALDALVICLEEFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPDTKLKRQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDK-DDMVKKNCATLIREIAKHTPE 913
            Y+K+    ++ + +  + PQ  + +   G ++ L   L D  P +++ AA AL  +A H+ +L+ AVV    +P LV  + E +   K+ A+  L  +AKHSPELAQ+VVD GA+  L   +   D  +K      L  +++H+  LA+ VV+A   P+++ C+++ D  +K+ A++ + +I KH+P+L+Q VV+AG +A +   + +     +      L  +A HS +LA  V+ ++  P +  CL ++ +D +K   A  + +I +HTPE
Sbjct:   74 YKKAAAFVLRAVGK--HSPQLAQAIVDCGALDTLVICLEDFDPGVKEAAAWALRYIARHNAELSQAVVDAGAVPLLVLCIQEPEIALKRIAASALSDIAKHSPELAQTVVDAGAVAHLAQMILNPDAKLKHQILSALSQVSKHSVDLAEMVVEAEIFPVVLTCLKDKDEYVKKNASTLIREIAKHTPELSQLVVNAGGVAAVIDCIGSCKGNTRLPGIMMLGYVAAHSENLAMAVIISKGVPQLSVCLSEEPEDHIKAAAAWALGQIGRHTPE 344          
BLAST of Sperm associated antigen 6 vs. Ensembl Human
Match: SPAG6 (sperm associated antigen 6 [Source:HGNC Symbol;Acc:HGNC:11215])

HSP 1 Score: 745.347 bits (1923), Expect = 0.000e+0
Identity = 362/468 (77.35%), Postives = 412/468 (88.03%), Query Frame = 2
Query:  131 IAELANRPQNIETLQCAGVMNLLRPLLLDVVPSIQQTAALALGRLANHSDDLALAVVKGDILPQLVYSLAEQDRFYKKAASFVLRAVAKHSPELAQSVVDCGALDALVICLEEFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPDTKLKRQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIREIAKHTPELSQLIVNAGGVAAIVDFIGETKGNISLPGIMMLGYVAAHSETLSMSVIVSRGVLQLSSIFNNDCEDHILAATAWALGQIGRHTPEHSKAVAKQNVLPKLLRCYLRPDVSEDLQNKSKKALKHILQKCVYLEALEPLLQDAPPNILKHVVAQFSKVLPNNPQARRLFVTSGGLKKVQDMKVEPGSALSEYINIINNCYPEEIVKYYSP 1534
            +AELA RPQNIETLQ AGVM+LLR LLLDVVP+IQQTAALALGRLAN++DDLA AVVK DILPQLVYSLAEQ+RFYKKAA+FVLRAV KHSP+LAQ++VDCGALD LVICLE+FDP VKE +AW L YIARHNA+L+Q+VVDAGAVPLLVLC+QEP++ LKRIAASALSDI KHSP+LAQTVVDAGA+AHLAQM+LNPD KLK QI SAL+Q++KHSVDLAE+VVEAEIFP +LTCLKDKD+ VKKN +TLIREIAKHTPELSQL+VNAGGVAA++D IG  KGN  LPGIMMLGYVAAHSE L+M+VI+S+GV QLS   + + EDHI AA AWALGQIGRHTPEH++AVA  N LP LL  Y+  + SEDLQ KSKKA+K+ILQKC YL ALEP L DAPPNILKHVV QFSKVLP++ +ARRLFVTSGGLKKVQ++K EPGS L EYIN IN+CYPEEIV  + P
Sbjct:    2 VAELATRPQNIETLQNAGVMSLLRTLLLDVVPTIQQTAALALGRLANYNDDLAEAVVKCDILPQLVYSLAEQNRFYKKAAAFVLRAVGKHSPQLAQAIVDCGALDTLVICLEDFDPGVKEAAAWALRYIARHNAELSQAVVDAGAVPLLVLCIQEPEIALKRIAASALSDIAKHSPELAQTVVDAGAVAHLAQMILNPDAKLKHQILSALSQVSKHSVDLAEMVVEAEIFPVVLTCLKDKDEYVKKNASTLIREIAKHTPELSQLVVNAGGVAAVIDCIGSCKGNTRLPGIMMLGYVAAHSENLAMAVIISKGVPQLSVCLSEEPEDHIKAAAAWALGQIGRHTPEHARAVAVTNTLPVLLSLYMSTESSEDLQVKSKKAIKNILQKCTYLPALEPFLYDAPPNILKHVVGQFSKVLPHDSKARRLFVTSGGLKKVQEIKAEPGSLLQEYINSINSCYPEEIVSKFFP 469          
BLAST of Sperm associated antigen 6 vs. Ensembl Human
Match: SPAG6 (sperm associated antigen 6 [Source:HGNC Symbol;Acc:HGNC:11215])

HSP 1 Score: 713.761 bits (1841), Expect = 0.000e+0
Identity = 351/455 (77.14%), Postives = 395/455 (86.81%), Query Frame = 2
Query:   62 MSQRQVLQVFEQYQKSRTQFVQTIAELANRPQNIETLQCAGVMNLLRPLLLDVVPSIQQTAALALGRLANHSDDLALAVVKGDILPQLVYSLAEQDRFYKKAASFVLRAVAKHSPELAQSVVDCGALDALVICLEEFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPDTKLKRQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIREIAKHTPELSQLIVNAGGVAAIVDFIGETKGNISLPGIMMLGYVAAHSETLSMSVIVSRGVLQLSSIFNNDCEDHILAATAWALGQIGRHTPEHSKAVAKQNVLPKLLRCYLRPDVSEDLQNKSKKALKHILQKCVYLEALEPLLQDAPPNILKHVVAQFSKVLPNNPQARRLFVTSGG 1426
            MSQRQVLQVFEQYQK+RTQFVQ +AELA RPQNIETLQ AGVM+LLR LLLDVVP+IQQTAALALGRLAN++DDLA AVVK DILPQLVYSLAEQ+RFYKKAA+FVLRAV KHSP+LAQ++VDCGALD LVICLE+FDP VKE +AW L YIARHNA+L+Q+VVDAGAVPLLVLC+QEP++ LKRIAASALSDI KHSP+LAQTVVDAGA+AHLAQM+LNPD KLK QI SAL+Q++KHSVDLAE+VVEAEIFP +LTCLKDKD+ VKKN +TLIREIAKHTPELSQL+VNAGGVAA++D IG  KGN  LPGIMMLGYVAAHSE L+M+VI+S+GV QLS   + + EDHI AA AWALGQIGRHTPEH++AVA  N LP LL  Y+  + SEDLQ KSKKA+K+ILQKC YL ALEP L DAPPNILKHVV QFSKVL   P   R     GG
Sbjct:    1 MSQRQVLQVFEQYQKARTQFVQMVAELATRPQNIETLQNAGVMSLLRTLLLDVVPTIQQTAALALGRLANYNDDLAEAVVKCDILPQLVYSLAEQNRFYKKAAAFVLRAVGKHSPQLAQAIVDCGALDTLVICLEDFDPGVKEAAAWALRYIARHNAELSQAVVDAGAVPLLVLCIQEPEIALKRIAASALSDIAKHSPELAQTVVDAGAVAHLAQMILNPDAKLKHQILSALSQVSKHSVDLAEMVVEAEIFPVVLTCLKDKDEYVKKNASTLIREIAKHTPELSQLVVNAGGVAAVIDCIGSCKGNTRLPGIMMLGYVAAHSENLAMAVIISKGVPQLSVCLSEEPEDHIKAAAAWALGQIGRHTPEHARAVAVTNTLPVLLSLYMSTESSEDLQVKSKKAIKNILQKCTYLPALEPFLYDAPPNILKHVVGQFSKVL--FPWIFRYTSAEGG 453          
BLAST of Sperm associated antigen 6 vs. Ensembl Human
Match: SPAG6 (sperm associated antigen 6 [Source:HGNC Symbol;Acc:HGNC:11215])

HSP 1 Score: 221.861 bits (564), Expect = 3.919e-68
Identity = 107/130 (82.31%), Postives = 121/130 (93.08%), Query Frame = 2
Query:  182 GVMNLLRPLLLDVVPSIQQTAALALGRLANHSDDLALAVVKGDILPQLVYSLAEQDRFYKKAASFVLRAVAKHSPELAQSVVDCGALDALVICLEEFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAVP 571
            GVM+LLR LLLDVVP+IQQTAALALGRLAN++DDLA AVVK DILPQLVYSLAEQ+RFYKKAA+FVLRAV KHSP+LAQ++VDCGALD LVICLE+FDP VKE +AW L YIARHNA+L+Q+VVDAGAVP
Sbjct:  117 GVMSLLRTLLLDVVPTIQQTAALALGRLANYNDDLAEAVVKCDILPQLVYSLAEQNRFYKKAAAFVLRAVGKHSPQLAQAIVDCGALDTLVICLEDFDPGVKEAAAWALRYIARHNAELSQAVVDAGAVP 246          

HSP 2 Score: 128.257 bits (321), Expect = 3.897e-33
Identity = 96/256 (37.50%), Postives = 137/256 (53.52%), Query Frame = 2
Query:   62 MSQRQVLQVFEQYQKSRTQFVQTIAELANRPQNIETLQCAGVMNLLRPLLLDVV-PSIQQTAALALGRLANHSDDLALAVVKGDILPQLVYSLAEQDRFYKKAASFVL-RAVAKHSPELAQSVVDCGALDALVICLEEFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPDTKLKRQIFSALAQIAKHSVDLAEIVVEAEIFP 823
            MSQRQVLQVFEQYQK+RTQFVQ +AELA RPQNIETLQ AG      P+    + P   + AAL +  L + S         G  + + ++S   Q  F  +A    L     + +  L  S +  G +  L   L +  P +++ +A  LG +A +N  LA++VV    +P LV  + E +   K+ AA  L  + KHSP LAQ +VD GA+  L   + + D  +K     AL  IA+H+ +L++ VV+A   P
Sbjct:    1 MSQRQVLQVFEQYQKARTQFVQMVAELATRPQNIETLQNAGEPGARTPVAPRALSPRRLRPAALPVELLGSRS--------VGTGVRKSIHSF--QRVFGGQAERVKLPDGCGRCALSLFPSSLHTGVMSLLRTLLLDVVPTIQQTAALALGRLANYNDDLAEAVVKCDILPQLVYSLAEQNRFYKKAAAFVLRAVGKHSPQLAQAIVDCGALDTLVICLEDFDPGVKEAAAWALRYIARHNAELSQAVVDAGAVP 246          

HSP 3 Score: 63.929 bits (154), Expect = 9.665e-11
Identity = 35/124 (28.23%), Postives = 70/124 (56.45%), Query Frame = 2
Query:  686 GAIAHLAQMVLNPDTKLKRQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIREIAKHTPELSQLIVNAGGVAAIVDFIGETKGNISLPGIMMLGYVAAHSETLSMSVI 1057
            G ++ L  ++L+    +++    AL ++A ++ DLAE VV+ +I P ++  L +++   KK  A ++R + KH+P+L+Q IV+ G +  +V  + +    +       L Y+A H+  LS +V+
Sbjct:  117 GVMSLLRTLLLDVVPTIQQTAALALGRLANYNDDLAEAVVKCDILPQLVYSLAEQNRFYKKAAAFVLRAVGKHSPQLAQAIVDCGALDTLVICLEDFDPGVKEAAAWALRYIARHNAELSQAVV 240          

HSP 4 Score: 62.003 bits (149), Expect = 4.534e-10
Identity = 37/113 (32.74%), Postives = 60/113 (53.10%), Query Frame = 2
Query:  608 LKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPDTKLKRQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIREIAKHTPELSQLIVNAGGV 946
            +++ AA AL  +  ++ DLA+ VV    +  L   +   +   K+     L  + KHS  LA+ +V+      ++ CL+D D  VK+  A  +R IA+H  ELSQ +V+AG V
Sbjct:  133 IQQTAALALGRLANYNDDLAEAVVKCDILPQLVYSLAEQNRFYKKAAAFVLRAVGKHSPQLAQAIVDCGALDTLVICLEDFDPGVKEAAAWALRYIARHNAELSQAVVDAGAV 245          
BLAST of Sperm associated antigen 6 vs. Ensembl Celegans
Match: ima-3 (Importin subunit alpha-3 [Source:UniProtKB/Swiss-Prot;Acc:Q19969])

HSP 1 Score: 60.077 bits (144), Expect = 2.491e-9
Identity = 71/358 (19.83%), Postives = 145/358 (40.50%), Query Frame = 2
Query:  422 VVDCGALDALVICLEEFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPDTKLK--RQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIREIAKHTPELSQLIVNAGGVAAIVDFIGETKGNISLPGIMMLGYVAAHSETLSMSVIVSRGVLQLSSIFNNDCEDHILAATAWALGQIGRHTPEHSKAVAKQNVLPKLLRCYLRPDVSED------LQNKSKKALKHILQKCVYLEALEP---LLQDAPPNILKHVVAQFSKVLPNNPQARRLFVTS----GGLKKVQDMK 1450
            ++  G L  LV CL   DP ++  +AW L  IA   ++  Q+VV+AGAVPL +  +   +L +   +  AL +I    P      ++ G +  L Q + NP+  +   R +   +  + +         V   I PA+   +  +D  +  +    +  +     E  Q+++ A  V  +V  +G     +    +  +G +   ++  +  V+ S GVL+         ++ I     W +  I     +  + V    ++P ++    R D          + N +     + +++ V L  L P   +L      I++ V+   + +L    +A     +     GGL K+++++
Sbjct:  104 LIGSGILPVLVQCLSSTDPNLQFEAAWALTNIASGTSEQTQAVVNAGAVPLFLQLLSCGNLNVCEQSVWALGNIIGDGPHFRDYCLELGILQPLLQFI-NPEIPIGFLRNVTWVIVNLCRCKDPAPSPAVVRTILPALSLLIHHQDTNILIDTVWALSYLTDGGNEHIQMVIEAQVVTHLVPLLGHVDVKVQTAALRAVGNIVTGTDEQTQLVLDS-GVLRFMPGLLAHYKEKINKEAVWFVSNITAGNQQQVQDVFDAGIMPMIIHLLDRGDFPTQKEAAWAISNVTISGRPNQVEQMVKLGVLRPFCAMLSCTDSQIIQVVLDGINNILKMAGEAAEQVTSEIEECGGLDKIENLQ 459          

HSP 2 Score: 54.299 bits (129), Expect = 1.820e-7
Identity = 42/186 (22.58%), Postives = 83/186 (44.62%), Query Frame = 2
Query:  251 ALGRLANHSDDLALAVVKGDILPQLVYSLAEQDRFYKKAASFVLRAVAKHSPELAQSVVDCGALDALVICLEEFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDIC-KHSPDLAQTVVDAGAIAHLAQMVLNPDTKLKRQIFSALAQIAKHSVDLAEIVV 805
            AL  L +  ++    V++  ++  LV  L   D   + AA   +  +   + E  Q V+D G L  +   L  +   + + + W +  I   N Q  Q V DAG +P+++  +   D   ++ AA A+S++     P+  + +V  G +     M+   D+++ + +   +  I K + + AE V 
Sbjct:  258 ALSYLTDGGNEHIQMVIEAQVVTHLVPLLGHVDVKVQTAALRAVGNIVTGTDEQTQLVLDSGVLRFMPGLLAHYKEKINKEAVWFVSNITAGNQQQVQDVFDAGIMPMIIHLLDRGDFPTQKEAAWAISNVTISGRPNQVEQMVKLGVLRPFCAMLSCTDSQIIQVVLDGINNILKMAGEAAEQVT 443          
BLAST of Sperm associated antigen 6 vs. Ensembl Celegans
Match: ima-2 (Importin subunit alpha-2 [Source:UniProtKB/Swiss-Prot;Acc:P91276])

HSP 1 Score: 55.8398 bits (133), Expect = 6.007e-8
Identity = 63/268 (23.51%), Postives = 117/268 (43.66%), Query Frame = 2
Query:  422 VVDCGALDALVICLEEFDPAVKEGSAWTLGYIARHNAQLAQSVVDAG-AVPLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVD---AGAIAHLAQMVLNPDTKLKRQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIREIAKHTPELSQLIVNAGGVAAIVDFIGETKGNISLPGIMMLGYVAAHSETLSMSVIVSRGVLQLSSIFNNDCEDHILAATAWALGQIGRHTPEHSKAVAKQNVLPKLL 1213
            V+ CG L ALV  L   +  V+  +AW L  I   + +   + V+AG  +PL+ L V +    +   A  A+++I   S  L   V+      A+ HL + V        R I  A + + +H    A + V   +   ++  ++  D  V+++    +  +     E  +L   +G +  +V F  E + N+  P +  LG VA  +++L+ +VI    + ++  +        I+    W +  I   T +  +AV   N+LP L+
Sbjct:  128 VIHCGLLQALVQALSVENERVQYEAAWALTNIVSGSTEQTIAAVEAGVTIPLIHLSVHQS-AQISEQALWAVANIAGDSSQLRDYVIKCHGVEALMHLMEKVDQLGDSHVRTIAWAFSNMCRHKNPHAPLEVLRVLSKGLVKLVQHTDRQVRQDACWAVSYLTDGPDEQIELARESGVLPHVVAFFKEAE-NLVAPALRTLGNVATGNDSLTQAVIDLGSLDEILPLMEKTRSSSIVKECCWLVSNIIAGTQKQIQAVLDANLLPVLI 393          
BLAST of Sperm associated antigen 6 vs. Ensembl Fly
Match: Kap-alpha1 (gene:FBgn0024889 transcript:FBtr0074881)

HSP 1 Score: 60.8474 bits (146), Expect = 2.152e-9
Identity = 57/261 (21.84%), Postives = 112/261 (42.91%), Query Frame = 2
Query:  203 PLLLDVVPS----IQQTAALALGRLANHSDDLALAVVKGDILPQLVYSLAEQDRFYK-KAASFVLRAVAKHSPELAQSVVDCGALDALVICLEEFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPDTKLKRQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIRE-IAKHTPELSQLIVNAGGVAAIVDFI 967
            P+ +D++ S    +Q+ A  ALG +A  S      ++   IL  L++ L+  DR    + A + L  + +     A        L  L   L+  D  V   + W +GY++       Q+V+DAG    LV  +  P   +   A  A+ +I        Q ++   A+  ++ ++ +    +K++    ++ IA  + +  + ++ A IFP ++  ++  +   +K  A  I    +  T E    +V  G V  + DF+
Sbjct:  183 PIFIDLLSSPHDDVQEQAVWALGNIAGDSPMCRDHLLGSGILEPLLHVLSNSDRITMIRNAVWTLSNLCRGKSPPADFAKISHGLPILARLLKYTDADVLSDTCWAIGYLSDGPNDKIQAVIDAGVCRRLVELLLHPQQNVSTAALRAVGNIVTGDDQQTQVILGYNALTCISHLLHSTAETIKKESCWTISNIAAGNREQIQALINANIFPQLMVIMQTAEFKTRKEAAWAITNATSSGTHEQIHYLVQVGCVPPMCDFL 443          

HSP 2 Score: 59.3066 bits (142), Expect = 6.387e-9
Identity = 50/242 (20.66%), Postives = 109/242 (45.04%), Query Frame = 2
Query:  494 SAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPD--TKLKRQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIREIAKHTPELSQLIVNAGGVAAIVDFIGETKGNISLPGIMMLGYVAAHSETLSMSVIVSRGVLQLSSIFNNDCEDHILAATAWALGQIGRHTPEHSKAVAKQNVLPKLL 1213
            +AWTL  IA   +Q  + V++AGAVP+ +  +  P   ++  A  AL +I   SP     ++ +G +  L  ++ N D  T ++  +++ L+ + +     A+    +   P +   LK  D  V  +    I  ++    +  Q +++AG    +V+ +   + N+S   +  +G +    +  +  ++    +  +S + ++  E  I   + W +  I     E  +A+   N+ P+L+
Sbjct:  158 AAWTLTNIASGTSQQTKVVIEAGAVPIFIDLLSSPHDDVQEQAVWALGNIAGDSPMCRDHLLGSGILEPLLHVLSNSDRITMIRNAVWT-LSNLCRGKSPPADFAKISHGLPILARLLKYTDADVLSDTCWAIGYLSDGPNDKIQAVIDAGVCRRLVELLLHPQQNVSTAALRAVGNIVTGDDQQTQVILGYNALTCISHLLHSTAET-IKKESCWTISNIAAGNREQIQALINANIFPQLM 397          
BLAST of Sperm associated antigen 6 vs. Ensembl Fly
Match: Kap-alpha3 (gene:FBgn0027338 transcript:FBtr0301189)

HSP 1 Score: 56.6102 bits (135), Expect = 4.056e-8
Identity = 73/339 (21.53%), Postives = 136/339 (40.12%), Query Frame = 2
Query:  233 QQTAALALGR--LANHSDDLALAVVKGDILPQLVYSLAEQDR-FYKKAASFVLRAVAKHSPELAQSVVDCGALDALVICLEEFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAV-PLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPDTKLKRQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIREIAKHTPELSQLIVNAGGVAAIVDFIGETKGNISLPGIMMLGYVAAHSETLSMSVIVSRGVLQLSSIFNN--DCEDHILAATAWALGQIG-RHTPEHSKAVAKQNVLP---KLLRC 1219
            QQ AA+   R  L++  +     +++ DILP LV  L + +    +  A++ L  +A  +      VV  GA+   +  L    P V E + W LG I      L   V+  G V PLL     +  +   R     + ++C++      T      +  L  ++ + DT +      A++ +     D  ++V+E+ + P ++  L + +  V+      +  I   + E +Q+++N   ++     +   K  I    +  L  + A +++   +VI    V  L  I  N    E       AWA+  +      E    + K+ V+P    LL C
Sbjct:   82 QQLAAVQAARKLLSSDKNPPINDLIQSDILPILVECLKQHNHTMLQFEAAWALTNIASGTSAQTNEVVAAGAVPLFLQLLNSPAPNVCEQAVWALGNIIGDGPLLRDFVIKHGVVQPLLSFIKPDIPITFLRNVTWVIVNLCRNKDPAPPTATIHEILPALNVLIHHTDTNILVDTVWAISYLTDGGNDQIQMVIESGVVPKLIPLLGNSEVKVQTAALRAVGNIVTGSDEQTQVVLNYDALSYFPGLLSHPKEKIRKEAVWFLSNITAGNQSQVQAVI---NVGLLPKIIENLSKGEFQTQKEAAWAISNLTISGNREQVFTLIKEGVIPPFCDLLSC 417          
BLAST of Sperm associated antigen 6 vs. Ensembl Fly
Match: Kap-alpha3 (gene:FBgn0027338 transcript:FBtr0082106)

HSP 1 Score: 56.6102 bits (135), Expect = 4.056e-8
Identity = 73/339 (21.53%), Postives = 136/339 (40.12%), Query Frame = 2
Query:  233 QQTAALALGR--LANHSDDLALAVVKGDILPQLVYSLAEQDR-FYKKAASFVLRAVAKHSPELAQSVVDCGALDALVICLEEFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAV-PLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPDTKLKRQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIREIAKHTPELSQLIVNAGGVAAIVDFIGETKGNISLPGIMMLGYVAAHSETLSMSVIVSRGVLQLSSIFNN--DCEDHILAATAWALGQIG-RHTPEHSKAVAKQNVLP---KLLRC 1219
            QQ AA+   R  L++  +     +++ DILP LV  L + +    +  A++ L  +A  +      VV  GA+   +  L    P V E + W LG I      L   V+  G V PLL     +  +   R     + ++C++      T      +  L  ++ + DT +      A++ +     D  ++V+E+ + P ++  L + +  V+      +  I   + E +Q+++N   ++     +   K  I    +  L  + A +++   +VI    V  L  I  N    E       AWA+  +      E    + K+ V+P    LL C
Sbjct:   82 QQLAAVQAARKLLSSDKNPPINDLIQSDILPILVECLKQHNHTMLQFEAAWALTNIASGTSAQTNEVVAAGAVPLFLQLLNSPAPNVCEQAVWALGNIIGDGPLLRDFVIKHGVVQPLLSFIKPDIPITFLRNVTWVIVNLCRNKDPAPPTATIHEILPALNVLIHHTDTNILVDTVWAISYLTDGGNDQIQMVIESGVVPKLIPLLGNSEVKVQTAALRAVGNIVTGSDEQTQVVLNYDALSYFPGLLSHPKEKIRKEAVWFLSNITAGNQSQVQAVI---NVGLLPKIIENLSKGEFQTQKEAAWAISNLTISGNREQVFTLIKEGVIPPFCDLLSC 417          
BLAST of Sperm associated antigen 6 vs. Ensembl Fly
Match: Kap-alpha3 (gene:FBgn0027338 transcript:FBtr0082108)

HSP 1 Score: 56.6102 bits (135), Expect = 4.056e-8
Identity = 73/339 (21.53%), Postives = 136/339 (40.12%), Query Frame = 2
Query:  233 QQTAALALGR--LANHSDDLALAVVKGDILPQLVYSLAEQDR-FYKKAASFVLRAVAKHSPELAQSVVDCGALDALVICLEEFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAV-PLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPDTKLKRQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIREIAKHTPELSQLIVNAGGVAAIVDFIGETKGNISLPGIMMLGYVAAHSETLSMSVIVSRGVLQLSSIFNN--DCEDHILAATAWALGQIG-RHTPEHSKAVAKQNVLP---KLLRC 1219
            QQ AA+   R  L++  +     +++ DILP LV  L + +    +  A++ L  +A  +      VV  GA+   +  L    P V E + W LG I      L   V+  G V PLL     +  +   R     + ++C++      T      +  L  ++ + DT +      A++ +     D  ++V+E+ + P ++  L + +  V+      +  I   + E +Q+++N   ++     +   K  I    +  L  + A +++   +VI    V  L  I  N    E       AWA+  +      E    + K+ V+P    LL C
Sbjct:   82 QQLAAVQAARKLLSSDKNPPINDLIQSDILPILVECLKQHNHTMLQFEAAWALTNIASGTSAQTNEVVAAGAVPLFLQLLNSPAPNVCEQAVWALGNIIGDGPLLRDFVIKHGVVQPLLSFIKPDIPITFLRNVTWVIVNLCRNKDPAPPTATIHEILPALNVLIHHTDTNILVDTVWAISYLTDGGNDQIQMVIESGVVPKLIPLLGNSEVKVQTAALRAVGNIVTGSDEQTQVVLNYDALSYFPGLLSHPKEKIRKEAVWFLSNITAGNQSQVQAVI---NVGLLPKIIENLSKGEFQTQKEAAWAISNLTISGNREQVFTLIKEGVIPPFCDLLSC 417          
BLAST of Sperm associated antigen 6 vs. Ensembl Fly
Match: Kap-alpha3 (gene:FBgn0027338 transcript:FBtr0082107)

