wdr-1

Overview
Namewdr-1 (AIX99552.1)
Smed IDSMED30019305
Length (bp)2163
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of wdr-1 (SMED30019305) t-SNE clustered cells

Violin plots show distribution of expression levels for wdr-1 (SMED30019305) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of wdr-1 (SMED30019305) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for wdr-1 (SMED30019305) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019305

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30019305SMESG000045753.1 SMESG000037894.1 SmedASXL_009987SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30019305SMESG000045753.1 SMESG000037894.1 dd_Smed_v4_2585_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30019305SMESG000045753.1 SMESG000037894.1 dd_Smed_v4_2585_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30019305SMESG000045753.1 SMESG000037894.1 dd_Smed_v4_2585_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30019305SMESG000045753.1 SMESG000037894.1 dd_Smed_v4_2585_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30019305SMESG000045753.1 SMESG000037894.1 dd_Smed_v4_2585_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30019305SMESG000045753.1 SMESG000037894.1 dd_Smed_v6_2585_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30019305SMESG000045753.1 SMESG000037894.1 dd_Smed_v4_2585_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30019305SMESG000045753.1 SMESG000037894.1 dd_Smed_v4_2585_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30019305SMESG000045753.1 SMESG000037894.1 dd_Smed_v4_2585_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30019305SMESG000045753.1 SMESG000037894.1 dd_Smed_v4_2585_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of wdr-1 vs. Ensembl Human
Match: CFAP52 (cilia and flagella associated protein 52 [Source:HGNC Symbol;Acc:HGNC:16053])

HSP 1 Score: 729.939 bits (1883), Expect = 0.000e+0
Identity = 355/644 (55.12%), Postives = 465/644 (72.20%), Query Frame = 2
Query:   86 EINKLELINVIGFNGTILDGLHVHPDRQHIIYGLGCTVVIEDLNTKNQCFLQGHTNNVVCITVSNSGKYIASGQITHMGYKADIMLWDYVTKQCVSTFSLHKVKVQSLAFSPNEKYLASLGGQDDGCVVIWSLTKMEPICGSPAQHKSAGITECLVYSNTNDDVFVTAGENTLRVWELDVENRKIRPTECSLGAIKRSIKCITISKDDSVFFCGTSSGDILGVNMKSCLLSCIGPEKETFSLGVLSIIRLINGDLIVGAGDGTICQVKVVEKKEGNKIMPKIVKTSNSCMLVGGVSSITLRGQGHQFYAGTEKSHIYRFSLGDFKSELINTAHYSAVNDIVYPNNCPKLFVTCSFQDVRVFHSDSQKELLRINIPNMTCYTCDIFKDGTAIITGWDDSKIRAFYPETGALMYTINDAHKKGVTAIAATSDCRKVVSGGGEGQVRVWRIEECKVSQANTIPHSHGNRKKSNVKSVVYVAHMETAMKEHANAVSCIRMNKDDTQCVSSSADGTCIIWCLIKYTRKQIMFANTLFRCVCWRPDECQIITSGTDRKIGYWEVYDGSLIRELEGSRSGSVNGMDITADGDIFVTGGDDKIVKVWKYNEGYVTHVGLGHSMPITRLRISPDRQLITTVSEDGAIYFWKFP 2017
            ++ +LEL  VIGFNG +  GL  HPD++H+IY LGCTV+I+ +NTK Q FLQGH NNV C+ +S SG+YIASGQ+T MG+KADI+LWDY  ++ ++  SLHK K+++LAFSPN+ YL SLGG DDG VV+WS+ K + ICGSPA   + G    +++S   D++F+TAG  T+RVWELD+ NRKI PTEC  G +KR +  I +  DDS F+ GT++GDIL +N ++ LL+ +GP K+ FSLGV +I  L  G L+VG+G G +    V  K  G K + KI        L GG++SITLRG+GHQF  GTE+SHIYR S  DFK  LI T H+ AV DIV+P    +LF TC+ +D+RV+H+ S +ELLRI +PNMTC+  D  +DG +II+ W+D KIRAF PETG LMY IN+AH+ GVTAIA TSDC++V+SGGGEG+VRVW+I  C+  +                        +E A+KEH ++VSCIR+ +++ +CV++S DGTCIIW L++  R Q++ ANTLF+CVC+ P+E QIITSGTDRKI YWEV+DG++IRELEGS SGS+NGMDIT +G  FVTGG+D +VKVW YNEG VTHVG+GHS  ITR+RISP  Q I +VS DGAI  WK+P
Sbjct:   10 QVAELELDAVIGFNGHVPTGLKCHPDQEHMIYPLGCTVLIQAINTKEQNFLQGHGNNVSCLAISRSGEYIASGQVTFMGFKADIILWDYKNRELLARLSLHKGKIEALAFSPNDLYLVSLGGPDDGSVVVWSIAKRDAICGSPAAGLNVGNATNVIFSRCRDEMFMTAGNGTIRVWELDLPNRKIWPTECQTGQLKRIVMSIGVDDDDSFFYLGTTTGDILKMNPRTKLLTDVGPAKDKFSLGVSAIRCLKMGGLLVGSGAGLL----VFCKSPGYKPIKKI-------QLQGGITSITLRGEGHQFLVGTEESHIYRVSFTDFKETLIATCHFDAVEDIVFPFGTAELFATCAKKDIRVWHTSSNRELLRITVPNMTCHGIDFMRDGKSIISAWNDGKIRAFAPETGRLMYVINNAHRIGVTAIATTSDCKRVISGGGEGEVRVWQI-GCQTQK------------------------LEEALKEHKSSVSCIRVKRNNEECVTASTDGTCIIWDLVRLRRNQMILANTLFQCVCYHPEEFQIITSGTDRKIAYWEVFDGTVIRELEGSLSGSINGMDITQEGVHFVTGGNDHLVKVWDYNEGEVTHVGVGHSGNITRIRISPGNQYIVSVSADGAILRWKYP 617          
BLAST of wdr-1 vs. Ensembl Human
Match: CFAP52 (cilia and flagella associated protein 52 [Source:HGNC Symbol;Acc:HGNC:16053])

HSP 1 Score: 624.009 bits (1608), Expect = 0.000e+0
Identity = 305/562 (54.27%), Postives = 400/562 (71.17%), Query Frame = 2
Query:  332 DIMLWDYVTKQCVSTFSLHKVKVQSLAFSPNEKYLASLGGQDDGCVVIWSLTKMEPICGSPAQHKSAGITECLVYSNTNDDVFVTAGENTLRVWELDVENRKIRPTECSLGAIKRSIKCITISKDDSVFFCGTSSGDILGVNMKSCLLSCIGPEKETFSLGVLSIIRLINGDLIVGAGDGTICQVKVVEKKEGNKIMPKIVKTSNSCMLVGGVSSITLRGQGHQFYAGTEKSHIYRFSLGDFKSELINTAHYSAVNDIVYPNNCPKLFVTCSFQDVRVFHSDSQKELLRINIPNMTCYTCDIFKDGTAIITGWDDSKIRAFYPETGALMYTINDAHKKGVTAIAATSDCRKVVSGGGEGQVRVWRIEECKVSQANTIPHSHGNRKKSNVKSVVYVAHMETAMKEHANAVSCIRMNKDDTQCVSSSADGTCIIWCLIKYTRKQIMFANTLFRCVCWRPDECQIITSGTDRKIGYWEVYDGSLIRELEGSRSGSVNGMDITADGDIFVTGGDDKIVKVWKYNEGYVTHVGLGHSMPITRLRISPDRQLITTVSEDGAIYFWKFP 2017
            DI+LWDY  ++ ++  SLHK K+++LAFSPN+ YL SLGG DDG VV+WS+ K + ICGSPA   + G    +++S   D++F+TAG  T+RVWELD+ NRKI PTEC  G +KR +  I +  DDS F+ GT++GDIL +N ++ LL+ +GP K+ FSLGV +I  L  G L+VG+G G +    V  K  G K + KI        L GG++SITLRG+GHQF  GTE+SHIYR S  DFK  LI T H+ AV DIV+P    +LF TC+ +D+RV+H+ S +ELLRI +PNMTC+  D  +DG +II+ W+D KIRAF PETG LMY IN+AH+ GVTAIA TSDC++V+SGGGEG+VRVW+I  C+  +                        +E A+KEH ++VSCIR+ +++ +CV++S DGTCIIW L++  R Q++ ANTLF+CVC+ P+E QIITSGTDRKI YWEV+DG++IRELEGS SGS+NGMDIT +G  FVTGG+D +VKVW YNEG VTHVG+GHS  ITR+RISP  Q I +VS DGAI  WK+P
Sbjct:   24 DIILWDYKNRELLARLSLHKGKIEALAFSPNDLYLVSLGGPDDGSVVVWSIAKRDAICGSPAAGLNVGNATNVIFSRCRDEMFMTAGNGTIRVWELDLPNRKIWPTECQTGQLKRIVMSIGVDDDDSFFYLGTTTGDILKMNPRTKLLTDVGPAKDKFSLGVSAIRCLKMGGLLVGSGAGLL----VFCKSPGYKPIKKI-------QLQGGITSITLRGEGHQFLVGTEESHIYRVSFTDFKETLIATCHFDAVEDIVFPFGTAELFATCAKKDIRVWHTSSNRELLRITVPNMTCHGIDFMRDGKSIISAWNDGKIRAFAPETGRLMYVINNAHRIGVTAIATTSDCKRVISGGGEGEVRVWQIG-CQTQK------------------------LEEALKEHKSSVSCIRVKRNNEECVTASTDGTCIIWDLVRLRRNQMILANTLFQCVCYHPEEFQIITSGTDRKIAYWEVFDGTVIRELEGSLSGSINGMDITQEGVHFVTGGNDHLVKVWDYNEGEVTHVGVGHSGNITRIRISPGNQYIVSVSADGAILRWKYP 549          
BLAST of wdr-1 vs. Ensembl Human
Match: CFAP52 (cilia and flagella associated protein 52 [Source:HGNC Symbol;Acc:HGNC:16053])

HSP 1 Score: 108.612 bits (270), Expect = 3.034e-27
Identity = 49/84 (58.33%), Postives = 64/84 (76.19%), Query Frame = 2
Query:   86 EINKLELINVIGFNGTILDGLHVHPDRQHIIYGLGCTVVIEDLNTKNQCFLQGHTNNVVCITVSNSGKYIASGQITHMGYKADI 337
            ++ +LEL  VIGFNG +  GL  HPD++H+IY LGCTV+I+ +NTK Q FLQGH NNV C+ +S SG+YIASGQ+T MG+K   
Sbjct:   10 QVAELELDAVIGFNGHVPTGLKCHPDQEHMIYPLGCTVLIQAINTKEQNFLQGHGNNVSCLAISRSGEYIASGQVTFMGFKTSF 93          
BLAST of wdr-1 vs. Ensembl Human
Match: CFAP52 (cilia and flagella associated protein 52 [Source:HGNC Symbol;Acc:HGNC:16053])

HSP 1 Score: 102.834 bits (255), Expect = 1.110e-25
Identity = 43/74 (58.11%), Postives = 62/74 (83.78%), Query Frame = 2
Query: 1523 METAMKEHANAVSCIRMNKDDTQCVSSSADGTCIIWCLIKYTRKQIMFANTLFRCVCWRPDECQIITSGTDRKI 1744
            +E A+KEH ++VSCIR+ +++ +CV++S DGTCIIW L++  R Q++ ANTLF+CVC+ P+E QIITSGTDRK+
Sbjct:    5 LEEALKEHKSSVSCIRVKRNNEECVTASTDGTCIIWDLVRLRRNQMILANTLFQCVCYHPEEFQIITSGTDRKV 78          
BLAST of wdr-1 vs. Ensembl Human
Match: WDR90 (WD repeat domain 90 [Source:HGNC Symbol;Acc:HGNC:26960])