HSP 1 Score: 56.6102 bits (135), Expect = 4.056e-8
Identity = 73/339 (21.53%), Postives = 136/339 (40.12%), Query Frame = 2
Query:  233 QQTAALALGR--LANHSDDLALAVVKGDILPQLVYSLAEQDR-FYKKAASFVLRAVAKHSPELAQSVVDCGALDALVICLEEFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAV-PLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPDTKLKRQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIREIAKHTPELSQLIVNAGGVAAIVDFIGETKGNISLPGIMMLGYVAAHSETLSMSVIVSRGVLQLSSIFNN--DCEDHILAATAWALGQIG-RHTPEHSKAVAKQNVLP---KLLRC 1219
            QQ AA+   R  L++  +     +++ DILP LV  L + +    +  A++ L  +A  +      VV  GA+   +  L    P V E + W LG I      L   V+  G V PLL     +  +   R     + ++C++      T      +  L  ++ + DT +      A++ +     D  ++V+E+ + P ++  L + +  V+      +  I   + E +Q+++N   ++     +   K  I    +  L  + A +++   +VI    V  L  I  N    E       AWA+  +      E    + K+ V+P    LL C
Sbjct:   82 QQLAAVQAARKLLSSDKNPPINDLIQSDILPILVECLKQHNHTMLQFEAAWALTNIASGTSAQTNEVVAAGAVPLFLQLLNSPAPNVCEQAVWALGNIIGDGPLLRDFVIKHGVVQPLLSFIKPDIPITFLRNVTWVIVNLCRNKDPAPPTATIHEILPALNVLIHHTDTNILVDTVWAISYLTDGGNDQIQMVIESGVVPKLIPLLGNSEVKVQTAALRAVGNIVTGSDEQTQVVLNYDALSYFPGLLSHPKEKIRKEAVWFLSNITAGNQSQVQAVI---NVGLLPKIIENLSKGEFQTQKEAAWAISNLTISGNREQVFTLIKEGVIPPFCDLLSC 417          
BLAST of Sperm associated antigen 6 vs. Ensembl Zebrafish
Match: spag6 (sperm associated antigen 6 [Source:ZFIN;Acc:ZDB-GENE-040704-53])

HSP 1 Score: 824.698 bits (2129), Expect = 0.000e+0
Identity = 393/506 (77.67%), Postives = 447/506 (88.34%), Query Frame = 2
Query:   62 MSQRQVLQVFEQYQKSRTQFVQTIAELANRPQNIETLQCAGVMNLLRPLLLDVVPSIQQTAALALGRLANHSDDLALAVVKGDILPQLVYSLAEQDRFYKKAASFVLRAVAKHSPELAQSVVDCGALDALVICLEEFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPDTKLKRQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIREIAKHTPELSQLIVNAGGVAAIVDFIGETKGNISLPGIMMLGYVAAHSETLSMSVIVSRGVLQLSSIFNNDCEDHILAATAWALGQIGRHTPEHSKAVAKQNVLPKLLRCYLRPDVSEDLQNKSKKALKHILQKCVYLEALEPLLQDAPPNILKHVVAQFSKVLPNNPQARRLFVTSGGLKKVQDMKVEPGSALSEYINIINNCYPEEIVKYYSPGYSEALLERVESYQP 1579
            MSQRQ+LQVFEQYQK+RTQFVQT+A+LA RPQN ETLQ AGVM+LLRPLLLD VP+IQQTAALALGRLAN++DDLA AVVKGDILPQLVYSLAEQ+RFYKKAA+FVLRAVAKHSPELAQ+VVDCGA+DALVI LEEFDP VKE +AW +G IARHN QL+Q+VVDAG VPLLVLC+QEP++ LKR+AASALSDI KHSP+LAQTVVD GAIAHLAQM+LNPD KLKRQ+FSAL QIAKHSVD+AE+VVEAEIFPA L CLKD D+ V+KN ATLIREI KHTPELSQ+IVN GGVAA++D++G++KGN+ LPGIMMLGYVAAHSE L+M+VIVS+GV QL+     + EDH+ AA AWA GQIGRHTPEH+K VA  NV PKLL  YL  + SEDLQ K+KK LK ILQKC YL ALEPLL +AP NILKHV+ QFSKVLP++ +ARRLFVTSGGLKKVQ++K EPGSA+ EYIN INNCYPEEIV+YYSPGYSE LLER+E YQP
Sbjct:    1 MSQRQILQVFEQYQKARTQFVQTVADLATRPQNSETLQNAGVMSLLRPLLLDAVPTIQQTAALALGRLANYNDDLAEAVVKGDILPQLVYSLAEQNRFYKKAAAFVLRAVAKHSPELAQAVVDCGAVDALVISLEEFDPGVKEAAAWAIGNIARHNGQLSQAVVDAGVVPLLVLCIQEPEIALKRVAASALSDIAKHSPELAQTVVDTGAIAHLAQMILNPDAKLKRQVFSALGQIAKHSVDVAEMVVEAEIFPAALVCLKDPDEYVRKNVATLIREITKHTPELSQMIVNVGGVAAVIDYLGDSKGNVRLPGIMMLGYVAAHSENLAMAVIVSKGVPQLAICLEEEQEDHVKAAIAWAFGQIGRHTPEHAKVVAVANVFPKLLNLYLDTESSEDLQVKAKKGLKSILQKCTYLPALEPLLYEAPSNILKHVICQFSKVLPHDSKARRLFVTSGGLKKVQEIKAEPGSAIQEYINAINNCYPEEIVRYYSPGYSETLLERIEKYQP 506          
BLAST of Sperm associated antigen 6 vs. Ensembl Zebrafish
Match: spag6 (sperm associated antigen 6 [Source:ZFIN;Acc:ZDB-GENE-040704-53])

HSP 1 Score: 805.823 bits (2080), Expect = 0.000e+0
Identity = 386/498 (77.51%), Postives = 439/498 (88.15%), Query Frame = 2
Query:   86 VFEQYQKSRTQFVQTIAELANRPQNIETLQCAGVMNLLRPLLLDVVPSIQQTAALALGRLANHSDDLALAVVKGDILPQLVYSLAEQDRFYKKAASFVLRAVAKHSPELAQSVVDCGALDALVICLEEFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPDTKLKRQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIREIAKHTPELSQLIVNAGGVAAIVDFIGETKGNISLPGIMMLGYVAAHSETLSMSVIVSRGVLQLSSIFNNDCEDHILAATAWALGQIGRHTPEHSKAVAKQNVLPKLLRCYLRPDVSEDLQNKSKKALKHILQKCVYLEALEPLLQDAPPNILKHVVAQFSKVLPNNPQARRLFVTSGGLKKVQDMKVEPGSALSEYINIINNCYPEEIVKYYSPGYSEALLERVESYQP 1579
            VFEQYQK+RTQFVQT+A+LA RPQN ETLQ AGVM+LLRPLLLD VP+IQQTAALALGRLAN++DDLA AVVKGDILPQLVYSLAEQ+RFYKKAA+FVLRAVAKHSPELAQ+VVDCGA+DALVI LEEFDP VKE +AW +G IARHN QL+Q+VVDAG VPLLVLC+QEP++ LKR+AASALSDI KHSP+LAQTVVD GAIAHLAQM+LNPD KLKRQ+FSAL QIAKHSVD+AE+VVEAEIFPA L CLKD D+ V+KN ATLIREI KHTPELSQ+IVN GGVAA++D++G++KGN+ LPGIMMLGYVAAHSE L+M+VIVS+GV QL+     + EDH+ AA AWA GQIGRHTPEH+K VA  NV PKLL  YL  + SEDLQ K+KK LK ILQKC YL ALEPLL +AP NILKHV+ QFSKVLP++ +ARRLFVTSGGLKKVQ++K EPGSA+ EYIN INNCYPEEIV+YYSPGYSE LLER+E YQP
Sbjct:   23 VFEQYQKARTQFVQTVADLATRPQNSETLQNAGVMSLLRPLLLDAVPTIQQTAALALGRLANYNDDLAEAVVKGDILPQLVYSLAEQNRFYKKAAAFVLRAVAKHSPELAQAVVDCGAVDALVISLEEFDPGVKEAAAWAIGNIARHNGQLSQAVVDAGVVPLLVLCIQEPEIALKRVAASALSDIAKHSPELAQTVVDTGAIAHLAQMILNPDAKLKRQVFSALGQIAKHSVDVAEMVVEAEIFPAALVCLKDPDEYVRKNVATLIREITKHTPELSQMIVNVGGVAAVIDYLGDSKGNVRLPGIMMLGYVAAHSENLAMAVIVSKGVPQLAICLEEEQEDHVKAAIAWAFGQIGRHTPEHAKVVAVANVFPKLLNLYLDTESSEDLQVKAKKGLKSILQKCTYLPALEPLLYEAPSNILKHVICQFSKVLPHDSKARRLFVTSGGLKKVQEIKAEPGSAIQEYINAINNCYPEEIVRYYSPGYSETLLERIEKYQP 520          
BLAST of Sperm associated antigen 6 vs. Ensembl Zebrafish
Match: kpna7 (karyopherin alpha 7 (importin alpha 8) [Source:ZFIN;Acc:ZDB-GENE-040426-2023])

HSP 1 Score: 61.6178 bits (148), Expect = 1.475e-9
Identity = 53/247 (21.46%), Postives = 102/247 (41.30%), Query Frame = 2
Query:  416 QSVVDCGALDALVICL-EEFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAI-AHLAQMVLNPDTKLKRQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIREIAKHTPELSQLIVNAGGVAAIVDFIGETKGNISLPGIMMLGYVAAHSETLSMSVIVSRGVLQLSSIFNNDCEDHILAATAWALGQI 1150
            + +++ G L   V  L    DP ++  +AW+L  +A   +   Q VV+ GAVP  +  +  P L +   A  AL +I          ++D G I A LA++  +      R +   L+ + ++           ++ P+I+  L   D  +  +    I  +     E   +I+ AG +  +V+ +G  +  +  P +  +G + + S+ L     +  GVL          +  +    AWA+  I
Sbjct:  110 KEIIEAGLLTRFVEFLGRNDDPTLQFEAAWSLTNVASGTSWHTQQVVEHGAVPAFIALLASPLLNISEQAVWALGNIAGDGSSYRDALIDCGVIPALLARLTPDAPVGYLRNLTWTLSNLCRNKNPFPRFSAVQQMLPSIIQLLHHSDKSILSDACWAISYLTDGPNERIDVIIKAGILTRLVELLGFEELAVVTPALRSIGNIVSGSD-LQTQAAIDAGVLSALPKLMRHQKSSVQKEAAWAVSNI 355          
BLAST of Sperm associated antigen 6 vs. Ensembl Zebrafish
Match: kpna5 (karyopherin alpha 5 (importin alpha 6) [Source:NCBI gene;Acc:553205])

HSP 1 Score: 61.2326 bits (147), Expect = 1.823e-9
Identity = 60/267 (22.47%), Postives = 114/267 (42.70%), Query Frame = 2
Query:  179 AGVMNLLRPLLLDVVPSIQQTAALALGRLANHSDDLALAVVKGDILPQLVYSLAEQDRFYK-KAASFVLRAV--AKHSPELAQSVVDCGALDALVICLEEFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPDTKLKRQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIRE-IAKHTPELSQLIVNAGGVAAIVDFI 967
             G + +   LL      +Q+ A  ALG +A  + +    V+   ILP L   LA+ +R    + A + L  +   K+ P     V  C  L  L   L   DP V   + W L Y++       Q+V+D+G    LV  +   D  +   A  A+ +I        Q +++  A+  L  ++ +P   +K++    ++ I   +    + V+++ +FP ++  L+  +   +K  A  I    +  TPE  + +V+   +  + D +
Sbjct:  169 TGAVPIFIELLNSEYEDVQEQAVWALGNIAGDNAECRDYVLNCGILPSLQQLLAKSNRLTTTRNAVWALSNLCRGKNPPPDFAKVSPC--LSVLSRLLFSSDPDVLADACWALSYLSDGPNDKIQTVIDSGVCRRLVELLMHSDYKVVSPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIKKEACWTVSNITAGNRAQIQAVIDSNVFPVLIEILQKAEFRTRKEAAWAITNATSGGTPEQIRYLVSLNTIKPMCDLL 433          

HSP 2 Score: 50.0618 bits (118), Expect = 5.869e-6
Identity = 60/283 (21.20%), Postives = 117/283 (41.34%), Query Frame = 2
Query:  368 ASFVLRAVAKHSPELAQSVVDCGALDALVICLEEFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAVP-LLVLCVQEPDLGLKRIAASALSDICKHS---PDLAQTVVDAGAIAHLAQMVLNPDTKLKRQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIREIAKHTPELSQLIVNAGGVAAIVDFIGETKGNISLPGIMMLGYVAAHSETLSMSVIVSRGVLQLSSIFNNDCEDHILAATAWALGQ-IGRHTPEHSKAVAKQNVL 1201
            A++ L  +A  + +  + V++ GA+   +  L      V+E + W LG IA  NA+    V++ G +P L  L  +   L   R A  ALS++C+     PD A+    +  ++ L++++ + D  +      AL+ ++    D  + V+++ +   ++  L   D  V       +  I       +Q+I+N   +  ++  +   K +I       +  + A +     +VI S     L  I     E       AWA+       TPE  + +   N +
Sbjct:  148 AAWALTNIASGTFQHTKVVIETGAVPIFIELLNSEYEDVQEQAVWALGNIAGDNAECRDYVLNCGILPSLQQLLAKSNRLTTTRNAVWALSNLCRGKNPPPDFAKV---SPCLSVLSRLLFSSDPDVLADACWALSYLSDGPNDKIQTVIDSGVCRRLVELLMHSDYKVVSPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIKKEACWTVSNITAGNRAQIQAVIDSNVFPVLIEILQK-AEFRTRKEAAWAITNATSGGTPEQIRYLVSLNTI 426          
BLAST of Sperm associated antigen 6 vs. Ensembl Zebrafish
Match: kpna6 (karyopherin alpha 6 (importin alpha 7) [Source:ZFIN;Acc:ZDB-GENE-130530-626])

HSP 1 Score: 58.5362 bits (140), Expect = 1.171e-8
Identity = 61/267 (22.85%), Postives = 114/267 (42.70%), Query Frame = 2
Query:  179 AGVMNLLRPLLLDVVPSIQQTAALALGRLANHSDDLALAVVKGDILPQLVYSLAEQDRF-YKKAASFVLRAV--AKHSPELAQSVVDCGALDALVICLEEFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPDTKLKRQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIRE-IAKHTPELSQLIVNAGGVAAIVDFI 967
            AG + +   LL      +Q+ A  ALG +A  S      V+  +ILP L+  L +  R    + A + L  +   K  P   + V  C  L  L   L   D  +   + W L Y++    +  Q+V+D+G    LV  +   D  +   +  A+ +I        Q V++  A+  L  ++ +    ++++    ++ I   +    + V++A IFP ++  L+  +   +K  A  I    +  TPE  + +VN G +  + D +
Sbjct:  167 AGAVPVFIELLNSDFEDVQEQAVWALGNIAGDSAVCRDYVLNCNILPPLLVLLTKSTRLTMTRNAVWALSNLCRGKSPPPDFEKVSPC--LPVLSRLLFSSDSDLLADACWALSYLSDGPNEKIQAVIDSGVCRRLVELLMHSDYKVASPSLRAVGNIVTGDDIQTQVVLNCSALPCLLHLLSSAKESIRKEACWTISNITAGNRAQIQAVIDANIFPVLIEILQKAEFRTRKEAAWAITNATSGGTPEQIRYLVNLGCIKPLCDLL 431          

HSP 2 Score: 53.1434 bits (126), Expect = 6.366e-7
Identity = 45/169 (26.63%), Postives = 82/169 (48.52%), Query Frame = 2
Query:  242 AALALGRLANHSDDLALAVVKGDILPQLVYSLAEQDRFYKKAASFVLRAVAK---HSPELAQSVVDCGALDALVICLEEFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSD-ICKHSPDLAQTVVDAGAIAHLAQMVLNPDTKL 736
            A  AL  L++  ++   AV+   +  +LV  L   D    K AS  LRAV           Q V++C AL  L+  L     ++++ + WT+  I   N    Q+V+DA   P+L+  +Q+ +   ++ AA A+++     +P+  + +V+ G I  L  ++   D+K+
Sbjct:  273 ACWALSYLSDGPNEKIQAVIDSGVCRRLVELLMHSDY---KVASPSLRAVGNIVTGDDIQTQVVLNCSALPCLLHLLSSAKESIRKEACWTISNITAGNRAQIQAVIDANIFPVLIEILQKAEFRTRKEAAWAITNATSGGTPEQIRYLVNLGCIKPLCDLLTVMDSKI 438          
BLAST of Sperm associated antigen 6 vs. Ensembl Xenopus
Match: ufd1 (ubiquitin recognition factor in ER associated degradation 1 [Source:Xenbase;Acc:XB-GENE-963687])

HSP 1 Score: 830.861 bits (2145), Expect = 0.000e+0
Identity = 396/508 (77.95%), Postives = 458/508 (90.16%), Query Frame = 2
Query:   62 MSQRQVLQVFEQYQKSRTQFVQTIAELANRPQNIETLQCAGVMNLLRPLLLDVVPSIQQTAALALGRLANHSDDLALAVVKGDILPQLVYSLAEQDRFYKKAASFVLRAVAKHSPELAQSVVDCGALDALVICLEEFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPDTKLKRQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIREIAKHTPELSQLIVNAGGVAAIVDFIGETKGNISLPGIMMLGYVAAHSETLSMSVIVSRGVLQLSSIFNNDCEDHILAATAWALGQIGRHTPEHSKAVAKQNVLPKLLRCYLRPDVSEDLQNKSKKALKHILQKCVYLEALEPLLQDAPPNILKHVVAQFSKVLPNNPQARRLFVTSGGLKKVQDMKVEPGSALSEYINIINNCYPEEIVKYYSPGYSEALLERVESYQPAL 1585
            MSQRQVLQVFEQYQ++RTQFVQT+AELA RPQNIETLQ AGVM+LLRPLLLDVVP+IQQT+ALALGRLAN++DDLA AVVKGDILPQLVYSLAEQ+RFYKKAA+FVLRAVAKHSP+LAQS+VDCGA+D LVICLE+FDP VKE +AW LGYI+RHNA+L+Q+VVDAGAVPLLVLC+QEP++ LKRIAASALSD+ KHSP+LAQTVVDAGAIAHLAQM+LNPD KLKRQ+ SAL+QIAKHSVDLAE+VVEAEIFP +LTCLKD D+ VKKN +TLIREIA+HTPELSQLIVNAGGVAA++D IG   GN+ LPGIMMLGYVAAHSE L+M+VI+S+GV QL+   + + EDHI AA AW+LGQIGRHTPEH++AVA  NVLPKLL  Y+  D SEDLQ K+KKALK+ILQKC +L ALEPLL DAPPNILKHVV QFSKVLP++ +ARRLFVTSGGLKK+Q++  + GS L EYIN INNC+PEEIV+YYSPGYS++LLERV+ YQP +
Sbjct:    1 MSQRQVLQVFEQYQRARTQFVQTVAELATRPQNIETLQNAGVMSLLRPLLLDVVPTIQQTSALALGRLANYNDDLAEAVVKGDILPQLVYSLAEQNRFYKKAAAFVLRAVAKHSPQLAQSIVDCGAVDTLVICLEDFDPGVKESAAWALGYISRHNAELSQAVVDAGAVPLLVLCIQEPEIALKRIAASALSDLSKHSPELAQTVVDAGAIAHLAQMILNPDAKLKRQVLSALSQIAKHSVDLAEMVVEAEIFPVVLTCLKDPDEYVKKNSSTLIREIARHTPELSQLIVNAGGVAAVIDCIGNCSGNVRLPGIMMLGYVAAHSENLAMAVIISKGVPQLAICLSEEAEDHIKAAAAWSLGQIGRHTPEHARAVAVANVLPKLLSLYMDTDSSEDLQVKAKKALKNILQKCTHLPALEPLLHDAPPNILKHVVGQFSKVLPHDSKARRLFVTSGGLKKIQEIVADTGSPLQEYINTINNCFPEEIVRYYSPGYSQSLLERVDHYQPVI 508          
BLAST of Sperm associated antigen 6 vs. Ensembl Xenopus
Match: ufd1 (ubiquitin recognition factor in ER associated degradation 1 [Source:Xenbase;Acc:XB-GENE-963687])

HSP 1 Score: 798.505 bits (2061), Expect = 0.000e+0
Identity = 382/492 (77.64%), Postives = 442/492 (89.84%), Query Frame = 2
Query:  110 RTQFVQTIAELANRPQNIETLQCAGVMNLLRPLLLDVVPSIQQTAALALGRLANHSDDLALAVVKGDILPQLVYSLAEQDRFYKKAASFVLRAVAKHSPELAQSVVDCGALDALVICLEEFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPDTKLKRQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIREIAKHTPELSQLIVNAGGVAAIVDFIGETKGNISLPGIMMLGYVAAHSETLSMSVIVSRGVLQLSSIFNNDCEDHILAATAWALGQIGRHTPEHSKAVAKQNVLPKLLRCYLRPDVSEDLQNKSKKALKHILQKCVYLEALEPLLQDAPPNILKHVVAQFSKVLPNNPQARRLFVTSGGLKKVQDMKVEPGSALSEYINIINNCYPEEIVKYYSPGYSEALLERVESYQPAL 1585
            RTQFVQT+AELA RPQNIETLQ AGVM+LLRPLLLDVVP+IQQT+ALALGRLAN++DDLA AVVKGDILPQLVYSLAEQ+RFYKKAA+FVLRAVAKHSP+LAQS+VDCGA+D LVICLE+FDP VKE +AW LGYI+RHNA+L+Q+VVDAGAVPLLVLC+QEP++ LKRIAASALSD+ KHSP+LAQTVVDAGAIAHLAQM+LNPD KLKRQ+ SAL+QIAKHSVDLAE+VVEAEIFP +LTCLKD D+ VKKN +TLIREIA+HTPELSQLIVNAGGVAA++D IG   GN+ LPGIMMLGYVAAHSE L+M+VI+S+GV QL+   + + EDHI AA AW+LGQIGRHTPEH++AVA  NVLPKLL  Y+  D SEDLQ K+KKALK+ILQKC +L ALEPLL DAPPNILKHVV QFSKVLP++ +ARRLFVTSGGLKK+Q++  + GS L EYIN INNC+PEEIV+YYSPGYS++LLERV+ YQP +
Sbjct:    4 RTQFVQTVAELATRPQNIETLQNAGVMSLLRPLLLDVVPTIQQTSALALGRLANYNDDLAEAVVKGDILPQLVYSLAEQNRFYKKAAAFVLRAVAKHSPQLAQSIVDCGAVDTLVICLEDFDPGVKESAAWALGYISRHNAELSQAVVDAGAVPLLVLCIQEPEIALKRIAASALSDLSKHSPELAQTVVDAGAIAHLAQMILNPDAKLKRQVLSALSQIAKHSVDLAEMVVEAEIFPVVLTCLKDPDEYVKKNSSTLIREIARHTPELSQLIVNAGGVAAVIDCIGNCSGNVRLPGIMMLGYVAAHSENLAMAVIISKGVPQLAICLSEEAEDHIKAAAAWSLGQIGRHTPEHARAVAVANVLPKLLSLYMDTDSSEDLQVKAKKALKNILQKCTHLPALEPLLHDAPPNILKHVVGQFSKVLPHDSKARRLFVTSGGLKKIQEIVADTGSPLQEYINTINNCFPEEIVRYYSPGYSQSLLERVDHYQPVI 495          
BLAST of Sperm associated antigen 6 vs. Ensembl Xenopus
Match: ufd1 (ubiquitin recognition factor in ER associated degradation 1 [Source:Xenbase;Acc:XB-GENE-963687])

HSP 1 Score: 778.089 bits (2008), Expect = 0.000e+0
Identity = 372/478 (77.82%), Postives = 430/478 (89.96%), Query Frame = 2
Query:   89 FEQYQKSRTQFVQTIAELANRPQNIETLQCAGVMNLLRPLLLDVVPSIQQTAALALGRLANHSDDLALAVVKGDILPQLVYSLAEQDRFYKKAASFVLRAVAKHSPELAQSVVDCGALDALVICLEEFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPDTKLKRQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIREIAKHTPELSQLIVNAGGVAAIVDFIGETKGNISLPGIMMLGYVAAHSETLSMSVIVSRGVLQLSSIFNNDCEDHILAATAWALGQIGRHTPEHSKAVAKQNVLPKLLRCYLRPDVSEDLQNKSKKALKHILQKCVYLEALEPLLQDAPPNILKHVVAQFSKVLPNNPQARRLFVTSGGLKKVQDMKVEPGSALSEYINIINNCYPEEIVK 1522
            FEQYQ++RTQFVQT+AELA RPQNIETLQ AGVM+LLRPLLLDVVP+IQQT+ALALGRLAN++DDLA AVVKGDILPQLVYSLAEQ+RFYKKAA+FVLRAVAKHSP+LAQS+VDCGA+D LVICLE+FDP VKE +AW LGYI+RHNA+L+Q+VVDAGAVPLLVLC+QEP++ LKRIAASALSD+ KHSP+LAQTVVDAGAIAHLAQM+LNPD KLKRQ+ SAL+QIAKHSVDLAE+VVEAEIFP +LTCLKD D+ VKKN +TLIREIA+HTPELSQLIVNAGGVAA++D IG   GN+ LPGIMMLGYVAAHSE L+M+VI+S+GV QL+   + + EDHI AA AW+LGQIGRHTPEH++AVA  NVLPKLL  Y+  D SEDLQ K+KKALK+ILQKC +L ALEPLL DAPPNILKHVV QFSKVLP++ +ARRLFVTSGGLKK+Q++  + GS L EYIN INNC+PEEIV+
Sbjct:   13 FEQYQRARTQFVQTVAELATRPQNIETLQNAGVMSLLRPLLLDVVPTIQQTSALALGRLANYNDDLAEAVVKGDILPQLVYSLAEQNRFYKKAAAFVLRAVAKHSPQLAQSIVDCGAVDTLVICLEDFDPGVKESAAWALGYISRHNAELSQAVVDAGAVPLLVLCIQEPEIALKRIAASALSDLSKHSPELAQTVVDAGAIAHLAQMILNPDAKLKRQVLSALSQIAKHSVDLAEMVVEAEIFPVVLTCLKDPDEYVKKNSSTLIREIARHTPELSQLIVNAGGVAAVIDCIGNCSGNVRLPGIMMLGYVAAHSENLAMAVIISKGVPQLAICLSEEAEDHIKAAAAWSLGQIGRHTPEHARAVAVANVLPKLLSLYMDTDSSEDLQVKAKKALKNILQKCTHLPALEPLLHDAPPNILKHVVGQFSKVLPHDSKARRLFVTSGGLKKIQEIVADTGSPLQEYINTINNCFPEEIVR 490          
BLAST of Sperm associated antigen 6 vs. Ensembl Xenopus
Match: ufd1 (ubiquitin recognition factor in ER associated degradation 1 [Source:Xenbase;Acc:XB-GENE-963687])