HSP 1 Score: 95.1301 bits (235), Expect = 2.436e-19
Identity = 114/473 (24.10%), Postives = 196/473 (41.44%), Query Frame = 2
Query:   98 LELINVIGFNGTILDGLHVHPDRQHIIYGLGCTVVIEDLNTKNQCFLQGHTNNVVCITVSNSGKYIASGQ-ITHMGYKADIMLWDYVTKQCVSTFSLHKVKVQSLAFSPNEKYLASLGGQDDGCVVIW--------SLTKM-EPICGSPAQHKSAGITECLVYSNTNDDVFVTAGENTLRVWELDVENRKI------RPTECSLGAIKRSIKCITISKDDSVFFCGTSSGDILGVNMKS--CLLSCIGPEKETFSLGVL--SIIRLINGDLIVGAGDGTICQVKVVEKK--EGNKIMPKIVKTSNSCMLVGGVSSITLRGQGHQFYAGTEKSHIYRFSLGDFKSELINTAHYSAVNDIVYP---NNCPKLFVTCSFQ-DVRVFHSDSQKELLRINIPNMTCY------TCDIFKDGTAIITGWDDSKIRAFYPETGALMYTINDAHKKGVTAIAATSDCRKVVSGGGEGQVRV 1420
            L L  V+G++G     +   PD     Y  G  VV+EDL++  Q    GH+  +  + +S+S + +AS    +       I +WD     C      H   V +LAFSP+++ L +LG  D   + +W        S T++ EP+ G       AG   C+             G+ T+  W L      I       P   ++GA + +  C        + +CGTSSG +   + ++  C LS    E +   +G+L  S  RL++G      G   +  V  V +   +G+      V   +  +L G V S +          GT    ++  S  +  S  + + H S VN++V+    ++C     TCS    VRV+   S + +++  + N +C        C    +   +  G+ D  +R F     A+   ++  H   +T +A ++D + V+SG  +G V V
Sbjct: 1108 LRLKAVVGYSGNGRANMVWRPDTGFFAYTCGRLVVVEDLHSGAQQHWSGHSAEISTLALSHSAQVLASASGRSSTTAHCQIRVWDVSGGLCQHLIFPHSTTVLALAFSPDDRLLVTLGDHDGRTLALWGTATYDLVSSTRLPEPVHGVAFNPWDAGELTCV-------------GQGTVTFWLLQQRGADISLQVRREPVPEAVGAGELTSLCYGAPP---LLYCGTSSGQVCVWDTRAGRCFLSW---EADDGGIGLLLFSGSRLVSGS---STGRLRLWAVGAVSELRCKGSGARSSSVFMEHELVLDGAVVSASFDDSVDMGVVGTTAGTLWFVSWAEGTSTRLISGHRSKVNEVVFSPGESHC----ATCSEDGSVRVWALASMELVIQFQVLNQSCLCLAWSPPCCGRPEQQRLAAGYGDGSLRIFSVSRTAMELKMHP-HPVALTTVAFSTDGQTVLSGDKDGLVAV 1553          

HSP 2 Score: 84.3445 bits (207), Expect = 6.100e-16
Identity = 137/694 (19.74%), Postives = 248/694 (35.73%), Query Frame = 2
Query:   98 LELINVIGFNGTILDGLHVHPDRQHIIYGLGCTVVIEDLNTKNQCFLQGHTNNVVCITVSNSGKYIASGQITHMGYKADIMLWDYVTKQCVSTFSLHKVKVQSLAFSPNEKYLASLGGQDDG--CVVIWSLTKMEPICGSPAQHKSAGITECLVYSNTNDDV------------FVTAGENTLRVWELDVENRKIRPTECSLG---AIKRSIKCITISKDD------SVFFCGTSSGDILGVNMKSCLL------------SCIGPEKETFSLG---VLSIIRLINGDLIVGAGDGTICQVKVVEKKEGNKIMPKIVKTSNSCMLV-----GGVSSITLRGQGHQFYAGTEKSHIYRFSLGDFKSELINTAHYSAVNDIVYPNNCPKLFVTCSFQDVRVFHSDSQKELLRINIPNMTCYTCDIFKDGTAIITGWDDSKIRAFYPETGALMYTINDAHKKGVTAIAATSDCRKVVSGGGEG----------QVRVWRIEECKV-SQANTIPHSHGNRKKSNVKSVVYVAHMETAMKEHANAVSCIRMNKDDTQCVSSSADGTCIIWCLIKYTRKQIMFANTLFRCVCWRPDEC-QIITSGTDRKIGYWEVYDGSLIRELEGSRSGSVNGMDITADGDIFVTGGDDKIVKVWKY--NEGYVTHVGLGHSMPITRLRISPDRQLITTVSEDGAIYFW 2008
            L L  VIGF G         PD   ++Y     +V+  ++T  Q F  GHT+ V  + +  S   +AS Q       + + LWD+ T +C+  F      V SL+FS +   L  +G    G   VV W             Q    G    L  ++T+ DV              + G+ ++R+W L      +R     LG   A++ +      ++D       ++ F  + SG IL ++ +  ++                P+K+TFS G    +S + +      VG+ DG +                ++     S +L+     G VSS+ +   G +  + T   H+           ++  +H + V  +       +L      + VR++   + ++L                        G+    +R+F  E   ++   +  H+  VT + AT D R + S   +G          Q  V R+    V   A   P +    +   + + V  +     +   A+    +R++       SS  D                         VC+ P     ++ S +  ++   +   G +IREL G        + ++ D    +     + +KVW Y         V +GHS P+  +  SPD+Q +  +S   A++ W
Sbjct:  359 LRLKGVIGFGGHGTRQALWTPDGAAVVYPCHAVIVVLLVDTGEQRFFLGHTDKVSALALDGSSSLLASAQAR---APSVMRLWDFQTGRCLCLFRSPMHVVCSLSFSDSGALLCGVGKDHHGRTMVVAWGT----------GQVGLGGEVVVLAKAHTDFDVQAFRVTFFDETRMASCGQGSVRLWRL--RGGVLRSCPVDLGEHHALQFTDLAFKQARDGCPEPSAAMLFVCSRSGHILEIDCQRMVVRHARRLLPTRTPGGPHPQKQTFSSGPGIAISSLSVSPAMCAVGSEDGFL----------------RLWPLDFSSVLLEAEHEGPVSSVCVSPDGLRVLSATSSGHLGFLDTLSRVYHMLARSHTAPVLALAMEQRRGQLATVSQDRTVRIWDLATLQQLYDFTSSEDAPCAVTFHPTRPTFFCGFSSGAVRSFSLEAAEVLVE-HTCHRGAVTGLTATPDGRLLFSSCSQGSLAQYSCADPQWHVLRVAADMVCPDAPASPSALAVSRDGRLLAFVGPSRCTVTVMGSASLDELLRVDIGTLDLASSRLDSA---------------------MAVCFGPAALGHLLVSTSSNRVVVLDAVSGRIIRELPGVHPEPCPSLTLSEDARFLLIAA-GRTIKVWDYATQASPGPQVYIGHSEPVQAVAFSPDQQQV--LSAGDAVFLW 996          
BLAST of wdr-1 vs. Ensembl Celegans
Match: pfs-2 (Polyadenylation Factor Subunit homolog [Source:UniProtKB/TrEMBL;Acc:U4PN22])

HSP 1 Score: 63.1586 bits (152), Expect = 6.216e-10
Identity = 54/233 (23.18%), Postives = 99/233 (42.49%), Query Frame = 2
Query: 1322 TINDAHKKGVTAIAATSDCRKVVSGGGEGQVRVWRIEECKVSQANTIPHSHGNRKKSNVKSVVYVAHMETAMKEHANAVSCIRMNKDDTQCVSSSADGTCIIWCLIKYTRKQIMFAN-TLFRCVCWRPDECQIITSGTD--RKIGYWEVYDGSLIRELEGSRSGSVNGMDITADGDIFVTGGDDKIVKVWKYNEGYVTHVGLGHSMPITRLRISPDRQ-LITTVSEDGAIYFW 2008
            TI  AH   + A+   S+ + ++S    G V+ W                     + N+ +    AHM +A K+   A+  +     D +  ++S DGT  +W   +YT ++++  +    RC+ W P +  I T   D  + +  W+   GS +  L+  +S SV  ++   +G+  +TGG D +VK++             H   +  L   P  + L  +   DG+I +W
Sbjct:  180 TILQAHDSAIRALKWASNEQWLLSADQGGYVKYW---------------------QPNMNN----AHMFSAHKD--EAIRGLAFAPTDVKFATASDDGTARVWDFARYTEERVLRGHGAEVRCIDWHPTKGLIATGSRDTQQPVKIWDPKSGSCLATLQEHKS-SVMAVEFNKNGNWLLTGGRDHLVKMYDIRMMKEMRTYRAHKKEVISLAWHPIHEGLFVSGGGDGSIVYW 384          
BLAST of wdr-1 vs. Ensembl Celegans
Match: sel-10 (F-box/WD repeat-containing protein sel-10 [Source:UniProtKB/Swiss-Prot;Acc:Q93794])

HSP 1 Score: 62.003 bits (149), Expect = 9.466e-10
Identity = 73/274 (26.64%), Postives = 113/274 (41.24%), Query Frame = 2
Query: 1256 IITGWDDSKIRAFYPETGALMYTINDAHKKGVTAIAATSDCRKVVSGGGEGQVRVWRIEECKV--------------SQANTIPHSHGNRKKSNVKSVVYVAHMETAMKEHANAVSCIRMNKDDTQCVSSSADGTCIIW------CLIKYTRKQIMFANTLFRCVCWRPDECQIITSGT-DRKIGYWEVY--DGSLIRELEGSRSGSVNGMDITADGDIFVTGGDDKIVKVWKYNEGYVTHVGLGHSMPITRLRISPDRQLITTVSEDGAIYFW 2008
            ++TG DD+ ++ +  + G +MYT+   H  GV     +   R +VSG  +  V+VW   +  +              + A +I  +        V  V    H+ T    HA AV C++   D T  VS   D T  IW      C+   T       + LF        E  I+ SG+ D  I  W+    +G     L    +   +GM +   G+I V+   D  V+VW  +EG   H+  GH   IT L+    R ++ T S+DG +  W
Sbjct:  267 LVTGSDDNTLKVWCIDKGEVMYTLV-GHTGGVWTSQISQCGRYIVSGSTDRTVKVWSTVDGSLLHTLQGHTSTVRCMAMAGSILVTGSRDTTLRVWDVESGRHLATLHGHHA-AVRCVQF--DGTTVVSGGYDFTVKIWNAHTGRCIRTLTGHNNRVYSLLFES------ERSIVCSGSLDTSIRVWDFTRPEGQECVALLQGHTSLTSGMQLR--GNILVSCNADSHVRVWDIHEGTCVHMLSGHRSAITSLQWF-GRNMVATSSDDGTVKLW 527          

HSP 2 Score: 51.6026 bits (122), Expect = 1.782e-6
Identity = 45/196 (22.96%), Postives = 77/196 (39.29%), Query Frame = 2
Query: 1550 NAVSCIRMNKDDTQCVSSSADGTCIIWCLIKYTRKQIMFANTLFRCVCWRPDECQ----IITSGTDRKIGYWEVYDGSLIRELEG------------------SRSGSVNGMDITA-------------------DGDIFVTGGDDKIVKVWKYNEGYVTHVGLGHSMPITRLRISPDRQLITTVSEDGAIYFWKF 2014
            + ++C++++ D    V+ S D T  +WC+ K    ++M+         W     Q    I++  TDR +  W   DGSL+  L+G                  SR  ++   D+ +                   DG   V+GG D  VK+W  + G       GH+  +  L    +R ++ + S D +I  W F
Sbjct:  255 HVITCMQIHDD--VLVTGSDDNTLKVWCIDK---GEVMYTLVGHTGGVWTSQISQCGRYIVSGSTDRTVKVWSTVDGSLLHTLQGHTSTVRCMAMAGSILVTGSRDTTLRVWDVESGRHLATLHGHHAAVRCVQFDGTTVVSGGYDFTVKIWNAHTGRCIRTLTGHNNRVYSLLFESERSIVCSGSLDTSIRVWDF 445          
BLAST of wdr-1 vs. Ensembl Celegans
Match: sel-10 (F-box/WD repeat-containing protein sel-10 [Source:UniProtKB/Swiss-Prot;Acc:Q93794])

HSP 1 Score: 62.003 bits (149), Expect = 9.466e-10
Identity = 73/274 (26.64%), Postives = 113/274 (41.24%), Query Frame = 2
Query: 1256 IITGWDDSKIRAFYPETGALMYTINDAHKKGVTAIAATSDCRKVVSGGGEGQVRVWRIEECKV--------------SQANTIPHSHGNRKKSNVKSVVYVAHMETAMKEHANAVSCIRMNKDDTQCVSSSADGTCIIW------CLIKYTRKQIMFANTLFRCVCWRPDECQIITSGT-DRKIGYWEVY--DGSLIRELEGSRSGSVNGMDITADGDIFVTGGDDKIVKVWKYNEGYVTHVGLGHSMPITRLRISPDRQLITTVSEDGAIYFW 2008
            ++TG DD+ ++ +  + G +MYT+   H  GV     +   R +VSG  +  V+VW   +  +              + A +I  +        V  V    H+ T    HA AV C++   D T  VS   D T  IW      C+   T       + LF        E  I+ SG+ D  I  W+    +G     L    +   +GM +   G+I V+   D  V+VW  +EG   H+  GH   IT L+    R ++ T S+DG +  W
Sbjct:  267 LVTGSDDNTLKVWCIDKGEVMYTLV-GHTGGVWTSQISQCGRYIVSGSTDRTVKVWSTVDGSLLHTLQGHTSTVRCMAMAGSILVTGSRDTTLRVWDVESGRHLATLHGHHA-AVRCVQF--DGTTVVSGGYDFTVKIWNAHTGRCIRTLTGHNNRVYSLLFES------ERSIVCSGSLDTSIRVWDFTRPEGQECVALLQGHTSLTSGMQLR--GNILVSCNADSHVRVWDIHEGTCVHMLSGHRSAITSLQWF-GRNMVATSSDDGTVKLW 527          