HSP 1 Score: 776.933 bits (2005), Expect = 0.000e+0
Identity = 373/480 (77.71%), Postives = 430/480 (89.58%), Query Frame = 2
Query:   89 FEQYQKSRTQFVQTIAELANRPQNIETLQCAGVMNLLRPLLLDVVPSIQQTAALALGRLANHSDDLALAVVKGDILPQLVYSLAEQDRFYKKAASFVLRAVAKHSPELAQSVVDCGALDALVICLEEFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPDTKLKRQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIREIAKHTPELSQLIVNAGGVAAIVDFIGETKGNISLPGIMMLGYVAAHSETLSMSVIVSRGVLQLSSIFNNDCEDHILAATAWALGQIGRHTPEHSKAVAKQNVLPKLLRCYLRPDVSEDLQNKSKKALKHILQKCVYLEALEPLLQDAPPNILKHVVAQFSKVLPNNPQARRLFVTSGGLKKVQDMKVEPGSALSEYINIINNCYPEEIVKYY 1528
            FEQYQ++RTQFVQT+AELA RPQNIETLQ AGVM+LLRPLLLDVVP+IQQT+ALALGRLAN++DDLA AVVKGDILPQLVYSLAEQ+RFYKKAA+FVLRAVAKHSP+LAQS+VDCGA+D LVICLE+FDP VKE +AW LGYI+RHNA+L+Q+VVDAGAVPLLVLC+QEP++ LKRIAASALSD+ KHSP+LAQTVVDAGAIAHLAQM+LNPD KLKRQ+ SAL+QIAKHSVDLAE+VVEAEIFP +LTCLKD D+ VKKN +TLIREIA+HTPELSQLIVNAGGVAA++D IG   GN+ LPGIMMLGYVAAHSE L+M+VI+S+GV QL+   + + EDHI AA AW+LGQIGRHTPEH++AVA  NVLPKLL  Y+  D SEDLQ K+KKALK+ILQKC +L ALEPLL DAPPNILKHVV QFSKVLP++ +ARRLFVTSGGLKK+Q++  + GS L EYIN INNC+PEEIV  Y
Sbjct:   13 FEQYQRARTQFVQTVAELATRPQNIETLQNAGVMSLLRPLLLDVVPTIQQTSALALGRLANYNDDLAEAVVKGDILPQLVYSLAEQNRFYKKAAAFVLRAVAKHSPQLAQSIVDCGAVDTLVICLEDFDPGVKESAAWALGYISRHNAELSQAVVDAGAVPLLVLCIQEPEIALKRIAASALSDLSKHSPELAQTVVDAGAIAHLAQMILNPDAKLKRQVLSALSQIAKHSVDLAEMVVEAEIFPVVLTCLKDPDEYVKKNSSTLIREIARHTPELSQLIVNAGGVAAVIDCIGNCSGNVRLPGIMMLGYVAAHSENLAMAVIISKGVPQLAICLSEEAEDHIKAAAAWSLGQIGRHTPEHARAVAVANVLPKLLSLYMDTDSSEDLQVKAKKALKNILQKCTHLPALEPLLHDAPPNILKHVVGQFSKVLPHDSKARRLFVTSGGLKKIQEIVADTGSPLQEYINTINNCFPEEIVSPY 492          
BLAST of Sperm associated antigen 6 vs. Ensembl Xenopus
Match: ufd1 (ubiquitin recognition factor in ER associated degradation 1 [Source:Xenbase;Acc:XB-GENE-963687])

HSP 1 Score: 775.778 bits (2002), Expect = 0.000e+0
Identity = 373/480 (77.71%), Postives = 430/480 (89.58%), Query Frame = 2
Query:   89 FEQYQKSRTQFVQTIAELANRPQNIETLQCAGVMNLLRPLLLDVVPSIQQTAALALGRLANHSDDLALAVVKGDILPQLVYSLAEQDRFYKKAASFVLRAVAKHSPELAQSVVDCGALDALVICLEEFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPDTKLKRQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIREIAKHTPELSQLIVNAGGVAAIVDFIGETKGNISLPGIMMLGYVAAHSETLSMSVIVSRGVLQLSSIFNNDCEDHILAATAWALGQIGRHTPEHSKAVAKQNVLPKLLRCYLRPDVSEDLQNKSKKALKHILQKCVYLEALEPLLQDAPPNILKHVVAQFSKVLPNNPQARRLFVTSGGLKKVQDMKVEPGSALSEYINIINNCYPEEIVKYY 1528
            FEQYQ++RTQFVQT+AELA RPQNIETLQ AGVM+LLRPLLLDVVP+IQQT+ALALGRLAN++DDLA AVVKGDILPQLVYSLAEQ+RFYKKAA+FVLRAVAKHSP+LAQS+VDCGA+D LVICLE+FDP VKE +AW LGYI+RHNA+L+Q+VVDAGAVPLLVLC+QEP++ LKRIAASALSD+ KHSP+LAQTVVDAGAIAHLAQM+LNPD KLKRQ+ SAL+QIAKHSVDLAE+VVEAEIFP +LTCLKD D+ VKKN +TLIREIA+HTPELSQLIVNAGGVAA++D IG   GN+ LPGIMMLGYVAAHSE L+M+VI+S+GV QL+   + + EDHI AA AW+LGQIGRHTPEH++AVA  NVLPKLL  Y+  D SEDLQ K+KKALK+ILQKC +L ALEPLL DAPPNILKHVV QFSKVLP++ +ARRLFVTSGGLKK+Q++  + GS L EYIN INNC+PEEIV  Y
Sbjct:   10 FEQYQRARTQFVQTVAELATRPQNIETLQNAGVMSLLRPLLLDVVPTIQQTSALALGRLANYNDDLAEAVVKGDILPQLVYSLAEQNRFYKKAAAFVLRAVAKHSPQLAQSIVDCGAVDTLVICLEDFDPGVKESAAWALGYISRHNAELSQAVVDAGAVPLLVLCIQEPEIALKRIAASALSDLSKHSPELAQTVVDAGAIAHLAQMILNPDAKLKRQVLSALSQIAKHSVDLAEMVVEAEIFPVVLTCLKDPDEYVKKNSSTLIREIARHTPELSQLIVNAGGVAAVIDCIGNCSGNVRLPGIMMLGYVAAHSENLAMAVIISKGVPQLAICLSEEAEDHIKAAAAWSLGQIGRHTPEHARAVAVANVLPKLLSLYMDTDSSEDLQVKAKKALKNILQKCTHLPALEPLLHDAPPNILKHVVGQFSKVLPHDSKARRLFVTSGGLKKIQEIVADTGSPLQEYINTINNCFPEEIVSPY 489          
BLAST of Sperm associated antigen 6 vs. Ensembl Mouse
Match: Spag6l (sperm associated antigen 6-like [Source:MGI Symbol;Acc:MGI:1354388])

HSP 1 Score: 841.262 bits (2172), Expect = 0.000e+0
Identity = 404/506 (79.84%), Postives = 455/506 (89.92%), Query Frame = 2
Query:   62 MSQRQVLQVFEQYQKSRTQFVQTIAELANRPQNIETLQCAGVMNLLRPLLLDVVPSIQQTAALALGRLANHSDDLALAVVKGDILPQLVYSLAEQDRFYKKAASFVLRAVAKHSPELAQSVVDCGALDALVICLEEFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPDTKLKRQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIREIAKHTPELSQLIVNAGGVAAIVDFIGETKGNISLPGIMMLGYVAAHSETLSMSVIVSRGVLQLSSIFNNDCEDHILAATAWALGQIGRHTPEHSKAVAKQNVLPKLLRCYLRPDVSEDLQNKSKKALKHILQKCVYLEALEPLLQDAPPNILKHVVAQFSKVLPNNPQARRLFVTSGGLKKVQDMKVEPGSALSEYINIINNCYPEEIVKYYSPGYSEALLERVESYQP 1579
            MSQRQVLQVFEQYQK+RTQFVQ +AELA RPQNIETLQ AGVM+LLRPLLLDVVP+IQQTAALALGRLAN++DDLA AVVKGDILPQLVYSLAEQ+RFYKKAA+FVLRAV KHSP+LAQ++VDCGALD LVICLE+FDP VKE +AW LGYIARHN +L+Q+VVDAGA+PLLVLC+QEP++ LKRIAASALSDI KHSP+LAQTVVDAGAIAHLAQM+LNPD KLKRQ+ SAL+QIAKHSVDLAE+VVEAEIFP +LTCLKDKD+ VKKN  TLIREIAKHTPELSQLIVNAGGVAA++D IG  KGNI LPGIMMLGYVAAHSE L+M+VI+S+GV QLS   + + EDHI AA AWALGQ+GRHTPEH++AVA  N LP LL  Y+ P+ SEDLQ KSKKA+K+ILQKC YL ALEP L DAPPNILKHVV QFSKVLP++ +ARRLFVTSGGLKKVQ++K EPGS L EYIN INNCYPEEIV+YYSPGYS+ LL+RV+SYQP
Sbjct:    1 MSQRQVLQVFEQYQKARTQFVQMVAELATRPQNIETLQNAGVMSLLRPLLLDVVPTIQQTAALALGRLANYNDDLAEAVVKGDILPQLVYSLAEQNRFYKKAAAFVLRAVGKHSPQLAQAIVDCGALDTLVICLEDFDPGVKEAAAWALGYIARHNTELSQAVVDAGAIPLLVLCIQEPEIALKRIAASALSDISKHSPELAQTVVDAGAIAHLAQMILNPDAKLKRQVLSALSQIAKHSVDLAEMVVEAEIFPVVLTCLKDKDEYVKKNACTLIREIAKHTPELSQLIVNAGGVAAVIDCIGSCKGNIRLPGIMMLGYVAAHSENLAMAVIISKGVPQLSICLSEEPEDHIKAAAAWALGQLGRHTPEHARAVAVTNTLPVLLSLYMSPESSEDLQLKSKKAIKNILQKCTYLPALEPFLYDAPPNILKHVVGQFSKVLPHDSKARRLFVTSGGLKKVQEIKAEPGSLLQEYINSINNCYPEEIVRYYSPGYSDTLLQRVDSYQP 506          
BLAST of Sperm associated antigen 6 vs. Ensembl Mouse
Match: Spag6 (sperm associated antigen 6 [Source:MGI Symbol;Acc:MGI:3040687])

HSP 1 Score: 788.875 bits (2036), Expect = 0.000e+0
Identity = 388/506 (76.68%), Postives = 446/506 (88.14%), Query Frame = 2
Query:   62 MSQRQVLQVFEQYQKSRTQFVQTIAELANRPQNIETLQCAGVMNLLRPLLLDVVPSIQQTAALALGRLANHSDDLALAVVKGDILPQLVYSLAEQDRFYKKAASFVLRAVAKHSPELAQSVVDCGALDALVICLEEFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPDTKLKRQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIREIAKHTPELSQLIVNAGGVAAIVDFIGETKGNISLPGIMMLGYVAAHSETLSMSVIVSRGVLQLSSIFNNDCEDHILAATAWALGQIGRHTPEHSKAVAKQNVLPKLLRCYLRPDVSEDLQNKSKKALKHILQKCVYLEALEPLLQDAPPNILKHVVAQFSKVLPNNPQARRLFVTSGGLKKVQDMKVEPGSALSEYINIINNCYPEEIVKYYSPGYSEALLERVESYQP 1579
            MSQRQVLQVFE YQ +RT+FVQ +AE A +PQNIETLQ AG+M+LLRPLLLDVVP+IQQTAALALGRLAN++DDLA AVVKGDILPQLVYSLAEQ+  YKKAA+FVLRAV KHSP+LAQ+ VDCGALD+LVICLE+FDP VKE +AW L YIARHNA+L+Q+VVDAGAVPLLVLC+QEP+  LKRIAASALSDI KHSP+LAQTVVD GAIAHLAQM+LNPD KLK+Q+ SAL+ IAKHSVDLAE+VVEAEIFP +LTCLKDKDD VKKN  TLIREIAKHTPELSQLIVNAGGVAA++D IG  KGNI LPGIMMLGY+AAHSE L+M+VI+S+GV QLS   + + EDHI AA AWALGQ+GRHTPEH++AVA  N LP LL  Y+ P+ SEDLQ KSKKA+K+I+QKC YL ALEP L DAPPNILK+V  QFSKVLP++ +ARRLFVTSGGLKK+Q++K EPGS L EYIN IN+CYPEEIV+YYSPGYS+ LL+R++SYQP
Sbjct:    1 MSQRQVLQVFELYQNARTRFVQMVAEQATKPQNIETLQNAGIMSLLRPLLLDVVPTIQQTAALALGRLANYNDDLAEAVVKGDILPQLVYSLAEQNCVYKKAAAFVLRAVGKHSPQLAQATVDCGALDSLVICLEDFDPGVKEAAAWALAYIARHNAELSQAVVDAGAVPLLVLCIQEPETALKRIAASALSDISKHSPELAQTVVDVGAIAHLAQMILNPDEKLKQQVLSALSHIAKHSVDLAEMVVEAEIFPVVLTCLKDKDDFVKKNACTLIREIAKHTPELSQLIVNAGGVAAVIDCIGSCKGNIRLPGIMMLGYMAAHSENLAMAVIISKGVPQLSDCLSEEPEDHIKAAAAWALGQVGRHTPEHARAVAITNTLPVLLALYMSPESSEDLQVKSKKAIKNIIQKCTYLPALEPFLYDAPPNILKYVAGQFSKVLPHDSKARRLFVTSGGLKKIQEIKAEPGSILQEYINNINSCYPEEIVRYYSPGYSDILLQRIDSYQP 506          
BLAST of Sperm associated antigen 6 vs. Ensembl Mouse
Match: Spag6 (sperm associated antigen 6 [Source:MGI Symbol;Acc:MGI:3040687])

HSP 1 Score: 256.144 bits (653), Expect = 9.216e-83
Identity = 133/166 (80.12%), Postives = 152/166 (91.57%), Query Frame = 2
Query:  131 IAELANRPQNIETLQCAGVMNLLRPLLLDVVPSIQQTAALALGRLANHSDDLALAVVKGDILPQLVYSLAEQDRFYKKAASFVLRAVAKHSPELAQSVVDCGALDALVICLEEFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAAS 628
            +AE A +PQNIETLQ AG+M+LLRPLLLDVVP+IQQTAALALGRLAN++DDLA AVVKGDILPQLVYSLAEQ+  YKKAA+FVLRAV KHSP+LAQ+ VDCGALD+LVICLE+FDP VKE +AW L YIARHNA+L+Q+VVDAGAVPLLVLC+QEP+  LKRIAAS
Sbjct:    2 VAEQATKPQNIETLQNAGIMSLLRPLLLDVVPTIQQTAALALGRLANYNDDLAEAVVKGDILPQLVYSLAEQNCVYKKAAAFVLRAVGKHSPQLAQATVDCGALDSLVICLEDFDPGVKEAAAWALAYIARHNAELSQAVVDAGAVPLLVLCIQEPETALKRIAAS 167          

HSP 2 Score: 72.4034 bits (176), Expect = 1.810e-14
Identity = 50/159 (31.45%), Postives = 89/159 (55.97%), Query Frame = 2
Query:  404 PELAQSVVDCGALDALVICLEEFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPDTKLKRQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCAT 880
            P+  +++ + G +  L   L +  P +++ +A  LG +A +N  LA++VV    +P LV  + E +   K+ AA  L  + KHSP LAQ  VD GA+  L   + + D  +K     ALA IA+H+ +L++ VV+A   P ++ C+++ +  +K+  A+
Sbjct:    9 PQNIETLQNAGIMSLLRPLLLDVVPTIQQTAALALGRLANYNDDLAEAVVKGDILPQLVYSLAEQNCVYKKAAAFVLRAVGKHSPQLAQATVDCGALDSLVICLEDFDPGVKEAAAWALAYIARHNAELSQAVVDAGAVPLLVLCIQEPETALKRIAAS 167          

HSP 3 Score: 55.8398 bits (133), Expect = 1.019e-8
Identity = 30/101 (29.70%), Postives = 63/101 (62.38%), Query Frame = 2
Query:  656 PDLAQTVVDAGAIAHLAQMVLNPDTKLKRQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIREIAKHTPELSQLIVNAGGVAAIV 958
            P   +T+ +AG ++ L  ++L+    +++    AL ++A ++ DLAE VV+ +I P ++  L +++ + KK  A ++R + KH+P+L+Q  V+ G + ++V
Sbjct:    9 PQNIETLQNAGIMSLLRPLLLDVVPTIQQTAALALGRLANYNDDLAEAVVKGDILPQLVYSLAEQNCVYKKAAAFVLRAVGKHSPQLAQATVDCGALDSLV 109          

HSP 4 Score: 53.5286 bits (127), Expect = 6.071e-8
Identity = 39/122 (31.97%), Postives = 63/122 (51.64%), Query Frame = 2
Query:  608 LKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPDTKLKRQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIREIAKHTPELSQLIVNAGGVAAIVDFIGE 973
            +++ AA AL  +  ++ DLA+ VV    +  L   +   +   K+     L  + KHS  LA+  V+     +++ CL+D D  VK+  A  +  IA+H  ELSQ +V+AG V  +V  I E
Sbjct:   35 IQQTAALALGRLANYNDDLAEAVVKGDILPQLVYSLAEQNCVYKKAAAFVLRAVGKHSPQLAQATVDCGALDSLVICLEDFDPGVKEAAAWALAYIARHNAELSQAVVDAGAVPLLVLCIQE 156          
BLAST of Sperm associated antigen 6 vs. Ensembl Mouse
Match: Kpna7 (karyopherin alpha 7 (importin alpha 8) [Source:MGI Symbol;Acc:MGI:2141165])

HSP 1 Score: 61.2326 bits (147), Expect = 1.767e-9
Identity = 58/247 (23.48%), Postives = 111/247 (44.94%), Query Frame = 2
Query:  296 VVKGDILPQLVYSL-AEQDRFYKKAASFVLRAVAKHSPELAQSVVDCGALDALVICLEEFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQE--PDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPDTKLKRQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIREIAKHTPELSQLIVNAGGVAAIVDFIGETKGNISLPGIMMLGYVAA 1027
            +++  ++P+LV  L A      +  A++VL  +A  + E  ++VV  GA+  L+  L      V E + W LG IA   A+    V+   A+P L+  + +  P   L+ I+ + LS++C++             +  L Q++L+ D ++      AL+ + K   +    VV   I P ++  +   +  +   C   I  I   T E +Q+ ++AG +  +   +   K +I +     +  VAA
Sbjct:  107 IIEAGLIPKLVDFLKATPHPKLQFEAAWVLTNIASGTSEQTRAVVKEGAIQPLIELLCSPHLTVSEQAVWALGNIAGDCAEFRDCVISNNAIPHLINLISKGIPITFLRNISWT-LSNLCRNKDPYPSESAVRQMLPPLCQLLLHRDNEILADTCWALSYLTKGGKEYIHHVVTTGILPRLVELMTSSELSISIPCLHTIGNIVAGTDEQTQMAIDAGMLKVLGQVLKHPKTSIQVLAAWTMSNVAA 352          

HSP 2 Score: 53.1434 bits (126), Expect = 6.505e-7
Identity = 56/267 (20.97%), Postives = 114/267 (42.70%), Query Frame = 2
Query:  422 VVDCGALDALVICLEEF-DPAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLN--PDTKLKRQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIREIAKHTPELSQLIVNAGGVAAIVDFIGETKGNISLPGIMMLGYVAAHSETLSMSVIVSRGVLQLSSIFNNDCEDHILAATAWALGQIGRHTPEHSKAVAKQNVLPKLL 1213
            +++ G +  LV  L+    P ++  +AW L  IA   ++  ++VV  GA+  L+  +  P L +   A  AL +I     +    V+   AI HL  ++    P T L R I   L+ + ++           ++ P +   L  +D+ +  +    +  + K   E    +V  G +  +V+ +  ++ +IS+P +  +G + A ++     + +  G+L++        +  I    AW +  +    P H       N+LP L+
Sbjct:  107 IIEAGLIPKLVDFLKATPHPKLQFEAAWVLTNIASGTSEQTRAVVKEGAIQPLIELLCSPHLTVSEQAVWALGNIAGDCAEFRDCVISNNAIPHLINLISKGIPITFL-RNISWTLSNLCRNKDPYPSESAVRQMLPPLCQLLLHRDNEILADTCWALSYLTKGGKEYIHHVVTTGILPRLVELMTSSELSISIPCLHTIGNIVAGTDE-QTQMAIDAGMLKVLGQVLKHPKTSIQVLAAWTMSNVAA-GPRHQVEQLLCNLLPILV 370          
BLAST of Sperm associated antigen 6 vs. Ensembl Mouse
Match: Kpna7 (karyopherin alpha 7 (importin alpha 8) [Source:MGI Symbol;Acc:MGI:2141165])

HSP 1 Score: 61.2326 bits (147), Expect = 1.767e-9
Identity = 58/247 (23.48%), Postives = 111/247 (44.94%), Query Frame = 2
Query:  296 VVKGDILPQLVYSL-AEQDRFYKKAASFVLRAVAKHSPELAQSVVDCGALDALVICLEEFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQE--PDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPDTKLKRQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIREIAKHTPELSQLIVNAGGVAAIVDFIGETKGNISLPGIMMLGYVAA 1027
            +++  ++P+LV  L A      +  A++VL  +A  + E  ++VV  GA+  L+  L      V E + W LG IA   A+    V+   A+P L+  + +  P   L+ I+ + LS++C++             +  L Q++L+ D ++      AL+ + K   +    VV   I P ++  +   +  +   C   I  I   T E +Q+ ++AG +  +   +   K +I +     +  VAA
Sbjct:  107 IIEAGLIPKLVDFLKATPHPKLQFEAAWVLTNIASGTSEQTRAVVKEGAIQPLIELLCSPHLTVSEQAVWALGNIAGDCAEFRDCVISNNAIPHLINLISKGIPITFLRNISWT-LSNLCRNKDPYPSESAVRQMLPPLCQLLLHRDNEILADTCWALSYLTKGGKEYIHHVVTTGILPRLVELMTSSELSISIPCLHTIGNIVAGTDEQTQMAIDAGMLKVLGQVLKHPKTSIQVLAAWTMSNVAA 352          

HSP 2 Score: 53.1434 bits (126), Expect = 6.505e-7
Identity = 56/267 (20.97%), Postives = 114/267 (42.70%), Query Frame = 2
Query:  422 VVDCGALDALVICLEEF-DPAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLN--PDTKLKRQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIREIAKHTPELSQLIVNAGGVAAIVDFIGETKGNISLPGIMMLGYVAAHSETLSMSVIVSRGVLQLSSIFNNDCEDHILAATAWALGQIGRHTPEHSKAVAKQNVLPKLL 1213
            +++ G +  LV  L+    P ++  +AW L  IA   ++  ++VV  GA+  L+  +  P L +   A  AL +I     +    V+   AI HL  ++    P T L R I   L+ + ++           ++ P +   L  +D+ +  +    +  + K   E    +V  G +  +V+ +  ++ +IS+P +  +G + A ++     + +  G+L++        +  I    AW +  +    P H       N+LP L+
Sbjct:  107 IIEAGLIPKLVDFLKATPHPKLQFEAAWVLTNIASGTSEQTRAVVKEGAIQPLIELLCSPHLTVSEQAVWALGNIAGDCAEFRDCVISNNAIPHLINLISKGIPITFL-RNISWTLSNLCRNKDPYPSESAVRQMLPPLCQLLLHRDNEILADTCWALSYLTKGGKEYIHHVVTTGILPRLVELMTSSELSISIPCLHTIGNIVAGTDE-QTQMAIDAGMLKVLGQVLKHPKTSIQVLAAWTMSNVAA-GPRHQVEQLLCNLLPILV 370          
BLAST of Sperm associated antigen 6 vs. UniProt
Match: sp|Q9JLI7|SPAG6_MOUSE (Sperm-associated antigen 6 OS=Mus musculus OX=10090 GN=Spag6 PE=1 SV=1)

HSP 1 Score: 841.262 bits (2172), Expect = 0.000e+0
Identity = 404/506 (79.84%), Postives = 455/506 (89.92%), Query Frame = 2
Query:   62 MSQRQVLQVFEQYQKSRTQFVQTIAELANRPQNIETLQCAGVMNLLRPLLLDVVPSIQQTAALALGRLANHSDDLALAVVKGDILPQLVYSLAEQDRFYKKAASFVLRAVAKHSPELAQSVVDCGALDALVICLEEFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPDTKLKRQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIREIAKHTPELSQLIVNAGGVAAIVDFIGETKGNISLPGIMMLGYVAAHSETLSMSVIVSRGVLQLSSIFNNDCEDHILAATAWALGQIGRHTPEHSKAVAKQNVLPKLLRCYLRPDVSEDLQNKSKKALKHILQKCVYLEALEPLLQDAPPNILKHVVAQFSKVLPNNPQARRLFVTSGGLKKVQDMKVEPGSALSEYINIINNCYPEEIVKYYSPGYSEALLERVESYQP 1579
            MSQRQVLQVFEQYQK+RTQFVQ +AELA RPQNIETLQ AGVM+LLRPLLLDVVP+IQQTAALALGRLAN++DDLA AVVKGDILPQLVYSLAEQ+RFYKKAA+FVLRAV KHSP+LAQ++VDCGALD LVICLE+FDP VKE +AW LGYIARHN +L+Q+VVDAGA+PLLVLC+QEP++ LKRIAASALSDI KHSP+LAQTVVDAGAIAHLAQM+LNPD KLKRQ+ SAL+QIAKHSVDLAE+VVEAEIFP +LTCLKDKD+ VKKN  TLIREIAKHTPELSQLIVNAGGVAA++D IG  KGNI LPGIMMLGYVAAHSE L+M+VI+S+GV QLS   + + EDHI AA AWALGQ+GRHTPEH++AVA  N LP LL  Y+ P+ SEDLQ KSKKA+K+ILQKC YL ALEP L DAPPNILKHVV QFSKVLP++ +ARRLFVTSGGLKKVQ++K EPGS L EYIN INNCYPEEIV+YYSPGYS+ LL+RV+SYQP
Sbjct:    1 MSQRQVLQVFEQYQKARTQFVQMVAELATRPQNIETLQNAGVMSLLRPLLLDVVPTIQQTAALALGRLANYNDDLAEAVVKGDILPQLVYSLAEQNRFYKKAAAFVLRAVGKHSPQLAQAIVDCGALDTLVICLEDFDPGVKEAAAWALGYIARHNTELSQAVVDAGAIPLLVLCIQEPEIALKRIAASALSDISKHSPELAQTVVDAGAIAHLAQMILNPDAKLKRQVLSALSQIAKHSVDLAEMVVEAEIFPVVLTCLKDKDEYVKKNACTLIREIAKHTPELSQLIVNAGGVAAVIDCIGSCKGNIRLPGIMMLGYVAAHSENLAMAVIISKGVPQLSICLSEEPEDHIKAAAAWALGQLGRHTPEHARAVAVTNTLPVLLSLYMSPESSEDLQLKSKKAIKNILQKCTYLPALEPFLYDAPPNILKHVVGQFSKVLPHDSKARRLFVTSGGLKKVQEIKAEPGSLLQEYINSINNCYPEEIVRYYSPGYSDTLLQRVDSYQP 506          
BLAST of Sperm associated antigen 6 vs. UniProt
Match: sp|O75602|SPAG6_HUMAN (Sperm-associated antigen 6 OS=Homo sapiens OX=9606 GN=SPAG6 PE=2 SV=1)