HSP 2 Score: 51.6026 bits (122), Expect = 1.782e-6
Identity = 45/196 (22.96%), Postives = 77/196 (39.29%), Query Frame = 2
Query: 1550 NAVSCIRMNKDDTQCVSSSADGTCIIWCLIKYTRKQIMFANTLFRCVCWRPDECQ----IITSGTDRKIGYWEVYDGSLIRELEG------------------SRSGSVNGMDITA-------------------DGDIFVTGGDDKIVKVWKYNEGYVTHVGLGHSMPITRLRISPDRQLITTVSEDGAIYFWKF 2014
            + ++C++++ D    V+ S D T  +WC+ K    ++M+         W     Q    I++  TDR +  W   DGSL+  L+G                  SR  ++   D+ +                   DG   V+GG D  VK+W  + G       GH+  +  L    +R ++ + S D +I  W F
Sbjct:  255 HVITCMQIHDD--VLVTGSDDNTLKVWCIDK---GEVMYTLVGHTGGVWTSQISQCGRYIVSGSTDRTVKVWSTVDGSLLHTLQGHTSTVRCMAMAGSILVTGSRDTTLRVWDVESGRHLATLHGHHAAVRCVQFDGTTVVSGGYDFTVKIWNAHTGRCIRTLTGHNNRVYSLLFESERSIVCSGSLDTSIRVWDF 445          
BLAST of wdr-1 vs. Ensembl Celegans
Match: sel-10 (F-box/WD repeat-containing protein sel-10 [Source:UniProtKB/Swiss-Prot;Acc:Q93794])

HSP 1 Score: 62.003 bits (149), Expect = 9.571e-10
Identity = 73/274 (26.64%), Postives = 113/274 (41.24%), Query Frame = 2
Query: 1256 IITGWDDSKIRAFYPETGALMYTINDAHKKGVTAIAATSDCRKVVSGGGEGQVRVWRIEECKV--------------SQANTIPHSHGNRKKSNVKSVVYVAHMETAMKEHANAVSCIRMNKDDTQCVSSSADGTCIIW------CLIKYTRKQIMFANTLFRCVCWRPDECQIITSGT-DRKIGYWEVY--DGSLIRELEGSRSGSVNGMDITADGDIFVTGGDDKIVKVWKYNEGYVTHVGLGHSMPITRLRISPDRQLITTVSEDGAIYFW 2008
            ++TG DD+ ++ +  + G +MYT+   H  GV     +   R +VSG  +  V+VW   +  +              + A +I  +        V  V    H+ T    HA AV C++   D T  VS   D T  IW      C+   T       + LF        E  I+ SG+ D  I  W+    +G     L    +   +GM +   G+I V+   D  V+VW  +EG   H+  GH   IT L+    R ++ T S+DG +  W
Sbjct:  269 LVTGSDDNTLKVWCIDKGEVMYTLV-GHTGGVWTSQISQCGRYIVSGSTDRTVKVWSTVDGSLLHTLQGHTSTVRCMAMAGSILVTGSRDTTLRVWDVESGRHLATLHGHHA-AVRCVQF--DGTTVVSGGYDFTVKIWNAHTGRCIRTLTGHNNRVYSLLFES------ERSIVCSGSLDTSIRVWDFTRPEGQECVALLQGHTSLTSGMQLR--GNILVSCNADSHVRVWDIHEGTCVHMLSGHRSAITSLQWF-GRNMVATSSDDGTVKLW 529          

HSP 2 Score: 51.6026 bits (122), Expect = 1.770e-6
Identity = 45/196 (22.96%), Postives = 77/196 (39.29%), Query Frame = 2
Query: 1550 NAVSCIRMNKDDTQCVSSSADGTCIIWCLIKYTRKQIMFANTLFRCVCWRPDECQ----IITSGTDRKIGYWEVYDGSLIRELEG------------------SRSGSVNGMDITA-------------------DGDIFVTGGDDKIVKVWKYNEGYVTHVGLGHSMPITRLRISPDRQLITTVSEDGAIYFWKF 2014
            + ++C++++ D    V+ S D T  +WC+ K    ++M+         W     Q    I++  TDR +  W   DGSL+  L+G                  SR  ++   D+ +                   DG   V+GG D  VK+W  + G       GH+  +  L    +R ++ + S D +I  W F
Sbjct:  257 HVITCMQIHDD--VLVTGSDDNTLKVWCIDK---GEVMYTLVGHTGGVWTSQISQCGRYIVSGSTDRTVKVWSTVDGSLLHTLQGHTSTVRCMAMAGSILVTGSRDTTLRVWDVESGRHLATLHGHHAAVRCVQFDGTTVVSGGYDFTVKIWNAHTGRCIRTLTGHNNRVYSLLFESERSIVCSGSLDTSIRVWDF 447          
BLAST of wdr-1 vs. Ensembl Celegans
Match: smu-1 (Smu-1 suppressor of mec-8 and unc-52 protein [Source:UniProtKB/Swiss-Prot;Acc:G5EEG7])

HSP 1 Score: 60.8474 bits (146), Expect = 2.160e-9
Identity = 42/155 (27.10%), Postives = 67/155 (43.23%), Query Frame = 2
Query: 1571 MNKDDTQCVSSSADGTCIIWCL--------IKY-TRKQIMFANTLFRCVCWRPDECQIITSGTDRKIGYWEVYDGSLIRELEGSRSGSVNGMDITADGDIFVTGGDDKIVKVWKYNEGYVTHVGLGHSMPITRLRISPDRQLITTVSEDGAIYFW 2008
             + D    VS S DG   +W          +KY  +  +M  +   RC+ +  D   + T   D KI  W+V  G  +R  + + +  V  +  + D    ++GG+D +V+V     G       GHS  IT +R S +   I + S DG+I  W
Sbjct:  222 FSPDANYLVSGSKDGFIEVWNYMNGKLRKDLKYQAQDNLMMMDAAVRCISFSRDSEMLATGSIDGKIKVWKVETGDCLRRFDRAHTKGVCAVRFSKDNSHILSGGNDHVVRVHGMKSGKCLKEMRGHSSYITDVRYSDEGNHIISCSTDGSIRVW 376          
BLAST of wdr-1 vs. Ensembl Fly
Match: CG10064 (gene:FBgn0035724 transcript:FBtr0076937)

HSP 1 Score: 391.349 bits (1004), Expect = 2.185e-125
Identity = 221/665 (33.23%), Postives = 351/665 (52.78%), Query Frame = 2
Query:  113 VIGFNGTILDGLHVHPDRQHIIYGLGCTVVIEDLNTKNQCFLQGHTNNVVCITVSNSGKYIASGQITHMGYKADIMLWDYVTKQCVSTFSLHKVKVQSLAFSPNEKYLASLGGQDDGCVVIWSLTKMEPICGSPAQHKSAGITECLVYSNTNDDVFVTAGENTLRVWELDVENRKIRPTECSLGAIKRSIKCITISKDDSVFFCGTSSGDILGVNMK-------------SCLLSCIG---PEKET------FSLGVLSIIRLINGDLIVGAGDGTI------CQVKVVEKKEGNKIMPKIVKTSNSCMLVGGVSSITLRGQGHQFYAGTEKSHIYRFSLGDFKSELINTAHYSAVNDIVYPNNCPKLFVTCSFQDVRVFHSDSQKELLRINIPNMTCYTCDIFKDGTAIITGWDDSKIRAFYPETGALMYTINDAHKKGVTAIAATSDCRKVVSGGGEGQVRVWRIEECKVSQANTIPHSHGNRKKSNVKSVVYVAHMETAMKEHANAVSCIRMNKDDTQCVSSSADGTCIIWCLIKYTRKQIMFANTLFRCVCWRPDECQIITSGTDRKIGYWEVYDGSLIRELEGSRSGSVNGMDITADGDIFVTGGDDKIVKVWKYNEGYVTHVGLGHSMPITRLRISPDRQLITTVSEDGAIYFWKFPNN 2023
            + G NG + +G+  HP    II+ LG  + I D     Q F+ GHTN + C+ +S SGKY+ASGQI HMG++  +++W+Y  ++ ++   LHKV VQ++ F+  ++ + S+GG DDG V+++ +    PIC +PA    +G    +   + N   FVTAG+  LR+W +  E +K+   +  + +  R   C  I+K D   + GT +GDI+ + +              SC+L   G   P K T      +  GV ++  L  G L++GAG+G I        V ++  ++        ++T     + G +SS  +R +   FY  T+ + IY  ++  +  +L+ T H  +V  I +P N   +F T   + +R++ S  ++ELLRI + N  C       DGT+I++ W+D  IRAF P TG L+Y I +AH KG +A+A  S  R +V+GG EGQVRVW+I+                          Y   +   +K+H+  ++ + +N  DT+ +S+  DG+C+IW + + TRKQ++ ANT F    + P   Q+IT G+D +I YW VY+G+LIREL  S+  SVN + I   GD F+T G D  VK+W YN G V  +G  H+  +     SP   +  T S DG++  W  P +
Sbjct:   16 IFGINGKVENGVRQHPVTGSIIFALGNKIGIADYKKNTQEFVAGHTNTISCLDLSKSGKYMASGQINHMGFRGYVIIWNYDQRKEIARHDLHKVSVQAICFTAQDRCVVSIGGVDDGSVIVFDMEAFSPICQTPASRAISGNALTVRPLHNNPYFFVTAGDRHLRLWSILREEKKLYVQDVLMASKTRVFYCARINKTDEFAYLGTGTGDIVKIVLNCCDRDHVSKQGSTSCILGAFGTHNPRKPTGRDCNRYVNGVRALYVLEGGRLLIGAGNGDIELVEERTDVPLINFRDYPGPTWPYLRTLKKTHVSGRISSF-VRSKTDMFYICTDTNEIYGLNIKTWVLKLLRTCHTKSVYCITFPKNYSGVFATSGKECIRIWSSGRKQELLRIMVYNFNCACVRFTHDGTSIVSVWNDGIIRAFTPITGRLIYAIPNAHNKGCSALAVASSGRLIVTGGIEGQVRVWKIDP-------------------------YRQDLVGVLKDHSGPITSLDINYLDTEVISACTDGSCVIWDIKRMTRKQVVTANTQFMSASYFPTGVQVITCGSDGRIIYWMVYNGALIRELTASKKSSVNCLAINETGDYFITVGSDLQVKLWDYNSGAVVGIGSEHASSVISCAYSPCMTMFVTGSTDGSLIIWDVPRD 654          
BLAST of wdr-1 vs. Ensembl Fly
Match: Poc1 (gene:FBgn0036354 transcript:FBtr0075863)

HSP 1 Score: 65.4698 bits (158), Expect = 6.054e-11
Identity = 42/164 (25.61%), Postives = 74/164 (45.12%), Query Frame = 2
Query: 1523 METAMKEHANAVSCIRMNKDDTQCVSSSADGTCIIWCLIKYTRKQIMFAN--TLFRCVCWRPDECQIITSGTDRKIGYWEVYDGSLIRELEG---SRSGSVNGMDITADGDIFVTGGDDKIVKVWKYNEGYVTHVGLGHSMPITRLRISPDRQLITTVSEDGAI 1999
            +E     H+  ++ +R   D  Q  +SS D T I+W L +  R  I FA+       V W P    + ++G DR +  WE      +R + G   + S +V  +D  + G + +T  DDK  K+W+             +  +   + SP+ +L+ T S+D ++
Sbjct:   10 LERHFTGHSGGITQLRFGPDGAQIATSSTDSTVILWNLNQAARC-IRFASHSAPVNGVAWSPKGNLVASAGHDRTVKIWE----PKLRGVSGEFVAHSKAVRSVDFDSTGHLMLTASDDKSAKIWRVARRQFVSSFAQQNNWVRSAKFSPNGKLVATASDDKSV 168          
BLAST of wdr-1 vs. Ensembl Fly
Match: CG3909 (gene:FBgn0027524 transcript:FBtr0082172)

HSP 1 Score: 65.0846 bits (157), Expect = 6.663e-11
Identity = 52/209 (24.88%), Postives = 86/209 (41.15%), Query Frame = 2
Query: 1385 VVSGGGEGQVRVWRIEECKVSQANTIPHSHGNRKKSNVKSVVYVAHMETAMKEHANAVSCIRMNKDDTQCVSSSADGTCIIWCLIKYTRKQIM-FANTLFRCVCWRPDECQIITSGTDRKIGYWEVYDGSLIRELEGSRSGSVNGMDITADGDIFVTGGDDKIVKVWKYNEGYVTHVGLGHSMPITRLRISPDRQLITTVSEDGAIYFW 2008
            +V+GG +  V+VW ++E      NT+   H                    +K HA  V  + ++ D     SSS D T  +W      +K ++ F       V + P    +I+   D KI  + V  G   + L+         +  + DG    +G  D I+ ++    G V     GH+MP+  L  SP+ QL+ T S+DG +  +
Sbjct:   55 LVTGGLDDLVKVWDLQE-----DNTLKLRH-------------------KLKGHALGVVSVAVSSDGQTIASSSLDSTMCLWDARSGDKKHLLSFGPVDLWTVQFSPCNKYVISGLNDGKISMYSVETGKAEQTLDAQNGKYTLSIAYSPDGKYIASGAIDGIITIFDVAAGKVVQTLEGHAMPVRSLCFSPNSQLLLTASDDGHMKLY 239          
BLAST of wdr-1 vs. Ensembl Fly
Match: Poc1 (gene:FBgn0036354 transcript:FBtr0321318)

HSP 1 Score: 64.3142 bits (155), Expect = 1.560e-10
Identity = 42/167 (25.15%), Postives = 75/167 (44.91%), Query Frame = 2
Query: 1523 METAMKEHANAVSCIRMNKDDTQCVSSSADGTCIIWCLIKYTRKQIMFAN--TLFRCVCWRPDECQIITSGTDRKIGYWEVYDGSLIRELEG---SRSGSVNGMDITADGDIFVTGGDDKIVKVWKYNEGYVTHVGLGHSMPITRLRISPDRQLITTVSEDGAIYFW 2008
            +E     H+  ++ +R   D  Q  +SS D T I+W L +  R  I FA+       V W P    + ++G DR +  WE      +R + G   + S +V  +D  + G + +T  DDK  K+W+             +  +   + SP+ +L+ T S+D ++  +
Sbjct:   10 LERHFTGHSGGITQLRFGPDGAQIATSSTDSTVILWNLNQAARC-IRFASHSAPVNGVAWSPKGNLVASAGHDRTVKIWEPK----LRGVSGEFVAHSKAVRSVDFDSTGHLMLTASDDKSAKIWRVARRQFVSSFAQQNNWVRSAKFSPNGKLVATASDDKSVRIY 171          
BLAST of wdr-1 vs. Ensembl Fly
Match: wds (gene:FBgn0040066 transcript:FBtr0308566)

HSP 1 Score: 63.1586 bits (152), Expect = 3.076e-10
Identity = 66/272 (24.26%), Postives = 108/272 (39.71%), Query Frame = 2
Query: 1274 DSKIRAFYPETGALMYTINDAHKKGVTAIAATSDCRKVVSGGGEGQVRVWRIEECKVSQA-----------NTIPHSHGNRKKSNVKSV----VYVAHMETAMKEHANAVSCIRMNKDDTQCVSSSADGTCIIW------CLIKYTRKQIMFANTLFRCVCWRPDECQIITSGTDRKIGYWEVYDGSLIRELEGSRSGS---VNGMDITADGDIFVTGGDDKIVKVWKYNEGYVTHVGLGHSMPITRLRISPDRQLITTVS--EDGAIYFWK 2011
            D  I+ +    G    TI+  HK G++ +A +SD R +VSG  +  ++VW +   K  +            N  P S+     S  +SV    V        +  H++ VS +  N+D +  VSSS DG C IW      CL    +  I   N     V + P+   I+ +  D  +  W+   G  ++   G ++          +T  G   V+G +D +V +W      V     GH+  +      P   +I + +   D  I  WK
Sbjct:   93 DKLIKIWGAYDGKFEKTIS-GHKLGISDVAWSSDSRLLVSGSDDKTLKVWELSTGKSLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVRTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCL----KTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTG-GKWIVSGSEDNMVYIWNLQSKEVVQKLQGHTDTVLCTACHPTENIIASAALENDKTIKLWK 358          

HSP 2 Score: 59.6918 bits (143), Expect = 4.096e-9
Identity = 39/163 (23.93%), Postives = 71/163 (43.56%), Query Frame = 2
Query: 1523 METAMKEHANAVSCIRMNKDDTQCVSSSADGTCIIWCLIKYTRKQIMFANTL-FRCVCWRPDECQIITSGTDRKIGYWEVYDGSLIRELEGSRSGSVNGMDITADGDIFVTGGDDKIVKVWKYNEGYVTHVGLGHSMPITRLRISPDRQLITTVSEDGAIYFW 2008
            ++  +  H  AVS ++ + +     SSSAD    IW       ++ +  + L    V W  D   +++   D+ +  WE+  G  ++ L+G  S  V   +     ++ V+G  D+ V++W    G        HS P++ +  + D  LI + S DG    W
Sbjct:   64 LKFTLAGHTKAVSAVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSRLLVSGSDDKTLKVWELSTGKSLKTLKG-HSNYVFCCNFNPQSNLIVSGSFDESVRIWDVRTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIW 225          

HSP 3 Score: 54.299 bits (129), Expect = 2.255e-7
Identity = 34/123 (27.64%), Postives = 59/123 (47.97%), Query Frame = 2
Query: 1643 YTRKQIMFANT-LFRCVCWRPDECQIITSGTDRKIGYWEVYDGSLIRELEGSRSGSVNGMDITADGDIFVTGGDDKIVKVWKYNEGYVTHVGLGHSMPITRLRISPDRQLITTVSEDGAIYFW 2008
            YT K  +  +T     V + P+   + +S  D+ I  W  YDG   + + G + G ++ +  ++D  + V+G DDK +KVW+ + G       GHS  +     +P   LI + S D ++  W
Sbjct:   62 YTLKFTLAGHTKAVSAVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLG-ISDVAWSSDSRLLVSGSDDKTLKVWELSTGKSLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIW 183          

HSP 4 Score: 50.447 bits (119), Expect = 3.454e-6
Identity = 37/172 (21.51%), Postives = 71/172 (41.28%), Query Frame = 2
Query: 1508 VYVAHMETAMKEHANAVSCIRMNKDDTQCVSSSADGTCIIWCLI--KYTRKQIMFANTLFRCVCWRPDECQIITSGTDRKIGYWEVYDGSLIRELEGSRSGSVNGMDITADGDIFVTGGDDKIVKVWKYNEGYVTHVGLGH-SMPITRLRISPDRQLITTVSEDGAIYFWKF 2014
             Y    E  +  H   +S +  + D    VS S D T  +W L   K  +     +N +F C  + P    I++   D  +  W+V  G  ++ L  + S  V+ +    DG + V+   D + ++W    G      +   + P++ ++ SP+ + I   + D  +  W +
Sbjct:  101 AYDGKFEKTISGHKLGISDVAWSSDSRLLVSGSDDKTLKVWELSTGKSLKTLKGHSNYVF-CCNFNPQSNLIVSGSFDESVRIWDVRTGKCLKTLP-AHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDY 270          
BLAST of wdr-1 vs. Ensembl Zebrafish
Match: cfap52 (cilia and flagella associated protein 52 [Source:ZFIN;Acc:ZDB-GENE-050522-296])

HSP 1 Score: 715.301 bits (1845), Expect = 0.000e+0
Identity = 343/652 (52.61%), Postives = 447/652 (68.56%), Query Frame = 2
Query:   71 GEEVNEINKLELINVIGFNGTILDGLHVHPDRQHIIYGLGCTVVIEDLNTKNQCFLQGHTNNVVCITVSNSGKYIASGQITHMGYKADIMLWDYVTKQCVSTFSLHKVKVQSLAFSPNEKYLASLGGQDDGCVVIWSLTKMEPICGSPAQHKSAGITECLVYSNTNDDVFVTAGENTLRVWELDVENRKIRPTECSLGAIKRSIKCITISKDDSVFFCGTSSGDILGVNMKSCLLSCIGPEKETFSLGVLSIIRLINGDLIVGAGDG--TICQVKVVEKKEGNKIMPKIVKTSNSCMLVGGVSSITLRGQGHQFYAGTEKSHIYRFSLGDFKSELINTAHYSAVNDIVYPNNCPKLFVTCSFQDVRVFHSDSQKELLRINIPNMTCYTCDIFKDGTAIITGWDDSKIRAFYPETGALMYTINDAHKKGVTAIAATSDCRKVVSGGGEGQVRVWRIEECKVSQANTIPHSHGNRKKSNVKSVVYVAHMETAMKEHANAVSCIRMNKDDTQCVSSSADGTCIIWCLIKYTRKQIMFANTLFRCVCWRPDECQIITSGTDRKIGYWEVYDGSLIRELEGSRSGSVNGMDITADGDIFVTGGDDKIVKVWKYNEGYVTHVGLGHSMPITRLRISPDRQLITTVSEDGAIYFWKFPN 2020
             E+  E+ +L L  VIGFNG +  GL VHPD++H+IY LGCTV+I+ L +  Q FL GHTNNV CI+VS SG+YIASGQ+T MG+KAD+++WDY  K+  +   LHK KV+ L+FSPN+KYL SLGGQDD  +V+W++   E ICGSPA  +SAG    L Y+N +D++FV+AG  TLRVWELD+ NRKIRPTEC  G +KR +KC+ I  DD+ F+CGT+SGDIL VN+K+ LL+  GP K+ FS GV ++  L  GD++VG+GDG  T+C                  KT  S  L GGV+S+TLRG GHQFY GTE + +Y  S  DFK EL  T H SAV D+ +P    +LF TCS  D+RV+HS+S KELLRI +PN+TC+     +DG +I + W+D KIR F PE+G L   I++AH   VT IAAT+DC+++VSGGGEGQVRVW I +       T                         MKEH   V+CI++  +D +CV++S+DG CIIW L+++ R Q++ +NTLF  VC+ P+E QIITSGTDRKIGYWEVYDGS IRELEGS SGS+NGM I+ DG  FVTGGDDK++K+W Y++G VTHVG+GHS  IT +RI P+ + I + S DGAI  W++P 
Sbjct:    2 AEDTQEVPQLALEAVIGFNGHVFSGLKVHPDKEHLIYPLGCTVIIKSLRSGKQSFLHGHTNNVSCISVSKSGRYIASGQVTFMGFKADVIIWDYEKKEIYARLLLHKAKVEDLSFSPNDKYLVSLGGQDDASIVVWNIESKEAICGSPASAQSAGHCLALEYTNLSDEIFVSAGNGTLRVWELDLLNRKIRPTECQTGQLKRIVKCLEIPNDDNYFYCGTTSGDILKVNLKTRLLNSCGPVKQKFSKGVNTLKVLKTGDILVGSGDGMLTLCS-------------GANFKTIKSVQLEGGVTSVTLRGDGHQFYVGTEAAQMYSLSYTDFKPELTATNHNSAVKDVAFPFGTSELFATCSHNDIRVWHSESSKELLRITVPNITCHALGFMRDGRSIFSAWNDGKIRVFTPESGKLKLIIHNAHSMAVTTIAATNDCKRIVSGGGEGQVRVWEIFQDSYRLIET-------------------------MKEHKATVNCIKIKSNDKECVTASSDGACIIWDLVRFVRNQMVLSNTLFSVVCYHPEEYQIITSGTDRKIGYWEVYDGSAIRELEGSLSGSINGMHISEDGKYFVTGGDDKLLKLWLYSDGEVTHVGIGHSGSITNVRICPNSRYIVSTSADGAILRWRYPQ 615          
BLAST of wdr-1 vs. Ensembl Zebrafish
Match: cfap52 (cilia and flagella associated protein 52 [Source:ZFIN;Acc:ZDB-GENE-050522-296])

HSP 1 Score: 712.99 bits (1839), Expect = 0.000e+0
Identity = 342/652 (52.45%), Postives = 447/652 (68.56%), Query Frame = 2
Query:   71 GEEVNEINKLELINVIGFNGTILDGLHVHPDRQHIIYGLGCTVVIEDLNTKNQCFLQGHTNNVVCITVSNSGKYIASGQITHMGYKADIMLWDYVTKQCVSTFSLHKVKVQSLAFSPNEKYLASLGGQDDGCVVIWSLTKMEPICGSPAQHKSAGITECLVYSNTNDDVFVTAGENTLRVWELDVENRKIRPTECSLGAIKRSIKCITISKDDSVFFCGTSSGDILGVNMKSCLLSCIGPEKETFSLGVLSIIRLINGDLIVGAGDG--TICQVKVVEKKEGNKIMPKIVKTSNSCMLVGGVSSITLRGQGHQFYAGTEKSHIYRFSLGDFKSELINTAHYSAVNDIVYPNNCPKLFVTCSFQDVRVFHSDSQKELLRINIPNMTCYTCDIFKDGTAIITGWDDSKIRAFYPETGALMYTINDAHKKGVTAIAATSDCRKVVSGGGEGQVRVWRIEECKVSQANTIPHSHGNRKKSNVKSVVYVAHMETAMKEHANAVSCIRMNKDDTQCVSSSADGTCIIWCLIKYTRKQIMFANTLFRCVCWRPDECQIITSGTDRKIGYWEVYDGSLIRELEGSRSGSVNGMDITADGDIFVTGGDDKIVKVWKYNEGYVTHVGLGHSMPITRLRISPDRQLITTVSEDGAIYFWKFPN 2020
             ++  E+ +L L  VIGFNG +  GL VHPD++H+IY LGCTV+I+ L +  Q FL GHTNNV CI+VS SG+YIASGQ+T MG+KAD+++WDY  K+  +   LHK KV+ L+FSPN+KYL SLGGQDD  +V+W++   E ICGSPA  +SAG    L Y+N +D++FV+AG  TLRVWELD+ NRKIRPTEC  G +KR +KC+ I  DD+ F+CGT+SGDIL VN+K+ LL+  GP K+ FS GV ++  L  GD++VG+GDG  T+C                  KT  S  L GGV+S+TLRG GHQFY GTE + +Y  S  DFK EL  T H SAV D+ +P    +LF TCS  D+RV+HS+S KELLRI +PN+TC+     +DG +I + W+D KIR F PE+G L   I++AH   VT IAAT+DC+++VSGGGEGQVRVW I +       T                         MKEH   V+CI++  +D +CV++S+DG CIIW L+++ R Q++ +NTLF  VC+ P+E QIITSGTDRKIGYWEVYDGS IRELEGS SGS+NGM I+ DG  FVTGGDDK++K+W Y++G VTHVG+GHS  IT +RI P+ + I + S DGAI  W++P 
Sbjct:    2 ADDTQEVPQLALEAVIGFNGHVFSGLKVHPDKEHLIYPLGCTVIIKSLRSGKQSFLHGHTNNVSCISVSKSGRYIASGQVTFMGFKADVIIWDYEKKEIYARLLLHKAKVEDLSFSPNDKYLVSLGGQDDASIVVWNIESKEAICGSPASAQSAGHCLALEYTNLSDEIFVSAGNGTLRVWELDLLNRKIRPTECQTGQLKRIVKCLEIPNDDNYFYCGTTSGDILKVNLKTRLLNSCGPVKQKFSKGVNTLKVLKTGDILVGSGDGMLTLCS-------------GANFKTIKSVQLEGGVTSVTLRGDGHQFYVGTEAAQMYSLSYTDFKPELTATNHNSAVKDVAFPFGTSELFATCSHNDIRVWHSESSKELLRITVPNITCHALGFMRDGRSIFSAWNDGKIRVFTPESGKLKLIIHNAHSMAVTTIAATNDCKRIVSGGGEGQVRVWEIFQDSYRLIET-------------------------MKEHKATVNCIKIKSNDKECVTASSDGACIIWDLVRFVRNQMVLSNTLFSVVCYHPEEYQIITSGTDRKIGYWEVYDGSAIRELEGSLSGSINGMHISEDGKYFVTGGDDKLLKLWLYSDGEVTHVGIGHSGSITNVRICPNSRYIVSTSADGAILRWRYPQ 615          
BLAST of wdr-1 vs. Ensembl Zebrafish
Match: cfap52 (cilia and flagella associated protein 52 [Source:ZFIN;Acc:ZDB-GENE-050522-296])