HSP 1 Score: 825.083 bits (2130), Expect = 0.000e+0
Identity = 397/506 (78.46%), Postives = 451/506 (89.13%), Query Frame = 2
Query:   62 MSQRQVLQVFEQYQKSRTQFVQTIAELANRPQNIETLQCAGVMNLLRPLLLDVVPSIQQTAALALGRLANHSDDLALAVVKGDILPQLVYSLAEQDRFYKKAASFVLRAVAKHSPELAQSVVDCGALDALVICLEEFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPDTKLKRQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIREIAKHTPELSQLIVNAGGVAAIVDFIGETKGNISLPGIMMLGYVAAHSETLSMSVIVSRGVLQLSSIFNNDCEDHILAATAWALGQIGRHTPEHSKAVAKQNVLPKLLRCYLRPDVSEDLQNKSKKALKHILQKCVYLEALEPLLQDAPPNILKHVVAQFSKVLPNNPQARRLFVTSGGLKKVQDMKVEPGSALSEYINIINNCYPEEIVKYYSPGYSEALLERVESYQP 1579
            MSQRQVLQVFEQYQK+RTQFVQ +AELA RPQNIETLQ AGVM+LLR LLLDVVP+IQQTAALALGRLAN++DDLA AVVK DILPQLVYSLAEQ+RFYKKAA+FVLRAV KHSP+LAQ++VDCGALD LVICLE+FDP VKE +AW L YIARHNA+L+Q+VVDAGAVPLLVLC+QEP++ LKRIAASALSDI KHSP+LAQTVVDAGA+AHLAQM+LNPD KLK QI SAL+Q++KHSVDLAE+VVEAEIFP +LTCLKDKD+ VKKN +TLIREIAKHTPELSQL+VNAGGVAA++D IG  KGN  LPGIMMLGYVAAHSE L+M+VI+S+GV QLS   + + EDHI AA AWALGQIGRHTPEH++AVA  N LP LL  Y+  + SEDLQ KSKKA+K+ILQKC YL ALEP L DAPPNILKHVV QFSKVLP++ +ARRLFVTSGGLKKVQ++K EPGS L EYIN IN+CYPEEIV+YYSPGYS+ LL+RV+SYQP
Sbjct:    1 MSQRQVLQVFEQYQKARTQFVQMVAELATRPQNIETLQNAGVMSLLRTLLLDVVPTIQQTAALALGRLANYNDDLAEAVVKCDILPQLVYSLAEQNRFYKKAAAFVLRAVGKHSPQLAQAIVDCGALDTLVICLEDFDPGVKEAAAWALRYIARHNAELSQAVVDAGAVPLLVLCIQEPEIALKRIAASALSDIAKHSPELAQTVVDAGAVAHLAQMILNPDAKLKHQILSALSQVSKHSVDLAEMVVEAEIFPVVLTCLKDKDEYVKKNASTLIREIAKHTPELSQLVVNAGGVAAVIDCIGSCKGNTRLPGIMMLGYVAAHSENLAMAVIISKGVPQLSVCLSEEPEDHIKAAAAWALGQIGRHTPEHARAVAVTNTLPVLLSLYMSTESSEDLQVKSKKAIKNILQKCTYLPALEPFLYDAPPNILKHVVGQFSKVLPHDSKARRLFVTSGGLKKVQEIKAEPGSLLQEYINSINSCYPEEIVRYYSPGYSDTLLQRVDSYQP 506          
BLAST of Sperm associated antigen 6 vs. UniProt
Match: sp|G5EB89|KAPA_EMENI (Importin subunit alpha OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=kapA PE=1 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 3.113e-10
Identity = 72/322 (22.36%), Postives = 136/322 (42.24%), Query Frame = 2
Query:  266 ANHSDDLALAVVKGDI---LPQLVYS-LAEQDRFYKKAASFVLRAVAKHSPELAQSVVDCGALDALVICLEEFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPDTKLK--RQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIREIAKHTPELSQLIVNAGGVAAIVDFIGETKGNISLPGIMMLGYVAAHSETLSMSVIVSRGVLQLSSIFNNDCEDHILAATAWALGQIGRHTPEHSKAVAKQNVLPKLL 1213
            A  SDD A A+ + ++   LP++V    ++Q     +A +   + ++K      + V++ G +   V  L      V+  +AW L  IA  +AQ  Q V++AGAVP+ V  +  P+  ++  A  AL +I   SP     V++AGA+  L  ++ N   K+   R     L+   +      +    A   P +   +   DD V  +    I  ++    E  Q ++ AG    +V+ +     ++  P +  +G +    + +   VI++ G L       +  +D I     W +  I        ++V    ++P L+
Sbjct:   66 AAESDDEASAI-ESELNVELPEMVKGVFSDQIEAQIQATTKFRKLLSKERNPPIERVIETGVVSRFVEFLRSPHTLVQFEAAWALTNIASGSAQQTQVVIEAGAVPIFVELLSSPEPDVREQAVWALGNIAGDSPQCRDFVLNAGALRPLLTLI-NDGRKISMLRNATWTLSNFCRGKTPQPDWNTIAPALPVLAKLIYMLDDEVLIDACWAISYLSDGPNEKIQAVIEAGIPRRLVELLMHASTSVQTPALRSVGNIVT-GDDVQTQVIINCGALPALLSLLSSTKDGIRKEACWTISNITAGNSSQIQSVIDAGIIPPLV 384          

HSP 2 Score: 55.0694 bits (131), Expect = 1.149e-6
Identity = 47/181 (25.97%), Postives = 81/181 (44.75%), Query Frame = 2
Query:  242 AALALGRLANHSDDLALAVVKGDILPQLVYSLAEQDRFYKKAASFVLRAVAKHSPELAQSVVDCGALDALVICLEEFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDICK---HSPDLAQTVVDAGAIAHLAQMVLNPDTKLKRQIFSALAQIAK 775
            A  A+  L++  ++   AV++  I  +LV  L       +  A   +  +        Q +++CGAL AL+  L      +++ + WT+  I   N+   QSV+DAG +P LV  +   D   ++ A  A+S+        PD  + +V  G I  L  ++  PD K+ +     L  I K
Sbjct:  272 ACWAISYLSDGPNEKIQAVIEAGIPRRLVELLMHASTSVQTPALRSVGNIVTGDDVQTQVIINCGALPALLSLLSSTKDGIRKEACWTISNITAGNSSQIQSVIDAGIIPPLVHLLANGDFKTRKEACWAISNATSGGLQKPDQIRYLVTQGCIKPLCDLLACPDNKIIQVALDGLENILK 452          
BLAST of Sperm associated antigen 6 vs. UniProt
Match: sp|B9DHT4|ARIA_ARATH (ARM REPEAT PROTEIN INTERACTING WITH ABF2 OS=Arabidopsis thaliana OX=3702 GN=ARIA PE=1 SV=2)

HSP 1 Score: 65.855 bits (159), Expect = 5.924e-10
Identity = 64/270 (23.70%), Postives = 122/270 (45.19%), Query Frame = 2
Query:  329 YSLAEQDRFYKKAASFVLRAVAKHSPELAQSVVDCGALDALVICLEE------------FDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLG--------LKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPDTKLKRQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIREIAKHTPELSQLIVNAGGVAAIVDFIGETKGNISLPGIMMLGYVAAHSETLSMSVIVSRGVLQ 1078
            +S  E DR   K A+ VL  +AK+  +L   +VD GA+ AL+  L+             ++  V++GSA+ LG +A    +  + +VD GA+P LV  ++    G        + R AA A++++   +  +   V   G I  L +++   D+K++R    AL  +A  + D    +VE    P ++  L  +D  +      +I  +   +P + + ++ AG +  ++  +            ++LG  A+      +  IV RG ++
Sbjct:   61 FSWQESDRAAAKRATQVLAELAKNE-DLVNVIVDGGAVPALMTHLQAPPYNDGDLAEKPYEHEVEKGSAFALGLLA-IKPEYQKLIVDKGALPHLVNLLKRNKDGSSSRAVNSVIRRAADAITNLAHENSSIKTRVRVEGGIPPLVELLEFSDSKVQRAAAGALRTLAFKNDDNKNQIVECNALPTLILMLGSEDAAIHYEAVGVIGNLVHSSPHIKKEVLTAGALQPVIGLLSSCCPESQREAALLLGQFASTDSDCKVH-IVQRGAVR 327          

HSP 2 Score: 58.9214 bits (141), Expect = 8.506e-8
Identity = 57/191 (29.84%), Postives = 89/191 (46.60%), Query Frame = 2
Query:  131 IAELANRPQNIET-LQCAGVMNLLRPLLLDVVPSIQQTAALALGRLANHSDDLALAVVKGDILPQLVYSLAEQDRFYKKAASFVLRAVAKHSPELAQSVVDCGALDALVICLEEFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAH 700
            I  LA+   +I+T ++  G +  L  LL      +Q+ AA AL  LA  +DD    +V+ + LP L+  L  +D      A  V+  +   SP + + V+  GAL  ++  L    P  +  +A  LG  A  ++     +V  GAV  L+  +Q PD+ LK ++A AL         LAQ   +   IAH
Sbjct:  180 ITNLAHENSSIKTRVRVEGGIPPLVELLEFSDSKVQRAAAGALRTLAFKNDDNKNQIVECNALPTLILMLGSEDAAIHYEAVGVIGNLVHSSPHIKKEVLTAGALQPVIGLLSSCCPESQREAALLLGQFASTDSDCKVHIVQRGAVRPLIEMLQSPDVQLKEMSAFALG-------RLAQDAHNQAGIAH 363          
BLAST of Sperm associated antigen 6 vs. UniProt
Match: sp|B6HJ92|KAPA_PENRW (Importin subunit alpha OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) OX=500485 GN=kapA PE=1 SV=1)

HSP 1 Score: 63.929 bits (154), Expect = 2.117e-9
Identity = 75/334 (22.46%), Postives = 139/334 (41.62%), Query Frame = 2
Query:  236 QTAALALGRLA--NHSDDLALAVVKGDI---LPQLVYS-LAEQDRFYKKAASFVLRAVAKHSPELAQSVVDCGALDALVICLEEFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPDTKLK--RQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIREIAKHTPELSQLIVNAGGVAAIVDFIGETKGNISLPGIMMLGYVAAHSETLSMSVIVSRGVLQLSSIFNNDCEDHILAATAWALGQIGRHTPEHSKAVAKQNVLPKLL 1213
            Q   + +G +A    SDD A A+ + ++   LPQ+V    ++Q     +A +   + ++K      + V++ G +   V  L      V+  SAW L  IA  +AQ  Q V++AGAVP+ V  +  P+  ++  A  AL +I   SP     V+ AGA+  L  ++ N   KL   R     L+   +      +    A   P +   +   DD V  +    I  ++    +  Q ++ AG    +V+ +     ++  P +  +G +    + +   VI++ G L       +  +D I     W +  +        +AV    ++  L+
Sbjct:   54 QDGRIGVGGMAAATESDDEASAI-ESELNVELPQMVKGVFSDQVEEQIQATTKFRKLLSKERNPPIERVIETGVVARFVEFLRSPHTLVQFESAWALTNIASGSAQQTQVVIEAGAVPIFVELLSSPEPDVREQAVWALGNIAGDSPHCRDFVLGAGALRPLLNLI-NDGRKLSMLRNATWTLSNFCRGKTPQPDWNTIAPALPVLAKLIYMLDDEVLIDACWAISYLSDGANDKIQAVIEAGIPRRLVELLMHASTSVQTPALRSVGNIVT-GDDVQTQVIINCGSLPALLSLLSSTKDGIRKEACWTISNVTAGNSSQIQAVIDAGIIAPLI 384          
BLAST of Sperm associated antigen 6 vs. TrEMBL
Match: gnl|BL_ORD_ID|15762875 (tr|A0A1I8HT46|A0A1I8HT46_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig024813g1 PE=4 SV=1)

HSP 1 Score: 897.501 bits (2318), Expect = 0.000e+0
Identity = 427/506 (84.39%), Postives = 478/506 (94.47%), Query Frame = 2
Query:   62 MSQRQVLQVFEQYQKSRTQFVQTIAELANRPQNIETLQCAGVMNLLRPLLLDVVPSIQQTAALALGRLANHSDDLALAVVKGDILPQLVYSLAEQDRFYKKAASFVLRAVAKHSPELAQSVVDCGALDALVICLEEFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPDTKLKRQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIREIAKHTPELSQLIVNAGGVAAIVDFIGETKGNISLPGIMMLGYVAAHSETLSMSVIVSRGVLQLSSIFNNDCEDHILAATAWALGQIGRHTPEHSKAVAKQNVLPKLLRCYLRPDVSEDLQNKSKKALKHILQKCVYLEALEPLLQDAPPNILKHVVAQFSKVLPNNPQARRLFVTSGGLKKVQDMKVEPGSALSEYINIINNCYPEEIVKYYSPGYSEALLERVESYQP 1579
            MSQRQVLQVFEQYQK+RTQFVQT+AELA RPQNIETLQ AGVM+LLRPLLLD+VP+IQQTAALALGRLAN++D+LA AVVKGDILPQLVYSLAEQ+RFYKKAA+FVLRAVAKHSPELAQ+VVDCGALDALVICLEEFDP VKE +AW LGYIARH+A+LAQSVVDAGAVPLLVLCVQEPDL LKRIAASALSDI KHSP+LAQTVVDAGAIAHLAQMVLNPD KLKRQ+FSALAQIAKHSVDLAE+VVEAEIFPA+LTCLKD D+ V+KNCATLIRE+AKHTPELSQLIVNAGGVAA+VDF+G+++GN+ LPG+MMLGYVAAHSE L+M++IVSRGVL L ++   + EDHI AA AW+LGQIGRH+PEH+K+VA+ NVLPKLLR YLRPDVSEDLQ KSKKALKHILQKCV+LEALEPLLQ+APPNILKHVVAQFSKVLP+NP++RRLFVTSGGLKK+Q+++ EPGSAL+EYIN INNCYPEEIVKYYSPGYS+ALLER+E Y P
Sbjct:    1 MSQRQVLQVFEQYQKARTQFVQTVAELATRPQNIETLQNAGVMSLLRPLLLDIVPTIQQTAALALGRLANYNDELAEAVVKGDILPQLVYSLAEQNRFYKKAAAFVLRAVAKHSPELAQAVVDCGALDALVICLEEFDPGVKESAAWALGYIARHSAELAQSVVDAGAVPLLVLCVQEPDLSLKRIAASALSDISKHSPELAQTVVDAGAIAHLAQMVLNPDAKLKRQVFSALAQIAKHSVDLAEMVVEAEIFPAVLTCLKDPDEYVRKNCATLIREVAKHTPELSQLIVNAGGVAAMVDFVGDSRGNVRLPGVMMLGYVAAHSENLAMAIIVSRGVLGLDAVLQTEPEDHIQAAAAWSLGQIGRHSPEHAKSVAQANVLPKLLRAYLRPDVSEDLQIKSKKALKHILQKCVHLEALEPLLQEAPPNILKHVVAQFSKVLPHNPKSRRLFVTSGGLKKIQEIRAEPGSALAEYINTINNCYPEEIVKYYSPGYSDALLERIEHYLP 506          
BLAST of Sperm associated antigen 6 vs. TrEMBL
Match: gnl|BL_ORD_ID|15794625 (tr|A0A1I8GNF6|A0A1I8GNF6_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig003556g1 PE=4 SV=1)

HSP 1 Score: 896.345 bits (2315), Expect = 0.000e+0
Identity = 426/506 (84.19%), Postives = 479/506 (94.66%), Query Frame = 2
Query:   62 MSQRQVLQVFEQYQKSRTQFVQTIAELANRPQNIETLQCAGVMNLLRPLLLDVVPSIQQTAALALGRLANHSDDLALAVVKGDILPQLVYSLAEQDRFYKKAASFVLRAVAKHSPELAQSVVDCGALDALVICLEEFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPDTKLKRQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIREIAKHTPELSQLIVNAGGVAAIVDFIGETKGNISLPGIMMLGYVAAHSETLSMSVIVSRGVLQLSSIFNNDCEDHILAATAWALGQIGRHTPEHSKAVAKQNVLPKLLRCYLRPDVSEDLQNKSKKALKHILQKCVYLEALEPLLQDAPPNILKHVVAQFSKVLPNNPQARRLFVTSGGLKKVQDMKVEPGSALSEYINIINNCYPEEIVKYYSPGYSEALLERVESYQP 1579
            MSQRQVLQVFEQYQK+RTQFVQT+AELA RPQNIETLQ AGVM+LLRPLLLD+VP+IQQTAALALGRLAN++D+LA AVVKGDILPQLVYSLAEQ+RFYKKAA+FVLRAVAKHSPELAQ+VVDCGALDALVICLEEFDP VKE +AW LGYIARH+A+LAQSVVDAGAVPLLVLCVQEPDL LKRIAASALSDI KHSP+LAQTVVDAGAIAHLAQMVLNPD KLKRQ+FSALAQ+AKHSVDLAE+VVEAEIFPA+LTCLKD D+ V+KNCATLIRE+AKHTPELSQLIVNAGGVAA+VDF+G+++GN+ LPG+MMLGYVAAHSE L+M++IVSRGVL L ++   + EDHI AA AW+LGQIGRH+PEH+K+VA+ NVLPKLLR YLRPDVSEDLQ KSKKALKHILQKCV+LEALEPLLQ+APPNILKHVVAQFSKVLP+NP++RRLFVTSGGLKK+Q+++ EPGSAL+EYIN INNCYPEEIVKYYSPGYS+ALLER+E+Y P
Sbjct:    1 MSQRQVLQVFEQYQKARTQFVQTVAELATRPQNIETLQNAGVMSLLRPLLLDIVPTIQQTAALALGRLANYNDELAEAVVKGDILPQLVYSLAEQNRFYKKAAAFVLRAVAKHSPELAQAVVDCGALDALVICLEEFDPGVKESAAWALGYIARHSAELAQSVVDAGAVPLLVLCVQEPDLSLKRIAASALSDISKHSPELAQTVVDAGAIAHLAQMVLNPDAKLKRQVFSALAQMAKHSVDLAEMVVEAEIFPAVLTCLKDPDEYVRKNCATLIREVAKHTPELSQLIVNAGGVAAMVDFVGDSRGNVRLPGVMMLGYVAAHSENLAMAIIVSRGVLGLDAVLQTEPEDHIQAAAAWSLGQIGRHSPEHAKSVAQANVLPKLLRAYLRPDVSEDLQIKSKKALKHILQKCVHLEALEPLLQEAPPNILKHVVAQFSKVLPHNPKSRRLFVTSGGLKKIQEIRAEPGSALAEYINTINNCYPEEIVKYYSPGYSDALLERIENYLP 506          
BLAST of Sperm associated antigen 6 vs. TrEMBL
Match: gnl|BL_ORD_ID|15757020 (tr|A0A267DQ56|A0A267DQ56_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig008678g1 PE=4 SV=1)

HSP 1 Score: 894.804 bits (2311), Expect = 0.000e+0
Identity = 427/506 (84.39%), Postives = 475/506 (93.87%), Query Frame = 2
Query:   62 MSQRQVLQVFEQYQKSRTQFVQTIAELANRPQNIETLQCAGVMNLLRPLLLDVVPSIQQTAALALGRLANHSDDLALAVVKGDILPQLVYSLAEQDRFYKKAASFVLRAVAKHSPELAQSVVDCGALDALVICLEEFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPDTKLKRQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIREIAKHTPELSQLIVNAGGVAAIVDFIGETKGNISLPGIMMLGYVAAHSETLSMSVIVSRGVLQLSSIFNNDCEDHILAATAWALGQIGRHTPEHSKAVAKQNVLPKLLRCYLRPDVSEDLQNKSKKALKHILQKCVYLEALEPLLQDAPPNILKHVVAQFSKVLPNNPQARRLFVTSGGLKKVQDMKVEPGSALSEYINIINNCYPEEIVKYYSPGYSEALLERVESYQP 1579
            MSQRQVLQVFEQYQK+RTQFVQT+AELA RPQNIETLQ AGVM+LLRPLLLD+VP+IQQTAALALGRLAN++DDLA AVVKGDILPQLVYSLAEQ+RFYKKAA+FVLRAVAKHSPELAQ+VVDCGALDALVICLEEFDP VKE +AW LGYIARH  +LAQ+VVDAGAVPLLVLCVQEPDL LKRIAASALSDI KHSP+LAQTVVDAGAIAHLAQMVLNPD KLKRQ+FSALAQI+KHSVDLAE+VVEAEIFPA+LTCLKD D+ V+KNCATLIRE+AKHTPELSQLIVNAGGVAAIVDF+G+++GN+ LPG+MMLGYVAAHSE L+M+VIVSRGVL L ++   + EDHI AA AW+LGQIGRH+PEH+KAVA+ NVLPKLLR YLRPDVSEDLQ KSKKALKHILQKCV+LEALEPLLQ+AP NILKHVVAQFSKVLP+NP++RRLFVTSGGLKK+Q+++ EPGSAL+EYIN INNCYPEEIVKYYSPGYS++LLERVE Y P
Sbjct:    1 MSQRQVLQVFEQYQKARTQFVQTVAELATRPQNIETLQNAGVMSLLRPLLLDIVPTIQQTAALALGRLANYNDDLAEAVVKGDILPQLVYSLAEQNRFYKKAAAFVLRAVAKHSPELAQAVVDCGALDALVICLEEFDPGVKESAAWALGYIARHGPELAQAVVDAGAVPLLVLCVQEPDLSLKRIAASALSDISKHSPELAQTVVDAGAIAHLAQMVLNPDAKLKRQVFSALAQISKHSVDLAEMVVEAEIFPAVLTCLKDPDEYVRKNCATLIREVAKHTPELSQLIVNAGGVAAIVDFVGDSRGNVRLPGVMMLGYVAAHSENLAMAVIVSRGVLTLDAVLQTESEDHIQAAAAWSLGQIGRHSPEHAKAVAQANVLPKLLRAYLRPDVSEDLQIKSKKALKHILQKCVHLEALEPLLQEAPANILKHVVAQFSKVLPHNPKSRRLFVTSGGLKKIQEIRAEPGSALAEYINTINNCYPEEIVKYYSPGYSDSLLERVEHYLP 506          
BLAST of Sperm associated antigen 6 vs. TrEMBL
Match: gnl|BL_ORD_ID|18239564 (tr|A0A1I8HVJ4|A0A1I8HVJ4_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 887.1 bits (2291), Expect = 0.000e+0
Identity = 423/500 (84.60%), Postives = 471/500 (94.20%), Query Frame = 2
Query:   62 MSQRQVLQVFEQYQKSRTQFVQTIAELANRPQNIETLQCAGVMNLLRPLLLDVVPSIQQTAALALGRLANHSDDLALAVVKGDILPQLVYSLAEQDRFYKKAASFVLRAVAKHSPELAQSVVDCGALDALVICLEEFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPDTKLKRQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIREIAKHTPELSQLIVNAGGVAAIVDFIGETKGNISLPGIMMLGYVAAHSETLSMSVIVSRGVLQLSSIFNNDCEDHILAATAWALGQIGRHTPEHSKAVAKQNVLPKLLRCYLRPDVSEDLQNKSKKALKHILQKCVYLEALEPLLQDAPPNILKHVVAQFSKVLPNNPQARRLFVTSGGLKKVQDMKVEPGSALSEYINIINNCYPEEIVKYYSPGYSEALLER 1561
            MSQRQVLQVFEQYQK+RTQFVQT+AELA RPQNIETLQ AGVM+LLRPLLLD+VP+IQQTAALALGRLAN++DDLA AVVKGDILPQLVYSLAEQ+RFYKKAA+FVLRAVAKHSPELAQ+VVDCGALDALVICLEEFDP VKE +AW LGYIARH  +LAQ+VVDAGAVPLLVLCVQEPDL LKRIAASALSDI KHSP+LAQTVVDAGAIAHLAQMVLNPD KLKRQ+FSALAQI+KHSVDLAE+VVEAEIFPA+LTCLKD D+ V+KNCATLIRE+AKHTPELSQLIVNAGGVAAIVDF+G+++GN+ LPG+MMLGYVAAHSE L+M+VIVSRGVL L ++   + EDHI AA AW+LGQIGRH+PEH+KAVA+ NVLPKLLR YLRPDVSEDLQ KSKKALKHILQKCV+LEALEPLLQ+AP NILKHVVAQFSKVLP+NP++RRLFVTSGGLKK+Q+++ EPGSAL+EYIN INNCYPEEIVKYYSPGYS++LLER
Sbjct:    1 MSQRQVLQVFEQYQKARTQFVQTVAELATRPQNIETLQNAGVMSLLRPLLLDIVPTIQQTAALALGRLANYNDDLAEAVVKGDILPQLVYSLAEQNRFYKKAAAFVLRAVAKHSPELAQAVVDCGALDALVICLEEFDPGVKESAAWALGYIARHGPELAQAVVDAGAVPLLVLCVQEPDLSLKRIAASALSDISKHSPELAQTVVDAGAIAHLAQMVLNPDAKLKRQVFSALAQISKHSVDLAEMVVEAEIFPAVLTCLKDPDEYVRKNCATLIREVAKHTPELSQLIVNAGGVAAIVDFVGDSRGNVRLPGVMMLGYVAAHSENLAMAVIVSRGVLTLDAVLQTESEDHIQAAAAWSLGQIGRHSPEHAKAVAQANVLPKLLRAYLRPDVSEDLQIKSKKALKHILQKCVHLEALEPLLQEAPANILKHVVAQFSKVLPHNPKSRRLFVTSGGLKKIQEIRAEPGSALAEYINTINNCYPEEIVKYYSPGYSDSLLER 500          
BLAST of Sperm associated antigen 6 vs. TrEMBL
Match: gnl|BL_ORD_ID|23905671 (tr|K1PQU8|K1PQU8_CRAGI Sperm-associated antigen 6 OS=Crassostrea gigas OX=29159 GN=CGI_10011025 PE=4 SV=1)