HSP 1 Score: 712.99 bits (1839), Expect = 0.000e+0
Identity = 342/652 (52.45%), Postives = 447/652 (68.56%), Query Frame = 2
Query:   71 GEEVNEINKLELINVIGFNGTILDGLHVHPDRQHIIYGLGCTVVIEDLNTKNQCFLQGHTNNVVCITVSNSGKYIASGQITHMGYKADIMLWDYVTKQCVSTFSLHKVKVQSLAFSPNEKYLASLGGQDDGCVVIWSLTKMEPICGSPAQHKSAGITECLVYSNTNDDVFVTAGENTLRVWELDVENRKIRPTECSLGAIKRSIKCITISKDDSVFFCGTSSGDILGVNMKSCLLSCIGPEKETFSLGVLSIIRLINGDLIVGAGDG--TICQVKVVEKKEGNKIMPKIVKTSNSCMLVGGVSSITLRGQGHQFYAGTEKSHIYRFSLGDFKSELINTAHYSAVNDIVYPNNCPKLFVTCSFQDVRVFHSDSQKELLRINIPNMTCYTCDIFKDGTAIITGWDDSKIRAFYPETGALMYTINDAHKKGVTAIAATSDCRKVVSGGGEGQVRVWRIEECKVSQANTIPHSHGNRKKSNVKSVVYVAHMETAMKEHANAVSCIRMNKDDTQCVSSSADGTCIIWCLIKYTRKQIMFANTLFRCVCWRPDECQIITSGTDRKIGYWEVYDGSLIRELEGSRSGSVNGMDITADGDIFVTGGDDKIVKVWKYNEGYVTHVGLGHSMPITRLRISPDRQLITTVSEDGAIYFWKFPN 2020
             ++  E+ +L L  VIGFNG +  GL VHPD++H+IY LGCTV+I+ L +  Q FL GHTNNV CI+VS SG+YIASGQ+T MG+KAD+++WDY  K+  +   LHK KV+ L+FSPN+KYL SLGGQDD  +V+W++   E ICGSPA  +SAG    L Y+N +D++FV+AG  TLRVWELD+ NRKIRPTEC  G +KR +KC+ I  DD+ F+CGT+SGDIL VN+K+ LL+  GP K+ FS GV ++  L  GD++VG+GDG  T+C                  KT  S  L GGV+S+TLRG GHQFY GTE + +Y  S  DFK EL  T H SAV D+ +P    +LF TCS  D+RV+HS+S KELLRI +PN+TC+     +DG +I + W+D KIR F PE+G L   I++AH   VT IAAT+DC+++VSGGGEGQVRVW I +       T                         MKEH   V+CI++  +D +CV++S+DG CIIW L+++ R Q++ +NTLF  VC+ P+E QIITSGTDRKIGYWEVYDGS IRELEGS SGS+NGM I+ DG  FVTGGDDK++K+W Y++G VTHVG+GHS  IT +RI P+ + I + S DGAI  W++P 
Sbjct:    2 ADDTQEVPQLALEAVIGFNGHVFSGLKVHPDKEHLIYPLGCTVIIKSLRSGKQSFLHGHTNNVSCISVSKSGRYIASGQVTFMGFKADVIIWDYEKKEIYARLLLHKAKVEDLSFSPNDKYLVSLGGQDDASIVVWNIESKEAICGSPASAQSAGHCLALEYTNLSDEIFVSAGNGTLRVWELDLLNRKIRPTECQTGQLKRIVKCLEIPNDDNYFYCGTTSGDILKVNLKTRLLNSCGPVKQKFSKGVNTLKVLKTGDILVGSGDGMLTLCS-------------GANFKTIKSVQLEGGVTSVTLRGDGHQFYVGTEAAQMYSLSYTDFKPELTATNHNSAVKDVAFPFGTSELFATCSHNDIRVWHSESSKELLRITVPNITCHALGFMRDGRSIFSAWNDGKIRVFTPESGKLKLIIHNAHSMAVTTIAATNDCKRIVSGGGEGQVRVWEIFQDSYRLIET-------------------------MKEHKATVNCIKIKSNDKECVTASSDGACIIWDLVRFVRNQMVLSNTLFSVVCYHPEEYQIITSGTDRKIGYWEVYDGSAIRELEGSLSGSINGMHISEDGKYFVTGGDDKLLKLWLYSDGEVTHVGIGHSGSITNVRICPNSRYIVSTSADGAILRWRYPQ 615          
BLAST of wdr-1 vs. Ensembl Zebrafish
Match: mapkbp1 (mitogen-activated protein kinase binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-120207-1])

HSP 1 Score: 80.4925 bits (197), Expect = 5.425e-15
Identity = 76/290 (26.21%), Postives = 125/290 (43.10%), Query Frame = 2
Query:   56 KLRMS---GEEVNEINKLELINVIGFNGTILDGLHVHPDRQHIIYGLGCTVVI-EDLNTKNQCFLQGHTNNVVCITVSNSGKYIASGQITHMGYKADIMLWDYVTKQCVSTFSLHKVKVQSLAFSPNEKYLASLGGQDDGCVVIWSLTKMEPICGSPAQHKSAGITECLVYSNTNDDVFVTAGENTLRVWELD-VENRKIRPT------ECSLGAIKRS----IKCITISKDDSVFFCGTSSGDILGVNMKSCLLSCIGPEK-ETFSLGVLSIIRLINGDLIVGAGDGTI 877
            KLR S     + N  NK+ L  V+G        L   P    I Y  GC VV+      K    +      +  ++ S  GKY+ +G+  HM     + +WD   +  V+    HK  V  ++FSPN KY+ S+G Q D  V +W+  K   +  +    K   ++    +S+ +   FVTAG   ++ W LD  ++ K+  T         LG ++ +    + C    K  S  FC T+SG +   N K  L   +   K ++F+  + + + +    +  G  DGT+
Sbjct:   22 KLRRSKAGNNKENLSNKVTLEKVLGITSAGSRALACDPHSGLIAYPAGCVVVLLNPKKNKQHHIINSSRKTITTVSFSPDGKYVVTGESGHMPA---VRVWDVAERTQVAELQEHKYGVACVSFSPNSKYIVSVGYQHDMIVNVWAWKKNVVVAANKVSSKVTAVS----FSD-DSSYFVTAGNRHVKFWYLDHTKSSKVNATVPLSGRSGLLGELRNNFFSDVACGKGRKASST-FCITTSGLLCEFNDKRMLDKWVELRKNDSFATSMATSLSVCEDLIFCGCADGTV 302          
BLAST of wdr-1 vs. Ensembl Zebrafish
Match: mapkbp1 (mitogen-activated protein kinase binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-120207-1])

HSP 1 Score: 80.1073 bits (196), Expect = 7.212e-15
Identity = 76/290 (26.21%), Postives = 125/290 (43.10%), Query Frame = 2
Query:   56 KLRMS---GEEVNEINKLELINVIGFNGTILDGLHVHPDRQHIIYGLGCTVVI-EDLNTKNQCFLQGHTNNVVCITVSNSGKYIASGQITHMGYKADIMLWDYVTKQCVSTFSLHKVKVQSLAFSPNEKYLASLGGQDDGCVVIWSLTKMEPICGSPAQHKSAGITECLVYSNTNDDVFVTAGENTLRVWELD-VENRKIRPT------ECSLGAIKRS----IKCITISKDDSVFFCGTSSGDILGVNMKSCLLSCIGPEK-ETFSLGVLSIIRLINGDLIVGAGDGTI 877
            KLR S     + N  NK+ L  V+G        L   P    I Y  GC VV+      K    +      +  ++ S  GKY+ +G+  HM     + +WD   +  V+    HK  V  ++FSPN KY+ S+G Q D  V +W+  K   +  +    K   ++    +S+ +   FVTAG   ++ W LD  ++ K+  T         LG ++ +    + C    K  S  FC T+SG +   N K  L   +   K ++F+  + + + +    +  G  DGT+
Sbjct:   22 KLRRSKAGNNKENLSNKVTLEKVLGITSAGSRALACDPHSGLIAYPAGCVVVLLNPKKNKQHHIINSSRKTITTVSFSPDGKYVVTGESGHMPA---VRVWDVAERTQVAELQEHKYGVACVSFSPNSKYIVSVGYQHDMIVNVWAWKKNVVVAANKVSSKVTAVS----FSD-DSSYFVTAGNRHVKFWYLDHTKSSKVNATVPLSGRSGLLGELRNNFFSDVACGKGRKASST-FCITTSGLLCEFNDKRMLDKWVELRKNDSFATSMATSLSVCEDLIFCGCADGTV 302          
BLAST of wdr-1 vs. Ensembl Xenopus
Match: gucy1a2 (guanylate cyclase 1, soluble, alpha 2 [Source:Xenbase;Acc:XB-GENE-1011801])

HSP 1 Score: 738.413 bits (1905), Expect = 0.000e+0
Identity = 348/652 (53.37%), Postives = 463/652 (71.01%), Query Frame = 2
Query:   77 EVNEINKLELINVIGFNGTILDGLHVHPDRQHIIYGLGCTVVIEDLNTKNQCFLQGHTNNVVCITVSNSGKYIASGQITHMGYKADIMLWDYVTKQCVSTFSLHKVKVQSLAFSPNEKYLASLGGQDDGCVVIWSLTKMEPICGSPAQHKSAGITECLVYSNTNDDVFVTAGENTLRVWELDVENRKIRPTECSLGAIKRSIKCITISK-----DDSVFFCGTSSGDILGVNMKSCLLSCIGPEKETFSLGVLSIIRLINGDLIVGAGDGTICQVKVVEKKEGNKIMPKIVKTSNSCMLVGGVSSITLRGQGHQFYAGTEKSHIYRFSLGDFKSELINTAHYSAVNDIVYPNNCPKLFVTCSFQDVRVFHSDSQKELLRINIPNMTCYTCDIFKDGTAIITGWDDSKIRAFYPETGALMYTINDAHKKGVTAIAATSDCRKVVSGGGEGQVRVWRIEECKVSQANTIPHSHGNRKKSNVKSVVYVAHMETAMKEHANAVSCIRMNKDDTQCVSSSADGTCIIWCLIKYTRKQIMFANTLFRCVCWRPDECQIITSGTDRKIGYWEVYDGSLIRELEGSRSGSVNGMDITADGDIFVTGGDDKIVKVWKYNEGYVTHVGLGHSMPITRLRISPDRQLITTVSEDGAIYFWKFP 2017
            E  E N+LEL  +IGFNG +  GL  HPDR+H+IY LGCTV+IE+L+++ Q FLQGHTNNV C+  S SG+Y+ASGQ+T+MG+KADI+LWDY  ++  +  +LHKVKV++LAFSPN+ YL SLGGQDDG VV+W++ K E ICGSPA   S+G    ++++N +DD+F+T G  TLRVW++D+ NRK+RPTEC LG +KR + C+ ++      DDS F+CGTSSGDIL +N KS LLS   P+K  FSLGV ++  L  G+L+VG+GDG +   K               K + +  L G V+SI+LRGQGHQF+ GT  + IYRFS  +FK ELI T H  A+NDI +P    +LF TCS  D+RV+H+ + KELLRI +PNMTC   D  +DG +II+ W+D +IRAF PE+G LMY I +AH  GVTAIAATSDC+++VSGGGEGQVR+W I +                             +  +MKEH ++V+CI++  ++ +C+++S+DGTCIIW ++++TR Q++ +NTLFRCVC+ P+E Q +TSGTDRK+GYWEV+DGS IRELEGS+SG++NGMDI   G  FVTGGDDK+VKVW YNEG VTHVG+GHS  ITRL+I P  + I +VS DGAI  W +P
Sbjct:    3 EQGEDNRLELQGIIGFNGHVPSGLISHPDREHLIYPLGCTVIIENLSSRKQQFLQGHTNNVSCVAASRSGRYLASGQVTYMGFKADILLWDYGRREACAKLTLHKVKVEALAFSPNDLYLVSLGGQDDGSVVVWNVAKREAICGSPASSLSSGHATTIIFTNNSDDIFMTGGNGTLRVWDVDLPNRKMRPTECQLGQMKRVVTCLQVTSQSCFTDDSCFYCGTSSGDILTINTKSKLLSSFAPQKGKFSLGVTALRLLKTGELLVGSGDGKLALCKGPN-----------YKAAKTVQLQGSVTSISLRGQGHQFFVGTGGAQIYRFSYPEFKEELIATCHSEAINDIAFPFGTSELFATCSKNDIRVWHTATHKELLRITVPNMTCLAIDFMRDGKSIISAWNDGRIRAFMPESGRLMYCIENAHSMGVTAIAATSDCKRIVSGGGEGQVRIWEISK-------------------------ETQRLVQSMKEHKSSVTCIKLKGNNRECLTASSDGTCIIWDIVRFTRLQMVLSNTLFRCVCYHPEEFQFVTSGTDRKVGYWEVFDGSAIRELEGSKSGAINGMDICDQGAHFVTGGDDKLVKVWDYNEGEVTHVGIGHSGNITRLKICPLSKYIISVSTDGAILCWDYP 618          
BLAST of wdr-1 vs. Ensembl Xenopus
Match: gucy1a2 (guanylate cyclase 1, soluble, alpha 2 [Source:Xenbase;Acc:XB-GENE-1011801])

HSP 1 Score: 729.169 bits (1881), Expect = 0.000e+0
Identity = 340/639 (53.21%), Postives = 458/639 (71.67%), Query Frame = 2
Query:  101 ELINVIGFNGTILDGLHVHPDRQHIIYGLGCTVVIEDLNTKNQCFLQGHTNNVVCITVSNSGKYIASGQITHMGYKADIMLWDYVTKQCVSTFSLHKVKVQSLAFSPNEKYLASLGGQDDGCVVIWSLTKMEPICGSPAQHKSAGITECLVYSNTNDDVFVTAGENTLRVWELDVENRKIRPTECSLGAIKRSIKCITISKDDSVFFCGTSSGDILGVNMKSCLLSCIGPEKETFSLGVLSIIRLINGDLIVGAGDGTICQVKVVEKKEGNKIMPKIVKTSNSCMLVGGVSSITLRGQGHQFYAGTEKSHIYRFSLGDFKSELINTAHYSAVNDIVYPNNCPKLFVTCSFQDVRVFHSDSQKELLRINIPNMTCYTCDIFKDGTAIITGWDDSKIRAFYPETGALMYTINDAHKKGVTAIAATSDCRKVVSGGGEGQVRVWRIEECKVSQANTIPHSHGNRKKSNVKSVVYVAHMETAMKEHANAVSCIRMNKDDTQCVSSSADGTCIIWCLIKYTRKQIMFANTLFRCVCWRPDECQIITSGTDRKIGYWEVYDGSLIRELEGSRSGSVNGMDITADGDIFVTGGDDKIVKVWKYNEGYVTHVGLGHSMPITRLRISPDRQLITTVSEDGAIYFWKFP 2017
            E++ V+  +G +  GL  HPDR+H+IY LGCTV+IE+L+++ Q FLQGHTNNV C+  S SG+Y+ASGQ+T+MG+KADI+LWDY  ++  +  +LHKVKV++LAFSPN+ YL SLGGQDDG VV+W++ K E ICGSPA   S+G    ++++N +DD+F+T G  TLRVW++D+ NRK+RPTEC LG +KR + C+ +++DDS F+CGTSSGDIL +N KS LLS   P+K  FSLGV ++  L  G+L+VG+GDG +   K               K + +  L G V+SI+LRGQGHQF+ GT  + IYRFS  +FK ELI T H  A+NDI +P    +LF TCS  D+RV+H+ + KELLRI +PNMTC   D  +DG +II+ W+D +IRAF PE+G LMY I +AH  GVTAIAATSDC+++VSGGGEGQVR+W I +                             +  +MKEH ++V+CI++  ++ +C+++S+DGTCIIW ++++TR Q++ +NTLFRCVC+ P+E Q +TSGTDRK+GYWEV+DGS IRELEGS+SG++NGMDI   G  FVTGGDDK+VKVW YNEG VTHVG+GHS  ITRL+I P  + I +VS DGAI  W +P
Sbjct:    4 EVLVVLSHSGHVPSGLISHPDREHLIYPLGCTVIIENLSSRKQQFLQGHTNNVSCVAASRSGRYLASGQVTYMGFKADILLWDYGRREACAKLTLHKVKVEALAFSPNDLYLVSLGGQDDGSVVVWNVAKREAICGSPASSLSSGHATTIIFTNNSDDIFMTGGNGTLRVWDVDLPNRKMRPTECQLGQMKRVVTCLQVAEDDSCFYCGTSSGDILTINTKSKLLSSFAPQKGKFSLGVTALRLLKTGELLVGSGDGKLALCKGPN-----------YKAAKTVQLQGSVTSISLRGQGHQFFVGTGGAQIYRFSYPEFKEELIATCHSEAINDIAFPFGTSELFATCSKNDIRVWHTATHKELLRITVPNMTCLAIDFMRDGKSIISAWNDGRIRAFMPESGRLMYCIENAHSMGVTAIAATSDCKRIVSGGGEGQVRIWEISK-------------------------ETQRLVQSMKEHKSSVTCIKLKGNNRECLTASSDGTCIIWDIVRFTRLQMVLSNTLFRCVCYHPEEFQFVTSGTDRKVGYWEVFDGSAIRELEGSKSGAINGMDICDQGAHFVTGGDDKLVKVWDYNEGEVTHVGIGHSGNITRLKICPLSKYIISVSTDGAILCWDYP 606          
BLAST of wdr-1 vs. Ensembl Xenopus
Match: gucy1a2 (guanylate cyclase 1, soluble, alpha 2 [Source:Xenbase;Acc:XB-GENE-1011801])

HSP 1 Score: 727.628 bits (1877), Expect = 0.000e+0
Identity = 340/635 (53.54%), Postives = 454/635 (71.50%), Query Frame = 2
Query:  113 VIGFNGTILDGLHVHPDRQHIIYGLGCTVVIEDLNTKNQCFLQGHTNNVVCITVSNSGKYIASGQITHMGYKADIMLWDYVTKQCVSTFSLHKVKVQSLAFSPNEKYLASLGGQDDGCVVIWSLTKMEPICGSPAQHKSAGITECLVYSNTNDDVFVTAGENTLRVWELDVENRKIRPTECSLGAIKRSIKCITISKDDSVFFCGTSSGDILGVNMKSCLLSCIGPEKETFSLGVLSIIRLINGDLIVGAGDGTICQVKVVEKKEGNKIMPKIVKTSNSCMLVGGVSSITLRGQGHQFYAGTEKSHIYRFSLGDFKSELINTAHYSAVNDIVYPNNCPKLFVTCSFQDVRVFHSDSQKELLRINIPNMTCYTCDIFKDGTAIITGWDDSKIRAFYPETGALMYTINDAHKKGVTAIAATSDCRKVVSGGGEGQVRVWRIEECKVSQANTIPHSHGNRKKSNVKSVVYVAHMETAMKEHANAVSCIRMNKDDTQCVSSSADGTCIIWCLIKYTRKQIMFANTLFRCVCWRPDECQIITSGTDRKIGYWEVYDGSLIRELEGSRSGSVNGMDITADGDIFVTGGDDKIVKVWKYNEGYVTHVGLGHSMPITRLRISPDRQLITTVSEDGAIYFWKFP 2017
            V+  +G +  GL  HPDR+H+IY LGCTV+IE+L+++ Q FLQGHTNNV C+  S SG+Y+ASGQ+T+MG+KADI+LWDY  ++  +  +LHKVKV++LAFSPN+ YL SLGGQDDG VV+W++ K E ICGSPA   S+G    ++++N +DD+F+T G  TLRVW++D+ NRK+RPTEC LG +KR + C+ +S DDS F+CGTSSGDIL +N KS LLS   P+K  FSLGV ++  L  G+L+VG+GDG +   K               K + +  L G V+SI+LRGQGHQF+ GT  + IYRFS  +FK ELI T H  A+NDI +P    +LF TCS  D+RV+H+ + KELLRI +PNMTC   D  +DG +II+ W+D +IRAF PE+G LMY I +AH  GVTAIAATSDC+++VSGGGEGQVR+W I +                             +  +MKEH ++V+CI++  ++ +C+++S+DGTCIIW ++++TR Q++ +NTLFRCVC+ P+E Q +TSGTDRK+GYWEV+DGS IRELEGS+SG++NGMDI   G  FVTGGDDK+VKVW YNEG VTHVG+GHS  ITRL+I P  + I +VS DGAI  W +P
Sbjct:   18 VLSHSGHVPSGLISHPDREHLIYPLGCTVIIENLSSRKQQFLQGHTNNVSCVAASRSGRYLASGQVTYMGFKADILLWDYGRREACAKLTLHKVKVEALAFSPNDLYLVSLGGQDDGSVVVWNVAKREAICGSPASSLSSGHATTIIFTNNSDDIFMTGGNGTLRVWDVDLPNRKMRPTECQLGQMKRVVTCLQVSSDDSCFYCGTSSGDILTINTKSKLLSSFAPQKGKFSLGVTALRLLKTGELLVGSGDGKLALCKGPN-----------YKAAKTVQLQGSVTSISLRGQGHQFFVGTGGAQIYRFSYPEFKEELIATCHSEAINDIAFPFGTSELFATCSKNDIRVWHTATHKELLRITVPNMTCLAIDFMRDGKSIISAWNDGRIRAFMPESGRLMYCIENAHSMGVTAIAATSDCKRIVSGGGEGQVRIWEISK-------------------------ETQRLVQSMKEHKSSVTCIKLKGNNRECLTASSDGTCIIWDIVRFTRLQMVLSNTLFRCVCYHPEEFQFVTSGTDRKVGYWEVFDGSAIRELEGSKSGAINGMDICDQGAHFVTGGDDKLVKVWDYNEGEVTHVGIGHSGNITRLKICPLSKYIISVSTDGAILCWDYP 616          
BLAST of wdr-1 vs. Ensembl Xenopus
Match: gucy1a2 (guanylate cyclase 1, soluble, alpha 2 [Source:Xenbase;Acc:XB-GENE-1011801])

HSP 1 Score: 724.931 bits (1870), Expect = 0.000e+0
Identity = 341/645 (52.87%), Postives = 456/645 (70.70%), Query Frame = 2
Query:   83 NEINKLELINVIGFNGTILDGLHVHPDRQHIIYGLGCTVVIEDLNTKNQCFLQGHTNNVVCITVSNSGKYIASGQITHMGYKADIMLWDYVTKQCVSTFSLHKVKVQSLAFSPNEKYLASLGGQDDGCVVIWSLTKMEPICGSPAQHKSAGITECLVYSNTNDDVFVTAGENTLRVWELDVENRKIRPTECSLGAIKRSIKCITISKDDSVFFCGTSSGDILGVNMKSCLLSCIGPEKETFSLGVLSIIRLINGDLIVGAGDGTICQVKVVEKKEGNKIMPKIVKTSNSCMLVGGVSSITLRGQGHQFYAGTEKSHIYRFSLGDFKSELINTAHYSAVNDIVYPNNCPKLFVTCSFQDVRVFHSDSQKELLRINIPNMTCYTCDIFKDGTAIITGWDDSKIRAFYPETGALMYTINDAHKKGVTAIAATSDCRKVVSGGGEGQVRVWRIEECKVSQANTIPHSHGNRKKSNVKSVVYVAHMETAMKEHANAVSCIRMNKDDTQCVSSSADGTCIIWCLIKYTRKQIMFANTLFRCVCWRPDECQIITSGTDRKIGYWEVYDGSLIRELEGSRSGSVNGMDITADGDIFVTGGDDKIVKVWKYNEGYVTHVGLGHSMPITRLRISPDRQLITTVSEDGAIYFWKFP 2017
            ++  K E    I  +  +  GL  HPDR+H+IY LGCTV+IE+L+++ Q FLQGHTNNV C+  S SG+Y+ASGQ+T+MG+KADI+LWDY  ++  +  +LHKVKV++LAFSPN+ YL SLGGQDDG VV+W++ K E ICGSPA   S+G    ++++N +DD+F+T G  TLRVW++D+ NRK+RPTEC LG +KR + C+ +S DDS F+CGTSSGDIL +N KS LLS   P+K  FSLGV ++  L  G+L+VG+GDG +   K               K + +  L G V+SI+LRGQGHQF+ GT  + IYRFS  +FK ELI T H  A+NDI +P    +LF TCS  D+RV+H+ + KELLRI +PNMTC   D  +DG +II+ W+D +IRAF PE+G LMY I +AH  GVTAIAATSDC+++VSGGGEGQVR+W I +                             +  +MKEH ++V+CI++  ++ +C+++S+DGTCIIW ++++TR Q++ +NTLFRCVC+ P+E Q +TSGTDRK+GYWEV+DGS IRELEGS+SG++NGMDI   G  FVTGGDDK+VKVW YNEG VTHVG+GHS  ITRL+I P  + I +VS DGAI  W +P
Sbjct:   28 HKARKAEPPTHIPISRHVPSGLISHPDREHLIYPLGCTVIIENLSSRKQQFLQGHTNNVSCVAASRSGRYLASGQVTYMGFKADILLWDYGRREACAKLTLHKVKVEALAFSPNDLYLVSLGGQDDGSVVVWNVAKREAICGSPASSLSSGHATTIIFTNNSDDIFMTGGNGTLRVWDVDLPNRKMRPTECQLGQMKRVVTCLQVSSDDSCFYCGTSSGDILTINTKSKLLSSFAPQKGKFSLGVTALRLLKTGELLVGSGDGKLALCKGPN-----------YKAAKTVQLQGSVTSISLRGQGHQFFVGTGGAQIYRFSYPEFKEELIATCHSEAINDIAFPFGTSELFATCSKNDIRVWHTATHKELLRITVPNMTCLAIDFMRDGKSIISAWNDGRIRAFMPESGRLMYCIENAHSMGVTAIAATSDCKRIVSGGGEGQVRIWEISK-------------------------ETQRLVQSMKEHKSSVTCIKLKGNNRECLTASSDGTCIIWDIVRFTRLQMVLSNTLFRCVCYHPEEFQFVTSGTDRKVGYWEVFDGSAIRELEGSKSGAINGMDICDQGAHFVTGGDDKLVKVWDYNEGEVTHVGIGHSGNITRLKICPLSKYIISVSTDGAILCWDYP 636          
BLAST of wdr-1 vs. Ensembl Xenopus
Match: gucy1a2 (guanylate cyclase 1, soluble, alpha 2 [Source:Xenbase;Acc:XB-GENE-1011801])