HSP 1 Score: 883.248 bits (2281), Expect = 0.000e+0
Identity = 424/507 (83.63%), Postives = 473/507 (93.29%), Query Frame = 2
Query:   62 MSQRQVLQVFEQYQKSRTQFVQTIAELANRPQNIETLQCAGVMNLLRPLLLDVVPSIQQTAALALGRLANHSDDLALAVVKGDILPQLVYSLAEQDRFYKKAASFVLRAVAKHSPELAQSVVDCGALDALVICLEEFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPDTKLKRQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIREIAKHTPELSQLIVNAGGVAAIVDFIGETKGNISLPGIMMLGYVAAHSETLSMSVIVSRGVLQLSSIFNNDCEDHILAATAWALGQIGRHTPEHSKAVAKQNVLPKLLRCYLRPDVSEDLQNKSKKALKHILQKCVYLEALEPLLQDAPPNILKHVVAQFSKVLPNNPQARRLFVTSGGLKKVQDMKVEPGSALSEYINIINNCYPEEIVKYYSPGYSEALLERVESYQPA 1582
            MSQRQVLQVFEQYQK+RT FVQT+AELA+RPQNIETLQ AGVM+LLRPLLLD+VP+IQQTAALALGRLAN++DDLA AVVKGDILPQLVYSLAEQ+RFYKKAA+FVLRAVAKHSP+LAQSVVDCGALDALVICLEEFDP VKE +AW LGYIARHNA+LAQ+VVDAGAVPLLVLC+QEP+L LKRIAASALSDICKHSP+LAQTVVDAGAIAHLAQM+LNPD KLKRQ+FSAL+QI+KHSVDLAE+VVEAEIFPA+LTCLKD D+ VKKN ATLIREIAKHTPEL+QLIVNAGGVAA+VD++GE+KGNI LPGIMMLGYVAAHSE L+M+VIVS+GV+QL+   + + EDHI AA AWALGQIGRHTPEH+KAVA  NVLPKLL+CYLR D SEDLQ KSKKALK+ILQKCV+L ALEPLL DAPPNILKHVV QFSKVLP++ +ARRLFVTS GLKK+Q++K EPGSAL+EYIN INNCYPEEIVKYYSPGYS+ LLERVE YQP+
Sbjct:    1 MSQRQVLQVFEQYQKARTGFVQTVAELASRPQNIETLQNAGVMSLLRPLLLDIVPTIQQTAALALGRLANYNDDLAEAVVKGDILPQLVYSLAEQNRFYKKAAAFVLRAVAKHSPQLAQSVVDCGALDALVICLEEFDPGVKESAAWALGYIARHNAELAQAVVDAGAVPLLVLCIQEPELSLKRIAASALSDICKHSPELAQTVVDAGAIAHLAQMILNPDAKLKRQVFSALSQISKHSVDLAEMVVEAEIFPAVLTCLKDPDEYVKKNVATLIREIAKHTPELAQLIVNAGGVAAVVDYVGESKGNIRLPGIMMLGYVAAHSENLAMAVIVSKGVVQLAIALSEEPEDHIQAAAAWALGQIGRHTPEHAKAVAVANVLPKLLQCYLRADASEDLQTKSKKALKNILQKCVHLPALEPLLHDAPPNILKHVVGQFSKVLPHDSKARRLFVTSAGLKKIQEIKAEPGSALAEYINTINNCYPEEIVKYYSPGYSDTLLERVEQYQPS 507          
BLAST of Sperm associated antigen 6 vs. Ensembl Cavefish
Match: spag6 (sperm associated antigen 6 [Source:NCBI gene;Acc:103022863])

HSP 1 Score: 828.55 bits (2139), Expect = 0.000e+0
Identity = 394/507 (77.71%), Postives = 454/507 (89.55%), Query Frame = 2
Query:   62 MSQRQVLQVFEQYQKSRTQFVQTIAELANRPQNIETLQCAGVMNLLRPLLLDVVPSIQQTAALALGRLANHSDDLALAVVKGDILPQLVYSLAEQDRFYKKAASFVLRAVAKHSPELAQSVVDCGALDALVICLEEFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPDTKLKRQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIREIAKHTPELSQLIVNAGGVAAIVDFIGETKGNISLPGIMMLGYVAAHSETLSMSVIVSRGVLQLSSIFNNDCEDHILAATAWALGQIGRHTPEHSKAVAKQNVLPKLLRCYLRPDVSEDLQNKSKKALKHILQKCVYLEALEPLLQDAPPNILKHVVAQFSKVLPNNPQARRLFVTSGGLKKVQDMKVEPGSALSEYINIINNCYPEEIVKYYSPGYSEALLERVESYQPA 1582
            MSQRQVLQVFEQYQK+RTQFVQT+A+LA RPQNIETLQ AGVM+LLRPLLLD VP++QQTAALALGRLAN++DDLA A+VK DILPQLVYSLAEQ+RFYKKAA+FVLRAVAKHS ELAQ+VVDCGALDALV+ +EEFDP VKE +AW LGYIARHNAQLAQ+VVDAGAVPLLVLC+QEP++ LKRIAAS LSDI KHSP+LAQTVVD GAIAHLAQM LNPD KLKRQ+FSAL QI+KHSVDLAE+VVEAEIFPA+L+ LKD D+ VKKN  T++REI KHTPELSQ+IVNAGGVAA++D++G+++GN+ LPGIMMLGY+AAHSE L+M+VIVS+GV QL+     + EDHI AATAWA GQIG+HTPEH++AVA  NVLPKLL  YL    SEDLQ K+KKALK+ILQKC YL ALEPLL +AP NILKHV+ QFSKVLP++ +ARRLFVTSGGLKKVQ++K EPGSAL E+IN INNCYPEEIV+YYSPGYSE LLERV++YQP+
Sbjct:    1 MSQRQVLQVFEQYQKARTQFVQTVADLATRPQNIETLQNAGVMSLLRPLLLDAVPTVQQTAALALGRLANYNDDLADAIVKADILPQLVYSLAEQNRFYKKAAAFVLRAVAKHSAELAQAVVDCGALDALVVSVEEFDPGVKEAAAWALGYIARHNAQLAQAVVDAGAVPLLVLCIQEPEIALKRIAASTLSDIAKHSPELAQTVVDTGAIAHLAQMTLNPDAKLKRQVFSALGQISKHSVDLAEMVVEAEIFPAVLSSLKDPDEYVKKNVTTMMREITKHTPELSQMIVNAGGVAAVIDYLGDSRGNVRLPGIMMLGYIAAHSENLAMAVIVSKGVPQLAICMAEESEDHIKAATAWAFGQIGQHTPEHARAVAAANVLPKLLNLYLDTQSSEDLQVKAKKALKNILQKCTYLPALEPLLYEAPSNILKHVICQFSKVLPHDSKARRLFVTSGGLKKVQEIKAEPGSALQEHINAINNCYPEEIVRYYSPGYSEVLLERVDNYQPS 507          
BLAST of Sperm associated antigen 6 vs. Ensembl Cavefish
Match: kpna5 (karyopherin alpha 5 (importin alpha 6) [Source:NCBI gene;Acc:553205])

HSP 1 Score: 61.6178 bits (148), Expect = 1.068e-9
Identity = 61/267 (22.85%), Postives = 114/267 (42.70%), Query Frame = 2
Query:  179 AGVMNLLRPLLLDVVPSIQQTAALALGRLANHSDDLALAVVKGDILPQLVYSLAEQDRFYK-KAASFVLRAV--AKHSPELAQSVVDCGALDALVICLEEFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPDTKLKRQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIRE-IAKHTPELSQLIVNAGGVAAIVDFI 967
             G + +   LL      +Q+ A  ALG +A  + +    V+   ILP L   LA+ +R    + A + L  +   K+ P     V  C  L  L   L   DP V   + W L Y++       Q+V+D+G    LV  +   D  +   A  A+ +I        Q +++  A+  L  ++ +P   +K++    ++ I   +    + V++A IFP ++  L+  +   +K  A  I    +  +PE  + +V+   +  + D +
Sbjct:  173 TGAVPIFIELLNSEYEDVQEQAVWALGNIAGDNAECRDFVLNCGILPSLQQLLAKSNRLTTTRNAVWALSNLCRGKNPPPDFSKVSPC--LSVLSRLLFSSDPDVLADACWALSYLSDGPNDKIQAVIDSGVCRRLVELLMHSDYKVVSPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIKKEACWTVSNITAGNRAQIQTVIDANIFPVLIEILQKAEFRTRKEAAWAITNATSGGSPEQIRYLVSLNCIKPMCDLL 437          
BLAST of Sperm associated antigen 6 vs. Ensembl Cavefish
Match: kpna7 (importin subunit alpha-5-like [Source:NCBI gene;Acc:103041448])

HSP 1 Score: 60.8474 bits (146), Expect = 1.803e-9
Identity = 56/255 (21.96%), Postives = 106/255 (41.57%), Query Frame = 2
Query:  395 KHSPELAQSVVDCGALDALVICLEEFD-PAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAI-AHLAQMVLNPDTKLKRQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIREIAKHTPELSQLIVNAGGVAAIVDFIGETKGNISLPGIMMLGYVAAHSETLSMSVIVSRGVLQLSSIFNNDCEDHILAATAWALGQIG 1153
            + +P L + VV+ G L   V  L   D P ++  +AW+L  +A   +   Q VV+ GAVP  +  +  P L +   A  AL +I    P     ++D   I A LA++  +      R +   L+ + ++           ++ P+I+  L   D  V  +    I  +     E   +I+  G +  +V+ +   +  +  P +  +G + + S+  + + I   GVL          + ++    AWA+  I 
Sbjct:  104 ERNPPLKE-VVEAGLLSRFVEFLSRNDNPTLQFEAAWSLTNVASGTSWHTQQVVEHGAVPAFISLLASPMLNISEQAVWALGNIAGDGPSYRDALIDCNVIPALLARLTPDAPVGYLRNLTWTLSNLCRNKNPFPRFSAVQQMLPSIIQLLHHSDKSVLSDACWAISYLTDGPNERIDVIIKTGILPRLVELLTFEELAVVTPALRSIGNIVSGSDVQTQAAI-DAGVLTALPKLMRHPKPNVQKEAAWAVSNIA 356          
BLAST of Sperm associated antigen 6 vs. Ensembl Cavefish
Match: kpna3 (karyopherin subunit alpha 3 [Source:NCBI gene;Acc:103046682])

HSP 1 Score: 60.8474 bits (146), Expect = 1.841e-9
Identity = 58/295 (19.66%), Postives = 120/295 (40.68%), Query Frame = 2
Query:  143 ANRPQNIETLQCAGVMNLL-RPLLLDVVPSIQQTAALALGRLANHSDDLALAVVKGDILPQLVYSLAEQDRFYKKAASFVLRAVAKHSPELAQSVVDCGALDALV------------------------------------------ICLEEFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPDTKLKRQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIREIA 898
            ++R   I+ L  +G++ +L + L  D  PS+Q  AA AL  +A+ +     AVVK + +P  +  L    +   + A + L  +    P+    V+  G +  L+                                          +C+++ +  +   + W L Y+     +  Q V+D+G VP LV  +   ++ ++  A  A+ +I   + +  Q V++   ++H   ++ +P  K+ ++    L+ I   +    + V++A + P I+  L   D   +K  A  I  + 
Sbjct:  103 SDRNPPIDDLIKSGILPILVKCLERDDNPSLQFEAAWALTNIASGTSAQTQAVVKSNAVPLFLRLLHSPHQNVCEQAVWALGNIIGDGPQCRDYVISLGVVKPLLSFINPSIPITFLRNVTWVIVNLCRNKDPPPPMETVQEVRGVCVCVKDLNCCILVDTVWALSYLTDGGNEQIQMVIDSGVVPFLVPLLSHQEVKVQTAALRAVGNIVTGTDEQTQVVLNCDVLSHFPNLLTHPKEKINKEAVWFLSNITAGNQQQVQAVIDAGLIPMIIHQLAKGDFGTQKEAAWAISNLT 397          

HSP 2 Score: 56.9954 bits (136), Expect = 3.147e-8
Identity = 55/247 (22.27%), Postives = 109/247 (44.13%), Query Frame = 2
Query:   98 YQKSRTQFVQTIAELANRPQNIETLQ-----CAGVMNLLRPLLLDVVPSIQQTAALALGRLANHSDDLALAVVKGDILPQLVYSLAEQDRFYKKAASFVLRAVAKHSPELAQSVVDCGALDALVICLEEFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDIC-KHSPDLAQTVVDAGAIAHLAQMVLNPDTKLKRQIFSALAQI----AKHSVDLAEIVVE 808
            + ++ T  +  +    + P  +ET+Q     C  V +L   +L+D V         AL  L +  ++    V+   ++P LV  L+ Q+   + AA   +  +   + E  Q V++C  L      L      + + + W L  I   N Q  Q+V+DAG +P+++  + + D G ++ AA A+S++      D  + +V    I     ++   D+++ + +   L  I     + +  +AEI+ E
Sbjct:  218 FLRNVTWVIVNLCRNKDPPPPMETVQEVRGVCVCVKDLNCCILVDTV--------WALSYLTDGGNEQIQMVIDSGVVPFLVPLLSHQEVKVQTAALRAVGNIVTGTDEQTQVVLNCDVLSHFPNLLTHPKEKINKEAVWFLSNITAGNQQQVQAVIDAGLIPMIIHQLAKGDFGTQKEAAWAISNLTISGRKDQVEYLVQQNVIPPFCNLLSVKDSQVVQVVLDGLKNILIMAGEEASTIAEIIEE 456          

HSP 3 Score: 50.0618 bits (118), Expect = 4.601e-6
Identity = 53/274 (19.34%), Postives = 111/274 (40.51%), Query Frame = 2
Query:  422 VVDCGALDALVICLEEFD-PAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPDTKLK--RQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIREIAKHTPELSQLIVNAGGVAAIVDFIGETKGNISLPGIMMLGYVAAHSETLSMSVIVSRGVLQLSSIFNNDCEDHILAATAWALGQIGRHTPEHSKAVAKQNVLPKLLRCYLRPD 1234
            ++  G L  LV CLE  D P+++  +AW L  IA   +   Q+VV + AVPL +  +  P   +   A  AL +I    P     V+  G +  L   + NP   +   R +   +  + ++  D    +   +    +  C+KD +  +  +    +  +     E  Q+++++G V  +V  +   +  +    +  +G +   ++  +  V+    +    ++  +  E  I     W L  I     +  +AV    ++P ++    + D
Sbjct:  112 LIKSGILPILVKCLERDDNPSLQFEAAWALTNIASGTSAQTQAVVKSNAVPLFLRLLHSPHQNVCEQAVWALGNIIGDGPQCRDYVISLGVVKPLLSFI-NPSIPITFLRNVTWVIVNLCRNK-DPPPPMETVQEVRGVCVCVKDLNCCILVDTVWALSYLTDGGNEQIQMVIDSGVVPFLVPLLSHQEVKVQTAALRAVGNIVTGTDEQTQVVLNCDVLSHFPNLLTHPKE-KINKEAVWFLSNITAGNQQQVQAVIDAGLIPMIIHQLAKGD 382          
BLAST of Sperm associated antigen 6 vs. Ensembl Cavefish
Match: kpna6 (karyopherin subunit alpha 6 [Source:NCBI gene;Acc:103046157])

HSP 1 Score: 60.4622 bits (145), Expect = 2.561e-9
Identity = 62/267 (23.22%), Postives = 114/267 (42.70%), Query Frame = 2
Query:  179 AGVMNLLRPLLLDVVPSIQQTAALALGRLANHSDDLALAVVKGDILPQLVYSLAEQDRF-YKKAASFVLRAV--AKHSPELAQSVVDCGALDALVICLEEFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPDTKLKRQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIRE-IAKHTPELSQLIVNAGGVAAIVDFI 967
            AG + +   LL      +Q+ A  ALG +A  S      V+  +ILP L+  L +  R    + A + L  +   K  P   + V  C  L  L   L   D  +   + W L Y++    +  Q+V+D+G    LV  +   D  +   A  A+ +I        Q V++  A+  L  ++ +    ++++    ++ I   +    + V++A IFP ++  L+  +   +K  A  I    +  TPE  + +VN G +  + D +
Sbjct:  163 AGAVPVFIQLLNSEFEDVQEQAVWALGNIAGDSAVCRDFVLNCNILPPLLMLLTKSTRLTMTRNAVWALSNLCRGKSPPPEFEKVSPC--LPVLSRLLFSSDSDLLADACWALSYLSDGPNEKIQAVIDSGVCRRLVELLMHSDYKVASPALRAVGNIVTGDDIQTQVVLNCSALPCLLHLLSSAKESIRKEACWTISNITAGNRAQIQTVIDANIFPVLIEVLQKAEFRTRKEAAWAITNATSGGTPEQIRYLVNLGCIKPLCDLL 427          
BLAST of Sperm associated antigen 6 vs. Ensembl Sea Lamprey
Match: kpna7 (karyopherin alpha 7 (importin alpha 8) [Source:ZFIN;Acc:ZDB-GENE-040426-2023])

HSP 1 Score: 63.1586 bits (152), Expect = 8.655e-11
Identity = 83/381 (21.78%), Postives = 152/381 (39.90%), Query Frame = 2
Query:  494 SAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPDTKL-----KRQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIREIAKHTPELSQLIVNAGGVAAIVDFIGETKGNISLPGIMMLGYVAAHSETLSMSVIVSRGVLQLSSIFNNDCEDHILAATAWALGQIGRHTPEHSKAVAKQNVLPKLLRCYLRPDVSEDLQN-------KSKKALKHILQKCVYLEALEPLLQ--------------DAPPNILK--HVVAQFSKVLPNNPQARRLFVTSGGLKKVQDMKVEPGSALSE-YINIINNCYPEEIVKYYSPGYSEA 1549
            +AW L  IA   ++  ++VVD GAVP  V  +  P   +   A  AL +I    P L   V+  GA+  L  ++  PD  +      R +   ++ + ++            + PA++  L  +D  V+ +    +  ++    +  +++V AG V  +   +   +  +  P +  +G +   ++  + +VI + GVL +          ++    AWAL  I     E   AV    ++P L+    + +     +         S   + HI+   V + A+EPLL               DA  NI +    V Q  K+         +    GGL K++ ++     A+ +  +NII+        KY+S   SEA
Sbjct:  115 AAWALTNIASGTSEQTKAVVDGGAVPAFVALLSSPHAHISEQAVWALGNIAGDGPVLRDLVIKYGAVEPLLALMAMPDLSMLSVSYLRNLTWTISNLCRNKKPPPPEEAVLMLLPALVRLLHHEDREVQTDATWALSYLSDGPNDRIEMVVAAGVVPRLAQLLASPELTVLTPALRTVGNIVTGTDQQTQAVI-NTGVLPVFQNLLRHQRSNVQKEAAWALSNITAGHAEQINAVITAGLIPPLVEVLHKGEFKAQREAVWAVTNLTSGGTVDHIV-YVVQVGAMEPLLSLLEVKDSSTVLIILDAITNIFQAGDKVGQTDKLC-------MMVEELGGLDKIEHLQSHENEAVYKAALNIID--------KYFSEDDSEA 478          

HSP 2 Score: 60.4622 bits (145), Expect = 4.753e-10
Identity = 58/271 (21.40%), Postives = 122/271 (45.02%), Query Frame = 2
Query:  296 VVKGDILPQLVYSLAEQD-RFYKKAASFVLRAVAKHSPELAQSVVDCGALDALVICLEEFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIA-----ASALSDICKHS----PDLAQTVVDAGAIAHLAQMVLNPDTKLKRQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIREIAKHTPELSQLIVNAGGVAAIVDFIGETKGNISLPGIMMLGYV-AAHSETLSMSVIVSRGVL 1075
            ++   ++P+ V  L  +D    +  A++ L  +A  + E  ++VVD GA+ A V  L      + E + W LG IA     L   V+  GAV  L+  +  PDL +  ++        +S++C++     P+ A  ++    +  L +++ + D +++     AL+ ++    D  E+VV A + P +   L   +  V       +  I   T + +Q ++N G +    + +   + N+       L  + A H+E   ++ +++ G++
Sbjct:   90 IISAGLIPRFVQFLGHEDCSQIQFEAAWALTNIASGTSEQTKAVVDGGAVPAFVALLSSPHAHISEQAVWALGNIAGDGPVLRDLVIKYGAVEPLLALMAMPDLSMLSVSYLRNLTWTISNLCRNKKPPPPEEAVLML----LPALVRLLHHEDREVQTDATWALSYLSDGPNDRIEMVVAAGVVPRLAQLLASPELTVLTPALRTVGNIVTGTDQQTQAVINTGVLPVFQNLLRHQRSNVQKEAAWALSNITAGHAE--QINAVITAGLI 354          

HSP 3 Score: 47.7506 bits (112), Expect = 5.368e-6
Identity = 45/182 (24.73%), Postives = 85/182 (46.70%), Query Frame = 2
Query:  311 ILPQLVYSLAEQDRFYKKAASFVLRAVAKHSPELAQSVVDCGALDALVICLEEFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPDTKLKRQIFSALAQI-AKHSVDLAEIVVEAEIFPAILTCLKDKD 853
            +LP LV  L  +DR  +  A++ L  ++    +  + VV  G +  L   L   +  V   +  T+G I     Q  Q+V++ G +P+    ++     +++ AA ALS+I     +    V+ AG I  L +++   + K +R+   A+  + +  +VD    VV+      +L+ L+ KD
Sbjct:  227 LLPALVRLLHHEDREVQTDATWALSYLSDGPNDRIEMVVAAGVVPRLAQLLASPELTVLTPALRTVGNIVTGTDQQTQAVINTGVLPVFQNLLRHQRSNVQKEAAWALSNITAGHAEQINAVITAGLIPPLVEVLHKGEFKAQREAVWAVTNLTSGGTVDHIVYVVQVGAMEPLLSLLEVKD 408          
BLAST of Sperm associated antigen 6 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005568.1 (pep scaffold:Pmarinus_7.0:GL477092:38612:43101:1 gene:ENSPMAG00000005012.1 transcript:ENSPMAT00000005568.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.7658 bits (138), Expect = 3.402e-9
Identity = 58/280 (20.71%), Postives = 112/280 (40.00%), Query Frame = 2
Query:  395 KHSPELAQSVVDCGALDALVICLEEFD-PAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPD-----TKLKRQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIREIAKHTPELSQLIVNAGGVAAIVDFIGETKGNISLPGIMMLGYVAAHSETLSMSVIVSRGVLQLSSIFNNDCEDHILAATAWALGQIGRHTPEHSKAVAKQNVLPKLLR 1216
            KH P     ++  G +   V CL+  D P ++  +AW L  IA    +    VV AGAVP LV  V  P   +   A  AL +I     +    VV++GA+  L  ++ N +       L R +   L+ + ++      +     + P ++  L   D  ++ + A  +  +   T E   L+   G    +V  +G     +  P +  +G +   ++     V++  G L +  +     + +I     WA+  +     +  + +    ++P L+ 
Sbjct:    8 KHPP--FNDIIAAGLVPEFVACLDRDDCPLLQFEAAWALTNIASGTGEQTAIVVAAGAVPALVRLVSSPHSHISEQAVWALGNIAGDGAEHRDLVVNSGAVGPLVALLENCNIDEFHVGLLRNLTWTLSNLCRNKNPAPSVTTVLMLLPTMVRLLHHADHEIEADAAWALSYLTDGTNERIHLVQAQGVTPRLVQLLGCDVPAVVTPCLRAIGNMVTGTDE-QTQVVLKAGALDMFPMLLRHPKSNIQKEATWAVSNVAAGPIDQIEQIIAAGLVPHLIH 284          

HSP 2 Score: 53.1434 bits (126), Expect = 8.504e-8
Identity = 57/250 (22.80%), Postives = 106/250 (42.40%), Query Frame = 2
Query:  296 VVKGDILPQLVYSLAEQD-RFYKKAASFVLRAVAKHSPELAQSVVDCGALDALVICLEEFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAV-PLLVLC----VQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPDTKLKRQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIREIAKHTPELSQLIVNAGGVAAIVDFIGETKGNISLPGIMMLGYVAA 1027
            ++   ++P+ V  L   D    +  A++ L  +A  + E    VV  GA+ ALV  +      + E + W LG IA   A+    VV++GAV PL+ L     + E  +GL R     LS++C++             +  + +++ + D +++     AL+ +   + +   +V    + P ++  L      V   C   I  +   T E +Q+++ AG +      +   K NI       +  VAA
Sbjct:   15 IIAAGLVPEFVACLDRDDCPLLQFEAAWALTNIASGTGEQTAIVVAAGAVPALVRLVSSPHSHISEQAVWALGNIAGDGAEHRDLVVNSGAVGPLVALLENCNIDEFHVGLLRNLTWTLSNLCRNKNPAPSVTTVLMLLPTMVRLLHHADHEIEADAAWALSYLTDGTNERIHLVQAQGVTPRLVQLLGCDVPAVVTPCLRAIGNMVTGTDEQTQVVLKAGALDMFPMLLRHPKSNIQKEATWAVSNVAA 264          
BLAST of Sperm associated antigen 6 vs. Ensembl Sea Lamprey
Match: kpna4 (karyopherin alpha 4 (importin alpha 3) [Source:ZFIN;Acc:ZDB-GENE-030131-5584])

HSP 1 Score: 56.225 bits (134), Expect = 1.197e-8
Identity = 43/185 (23.24%), Postives = 84/185 (45.41%), Query Frame = 2
Query:  251 ALGRLANHSDDLALAVVKGDILPQLVYSLAEQDRFYKKAASFVLRAVAKHSPELAQSVVDCGALDALVICLEEFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDIC-KHSPDLAQTVVDAGAIAHLAQMVLNPDTKLKRQIFSALAQIAKHSVDLAEIV 802
            AL  L +  ++    V+   ++P LV  L+ Q+   + AA   +  +   + E  Q V++C AL      L      + + + W L  I   N Q  Q+V+DAG +P+++  + + D G ++ AA A+S++      D  + +V    I     ++   D ++ + +   L  I K + +  E +
Sbjct:  268 ALSYLTDGGNEQIQMVIDSGVVPYLVPLLSHQEVKVQTAALRAVGNIVTGTDEQTQVVLNCDALSHFPALLTHAKEKINKEAVWFLSNITAGNQQQVQAVIDAGLIPMIIHHLAKGDFGTQKEAAWAISNLTISGRKDQVEYLVRENVIPPFCALLAVKDPQVVQVVLDGLNNILKMAGEEVETI 452          