HSP 1 Score: 721.465 bits (1861), Expect = 0.000e+0
Identity = 339/635 (53.39%), Postives = 453/635 (71.34%), Query Frame = 2
Query:  113 VIGFNGTILDGLHVHPDRQHIIYGLGCTVVIEDLNTKNQCFLQGHTNNVVCITVSNSGKYIASGQITHMGYKADIMLWDYVTKQCVSTFSLHKVKVQSLAFSPNEKYLASLGGQDDGCVVIWSLTKMEPICGSPAQHKSAGITECLVYSNTNDDVFVTAGENTLRVWELDVENRKIRPTECSLGAIKRSIKCITISKDDSVFFCGTSSGDILGVNMKSCLLSCIGPEKETFSLGVLSIIRLINGDLIVGAGDGTICQVKVVEKKEGNKIMPKIVKTSNSCMLVGGVSSITLRGQGHQFYAGTEKSHIYRFSLGDFKSELINTAHYSAVNDIVYPNNCPKLFVTCSFQDVRVFHSDSQKELLRINIPNMTCYTCDIFKDGTAIITGWDDSKIRAFYPETGALMYTINDAHKKGVTAIAATSDCRKVVSGGGEGQVRVWRIEECKVSQANTIPHSHGNRKKSNVKSVVYVAHMETAMKEHANAVSCIRMNKDDTQCVSSSADGTCIIWCLIKYTRKQIMFANTLFRCVCWRPDECQIITSGTDRKIGYWEVYDGSLIRELEGSRSGSVNGMDITADGDIFVTGGDDKIVKVWKYNEGYVTHVGLGHSMPITRLRISPDRQLITTVSEDGAIYFWKFP 2017
            V+  +G +  GL  HPDR+H+IY LGCTV+IE+L+++ Q FLQGHTNNV C+  S SG+Y+ASGQ+T+MG+KADI+LWDY  ++  +  +LHKVKV++LAFSPN+ YL SLGGQDDG VV+W++ K E ICGSPA   S+G    ++++N +DD+F+T G  TLRVW++D+ NRK+RPTEC LG +KR + C+   +DDS F+CGTSSGDIL +N KS LLS   P+K  FSLGV ++  L  G+L+VG+GDG +   K               K + +  L G V+SI+LRGQGHQF+ GT  + IYRFS  +FK ELI T H  A+NDI +P    +LF TCS  D+RV+H+ + KELLRI +PNMTC   D  +DG +II+ W+D +IRAF PE+G LMY I +AH  GVTAIAATSDC+++VSGGGEGQVR+W I +                             +  +MKEH ++V+CI++  ++ +C+++S+DGTCIIW ++++TR Q++ +NTLFRCVC+ P+E Q +TSGTDRK+GYWEV+DGS IRELEGS+SG++NGMDI   G  FVTGGDDK+VKVW YNEG VTHVG+GHS  ITRL+I P  + I +VS DGAI  W +P
Sbjct:   11 VLSHSGHVPSGLISHPDREHLIYPLGCTVIIENLSSRKQQFLQGHTNNVSCVAASRSGRYLASGQVTYMGFKADILLWDYGRREACAKLTLHKVKVEALAFSPNDLYLVSLGGQDDGSVVVWNVAKREAICGSPASSLSSGHATTIIFTNNSDDIFMTGGNGTLRVWDVDLPNRKMRPTECQLGQMKRVVTCL---QDDSCFYCGTSSGDILTINTKSKLLSSFAPQKGKFSLGVTALRLLKTGELLVGSGDGKLALCKGPN-----------YKAAKTVQLQGSVTSISLRGQGHQFFVGTGGAQIYRFSYPEFKEELIATCHSEAINDIAFPFGTSELFATCSKNDIRVWHTATHKELLRITVPNMTCLAIDFMRDGKSIISAWNDGRIRAFMPESGRLMYCIENAHSMGVTAIAATSDCKRIVSGGGEGQVRIWEISK-------------------------ETQRLVQSMKEHKSSVTCIKLKGNNRECLTASSDGTCIIWDIVRFTRLQMVLSNTLFRCVCYHPEEFQFVTSGTDRKVGYWEVFDGSAIRELEGSKSGAINGMDICDQGAHFVTGGDDKLVKVWDYNEGEVTHVGIGHSGNITRLKICPLSKYIISVSTDGAILCWDYP 606          
BLAST of wdr-1 vs. Ensembl Mouse
Match: Cfap52 (cilia and flagella associated protein 52 [Source:MGI Symbol;Acc:MGI:1919110])

HSP 1 Score: 720.309 bits (1858), Expect = 0.000e+0
Identity = 348/644 (54.04%), Postives = 458/644 (71.12%), Query Frame = 2
Query:   86 EINKLELINVIGFNGTILDGLHVHPDRQHIIYGLGCTVVIEDLNTKNQCFLQGHTNNVVCITVSNSGKYIASGQITHMGYKADIMLWDYVTKQCVSTFSLHKVKVQSLAFSPNEKYLASLGGQDDGCVVIWSLTKMEPICGSPAQHKSAGITECLVYSNTNDDVFVTAGENTLRVWELDVENRKIRPTECSLGAIKRSIKCITISKDDSVFFCGTSSGDILGVNMKSCLLSCIGPEKETFSLGVLSIIRLINGDLIVGAGDGTICQVKVVEKKEGNKIMPKIVKTSNSCMLVGGVSSITLRGQGHQFYAGTEKSHIYRFSLGDFKSELINTAHYSAVNDIVYPNNCPKLFVTCSFQDVRVFHSDSQKELLRINIPNMTCYTCDIFKDGTAIITGWDDSKIRAFYPETGALMYTINDAHKKGVTAIAATSDCRKVVSGGGEGQVRVWRIEECKVSQANTIPHSHGNRKKSNVKSVVYVAHMETAMKEHANAVSCIRMNKDDTQCVSSSADGTCIIWCLIKYTRKQIMFANTLFRCVCWRPDECQIITSGTDRKIGYWEVYDGSLIRELEGSRSGSVNGMDITADGDIFVTGGDDKIVKVWKYNEGYVTHVGLGHSMPITRLRISPDRQLITTVSEDGAIYFWKFP 2017
            ++ +LEL  VIGFNG + +GL  HPD++H+IY LGCTV+I+ +NT  Q FL GH NNV C+T+S  G YIASGQ+T MG+KADI+LWD+  ++ ++  SLHK K+++LAFSPN+ YL SLGG DDG VV+WS+ K + ICGSPA   + G    +V+S   D++FVTAG  T+RVWELD+ NRKI PTEC  G +KR +    ++ DDS F+ GT++GDIL +N K+ LL+  GP K+ FSLGV ++  L  G L+VG+G G +   K    K   K+            L GG++SITLRG+GHQF+ GTE+SHIYR +  DFK  LI T H+ AV DIV+P    +LF TC+ +D+RV+H+ S++ELLRI +PNMTC+  D  +DG +II+ WDD KIRAF PE+G LMYTIN AH+ GVTAIA TSDC++++SGGGEG+VRVW++  C+  +                        +E A+KEH ++VSCIR+ K++ +CV++S DGTCIIW L++  R Q++ ANTLF+CVC+ P+E QIITSGTDRKI YWEV+DGS+IRELEGS SGS+NGMDIT +G  FVTGG D +VKVW YNEG VTHVG+GHS  I  +RISP  Q I +VS DGAI  WK+P
Sbjct:   10 DVAELELQAVIGFNGHVPNGLKCHPDQEHLIYPLGCTVLIQAINTNEQNFLHGHGNNVSCVTISKEGDYIASGQVTFMGFKADIILWDFKKRELIARLSLHKGKIEALAFSPNDLYLVSLGGPDDGSVVVWSIAKRDAICGSPAAGLNVGNATSVVFSRCRDEMFVTAGNGTIRVWELDLPNRKIWPTECQTGQMKRIVLSTGMADDDSFFYLGTTTGDILKMNPKTKLLADTGPVKDKFSLGVSALRCLKMGGLLVGSGAGLLIFCKSPSYKPIKKV-----------QLQGGITSITLRGEGHQFFVGTEESHIYRVNFTDFKETLIATCHFEAVQDIVFPFGTAELFATCAKKDIRVWHTMSKRELLRITVPNMTCHGIDFMRDGKSIISAWDDGKIRAFAPESGRLMYTINSAHRIGVTAIATTSDCKRIISGGGEGEVRVWQV-GCQTQK------------------------LEEALKEHKSSVSCIRVKKNNEECVTASTDGTCIIWDLVRLRRNQMILANTLFQCVCYHPEEFQIITSGTDRKIAYWEVFDGSVIRELEGSLSGSINGMDITQEGGHFVTGGHDHLVKVWDYNEGEVTHVGVGHSGNIMAMRISPGNQYIVSVSADGAILRWKYP 617          
BLAST of wdr-1 vs. Ensembl Mouse
Match: Cfap52 (cilia and flagella associated protein 52 [Source:MGI Symbol;Acc:MGI:1919110])

HSP 1 Score: 362.844 bits (930), Expect = 1.524e-119
Identity = 177/343 (51.60%), Postives = 237/343 (69.10%), Query Frame = 2
Query:   86 EINKLELINVIGFNGTILDGLHVHPDRQHIIYGLGCTVVIEDLNTKNQCFLQGHTNNVVCITVSNSGKYIASGQITHMGYKADIMLWDYVTKQCVSTFSLHKVKVQSLAFSPNEKYLASLGGQDDGCVVIWSLTKMEPICGSPAQHKSAGITECLVYSNTNDDVFVTAGENTLRVWELDVENRKIRPTECSLGAIKRSIKCITISKDDSVFFCGTSSGDILGVNMKSCLLSCIGPEKETFSLGVLSIIRLINGDLIVGAGDGTICQVKVVEKKEGNKIMPKIVKTSNSCMLVGGVSSITLRGQGHQFYAGTEKSHIYRFSLGDFKSELINTAHYSAVNDIVYP 1114
            ++ +LEL  VIGFNG + +GL  HPD++H+IY LGCTV+I+ +NT  Q FL GH NNV C+T+S  G YIASGQ+T MG+KADI+LWD+  ++ ++  SLHK K+++LAFSPN+ YL SLGG DDG VV+WS+ K + ICGSPA   + G    +V+S   D++FVTAG  T+RVWELD+ NRKI PTEC  G +KR +    ++ DDS F+ GT++GDIL +N K+ LL+  GP K+ FSLGV ++  L  G L+VG+G G +   K    K   K+            L GG++SITLRG+GHQF+ GTE+SHIYR +  DFK  LI T H+ AV DIV+P
Sbjct:   10 DVAELELQAVIGFNGHVPNGLKCHPDQEHLIYPLGCTVLIQAINTNEQNFLHGHGNNVSCVTISKEGDYIASGQVTFMGFKADIILWDFKKRELIARLSLHKGKIEALAFSPNDLYLVSLGGPDDGSVVVWSIAKRDAICGSPAAGLNVGNATSVVFSRCRDEMFVTAGNGTIRVWELDLPNRKIWPTECQTGQMKRIVLSTGMADDDSFFYLGTTTGDILKMNPKTKLLADTGPVKDKFSLGVSALRCLKMGGLLVGSGAGLLIFCKSPSYKPIKKV-----------QLQGGITSITLRGEGHQFFVGTEESHIYRVNFTDFKETLIATCHFEAVQDIVFP 341          
BLAST of wdr-1 vs. Ensembl Mouse
Match: Wdr90 (WD repeat domain 90 [Source:MGI Symbol;Acc:MGI:1921267])