HSP 2 Score: 52.7582 bits (125), Expect = 1.500e-7
Identity = 34/153 (22.22%), Postives = 70/153 (45.75%), Query Frame = 2
Query:  440 LDALVICLEEFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPDTKLKRQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIREIA 898
            L AL + +   D  +   + W L Y+     +  Q V+D+G VP LV  +   ++ ++  A  A+ +I   + +  Q V++  A++H   ++ +   K+ ++    L+ I   +    + V++A + P I+  L   D   +K  A  I  + 
Sbjct:  247 LPALCVLIHHTDINILVDTVWALSYLTDGGNEQIQMVIDSGVVPYLVPLLSHQEVKVQTAALRAVGNIVTGTDEQTQVVLNCDALSHFPALLTHAKEKINKEAVWFLSNITAGNQQQVQAVIDAGLIPMIIHHLAKGDFGTQKEAAWAISNLT 399          

HSP 3 Score: 48.9062 bits (115), Expect = 2.206e-6
Identity = 60/282 (21.28%), Postives = 122/282 (43.26%), Query Frame = 2
Query:  143 ANRPQNIETLQCAGVMNLL-RPLLLDVVPSIQQTAALALGRLANHSDDLALAVVKGDILPQLVYSLAEQDRFYKKAASFVLRAV--AKHSPELAQSVVDCGALDALVICLEEFDPAVK----EGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPDTKLKRQIFSALAQIAKHSVDLAEIVVEAEI---FPAILTCLKDKDDMVKKNCATLIREIAKHTPELSQLIVNAGGVAAIV 958
            ++R   I+ L  +G++ +L + L  +  PS+Q  AA AL  +A+ +     AVVK + +P  +  L    +   + A + L  +  A   P+    V+  G +  L   L   +PA+         W +  + R+             +P L + +   D+ +      ALS +     +  Q V+D+G + +L  ++ + + K++     A+  I   + +  ++V+  +    FPA+LT  K+K   + K     +  I     +  Q +++AG +  I+
Sbjct:  102 SDRNPPIDDLINSGILPILVQCLEREDNPSLQFEAAWALTNIASGTSAQTQAVVKSNAVPLFLKLLHSPHQNVCEQAVWALGNIIAAGDGPQCRDYVISLGVVKPL---LAFINPAIPITFLRNVTWVIVNLCRNKDPPPPMETIQEILPALCVLIHHTDINILVDTVWALSYLTDGGNEQIQMVIDSGVVPYLVPLLSHQEVKVQTAALRAVGNIVTGTDEQTQVVLNCDALSHFPALLTHAKEK---INKEAVWFLSNITAGNQQQVQAVIDAGLIPMII 377          
BLAST of Sperm associated antigen 6 vs. Ensembl Sea Lamprey
Match: kpna6 (karyopherin alpha 6 (importin alpha 7) [Source:ZFIN;Acc:ZDB-GENE-130530-626])

HSP 1 Score: 45.4394 bits (106), Expect = 7.291e-6
Identity = 30/121 (24.79%), Postives = 62/121 (51.24%), Query Frame = 2
Query:  416 QSVVDCGALDALVICLEEFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSD-ICKHSPDLAQTVVDAGAIAHLAQMVLNPDTKLKRQIFSALAQIAK 775
            Q +++C AL  L+  L     ++K+ + WT+  I   +    Q+V+DA   P+L+  +Q+ +   ++ AA A+++     +P+  + +V+ G I  L  ++   D K+ +   + L  I K
Sbjct:   44 QVILNCSALPCLLHLLSNPKESIKKEACWTISNITAGSRAQIQAVIDANIFPVLIEILQKAEFRTRKEAAWAITNATSGGTPEQIRFLVEQGCIKPLCDLLTVMDAKIVQVALNGLENILK 164          
BLAST of Sperm associated antigen 6 vs. Ensembl Yeast
Match: SRP1 (Karyopherin alpha homolog; forms a dimer with karyopherin beta Kap95p to mediate import of nuclear proteins, binds the nuclear localization signal of the substrate during import; involved in cotranslational protein degradation; binds ribosome-bound nascent polypeptides; Srp1p and Sts1p couple proteasomes to nascent polypeptides emerging from the ribosome for cotranslational degradation [Source:SGD;Acc:S000005133])

HSP 1 Score: 58.9214 bits (141), Expect = 1.004e-9
Identity = 62/304 (20.39%), Postives = 125/304 (41.12%), Query Frame = 2
Query:  314 LPQLVYSLAEQDRFYKKAASFVLRAV--AKHSPELAQSVVDCGALDALVICLEEFDPAVKE-GSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPDTKLKRQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIREIAKHTPELSQLIVNAGGVAAIVDFIGETKGNISLPGIMMLGYVAAHSETLSMSVIVSRGVLQLSSIFNNDCEDHILAATAWALGQIGRHTPEHSKAVAKQNVLPKLLR 1216
            LPQ+   L   D   + +A+   R +   +H P +   V+  G +  LV  + E  P + +  +AW L  IA   +   + VVDA AVPL +  +    + +K  A  AL ++   S D    V+   A+  +  +  +    L R     L+ + +      +  V ++  P +   +   D     +    I  ++    E  Q +++      +V+ +      +  P +  +G +   ++ L   V+++ GVL    +  +  +++I     W +  I     E  +AV   N++P L++
Sbjct:   89 LPQMTQQLNSDDMQEQLSATVKFRQILSREHRPPI-DVVIQAGVVPRLVEFMRENQPEMLQLEAAWALTNIASGTSAQTKVVVDADAVPLFIQLLYTGSVEVKEQAIWALGNVAGDSTDYRDYVLQCNAMEPILGLFNSNKPSLIRTATWTLSNLCRGKKPQPDWSVVSQALPTLAKLIYSMDTETLVDACWAISYLSDGPQEAIQAVIDVRIPKRLVELLSHESTLVQTPALRAVGNIVTGND-LQTQVVINAGVLPALRLLLSSPKENIKKEACWTISNITAGNTEQIQAVIDANLIPPLVK 390          

HSP 2 Score: 56.6102 bits (135), Expect = 5.763e-9
Identity = 66/292 (22.60%), Postives = 119/292 (40.75%), Query Frame = 2
Query:   95 QYQKSRTQFVQTIAELANRPQNIETLQCAGVMNLLRPLLLDVVPS-IQQTAALALGRLANHSDDLALAVVKGDILPQLVYSLAEQDRFYKKAASFVLRAVAKHSPELAQSVVDCGALDALVICLEEFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPDTKLKRQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIREIAKHTPELSQLIVNAGGVAAIVDFI 967
            Q Q S T   + I    +RP  I+ +  AGV+  L   + +  P  +Q  AA AL  +A+ +      VV  D +P  +  L       K+ A + L  VA  S +    V+ C A++ ++       P++   + WTL  + R         V + A+P L   +   D      A  A+S +     +  Q V+D      L +++ +  T ++     A+  I   +    ++V+ A + PA+   L    + +KK     I  I     E  Q +++A  +  +V  +
Sbjct:  102 QEQLSATVKFRQILSREHRPP-IDVVIQAGVVPRLVEFMRENQPEMLQLEAAWALTNIASGTSAQTKVVVDADAVPLFIQLLYTGSVEVKEQAIWALGNVAGDSTDYRDYVLQCNAMEPILGLFNSNKPSLIRTATWTLSNLCRGKKPQPDWSVVSQALPTLAKLIYSMDTETLVDACWAISYLSDGPQEAIQAVIDVRIPKRLVELLSHESTLVQTPALRAVGNIVTGNDLQTQVVINAGVLPALRLLLSSPKENIKKEACWTISNITAGNTEQIQAVIDANLIPPLVKLL 392          

HSP 3 Score: 50.447 bits (119), Expect = 4.850e-7
Identity = 52/255 (20.39%), Postives = 108/255 (42.35%), Query Frame = 2
Query:  296 VVKGDILPQLVYSLAE-QDRFYKKAASFVLRAVAKHSPELAQSVVDCGALDALVICLEEFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPDTKLKRQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIREIAKHTPELSQLIVNAGGVAAIVDFIGETKGNISLPGIMMLGYVAAHSETLSMSVI 1057
            V++  ++P+LV  + E Q    +  A++ L  +A  +    + VVD  A+   +  L      VKE + W LG +A  +      V+   A+  ++         L R A   LS++C+         V + A+  LA+++ + DT+       A++ ++    +  + V++  I   ++  L  +  +V+      +  I       +Q+++NAG + A+   +   K NI       +  + A +     +VI
Sbjct:  126 VIQAGVVPRLVEFMRENQPEMLQLEAAWALTNIASGTSAQTKVVVDADAVPLFIQLLYTGSVEVKEQAIWALGNVAGDSTDYRDYVLQCNAMEPILGLFNSNKPSLIRTATWTLSNLCRGKKPQPDWSVVSQALPTLAKLIYSMDTETLVDACWAISYLSDGPQEAIQAVIDVRIPKRLVELLSHESTLVQTPALRAVGNIVTGNDLQTQVVINAGVLPALRLLLSSPKENIKKEACWTISNITAGNTEQIQAVI 380          

HSP 4 Score: 50.447 bits (119), Expect = 5.619e-7
Identity = 50/229 (21.83%), Postives = 97/229 (42.36%), Query Frame = 2
Query:  242 AALALGRLANHSDDLALAVVKGDILPQLVYSLAEQDRFYKKAASFVLRAVAKHSPELAQSVVDCGALDALVICLEEFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDICK---HSPDLAQTVVDAGAIAHLAQMVLNPDTKLKRQIFSALAQIAKHSV-----------DLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLI 886
            A  A+  L++   +   AV+   I  +LV  L+ +    +  A   +  +   +    Q V++ G L AL + L      +K+ + WT+  I   N +  Q+V+DA  +P LV  ++  +   K+ A  A+S+        PD+ + +V  G I  L  ++   D ++      AL  I K              + A+ + +A     I  C ++++D + +    +I
Sbjct:  277 ACWAISYLSDGPQEAIQAVIDVRIPKRLVELLSHESTLVQTPALRAVGNIVTGNDLQTQVVINAGVLPALRLLLSSPKENIKKEACWTISNITAGNTEQIQAVIDANLIPPLVKLLEVAEYKTKKEACWAISNASSGGLQRPDIIRYLVSQGCIKPLCDLLEIADNRIIEVTLDALENILKMGEADKEARGLNINENADFIEKAGGMEKIFNCQQNENDKIYEKAYKII 505          
BLAST of Sperm associated antigen 6 vs. Ensembl Nematostella
Match: EDO42228 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S260])

HSP 1 Score: 858.596 bits (2217), Expect = 0.000e+0
Identity = 413/506 (81.62%), Postives = 461/506 (91.11%), Query Frame = 2
Query:   62 MSQRQVLQVFEQYQKSRTQFVQTIAELANRPQNIETLQCAGVMNLLRPLLLDVVPSIQQTAALALGRLANHSDDLALAVVKGDILPQLVYSLAEQDRFYKKAASFVLRAVAKHSPELAQSVVDCGALDALVICLEEFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPDTKLKRQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIREIAKHTPELSQLIVNAGGVAAIVDFIGETKGNISLPGIMMLGYVAAHSETLSMSVIVSRGVLQLSSIFNNDCEDHILAATAWALGQIGRHTPEHSKAVAKQNVLPKLLRCYLRPDVSEDLQNKSKKALKHILQKCVYLEALEPLLQDAPPNILKHVVAQFSKVLPNNPQARRLFVTSGGLKKVQDMKVEPGSALSEYINIINNCYPEEIVKYYSPGYSEALLERVESYQP 1579
            MS RQVLQVFEQYQKSRT FVQT+AELA+RPQNIETLQ AGVM+LLRPLLLD+VP+IQQTAALALGRLAN++DDLA AVVK DILPQLVYSLAEQ+RFYKKAA+FVLRAVAKHS + AQ VVDCGALDALVICLEEFDP VKE +AW LGYIARHNA+L+Q+VVDAGAVPLLVLC+QEP+L LKRIA+SALSDICKHSP+LAQTVVDAGAIAHLAQM+LN D KLKRQ+FSAL+QIAKHSVDLAE+VVEAEIFPA+L CLKD D+ V KN ATLIREIAKHTPEL+QLIVNAGGVAA+VD++G+  GN+ LPG+MMLGYVAAHSE L+MSVIVS+GV+QLS     + EDHI AA AWALGQIGRHTPEH+KAVA  NVLPKLL+CYLRPD SEDLQ K+KKALK+ILQKC +L ALEPLL DAPPNILKHVV QF+KVLP++ +ARRLFVTSGGLKKVQ++K EPGSAL EYIN INNCYPEEIV+YYSPGYS+ LLERVE YQP
Sbjct:    1 MSTRQVLQVFEQYQKSRTSFVQTVAELASRPQNIETLQNAGVMSLLRPLLLDIVPTIQQTAALALGRLANYNDDLAEAVVKADILPQLVYSLAEQNRFYKKAAAFVLRAVAKHSAQHAQCVVDCGALDALVICLEEFDPGVKEAAAWALGYIARHNAELSQAVVDAGAVPLLVLCIQEPELALKRIASSALSDICKHSPELAQTVVDAGAIAHLAQMILNTDAKLKRQVFSALSQIAKHSVDLAEMVVEAEIFPAVLNCLKDPDEYVCKNVATLIREIAKHTPELAQLIVNAGGVAAVVDYVGDKSGNVRLPGVMMLGYVAAHSENLAMSVIVSKGVVQLSISIAEESEDHIQAAAAWALGQIGRHTPEHAKAVAVANVLPKLLQCYLRPDSSEDLQTKAKKALKNILQKCTHLPALEPLLHDAPPNILKHVVGQFAKVLPHDAKARRLFVTSGGLKKVQEIKAEPGSALHEYINTINNCYPEEIVRYYSPGYSDRLLERVEQYQP 506          
BLAST of Sperm associated antigen 6 vs. Ensembl Nematostella
Match: EDO30648 (Importin subunit alpha [Source:UniProtKB/TrEMBL;Acc:A7T055])

HSP 1 Score: 83.1889 bits (204), Expect = 6.679e-17
Identity = 67/311 (21.54%), Postives = 141/311 (45.34%), Query Frame = 2
Query:  314 LPQLVYSL-AEQDRFYKKAASFVLRAVAKHSPELAQSVVDCGALDALVICLEEFD-PAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPDTKLK--RQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIREIAKHTPELSQLIVNAGGVAAIVDFIGETKGNISLPGIMMLGYVAAHSETLSMSVIVSRGVLQLSSIFNNDCEDHILAATAWALGQIGRHTPEHSKAVAKQNVLPKLLRCYLRPD 1234
            LP +V +L +  D     +   V + ++K        V++ G +  LV  L+ FD P ++  +AW L  IA   ++  ++V + GAVP+ V  +      +   A  AL +I    P +  TV+  GA+  L  ++  P T ++  R +   L+ + ++     ++    ++ PAI   +   D  V  +    +  +     E  QL++++G V  +V+ +G  + N+  P +  +G +    +  + +VI +  +    ++  +  + +I+   AWA+  +   T +  +AV    ++P ++    R D
Sbjct:   72 LPVVVGNLQSGDDNLMFTSVQSVRKMLSKEKSPPIDDVINAGLIPMLVKLLDRFDLPLLQFEAAWALTNIASGTSEQTKAVQEGGAVPMFVKLLSSVHDNVAEQAVWALGNIAGDGPLMRNTVIACGALGPLLALI-KPSTSIQFLRNVTWTLSNLCRNKNPPPDVTAVQQVLPAIARLILSDDKEVLADTCWALSYLTDGVNERIQLVLDSGVVPKLVELLGYPEVNVLTPALRAIGNIVTGRDDQTQAVIDTGALFYFRALLTHK-KSNIIKEAAWAISNVTAGTAQQIQAVMDSGLVPLIVDILRRGD 380          

HSP 2 Score: 62.003 bits (149), Expect = 3.567e-10
Identity = 66/302 (21.85%), Postives = 132/302 (43.71%), Query Frame = 2
Query:  122 VQTIAELANRPQN--IETLQCAGVMNLLRPLL--LDVVPSIQQTAALALGRLANHSDDLALAVVKGDILPQLVYSLAEQDRFYKKAASFVLRAVAKHSPELAQSVVDCGALDAL--------------------------------VICLEEFDPAV--------KE---GSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPDTKLKRQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLI 886
            VQ++ ++ ++ ++  I+ +  AG++ +L  LL   D+ P +Q  AA AL  +A+ + +   AV +G  +P  V  L+       + A + L  +A   P +  +V+ CGAL  L                                V  +++  PA+        KE    + W L Y+     +  Q V+D+G VP LV  +  P++ +   A  A+ +I     D  Q V+D GA+ +   ++ +  + + ++   A++ +   +    + V+++ + P I+  L+  D   +K    +I
Sbjct:   91 VQSVRKMLSKEKSPPIDDVINAGLIPMLVKLLDRFDL-PLLQFEAAWALTNIASGTSEQTKAVQEGGAVPMFVKLLSSVHDNVAEQAVWALGNIAGDGPLMRNTVIACGALGPLLALIKPSTSIQFLRNVTWTLSNLCRNKNPPPDVTAVQQVLPAIARLILSDDKEVLADTCWALSYLTDGVNERIQLVLDSGVVPKLVELLGYPEVNVLTPALRAIGNIVTGRDDQTQAVIDTGALFYFRALLTHKKSNIIKEAAWAISNVTAGTAQQIQAVMDSGLVPLIVDILRRGDFKARKEAIWVI 391          
BLAST of Sperm associated antigen 6 vs. Ensembl Nematostella
Match: EDO29161 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T4F4])

HSP 1 Score: 55.8398 bits (133), Expect = 2.048e-8
Identity = 42/173 (24.28%), Postives = 82/173 (47.40%), Query Frame = 2
Query:  296 VVKGDILPQLVYSLAEQDRFYKKAASFVLRAVAKHSPELAQSVVDCGALDALVICLEEFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDIC-KHSPDLAQTVVDAGAIAHLAQMVLNPDTKLKRQIFSALAQIAKHSVDLAEIVVEA 811
            V++  ++  LV  L+ Q+   + AA   +  +   + E  Q V++ GAL      L      +K+ + W L  I   N    Q V+DAG +PL++  ++  +   ++ AA A+S++      +    +V   A+ HL +++   DT++ + +   L  I K + D A ++  A
Sbjct:  169 VIESGVVQYLVPLLSHQEIKLQTAALRAVGNIVTGTDEQTQVVLNHGALSHFTGLLTHHKEKIKKEAVWFLSNITAGNQSQVQEVIDAGLIPLIIQTLETGEFQTQKEAAWAISNMTVSGRREQVAVLVHCNAVEHLCKLLDVRDTQVVQIVLDGLNNILKMAGDKATVIATA 341          

HSP 2 Score: 53.5286 bits (127), Expect = 1.022e-7
Identity = 34/153 (22.22%), Postives = 72/153 (47.06%), Query Frame = 2
Query:  440 LDALVICLEEFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPDTKLKRQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIREIA 898
            L AL + +   D  +   + W L Y+    +   Q V+++G V  LV  +   ++ L+  A  A+ +I   + +  Q V++ GA++H   ++ +   K+K++    L+ I   +    + V++A + P I+  L+  +   +K  A  I  + 
Sbjct:  133 LPALALLIHHQDLDILVDTVWALSYLTDGGSHQIQLVIESGVVQYLVPLLSHQEIKLQTAALRAVGNIVTGTDEQTQVVLNHGALSHFTGLLTHHKEKIKKEAVWFLSNITAGNQSQVQEVIDAGLIPLIIQTLETGEFQTQKEAAWAISNMT 285          

HSP 3 Score: 50.0618 bits (118), Expect = 1.624e-6
Identity = 56/266 (21.05%), Postives = 112/266 (42.11%), Query Frame = 2
Query:  434 GALDALVICLEEFDP-AVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPDTKLKRQIFSALAQIAKHSVDLAE---IVVEAEIFPAILTCLKDKDDMVKKNCATLIREIAKHTPELSQLIVNAGGVAAIVDFIGETKGNISLPGIMMLGYVAAHSETLSMSVIVSRGVLQLSSIFNNDCEDHILAATAWALGQIGRHTPEHSKAVAKQNVLPKLLRC 1219
            G L  LV CL+  D  +++  +AW L  IA   ++  Q+VV+AGAVP  +  +  P   +   A  AL +I    P L   V+  G +  L + V NP    + Q  +A A I+  +V       +++  ++ PA+   +  +D  +  +    +  +        QL++ +G V  +V  +   +  +    +  +G +   ++     V+++ G L   +      ++ I     W L  I        + V    ++P +++ 
Sbjct:    3 GILPILVQCLQREDNHSLQFEAAWALTNIASGTSEQTQAVVNAGAVPFFLKLLNSPRQHVCEQAVWALGNIVGDGPVLRDFVIGYGVVKPLLKFV-NPGVPFQTQKEAAWA-ISNMTVSGRREQPLLLLFQVLPALALLIHHQDLDILVDTVWALSYLTDGGSHQIQLVIESGVVQYLVPLLSHQEIKLQTAALRAVGNIVTGTDE-QTQVVLNHGALSHFTGLLTHHKEKIKKEAVWFLSNITAGNQSQVQEVIDAGLIPLIIQT 265          
BLAST of Sperm associated antigen 6 vs. Ensembl Nematostella
Match: EDO31940 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWI7])

HSP 1 Score: 54.6842 bits (130), Expect = 5.687e-8
Identity = 55/269 (20.45%), Postives = 110/269 (40.89%), Query Frame = 2
Query:  422 VVDCGALDALVICLEEFDP-AVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPDTKLK--RQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIREIAKHTPELSQLIVNAGGVAAIVDFIGETKGNISLPGIMMLGYVAAHSETLSMSVIVSRGVLQLSSIFNNDCEDHILAATAWALGQIGRHTPEHSKAVAKQNVLPKLLRC 1219
            ++  G L  LV CL+  D  +++  +AW L  IA   ++  Q+VV+AGAVP  +  +  P   +   A  AL +I    P L   V+  G +  L + V NP   +   R +   L  + ++      I    E+ PA+   +  +D  +  +    +  +        QL++ +G V  +V  +   +  +    +  +G +   ++     V+++ G L   +      ++ I     W L  I        + V    ++P +++ 
Sbjct:  103 LIKSGILPILVQCLQREDNHSLQFEAAWALTNIASGTSEQTQAVVNAGAVPFFLKLLNSPRQHVCEQAVWALGNIVGDGPVLRDFVIGYGVVKPLLKFV-NPGVPITFLRNVTWVLVNLCRNKEPPPPIDTIREVLPALALLIHHQDLDILVDTVWALSYLTDGGSHQIQLVIESGVVQYLVPLLSHQEIKLQTAALRAVGNIVTGTDE-QTQVVLNHGALSHFTGLLTHHKEKIKKEAVWFLSNITAGNQSQVQEVIDAGLIPLIIQT 369          

HSP 2 Score: 51.2174 bits (121), Expect = 7.362e-7
Identity = 31/135 (22.96%), Postives = 66/135 (48.89%), Query Frame = 2
Query:  440 LDALVICLEEFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPDTKLKRQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLK 844
            L AL + +   D  +   + W L Y+    +   Q V+++G V  LV  +   ++ L+  A  A+ +I   + +  Q V++ GA++H   ++ +   K+K++    L+ I   +    + V++A + P I+  L+
Sbjct:  237 LPALALLIHHQDLDILVDTVWALSYLTDGGSHQIQLVIESGVVQYLVPLLSHQEIKLQTAALRAVGNIVTGTDEQTQVVLNHGALSHFTGLLTHHKEKIKKEAVWFLSNITAGNQSQVQEVIDAGLIPLIIQTLE 371          
BLAST of Sperm associated antigen 6 vs. Ensembl Nematostella
Match: EDO38337 (Importin subunit alpha [Source:UniProtKB/TrEMBL;Acc:A7SD78])

HSP 1 Score: 53.1434 bits (126), Expect = 2.124e-7
Identity = 58/310 (18.71%), Postives = 126/310 (40.65%), Query Frame = 2
Query:  296 VVKGDILPQLVYSLAEQDRFYKKAASFVLRAVAKHSPELA-QSVVDCGALDALVICLE-EFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPDTKLK--RQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIREIAKHTPELSQLIVNAGGVAAIVDFIGETKGNISLPGIMMLGYVAAHSETLSMSVIVSRGVLQLSSIFNNDCEDHILAATAWALGQIGRHTPEHSKAVAKQNVLPKLL 1213
            + +G +   +V ++   D   + AA+   R +    P      V+ CG +   V  L+ E + A++  +AW L  IA   +   +  V+AGAVP  +  ++ P   ++  A  AL +I   S D    V++ G +     + L   T+L   R +  AL+ + +      +    +   P +   L   D  V  +    +  +     E  Q ++++G    +V+ +   + ++    +  +G +    +  +  ++    +  L  + ++  ++ I     W +  I        +AV   N++P L+
Sbjct:   69 MAEGPLFQDMVQAIISDDVEMQLAATQRFRKILSKEPNPPIDDVIKCGVIPKFVEFLQREDNSALQFEAAWALTNIASGTSMQTRETVNAGAVPCFIKLLESPKEEVQEQAVWALGNIAGDSADCRDYVLNCGVLTPFLNL-LTKSTRLSMTRNLVWALSNLCRGRHPPPDFAKVSPCLPLLSRLLFSTDAEVLADTCWALSYLLDGPNEKIQAVIDSGVCRRLVELLDHNQNSVVSAALRAVGNIVTGDDIQTQVILNCHALPNLLHLLSS-TKESIRKEACWTISNITAGNRLQIQAVIDANIIPMLI 376          
BLAST of Sperm associated antigen 6 vs. Ensembl Medaka
Match: spag6 (sperm associated antigen 6 [Source:NCBI gene;Acc:101168253])

HSP 1 Score: 729.169 bits (1881), Expect = 0.000e+0
Identity = 346/506 (68.38%), Postives = 427/506 (84.39%), Query Frame = 2
Query:   62 MSQRQVLQVFEQYQKSRTQFVQTIAELANRPQNIETLQCAGVMNLLRPLLLDVVPSIQQTAALALGRLANHSDDLALAVVKGDILPQLVYSLAEQDRFYKKAASFVLRAVAKHSPELAQSVVDCGALDALVICLEEFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPDTKLKRQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIREIAKHTPELSQLIVNAGGVAAIVDFIGETKGNISLPGIMMLGYVAAHSETLSMSVIVSRGVLQLSSIFNNDCEDHILAATAWALGQIGRHTPEHSKAVAKQNVLPKLLRCYLRPDVSEDLQNKSKKALKHILQKCVYLEALEPLLQDAPPNILKHVVAQFSKVLPNNPQARRLFVTSGGLKKVQDMKVEPGSALSEYINIINNCYPEEIVKYYSPGYSEALLERVESYQP 1579
            MSQRQ++QVFEQYQKSR QFVQTI++LA RPQNIE L  AGVM+LLRPLLLDVVP +Q TAALALGRLA+ S+ LA AVVK +ILP +V S+   +RF KKAA+FVLRAV+KHSPEL+Q+VVDCG +DALV CL EFDP VKE +AW+LG  ARHNA L+Q+VV+AGAVPLLVLC+ EP++ LKRIAAS LSDICKH+P+LA  VVDAGAI HLAQ++L+ DTKLKRQ+FSAL+QIAKHS DL+E+V E  +FPA +TCLKD D+ V+KN  TL+RE+AK T ELSQL+VN GG+ A++D++ +  G++ LPGIMMLGYVA+HSE+L+M+VI+S+GV QL+   + + EDHI AAT W++GQIG+HTP+H+KAVA  N+LPK+L+ Y     SEDLQ KSKKALK ILQKC +L ALEPLL DAP  ILKHV+ QFSKVLP++ +ARRLFVTSGGLKKVQ+++ EPGS L E+IN IN+C+PEEIV+Y+SPGYSE LLER+E+YQP
Sbjct:    1 MSQRQIIQVFEQYQKSRMQFVQTISDLAARPQNIEILHNAGVMSLLRPLLLDVVPGVQHTAALALGRLADSSNSLAEAVVKENILPDVVQSVTSHNRFQKKAAAFVLRAVSKHSPELSQAVVDCGGVDALVQCLMEFDPGVKEAAAWSLGCTARHNATLSQTVVNAGAVPLLVLCLLEPEMALKRIAASTLSDICKHTPELAHAVVDAGAIPHLAQLILSRDTKLKRQVFSALSQIAKHSADLSEMVAEVGVFPAAMTCLKDPDEYVRKNVTTLMREMAKQTAELSQLVVNCGGLGAVIDYLNDCSGSLRLPGIMMLGYVASHSESLAMAVILSKGVSQLAVCLSEEPEDHIKAATVWSIGQIGQHTPDHAKAVATANLLPKILKLYTDASSSEDLQAKSKKALKSILQKCTHLPALEPLLYDAPSKILKHVMCQFSKVLPHDSKARRLFVTSGGLKKVQEIQAEPGSVLQEHINAINSCFPEEIVRYHSPGYSEVLLERLENYQP 506          
BLAST of Sperm associated antigen 6 vs. Ensembl Medaka
Match: kpna2 (importin subunit alpha-1 [Source:NCBI gene;Acc:101160561])

HSP 1 Score: 65.0846 bits (157), Expect = 9.096e-11
Identity = 67/324 (20.68%), Postives = 132/324 (40.74%), Query Frame = 2
Query:  395 KHSPELAQSVVDCGALDALVICLEEFD-PAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPDTK-----LKRQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIREIAKHTPELSQLIVNAGGVAAIVDFIGETKGNISLPGIMMLGYVAAHSETLSMSVIVSRGVLQLSSIFNNDCEDHILAATAWALGQIGRHTPEHSKAVAKQNVLPKLLRCYLRPDVSEDLQNKSKKALKHI-----LQKCVYL---EALEPLL 1324
            KH P     ++  G +   V  L   D P ++  ++W L  IA   +    +VV+ GA+P  +  V  P L +   A  AL +I      L   V+  GA+A L  ++  PD         R +   L+ + ++      I    ++ PA++  L   D  V  +    +  +   + +  +++   G +  +V  +G  +  +  P +  +G +   ++  + +V+ +  +     +  +  + +I    AW L  I        + V    ++P L+   +R D     Q ++  A+ +      +Q+ VYL     LEPLL
Sbjct:   63 KHPP--IDQMISAGLIPKFVAFLGLMDFPPIQFEASWALTNIASGTSDQTAAVVEGGAIPAFINLVTSPHLHISEQAVWALGNIAGDGSALRDRVIKHGAVAPLLSLLAVPDLNVFTPGFLRNVTWTLSNLCRNKNPSPPISAVQQVMPALIRLLHHDDREVLADACWAVSYLTDGSNDRIEIVAGTGLIPRLVKLLGFEELPVITPALRAIGNIVTGTDEQTQAVLDAGALFMFPKLLRHK-KPNIQKEAAWTLSNITAGKDSQIQEVIDAGLVPYLVDLLVRADYKT--QKEAVWAVTNFTSGGTVQQVVYLVQANVLEPLL 381          

HSP 2 Score: 53.5286 bits (127), Expect = 3.355e-7
Identity = 64/266 (24.06%), Postives = 115/266 (43.23%), Query Frame = 2
Query:  296 VVKGDILPQLVYSLAEQDRF--YKKAASFVLRAVAKHSPELAQSVVDCGALDALVICLEEFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDL-----GLKRIAASALSDICKH---SPDLA--QTVVDAGAIAHLAQMVLNPDTKLKRQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIREIAKHTPELSQLIVNAGGVAAIVDFIGETKGNISLPGIMMLGYVAAHSETLSMSVI 1057
            ++   ++P+ V  L   D F   +  AS+ L  +A  + +   +VV+ GA+ A +  +      + E + W LG IA   + L   V+  GAV  L+  +  PDL     G  R     LS++C++   SP ++  Q V+ A     L +++ + D ++      A++ +   S D  EIV    + P ++  L  ++  V       I  I   T E +Q +++AG +      +   K NI       L  + A  ++    VI
Sbjct:   70 MISAGLIPKFVAFLGLMD-FPPIQFEASWALTNIASGTSDQTAAVVEGGAIPAFINLVTSPHLHISEQAVWALGNIAGDGSALRDRVIKHGAVAPLLSLLAVPDLNVFTPGFLRNVTWTLSNLCRNKNPSPPISAVQQVMPA-----LIRLLHHDDREVLADACWAVSYLTDGSNDRIEIVAGTGLIPRLVKLLGFEELPVITPALRAIGNIVTGTDEQTQAVLDAGALFMFPKLLRHKKPNIQKEAAWTLSNITAGKDSQIQEVI 329          
BLAST of Sperm associated antigen 6 vs. Ensembl Medaka
Match: kpna2 (importin subunit alpha-1 [Source:NCBI gene;Acc:101160561])

HSP 1 Score: 65.0846 bits (157), Expect = 1.045e-10
Identity = 67/324 (20.68%), Postives = 132/324 (40.74%), Query Frame = 2
Query:  395 KHSPELAQSVVDCGALDALVICLEEFD-PAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPDTK-----LKRQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIREIAKHTPELSQLIVNAGGVAAIVDFIGETKGNISLPGIMMLGYVAAHSETLSMSVIVSRGVLQLSSIFNNDCEDHILAATAWALGQIGRHTPEHSKAVAKQNVLPKLLRCYLRPDVSEDLQNKSKKALKHI-----LQKCVYL---EALEPLL 1324
            KH P     ++  G +   V  L   D P ++  ++W L  IA   +    +VV+ GA+P  +  V  P L +   A  AL +I      L   V+  GA+A L  ++  PD         R +   L+ + ++      I    ++ PA++  L   D  V  +    +  +   + +  +++   G +  +V  +G  +  +  P +  +G +   ++  + +V+ +  +     +  +  + +I    AW L  I        + V    ++P L+   +R D     Q ++  A+ +      +Q+ VYL     LEPLL
Sbjct:  102 KHPP--IDQMISAGLIPKFVAFLGLMDFPPIQFEASWALTNIASGTSDQTAAVVEGGAIPAFINLVTSPHLHISEQAVWALGNIAGDGSALRDRVIKHGAVAPLLSLLAVPDLNVFTPGFLRNVTWTLSNLCRNKNPSPPISAVQQVMPALIRLLHHDDREVLADACWAVSYLTDGSNDRIEIVAGTGLIPRLVKLLGFEELPVITPALRAIGNIVTGTDEQTQAVLDAGALFMFPKLLRHK-KPNIQKEAAWTLSNITAGKDSQIQEVIDAGLVPYLVDLLVRADYKT--QKEAVWAVTNFTSGGTVQQVVYLVQANVLEPLL 420          

HSP 2 Score: 53.9138 bits (128), Expect = 3.024e-7
Identity = 59/240 (24.58%), Postives = 104/240 (43.33%), Query Frame = 2
Query:  368 ASFVLRAVAKHSPELAQSVVDCGALDALVICLEEFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDL-----GLKRIAASALSDICKH---SPDLA--QTVVDAGAIAHLAQMVLNPDTKLKRQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIREIAKHTPELSQLIVNAGGVAAIVDFIGETKGNISLPGIMMLGYVAAHSETLSMSVI 1057
            AS+ L  +A  + +   +VV+ GA+ A +  +      + E + W LG IA   + L   V+  GAV  L+  +  PDL     G  R     LS++C++   SP ++  Q V+ A     L +++ + D ++      A++ +   S D  EIV    + P ++  L  ++  V       I  I   T E +Q +++AG +      +   K NI       L  + A  ++    VI
Sbjct:  134 ASWALTNIASGTSDQTAAVVEGGAIPAFINLVTSPHLHISEQAVWALGNIAGDGSALRDRVIKHGAVAPLLSLLAVPDLNVFTPGFLRNVTWTLSNLCRNKNPSPPISAVQQVMPA-----LIRLLHHDDREVLADACWAVSYLTDGSNDRIEIVAGTGLIPRLVKLLGFEELPVITPALRAIGNIVTGTDEQTQAVLDAGALFMFPKLLRHKKPNIQKEAAWTLSNITAGKDSQIQEVI 368          
BLAST of Sperm associated antigen 6 vs. Ensembl Medaka
Match: kpna4 (karyopherin subunit alpha 4 [Source:NCBI gene;Acc:101173644])

HSP 1 Score: 60.077 bits (144), Expect = 3.386e-9
Identity = 70/329 (21.28%), Postives = 130/329 (39.51%), Query Frame = 2
Query:   65 SQRQVLQVFEQYQKSRTQFVQTIAELA-------NRPQNIETLQCAGVMNLLRPLL-LDVVPSIQQTAALALGRLANHSDDLALAVVKGDILPQLVYSLAEQDRFYKKAASFVLRAVAKHSPELAQSVVDCGA-------------------------------------------LDALVICLEEFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPDTKLKRQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIREIA 898
            SQ   L+   Q   S  Q VQ  A  A       +R   I+ L  +G++ +L   L  D  PS+Q  AA AL  +A+ + +   AVV+ + +P  +  L    +   + A + L  +    P+    V+  G                                            L AL + +   D ++   + W L Y+     +  Q V+D+G VP LV  +   ++ ++  A  A+ +I   + +  Q V++  A++H   ++ +P  K+ ++    L+ I   +    + V++A++ P I+  L   D   +K  A  I  + 
Sbjct:   68 SQNTSLEAIVQNATSDNQGVQLSAVQAARKLLSSDRNPPIDDLIKSGILPILVHCLDRDDNPSLQFEAAWALTNIASGTSEQTQAVVQSNAVPLFLRLLHSPHQNVCEQAVWALGNIIGDGPQCRDYVISLGVVKPLLSFISPSIPITFLRNVTWVMVNLCRHKDPPPPMETIQEILPALCVLIHHTDVSILVDTVWALSYLTDAGNEQIQMVIDSGIVPHLVPLLSHQEVKVQTAALRAVGNIVTGTDEQTQVVLNCDALSHFPALLTHPKEKINKEAVWFLSNITAGNQQQVQAVIDAKLVPMIIHLLDKGDFGTQKEAAWAISNLT 396          

HSP 2 Score: 55.0694 bits (131), Expect = 1.356e-7
Identity = 53/274 (19.34%), Postives = 111/274 (40.51%), Query Frame = 2
Query:  422 VVDCGALDALVICLEEFD-PAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPDTKLK--RQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIREIAKHTPELSQLIVNAGGVAAIVDFIGETKGNISLPGIMMLGYVAAHSETLSMSVIVSRGVLQLSSIFNNDCEDHILAATAWALGQIGRHTPEHSKAVAKQNVLPKLLRCYLRPD 1234
            ++  G L  LV CL+  D P+++  +AW L  IA   ++  Q+VV + AVPL +  +  P   +   A  AL +I    P     V+  G +  L   + +P   +   R +   +  + +H      +    EI PA+   +   D  +  +    +  +     E  Q+++++G V  +V  +   +  +    +  +G +   ++  +  V+    +    ++  +  E  I     W L  I     +  +AV    ++P ++    + D
Sbjct:  110 LIKSGILPILVHCLDRDDNPSLQFEAAWALTNIASGTSEQTQAVVQSNAVPLFLRLLHSPHQNVCEQAVWALGNIIGDGPQCRDYVISLGVVKPLLSFI-SPSIPITFLRNVTWVMVNLCRHKDPPPPMETIQEILPALCVLIHHTDVSILVDTVWALSYLTDAGNEQIQMVIDSGIVPHLVPLLSHQEVKVQTAALRAVGNIVTGTDEQTQVVLNCDALSHFPALLTHPKE-KINKEAVWFLSNITAGNQQQVQAVIDAKLVPMIIHLLDKGD 381          
BLAST of Sperm associated antigen 6 vs. Ensembl Medaka
Match: KPNA2 (karyopherin subunit alpha 2 [Source:NCBI gene;Acc:101159727])

HSP 1 Score: 60.077 bits (144), Expect = 3.563e-9
Identity = 88/422 (20.85%), Postives = 165/422 (39.10%), Query Frame = 2
Query:  332 SLAEQDRFYKKAASFVLRAVAKHSPELAQSVVDCGALDALV--ICLEEFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPD-----TKLKRQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIREIAKHTPELSQLIVNAGGVAAIVDFIGETKGNISLPGIMMLGYVAAHSETLSMSVIVSRGVLQLSSIFNNDCEDHILAATAWALGQIGRHTPEHSKAVAKQNVLPKLLRCYLRPDVSEDLQ------NKSKKALKHILQKCVYLEALEPLLQ--------------DAPPNILKHVVAQFSKVLPNNPQARRLFVTSGGLKKVQDMKVEPGSAL-SEYINIINNCYPEE 1513
            +L  Q +  + A +F+ R   + SP +   ++  G +  LV  + L E +P ++  +AW L  IA   +   +SV+  GAVP  V  +  P   + + A  AL +I     D    V+  G +  L  ++   D     +   R +  AL+ + +H      +    ++ P +   L   D  V  +    +  +     E  +++V+   V  +V  +     +I  P +  +G +   ++  +  V+ + G L +  +       +I    AWA+  I        + V    ++P L+    + D     +      N +       +   V+  ALEPL+Q              DA  NIL     Q SK      + R L    GGL  ++ ++     A+    +NII+  + +E
Sbjct:   83 NLEHQVQAVQAARAFLSR---EKSPPV-DGIIAAGLIPTLVGFLALSE-NPPIQFEAAWALTNIASGTSHQTKSVIAGGAVPAFVSLISSPHQHISQQAIWALGNIAGDGADSRDLVIHHGGLQPLLALLETSDLSVFGSSYLRNVTWALSNLCRHKNPAPPLASVRQMLPVLAHLLHHDDREVLADTCRALSHLTDGANERIEMVVDTDCVPRLVQLLSCEDVSIVTPALRTIGNIVTGTDEQTQCVL-NAGALAVFPVLLGYPNPNIQKEAAWAVSNITAGKSSQIQEVINAGLVPMLVDILQQGDYKTQREAVWAVTNYTSGGTVDQVAYLVHCNALEPLIQLLHIKDSRVILVILDAIDNIL-----QMSKDTGEVEKVRLLIEGLGGLDTLEALQSHDNEAVYKSSLNIIDKYFSQE 493          

HSP 2 Score: 58.5362 bits (140), Expect = 1.068e-8
Identity = 48/184 (26.09%), Postives = 88/184 (47.83%), Query Frame = 2
Query:  251 ALGRLANHSDDLALAVVKGDILPQLVYSLAEQDRFYKKAASFVLRAVAKHSPELAQSVVDCGALDALVICLEEFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDICKHSP-DLAQTVVDAGAIAHLAQMVLNPDTKLKRQIFSALAQIAKHSVDLAEI 799
            AL  L + +++    VV  D +P+LV  L+ +D      A   +  +   + E  Q V++ GAL    + L   +P +++ +AW +  I    +   Q V++AG VP+LV  +Q+ D   +R A  A+++       D    +V   A+  L Q++   D+++   I  A+  I + S D  E+
Sbjct:  268 ALSHLTDGANERIEMVVDTDCVPRLVQLLSCEDVSIVTPALRTIGNIVTGTDEQTQCVLNAGALAVFPVLLGYPNPNIQKEAAWAVSNITAGKSSQIQEVINAGLVPMLVDILQQGDYKTQREAVWAVTNYTSGGTVDQVAYLVHCNALEPLIQLLHIKDSRVILVILDAIDNILQMSKDTGEV 451          
BLAST of Sperm associated antigen 6 vs. Planmine SMEST
Match: SMESG000018022.1 (SMESG000018022.1)

HSP 1 Score: 1035.4 bits (2676), Expect = 0.000e+0
Identity = 508/508 (100.00%), Postives = 508/508 (100.00%), Query Frame = 2
Query:   62 MSQRQVLQVFEQYQKSRTQFVQTIAELANRPQNIETLQCAGVMNLLRPLLLDVVPSIQQTAALALGRLANHSDDLALAVVKGDILPQLVYSLAEQDRFYKKAASFVLRAVAKHSPELAQSVVDCGALDALVICLEEFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPDTKLKRQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIREIAKHTPELSQLIVNAGGVAAIVDFIGETKGNISLPGIMMLGYVAAHSETLSMSVIVSRGVLQLSSIFNNDCEDHILAATAWALGQIGRHTPEHSKAVAKQNVLPKLLRCYLRPDVSEDLQNKSKKALKHILQKCVYLEALEPLLQDAPPNILKHVVAQFSKVLPNNPQARRLFVTSGGLKKVQDMKVEPGSALSEYINIINNCYPEEIVKYYSPGYSEALLERVESYQPAL 1585
            MSQRQVLQVFEQYQKSRTQFVQTIAELANRPQNIETLQCAGVMNLLRPLLLDVVPSIQQTAALALGRLANHSDDLALAVVKGDILPQLVYSLAEQDRFYKKAASFVLRAVAKHSPELAQSVVDCGALDALVICLEEFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPDTKLKRQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIREIAKHTPELSQLIVNAGGVAAIVDFIGETKGNISLPGIMMLGYVAAHSETLSMSVIVSRGVLQLSSIFNNDCEDHILAATAWALGQIGRHTPEHSKAVAKQNVLPKLLRCYLRPDVSEDLQNKSKKALKHILQKCVYLEALEPLLQDAPPNILKHVVAQFSKVLPNNPQARRLFVTSGGLKKVQDMKVEPGSALSEYINIINNCYPEEIVKYYSPGYSEALLERVESYQPAL
Sbjct:    1 MSQRQVLQVFEQYQKSRTQFVQTIAELANRPQNIETLQCAGVMNLLRPLLLDVVPSIQQTAALALGRLANHSDDLALAVVKGDILPQLVYSLAEQDRFYKKAASFVLRAVAKHSPELAQSVVDCGALDALVICLEEFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPDTKLKRQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIREIAKHTPELSQLIVNAGGVAAIVDFIGETKGNISLPGIMMLGYVAAHSETLSMSVIVSRGVLQLSSIFNNDCEDHILAATAWALGQIGRHTPEHSKAVAKQNVLPKLLRCYLRPDVSEDLQNKSKKALKHILQKCVYLEALEPLLQDAPPNILKHVVAQFSKVLPNNPQARRLFVTSGGLKKVQDMKVEPGSALSEYINIINNCYPEEIVKYYSPGYSEALLERVESYQPAL 508          
BLAST of Sperm associated antigen 6 vs. Planmine SMEST
Match: SMESG000055942.1 (SMESG000055942.1)

HSP 1 Score: 56.9954 bits (136), Expect = 2.020e-8
Identity = 78/374 (20.86%), Postives = 151/374 (40.37%), Query Frame = 2
Query:  110 RTQFVQTIAELANRPQN--IETLQCAGVMNLLRPLL-LDVVPSIQQTAALALGRLANHSDDLALAVVKGDILP---------------QLVYSLAE--------QD------------RFYK--------KAASFVLRAVAKHSPELAQSVVDCGALDALVICLEEFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPDTKLKRQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIREIA-KHTPELSQLIVNAGGVAAIVDFIGETKG---NISLPGIMMLGYVAAHSETLSMSVIVSRGVLQL 1081
            R + +Q   +L +  +N  I+ L  +G+M +L   L  D  P+IQ  AA AL  +A+ + +   AVV+   +P               Q V++L          +D            +F+K        +  ++V+  + ++       V     L AL   ++  D  +   + W L Y+        Q V++A  V  LV  +   D+ ++  A  A+ +I   + +  Q V++  A++H  Q++ +   K+ ++    L+ I   + +  + V++  + P I+  L   D   +K  A +I  +    TP+    +V  G +      +         + L GI+ +  VA     L  ++I   G L L
Sbjct:   78 RLEAIQAARKLLSSDKNPPIDNLIQSGIMPILVECLDNDAHPNIQFEAAWALTNIASGTSEQTNAVVQAGAVPLFLKLLGSTHSNVCEQAVWALGNIIGDGPTLRDYAISLGVVAPLLKFFKCRCTNNLLRNVTWVIVNLCRNKDPPPSPVTISELLPALRFLIQNIDTNILVDTVWALSYLTDGGNDQIQMVIEADIVRFLVPLLSHNDVKVQTAALRAVGNIVTGTDEQTQYVLNFDALSHFPQLLQHSKEKINKEAVWFLSNITAGNQEQVQAVIDYSLIPLIIYHLDKGDFQTQKEAAWVISNLTISGTPQQVAFVVQQGVIPPFCKMLSVRDAQVVQVVLDGILNILKVANDQSDLVCTMIEECGGLDL 451          

HSP 2 Score: 50.447 bits (119), Expect = 2.533e-6
Identity = 62/312 (19.87%), Postives = 119/312 (38.14%), Query Frame = 2
Query:  419 SVVDCGALDALVICLE-EFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQ-------------------------------------------MVLNPDTKLKRQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIREIAKHTPELSQLIVNAGGVAAIVDFIGETKGNISLPGIMMLGYVAAHSETLSMSVIVSRGVLQLSSIFNNDCED-HILAATAWALGQIG-RHTPEHSKAVAKQNVLPKLLR 1216
            +++  G +  LV CL+ +  P ++  +AW L  IA   ++   +VV AGAVPL +  +      +   A  AL +I    P L    +  G +A L +                                           ++ N DT +      AL+ +     D  ++V+EA+I   ++  L   D  V+      +  I   T E +Q ++N   ++     +  +K  I+   +  L  + A ++   +  ++   ++ L  I++ D  D       AW +  +    TP+    V +Q V+P   +
Sbjct:   99 NLIQSGIMPILVECLDNDAHPNIQFEAAWALTNIASGTSEQTNAVVQAGAVPLFLKLLGSTHSNVCEQAVWALGNIIGDGPTLRDYAISLGVVAPLLKFFKCRCTNNLLRNVTWVIVNLCRNKDPPPSPVTISELLPALRFLIQNIDTNILVDTVWALSYLTDGGNDQIQMVIEADIVRFLVPLLSHNDVKVQTAALRAVGNIVTGTDEQTQYVLNFDALSHFPQLLQHSKEKINKEAVWFLSNITAGNQE-QVQAVIDYSLIPL-IIYHLDKGDFQTQKEAAWVISNLTISGTPQQVAFVVQQGVIPPFCK 408          
BLAST of Sperm associated antigen 6 vs. Planmine SMEST
Match: SMESG000058125.1 (SMESG000058125.1)

HSP 1 Score: 56.225 bits (134), Expect = 4.013e-8
Identity = 76/374 (20.32%), Postives = 142/374 (37.97%), Query Frame = 2
Query:  110 RTQFVQTIAELANRPQN--IETLQCAGVMNLLRPLL-LDVVPSIQQTAALALGRLANHSDDLALAVVKGDILPQLVYSLAEQDRFYKKAASFVLRAVAKHSPELAQSVVDCGA-------------------------------------------LDALVICLEEFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPDTKLKRQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIREIA-KHTPELSQLIVNAGGVAAIVDFIGETKG---NISLPGIMMLGYVAAHSETLSMSVIVSRGVLQL 1081
            R + +Q   +L +  +N  I+ L  +G+M +L   L  D  P+IQ  AA AL  +A+ + +   AVV+   +P  +  L        + A + L  +    P L    +  G                                            L AL   ++  D  +   + W L Y+        Q V++A  V  LV  +   D+ ++  A  A+ +I   + +  Q V++  A++H  Q++ +   K+ ++    L+ I   + +  + V++  + P I+  L   D   +K  A +I  +    TP+    +V  G +      +         + L GI+ +  VA     L  ++I   G L L
Sbjct:   72 RLEAIQAARKLLSSDKNPPIDNLIQSGIMPILVECLDNDAHPNIQFEAAWALTNIASGTSEQTNAVVQAGAVPLFLKLLGSTHSNVCEQAVWALGNIIGDGPTLRDYAISLGVVAPLLKFLNADVPITFLRNVTWVIVNLCRNKDPPPSPVTISELLPALRFLIQNIDTNILVDTVWALSYLTDGGNDQIQMVIEADIVRFLVPLLSHNDVKVQTAALRAVGNIVTGTDEQTQYVLNFDALSHFPQLLQHSKEKINKEAVWFLSNITAGNQEQVQAVIDYSLIPLIIYHLDKGDFQTQKEAAWVISNLTISGTPQQVAFVVQQGVIPPFCKMLSVRDAQVVQVVLDGILNILKVANDQSDLVCTMIEECGGLDL 445          

HSP 2 Score: 53.5286 bits (127), Expect = 2.866e-7
Identity = 59/286 (20.63%), Postives = 115/286 (40.21%), Query Frame = 2
Query:  368 ASFVLRAVAKHSPELAQSVVDCGALDALVICLEEFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAV-PLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPDTKLKRQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIREIAKHTPELSQLIVNAGGVAAIVDFIGETKGNISLPGIMMLGYVAAHSETLSMSVIVSRGVLQLSSIFNNDCED-HILAATAWALGQIG-RHTPEHSKAVAKQNVLPKLLR 1216
            A++ L  +A  + E   +VV  GA+   +  L      V E + W LG I      L    +  G V PLL     +  +   R     + ++C++       V  +  +  L  ++ N DT +      AL+ +     D  ++V+EA+I   ++  L   D  V+      +  I   T E +Q ++N   ++     +  +K  I+   +  L  + A ++   +  ++   ++ L  I++ D  D       AW +  +    TP+    V +Q V+P   +
Sbjct:  119 AAWALTNIASGTSEQTNAVVQAGAVPLFLKLLGSTHSNVCEQAVWALGNIIGDGPTLRDYAISLGVVAPLLKFLNADVPITFLRNVTWVIVNLCRNKDPPPSPVTISELLPALRFLIQNIDTNILVDTVWALSYLTDGGNDQIQMVIEADIVRFLVPLLSHNDVKVQTAALRAVGNIVTGTDEQTQYVLNFDALSHFPQLLQHSKEKINKEAVWFLSNITAGNQE-QVQAVIDYSLIPL-IIYHLDKGDFQTQKEAAWVISNLTISGTPQQVAFVVQQGVIPPFCK 402          

HSP 3 Score: 50.447 bits (119), Expect = 2.648e-6
Identity = 52/268 (19.40%), Postives = 110/268 (41.04%), Query Frame = 2
Query:  419 SVVDCGALDALVICLE-EFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPDTKLK--RQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIREIAKHTPELSQLIVNAGGVAAIVDFIGETKGNISLPGIMMLGYVAAHSETLSMSVIVSRGVLQLSSIFNNDCEDHILAATAWALGQIGRHTPEHSKAVAKQNVLPKLL 1213
            +++  G +  LV CL+ +  P ++  +AW L  IA   ++   +VV AGAVPL +  +      +   A  AL +I    P L    +  G +A L +  LN D  +   R +   +  + ++       V  +E+ PA+   +++ D  +  +    +  +     +  Q+++ A  V  +V  +      +    +  +G +   ++  +  V+    +     +  +  E  I     W L  I     E  +AV   +++P ++
Sbjct:   93 NLIQSGIMPILVECLDNDAHPNIQFEAAWALTNIASGTSEQTNAVVQAGAVPLFLKLLGSTHSNVCEQAVWALGNIIGDGPTLRDYAISLGVVAPLLKF-LNADVPITFLRNVTWVIVNLCRNKDPPPSPVTISELLPALRFLIQNIDTNILVDTVWALSYLTDGGNDQIQMVIEADIVRFLVPLLSHNDVKVQTAALRAVGNIVTGTDEQTQYVLNFDALSHFPQLLQHSKE-KINKEAVWFLSNITAGNQEQVQAVIDYSLIPLII 358          
BLAST of Sperm associated antigen 6 vs. Planmine SMEST
Match: SMESG000058125.1 (SMESG000058125.1)

HSP 1 Score: 56.225 bits (134), Expect = 4.124e-8
Identity = 76/374 (20.32%), Postives = 142/374 (37.97%), Query Frame = 2
Query:  110 RTQFVQTIAELANRPQN--IETLQCAGVMNLLRPLL-LDVVPSIQQTAALALGRLANHSDDLALAVVKGDILPQLVYSLAEQDRFYKKAASFVLRAVAKHSPELAQSVVDCGA-------------------------------------------LDALVICLEEFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPDTKLKRQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIREIA-KHTPELSQLIVNAGGVAAIVDFIGETKG---NISLPGIMMLGYVAAHSETLSMSVIVSRGVLQL 1081
            R + +Q   +L +  +N  I+ L  +G+M +L   L  D  P+IQ  AA AL  +A+ + +   AVV+   +P  +  L        + A + L  +    P L    +  G                                            L AL   ++  D  +   + W L Y+        Q V++A  V  LV  +   D+ ++  A  A+ +I   + +  Q V++  A++H  Q++ +   K+ ++    L+ I   + +  + V++  + P I+  L   D   +K  A +I  +    TP+    +V  G +      +         + L GI+ +  VA     L  ++I   G L L
Sbjct:   61 RLEAIQAARKLLSSDKNPPIDNLIQSGIMPILVECLDNDAHPNIQFEAAWALTNIASGTSEQTNAVVQAGAVPLFLKLLGSTHSNVCEQAVWALGNIIGDGPTLRDYAISLGVVAPLLKFLNADVPITFLRNVTWVIVNLCRNKDPPPSPVTISELLPALRFLIQNIDTNILVDTVWALSYLTDGGNDQIQMVIEADIVRFLVPLLSHNDVKVQTAALRAVGNIVTGTDEQTQYVLNFDALSHFPQLLQHSKEKINKEAVWFLSNITAGNQEQVQAVIDYSLIPLIIYHLDKGDFQTQKEAAWVISNLTISGTPQQVAFVVQQGVIPPFCKMLSVRDAQVVQVVLDGILNILKVANDQSDLVCTMIEECGGLDL 434          

HSP 2 Score: 53.5286 bits (127), Expect = 2.544e-7
Identity = 59/286 (20.63%), Postives = 115/286 (40.21%), Query Frame = 2
Query:  368 ASFVLRAVAKHSPELAQSVVDCGALDALVICLEEFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAV-PLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPDTKLKRQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIREIAKHTPELSQLIVNAGGVAAIVDFIGETKGNISLPGIMMLGYVAAHSETLSMSVIVSRGVLQLSSIFNNDCED-HILAATAWALGQIG-RHTPEHSKAVAKQNVLPKLLR 1216
            A++ L  +A  + E   +VV  GA+   +  L      V E + W LG I      L    +  G V PLL     +  +   R     + ++C++       V  +  +  L  ++ N DT +      AL+ +     D  ++V+EA+I   ++  L   D  V+      +  I   T E +Q ++N   ++     +  +K  I+   +  L  + A ++   +  ++   ++ L  I++ D  D       AW +  +    TP+    V +Q V+P   +
Sbjct:  108 AAWALTNIASGTSEQTNAVVQAGAVPLFLKLLGSTHSNVCEQAVWALGNIIGDGPTLRDYAISLGVVAPLLKFLNADVPITFLRNVTWVIVNLCRNKDPPPSPVTISELLPALRFLIQNIDTNILVDTVWALSYLTDGGNDQIQMVIEADIVRFLVPLLSHNDVKVQTAALRAVGNIVTGTDEQTQYVLNFDALSHFPQLLQHSKEKINKEAVWFLSNITAGNQE-QVQAVIDYSLIPL-IIYHLDKGDFQTQKEAAWVISNLTISGTPQQVAFVVQQGVIPPFCK 391          

HSP 3 Score: 50.447 bits (119), Expect = 2.502e-6
Identity = 52/268 (19.40%), Postives = 110/268 (41.04%), Query Frame = 2
Query:  419 SVVDCGALDALVICLE-EFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPDTKLK--RQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIREIAKHTPELSQLIVNAGGVAAIVDFIGETKGNISLPGIMMLGYVAAHSETLSMSVIVSRGVLQLSSIFNNDCEDHILAATAWALGQIGRHTPEHSKAVAKQNVLPKLL 1213
            +++  G +  LV CL+ +  P ++  +AW L  IA   ++   +VV AGAVPL +  +      +   A  AL +I    P L    +  G +A L +  LN D  +   R +   +  + ++       V  +E+ PA+   +++ D  +  +    +  +     +  Q+++ A  V  +V  +      +    +  +G +   ++  +  V+    +     +  +  E  I     W L  I     E  +AV   +++P ++
Sbjct:   82 NLIQSGIMPILVECLDNDAHPNIQFEAAWALTNIASGTSEQTNAVVQAGAVPLFLKLLGSTHSNVCEQAVWALGNIIGDGPTLRDYAISLGVVAPLLKF-LNADVPITFLRNVTWVIVNLCRNKDPPPSPVTISELLPALRFLIQNIDTNILVDTVWALSYLTDGGNDQIQMVIEADIVRFLVPLLSHNDVKVQTAALRAVGNIVTGTDEQTQYVLNFDALSHFPQLLQHSKE-KINKEAVWFLSNITAGNQEQVQAVIDYSLIPLII 347          
BLAST of Sperm associated antigen 6 vs. Planmine SMEST
Match: SMESG000058125.1 (SMESG000058125.1)

HSP 1 Score: 56.225 bits (134), Expect = 4.493e-8
Identity = 76/374 (20.32%), Postives = 142/374 (37.97%), Query Frame = 2
Query:  110 RTQFVQTIAELANRPQN--IETLQCAGVMNLLRPLL-LDVVPSIQQTAALALGRLANHSDDLALAVVKGDILPQLVYSLAEQDRFYKKAASFVLRAVAKHSPELAQSVVDCGA-------------------------------------------LDALVICLEEFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPDTKLKRQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIREIA-KHTPELSQLIVNAGGVAAIVDFIGETKG---NISLPGIMMLGYVAAHSETLSMSVIVSRGVLQL 1081
            R + +Q   +L +  +N  I+ L  +G+M +L   L  D  P+IQ  AA AL  +A+ + +   AVV+   +P  +  L        + A + L  +    P L    +  G                                            L AL   ++  D  +   + W L Y+        Q V++A  V  LV  +   D+ ++  A  A+ +I   + +  Q V++  A++H  Q++ +   K+ ++    L+ I   + +  + V++  + P I+  L   D   +K  A +I  +    TP+    +V  G +      +         + L GI+ +  VA     L  ++I   G L L
Sbjct:   78 RLEAIQAARKLLSSDKNPPIDNLIQSGIMPILVECLDNDAHPNIQFEAAWALTNIASGTSEQTNAVVQAGAVPLFLKLLGSTHSNVCEQAVWALGNIIGDGPTLRDYAISLGVVAPLLKFLNADVPITFLRNVTWVIVNLCRNKDPPPSPVTISELLPALRFLIQNIDTNILVDTVWALSYLTDGGNDQIQMVIEADIVRFLVPLLSHNDVKVQTAALRAVGNIVTGTDEQTQYVLNFDALSHFPQLLQHSKEKINKEAVWFLSNITAGNQEQVQAVIDYSLIPLIIYHLDKGDFQTQKEAAWVISNLTISGTPQQVAFVVQQGVIPPFCKMLSVRDAQVVQVVLDGILNILKVANDQSDLVCTMIEECGGLDL 451          

HSP 2 Score: 53.1434 bits (126), Expect = 3.436e-7
Identity = 59/286 (20.63%), Postives = 115/286 (40.21%), Query Frame = 2
Query:  368 ASFVLRAVAKHSPELAQSVVDCGALDALVICLEEFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAV-PLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPDTKLKRQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIREIAKHTPELSQLIVNAGGVAAIVDFIGETKGNISLPGIMMLGYVAAHSETLSMSVIVSRGVLQLSSIFNNDCED-HILAATAWALGQIG-RHTPEHSKAVAKQNVLPKLLR 1216
            A++ L  +A  + E   +VV  GA+   +  L      V E + W LG I      L    +  G V PLL     +  +   R     + ++C++       V  +  +  L  ++ N DT +      AL+ +     D  ++V+EA+I   ++  L   D  V+      +  I   T E +Q ++N   ++     +  +K  I+   +  L  + A ++   +  ++   ++ L  I++ D  D       AW +  +    TP+    V +Q V+P   +
Sbjct:  125 AAWALTNIASGTSEQTNAVVQAGAVPLFLKLLGSTHSNVCEQAVWALGNIIGDGPTLRDYAISLGVVAPLLKFLNADVPITFLRNVTWVIVNLCRNKDPPPSPVTISELLPALRFLIQNIDTNILVDTVWALSYLTDGGNDQIQMVIEADIVRFLVPLLSHNDVKVQTAALRAVGNIVTGTDEQTQYVLNFDALSHFPQLLQHSKEKINKEAVWFLSNITAGNQE-QVQAVIDYSLIPL-IIYHLDKGDFQTQKEAAWVISNLTISGTPQQVAFVVQQGVIPPFCK 408          

HSP 3 Score: 50.447 bits (119), Expect = 3.064e-6
Identity = 52/268 (19.40%), Postives = 110/268 (41.04%), Query Frame = 2
Query:  419 SVVDCGALDALVICLE-EFDPAVKEGSAWTLGYIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDICKHSPDLAQTVVDAGAIAHLAQMVLNPDTKLK--RQIFSALAQIAKHSVDLAEIVVEAEIFPAILTCLKDKDDMVKKNCATLIREIAKHTPELSQLIVNAGGVAAIVDFIGETKGNISLPGIMMLGYVAAHSETLSMSVIVSRGVLQLSSIFNNDCEDHILAATAWALGQIGRHTPEHSKAVAKQNVLPKLL 1213
            +++  G +  LV CL+ +  P ++  +AW L  IA   ++   +VV AGAVPL +  +      +   A  AL +I    P L    +  G +A L +  LN D  +   R +   +  + ++       V  +E+ PA+   +++ D  +  +    +  +     +  Q+++ A  V  +V  +      +    +  +G +   ++  +  V+    +     +  +  E  I     W L  I     E  +AV   +++P ++
Sbjct:   99 NLIQSGIMPILVECLDNDAHPNIQFEAAWALTNIASGTSEQTNAVVQAGAVPLFLKLLGSTHSNVCEQAVWALGNIIGDGPTLRDYAISLGVVAPLLKF-LNADVPITFLRNVTWVIVNLCRNKDPPPSPVTISELLPALRFLIQNIDTNILVDTVWALSYLTDGGNDQIQMVIEADIVRFLVPLLSHNDVKVQTAALRAVGNIVTGTDEQTQYVLNFDALSHFPQLLQHSKE-KINKEAVWFLSNITAGNQEQVQAVIDYSLIPLII 364          
The following BLAST results are available for this feature:
BLAST of Sperm associated antigen 6 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SPAG60.000e+078.46sperm associated antigen 6 [Source:HGNC Symbol;Acc... [more]
SPAG65.233e-3277.73sperm associated antigen 6 [Source:HGNC Symbol;Acc... [more]
SPAG60.000e+077.35sperm associated antigen 6 [Source:HGNC Symbol;Acc... [more]
SPAG60.000e+077.14sperm associated antigen 6 [Source:HGNC Symbol;Acc... [more]
SPAG63.919e-6882.31sperm associated antigen 6 [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of Sperm associated antigen 6 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ima-32.491e-919.83Importin subunit alpha-3 [Source:UniProtKB/Swiss-... [more]
ima-26.007e-823.51Importin subunit alpha-2 [Source:UniProtKB/Swiss-... [more]
back to top
BLAST of Sperm associated antigen 6 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kap-alpha12.152e-921.84gene:FBgn0024889 transcript:FBtr0074881[more]
Kap-alpha34.056e-821.53gene:FBgn0027338 transcript:FBtr0301189[more]
Kap-alpha34.056e-821.53gene:FBgn0027338 transcript:FBtr0082106[more]
Kap-alpha34.056e-821.53gene:FBgn0027338 transcript:FBtr0082108[more]
Kap-alpha34.056e-821.53gene:FBgn0027338 transcript:FBtr0082107[more]
back to top
BLAST of Sperm associated antigen 6 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
spag60.000e+077.67sperm associated antigen 6 [Source:ZFIN;Acc:ZDB-GE... [more]
spag60.000e+077.51sperm associated antigen 6 [Source:ZFIN;Acc:ZDB-GE... [more]
kpna71.475e-921.46karyopherin alpha 7 (importin alpha 8) [Source:ZFI... [more]
kpna51.823e-922.47karyopherin alpha 5 (importin alpha 6) [Source:NCB... [more]
kpna61.171e-822.85karyopherin alpha 6 (importin alpha 7) [Source:ZFI... [more]
back to top
BLAST of Sperm associated antigen 6 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ufd10.000e+077.95ubiquitin recognition factor in ER associated degr... [more]
ufd10.000e+077.64ubiquitin recognition factor in ER associated degr... [more]
ufd10.000e+077.82ubiquitin recognition factor in ER associated degr... [more]
ufd10.000e+077.71ubiquitin recognition factor in ER associated degr... [more]
ufd10.000e+077.71ubiquitin recognition factor in ER associated degr... [more]
back to top
BLAST of Sperm associated antigen 6 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Spag6l0.000e+079.84sperm associated antigen 6-like [Source:MGI Symbol... [more]
Spag60.000e+076.68sperm associated antigen 6 [Source:MGI Symbol;Acc:... [more]
Spag69.216e-8380.12sperm associated antigen 6 [Source:MGI Symbol;Acc:... [more]
Kpna71.767e-923.48karyopherin alpha 7 (importin alpha 8) [Source:MGI... [more]
Kpna71.767e-923.48karyopherin alpha 7 (importin alpha 8) [Source:MGI... [more]
back to top
BLAST of Sperm associated antigen 6 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9JLI7|SPAG6_MOUSE0.000e+079.84Sperm-associated antigen 6 OS=Mus musculus OX=1009... [more]
sp|O75602|SPAG6_HUMAN0.000e+078.46Sperm-associated antigen 6 OS=Homo sapiens OX=9606... [more]
sp|G5EB89|KAPA_EMENI3.113e-1022.36Importin subunit alpha OS=Emericella nidulans (str... [more]
sp|B9DHT4|ARIA_ARATH5.924e-1023.70ARM REPEAT PROTEIN INTERACTING WITH ABF2 OS=Arabid... [more]
sp|B6HJ92|KAPA_PENRW2.117e-922.46Importin subunit alpha OS=Penicillium rubens (stra... [more]
back to top
BLAST of Sperm associated antigen 6 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|157628750.000e+084.39tr|A0A1I8HT46|A0A1I8HT46_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|157946250.000e+084.19tr|A0A1I8GNF6|A0A1I8GNF6_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|157570200.000e+084.39tr|A0A267DQ56|A0A267DQ56_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|182395640.000e+084.60tr|A0A1I8HVJ4|A0A1I8HVJ4_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|239056710.000e+083.63tr|K1PQU8|K1PQU8_CRAGI Sperm-associated antigen 6 ... [more]
back to top
BLAST of Sperm associated antigen 6 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
spag60.000e+077.71sperm associated antigen 6 [Source:NCBI gene;Acc:1... [more]
kpna51.068e-922.85karyopherin alpha 5 (importin alpha 6) [Source:NCB... [more]
kpna71.803e-921.96importin subunit alpha-5-like [Source:NCBI gene;Ac... [more]
kpna31.841e-919.66karyopherin subunit alpha 3 [Source:NCBI gene;Acc:... [more]
kpna62.561e-923.22karyopherin subunit alpha 6 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Sperm associated antigen 6 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
kpna78.655e-1121.78karyopherin alpha 7 (importin alpha 8) [Source:ZFI... [more]
ENSPMAT00000005568.13.402e-920.71pep scaffold:Pmarinus_7.0:GL477092:38612:43101:1 g... [more]
kpna41.197e-823.24karyopherin alpha 4 (importin alpha 3) [Source:ZFI... [more]
kpna67.291e-624.79karyopherin alpha 6 (importin alpha 7) [Source:ZFI... [more]
back to top
BLAST of Sperm associated antigen 6 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
SRP11.004e-920.39Karyopherin alpha homolog; forms a dimer with kary... [more]
back to top
BLAST of Sperm associated antigen 6 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO422280.000e+081.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO306486.679e-1721.54Importin subunit alpha [Source:UniProtKB/TrEMBL;A... [more]
EDO291612.048e-824.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO319405.687e-820.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO383372.124e-718.71Importin subunit alpha [Source:UniProtKB/TrEMBL;A... [more]
back to top
BLAST of Sperm associated antigen 6 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
spag60.000e+068.38sperm associated antigen 6 [Source:NCBI gene;Acc:1... [more]
kpna29.096e-1120.68importin subunit alpha-1 [Source:NCBI gene;Acc:101... [more]
kpna21.045e-1020.68importin subunit alpha-1 [Source:NCBI gene;Acc:101... [more]
kpna43.386e-921.28karyopherin subunit alpha 4 [Source:NCBI gene;Acc:... [more]
KPNA23.563e-920.85karyopherin subunit alpha 2 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Sperm associated antigen 6 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000018022.10.000e+0100.00SMESG000018022.1[more]
SMESG000055942.12.020e-820.86SMESG000055942.1[more]
SMESG000058125.14.013e-820.32SMESG000058125.1[more]
SMESG000058125.14.124e-820.32SMESG000058125.1[more]
SMESG000058125.14.493e-820.32SMESG000058125.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019318 ID=SMED30019318|Name=Sperm associated antigen 6|organism=Schmidtea mediterranea sexual|type=transcript|length=1664bp
GTCAGGTTTCTATAACAACGGTTACTACTATTTTGATAATTACATATTAG
TTTAATTTAAAATGAGTCAAAGACAAGTTTTACAAGTTTTTGAACAATAT
CAGAAATCTCGAACTCAATTTGTTCAAACGATTGCAGAATTAGCTAATAG
ACCGCAGAATATTGAGACTTTGCAATGTGCTGGAGTCATGAATCTTCTCA
GACCTTTACTATTAGACGTTGTACCATCAATTCAGCAGACTGCTGCTTTA
GCATTGGGTCGATTGGCTAACCACAGTGATGATTTGGCTTTAGCAGTTGT
GAAAGGAGATATTCTACCACAATTGGTGTACTCACTCGCGGAACAAGATA
GATTTTATAAAAAAGCAGCTTCATTTGTATTGAGAGCAGTGGCAAAGCAT
TCTCCCGAGTTGGCACAATCTGTAGTCGACTGTGGAGCACTGGATGCATT
GGTAATCTGTTTAGAAGAATTTGATCCAGCAGTAAAAGAAGGTTCTGCAT
GGACTTTGGGCTATATAGCTCGTCATAATGCACAATTAGCACAGTCTGTG
GTTGATGCAGGTGCTGTACCATTACTAGTTTTGTGCGTACAGGAACCCGA
TTTGGGATTAAAGAGAATAGCAGCAAGCGCTTTAAGTGATATATGCAAAC
ACAGCCCTGATTTAGCTCAAACTGTCGTTGATGCAGGCGCAATCGCTCAT
CTTGCACAAATGGTTCTCAATCCGGATACTAAACTAAAGCGTCAAATCTT
TTCGGCATTGGCTCAAATCGCCAAACATTCTGTTGATCTTGCAGAAATTG
TTGTTGAAGCGGAAATATTTCCAGCTATTCTTACTTGTTTGAAAGATAAA
GATGATATGGTTAAAAAGAATTGTGCAACGTTAATTCGAGAAATCGCCAA
GCATACACCGGAATTGAGTCAACTTATTGTAAATGCTGGTGGAGTAGCAG
CTATTGTTGATTTCATTGGGGAGACAAAAGGCAACATAAGTTTACCGGGA
ATAATGATGCTGGGTTATGTCGCTGCTCATTCCGAAACTTTGTCAATGTC
TGTAATAGTAAGCAGAGGAGTTTTACAGTTGAGTAGTATTTTCAACAACG
ACTGTGAAGATCACATTTTAGCTGCGACTGCGTGGGCTTTAGGTCAGATT
GGGCGTCACACTCCTGAACACTCAAAGGCGGTTGCTAAACAAAATGTTTT
GCCAAAACTGCTTCGTTGTTACCTACGTCCAGATGTAAGTGAAGACCTTC
AAAATAAGTCTAAAAAGGCTCTTAAACATATTCTTCAAAAATGTGTTTAC
TTGGAAGCTCTAGAGCCACTTTTGCAAGACGCACCTCCAAACATTCTAAA
GCATGTCGTTGCACAATTTAGCAAGGTGTTACCTAATAATCCACAAGCCA
GAAGACTTTTTGTCACGTCAGGAGGATTGAAAAAAGTTCAAGATATGAAA
GTCGAACCGGGATCGGCATTAAGTGAATACATTAATATAATAAATAATTG
TTATCCCGAAGAGATTGTAAAATATTACTCGCCAGGATATTCCGAAGCGC
TTTTGGAACGAGTTGAGAGCTATCAACCAGCCTTGTGAATCTTACAAAAA
GATAACATATAAACATTTGTTAAAATTAAAAAGATGATTAATTAAAAAAT
ATCCTAAAGTGAAA
back to top

protein sequence of SMED30019318-orf-1

>SMED30019318-orf-1 ID=SMED30019318-orf-1|Name=SMED30019318-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=509bp
MSQRQVLQVFEQYQKSRTQFVQTIAELANRPQNIETLQCAGVMNLLRPLL
LDVVPSIQQTAALALGRLANHSDDLALAVVKGDILPQLVYSLAEQDRFYK
KAASFVLRAVAKHSPELAQSVVDCGALDALVICLEEFDPAVKEGSAWTLG
YIARHNAQLAQSVVDAGAVPLLVLCVQEPDLGLKRIAASALSDICKHSPD
LAQTVVDAGAIAHLAQMVLNPDTKLKRQIFSALAQIAKHSVDLAEIVVEA
EIFPAILTCLKDKDDMVKKNCATLIREIAKHTPELSQLIVNAGGVAAIVD
FIGETKGNISLPGIMMLGYVAAHSETLSMSVIVSRGVLQLSSIFNNDCED
HILAATAWALGQIGRHTPEHSKAVAKQNVLPKLLRCYLRPDVSEDLQNKS
KKALKHILQKCVYLEALEPLLQDAPPNILKHVVAQFSKVLPNNPQARRLF
VTSGGLKKVQDMKVEPGSALSEYINIINNCYPEEIVKYYSPGYSEALLER
VESYQPAL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR000225Armadillo
IPR011989ARM-like
IPR000357HEAT
IPR016024ARM-type_fold
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005488binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0005874microtubule
GO:0005929cilium
GO:0015630microtubule cytoskeleton
GO:0031514motile cilium
GO:0042995cell projection
GO:0097228sperm principal piece
GO:1990716axonemal central apparatus
Vocabulary: biological process
TermDefinition
GO:0007288sperm axoneme assembly
GO:0021591ventricular system development
GO:0030030cell projection organization
GO:0030317flagellated sperm motility
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000225ArmadilloSMARTSM00185arm_5coord: 30..70
e-value: 0.032
score: 23.4
coord: 198..238
e-value: 5.5E-4
score: 29.2
coord: 240..280
e-value: 0.15
score: 21.1
coord: 323..365
e-value: 180.0
score: 3.5
coord: 282..322
e-value: 56.0
score: 7.4
coord: 367..409
e-value: 61.0
score: 7.2
coord: 156..196
e-value: 1.6E-4
score: 31.0
coord: 114..154
e-value: 3.0E-6
score: 36.8
IPR000225ArmadilloPFAMPF00514Armcoord: 114..154
e-value: 1.5E-7
score: 31.2
coord: 158..195
e-value: 1.9E-5
score: 24.5
coord: 198..237
e-value: 1.7E-4
score: 21.5
IPR000357HEAT repeatPFAMPF02985HEATcoord: 252..281
e-value: 0.0019
score: 18.3
IPR011989Armadillo-like helicalGENE3DG3DSA:1.25.10.10coord: 235..475
e-value: 9.0E-29
score: 102.2
IPR011989Armadillo-like helicalGENE3DG3DSA:1.25.10.10coord: 8..234
e-value: 1.5E-40
score: 141.0
NoneNo IPR availablePANTHERPTHR23314SPERM-ASSOCIATED ANTIGEN 6 ARMADILLO REPEAT-CONTAININGcoord: 1..506
NoneNo IPR availablePANTHERPTHR23314:SF2SPERM-ASSOCIATED ANTIGEN 6coord: 1..506
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 15..489