HSP 1 Score: 114.39 bits (285), Expect = 1.675e-25
Identity = 109/465 (23.44%), Postives = 198/465 (42.58%), Query Frame = 2
Query:   92 NKLELINVIGFNGTILDGLHVHPDRQHIIYGLGCTVVIEDLNTKNQCFLQGHTNNVVCITVSNSGKYIASGQIT-HMGYKADIMLWDYVTKQCVSTFSLHKVKVQSLAFSPNEKYLASLGGQDDGCVVIWSLTKMEPICGSPAQHKSAGITECLVYSNTNDDVFVTAGENTLRVWELDVE--------NRKIRPTECSLGAIKRSIKCITISKDDSVFFCGTSSGD--ILGVNMKSCLLSCIGPEKETFSLGVL--SIIRLINGDLIVGAGDGTICQVKVVE--KKEGNKIMPKIVKTSNSCMLVGGVSSITLRGQGHQFYAGTEKSHIYRFSLGDFKSELINTAHYSAVNDIVYPNNCPKLFVTCSFQDVRVFHSDSQKELLRINIPNMTCY-------TCDIFKDGTAIITGWDDSKIRAFYPETGALMYTINDAHKKGVTAIAATSDCRKVVSGGGEGQVRV 1420
             +L L  ++G+NG     +   PD     Y  G  VV+EDL++  Q    GH+  +  + ++  G+ +AS     +   +  I +WD     C    S H   VQ+LAFSP++++L +LG   D  + +WS+   E +  +       G+     ++  + +  +  G N +  W L           +R+  P E  LGA + +  C   S    + +CG+SSG   +       C L+    E +   +GVL  S  RLI+G          +  V VV   +++G+      V       L G V S +          GT    I+  S  +  S  + + H + VN++V+               VRV+   S + +++  + N +C        +C++  +   ++ G+ D  +R F     A+   ++  H+  +TAIA ++D + ++SG  +G V +
Sbjct: 1248 ERLRLKAIVGYNGNGRANMVWRPDTGFFAYTCGRLVVVEDLHSGTQRHWLGHSQEISTLALNQDGQILASASCCGNTAARCQIRIWDVPKGLCRHLLSHHDTAVQALAFSPDDEFLVTLGDYADRNLALWSMATYELLSSTRLLEPVHGV----AFNPWDANELICVGTNAITFWLLQHHGADTCFQVHREPIPEE--LGASELTSLCYGASP---LLYCGSSSGQVCVWDTGTGHCFLAW---EADDGEIGVLLCSGSRLISGS---NTKRLRLWAVGVVPELRRKGSSARSSSVFMERELTLDGAVVSASFDSGMDMGVVGTTAGTIWYISWTEGTSTRLISGHRTKVNEVVFSPGESHCATCGEDGSVRVWSLASMELVIQFQVLNQSCLCLAWTPPSCEL-PEQQQVVAGYSDGTLRVFSISRTAMELKMH-PHRTALTAIAFSTDGQTILSGDKDGLVAI 1695          

HSP 2 Score: 83.1889 bits (204), Expect = 9.520e-16
Identity = 135/691 (19.54%), Postives = 259/691 (37.48%), Query Frame = 2
Query:   98 LELINVIGFNGTILDGLHVHPDRQHIIYGLGCTVVIEDLNTKNQCFLQGHTNNVVCITVSNSGKYIASGQITHMGYKADIMLWDYVTKQCVSTFSLHKVKVQSLAFSPNEKYLASLGGQDDGCVVIWSLTKMEPICGSPAQHKSAGITECLVYSNTNDDV------------FVTAGENTLRVWELDVENRKIRPTECSLG----------AIKRSIKCITISKDDSVFFCGTSSGDILGVNMKSC-------LLSCIGP-----EKETFSLG---VLSIIRLINGDLIVGAGDGTICQVKVVEKKEGNKIMPKIVKTSNSCMLV-----GGVSSITLRGQGHQFYAGTEKSHIYRFSLGDFKSELINTAHYSAVNDIVYPNNCPKLFVTCSFQDVRVFHSDSQKELLRINIPNMTCYTCDIFKDGTAIITGWDDSKIRAFYPETGALMYTINDAHKKGVTAIAATSDCRKVVSGGGEGQVRVWRIEECKVSQ-------ANTIPHSHGNRKKSNVKSVVYVAHMETAMKEHANAVSCIRMNKDDTQCVSSSADGTCIIWCLIKYTRKQIMFANTL--FRCVCWRP-DECQIITSGTDRKIGYWEVYDGSLIRELEGSRSGSVNGMDITADGDIFVTGGDDKIVKVWKY--NEGYVTHVGLGHSMPITRLRISPDRQLITTVSEDGAIYFW 2008
            L L  VIGF G          D   ++Y     +++  ++T  Q F  GHT+ V  + ++ S   +AS Q+      + + LWD+ T  C+S F      + SL+FS +   L  +G    G  V+        +  S  Q    G    L   +T+ D+              + G  ++R+W L      +R     LG          A  +++         ++F C + SG IL ++ +         LL    P     EK+ FS+G    +S + +      VG+ DG +                ++     S +L+     G VSS++    G +  + T   H+    +   +  ++  +H + V  +    N  ++        VR++   + ++L   +    T               G+    +R+F  E+  ++   +  H+  +T++  T D R + S   +G +  +    C  SQ       AN +      R   N+ +V              +  SC       ++C+ +  +   +   L        + +N L     +C+ P +   ++ S +  K+   +   G  +REL   RS +   + ++ D  + +    D+ + VW Y         V +GHS P+  +  +PD+  + +V +  AI+ W
Sbjct:  439 LRLKGVIGFGGHSTQWALWTKDGVAVVYPCHAVIIVLQIDTGQQRFFLGHTDKVSALALNGSDTLLASAQVQP---PSMVRLWDFQTGSCLSLFRSPLHTICSLSFSGSGALLCGVGKDRHGRTVV--------VAWSTEQAGLGGEVVVLAKVHTDFDIRAFQVAFFDETRMASCGRGSVRLWRL--RGGVLRSCAVDLGEYCSLELTDLAFAQALDGHCAPSAGTLFVC-SHSGHILEIDHQRMSVQHVRRLLPARSPGAPLAEKQNFSVGSGIAISSLSVSTATCAVGSEDGYL----------------RLWPLDFSSVLLEAEHDGPVSSVSFSPDGLRVLSTTTSGHLGFLDVPSREYTVLARSHMAPVLALSTEPNRGQMATVSLDHTVRIWDLATLQQLYDFSSSEDTPCAVAFHPTMPNFFCGFSSGAVRSFSLESSGVLVE-HTRHRGAITSLVITLDGRFLFSSCSQGSLVQY---SCADSQCCVLRVAANMV--CQDGRPNPNILAV--------------SGDSCRLAFVGPSKCMVTIVESASLDELLRVDVSTLNLASNHLDWAVAICFSPGNSGHLLVSTSSNKVVVLDAVSGHTLRELSSVRSRACCSLALSEDAHLLL-AATDRTITVWDYPTQANPSCQVYIGHSEPVHAVAFTPDQLQVISVGD--AIFLW 1076          
BLAST of wdr-1 vs. Ensembl Mouse
Match: Wdr90 (WD repeat domain 90 [Source:MGI Symbol;Acc:MGI:1921267])

HSP 1 Score: 114.005 bits (284), Expect = 2.183e-25
Identity = 109/465 (23.44%), Postives = 198/465 (42.58%), Query Frame = 2
Query:   92 NKLELINVIGFNGTILDGLHVHPDRQHIIYGLGCTVVIEDLNTKNQCFLQGHTNNVVCITVSNSGKYIASGQIT-HMGYKADIMLWDYVTKQCVSTFSLHKVKVQSLAFSPNEKYLASLGGQDDGCVVIWSLTKMEPICGSPAQHKSAGITECLVYSNTNDDVFVTAGENTLRVWELDVE--------NRKIRPTECSLGAIKRSIKCITISKDDSVFFCGTSSGD--ILGVNMKSCLLSCIGPEKETFSLGVL--SIIRLINGDLIVGAGDGTICQVKVVE--KKEGNKIMPKIVKTSNSCMLVGGVSSITLRGQGHQFYAGTEKSHIYRFSLGDFKSELINTAHYSAVNDIVYPNNCPKLFVTCSFQDVRVFHSDSQKELLRINIPNMTCY-------TCDIFKDGTAIITGWDDSKIRAFYPETGALMYTINDAHKKGVTAIAATSDCRKVVSGGGEGQVRV 1420
             +L L  ++G+NG     +   PD     Y  G  VV+EDL++  Q    GH+  +  + ++  G+ +AS     +   +  I +WD     C    S H   VQ+LAFSP++++L +LG   D  + +WS+   E +  +       G+     ++  + +  +  G N +  W L           +R+  P E  LGA + +  C   S    + +CG+SSG   +       C L+    E +   +GVL  S  RLI+G          +  V VV   +++G+      V       L G V S +          GT    I+  S  +  S  + + H + VN++V+               VRV+   S + +++  + N +C        +C++  +   ++ G+ D  +R F     A+   ++  H+  +TAIA ++D + ++SG  +G V +
Sbjct: 1230 ERLRLKAIVGYNGNGRANMVWRPDTGFFAYTCGRLVVVEDLHSGTQRHWLGHSQEISTLALNQDGQILASASCCGNTAARCQIRIWDVPKGLCRHLLSHHDTAVQALAFSPDDEFLVTLGDYADRNLALWSMATYELLSSTRLLEPVHGV----AFNPWDANELICVGTNAITFWLLQHHGADTCFQVHREPIPEE--LGASELTSLCYGASP---LLYCGSSSGQVCVWDTGTGHCFLAW---EADDGEIGVLLCSGSRLISGS---NTKRLRLWAVGVVPELRRKGSSARSSSVFMERELTLDGAVVSASFDSGMDMGVVGTTAGTIWYISWTEGTSTRLISGHRTKVNEVVFSPGESHCATCGEDGSVRVWSLASMELVIQFQVLNQSCLCLAWTPPSCEL-PEQQQVVAGYSDGTLRVFSISRTAMELKMH-PHRTALTAIAFSTDGQTILSGDKDGLVAI 1677          

HSP 2 Score: 82.8037 bits (203), Expect = 1.071e-15
Identity = 136/698 (19.48%), Postives = 259/698 (37.11%), Query Frame = 2
Query:   98 LELINVIGFNGTILDGLHVHPDRQHIIYGLGCTVVIEDLNTKNQCFLQGHTNNVVCITVSNSGKYIASGQITHMGYKADIMLWDYVTKQCVSTFSLHKVKVQSLAFSPNEKYLASLGGQDDGCVVIWSLTKMEPICGSPAQHKSAGITECLVYSNTNDDV------------FVTAGENTLRVWELDVENRKIRPTECSLG----------AIKRSIKCITISKDDSVFFCGTSSGDILGVNMKSC-------LLSCIGP-----EKETFSLG---VLSIIRLINGDLIVGAGDGTICQVKVVEKKEGNKIMPKIVKTSNSCMLV-----GGVSSITLRGQGHQFYAGTEKSHIYRFSLGDFKSELINTAHYSAVNDIVYPNNCPKLFVTCSFQDVRVFHSDSQKELLRINIPNMTCYTCDIFKDGTAIITGWDDSKIRAFYPETGALMYTINDAHKKGVTAIAATSDCRKVVSGGGEGQVRVWRIEECKVSQ-------ANTIPHSHGNRKKSNVKSV---------VYVAHMETAMKEHANAVSCIRMNKDDTQCVSSSADGTCIIWCLIKYTRKQIMFANTLFRCVCWRP-DECQIITSGTDRKIGYWEVYDGSLIRELEGSRSGSVNGMDITADGDIFVTGGDDKIVKVWKY--NEGYVTHVGLGHSMPITRLRISPDRQLITTVSEDGAIYFW 2008
            L L  VIGF G          D   ++Y     +++  ++T  Q F  GHT+ V  + ++ S   +AS Q+      + + LWD+ T  C+S F      + SL+FS +   L  +G    G  V+        +  S  Q    G    L   +T+ D+              + G  ++R+W L      +R     LG          A  +++         ++F C + SG IL ++ +         LL    P     EK+ FS+G    +S + +      VG+ DG +                ++     S +L+     G VSS++    G +  + T   H+    +   +  ++  +H + V  +    N  ++        VR++   + ++L   +    T               G+    +R+F  E+  ++   +  H+  +T++  T D R + S   +G +  +    C  SQ       AN +      R   N+ +V         V  +     + E A+    +R++       S+  D     W +                 +C+ P +   ++ S +  K+   +   G  +REL   RS +   + ++ D  + +    D+ + VW Y         V +GHS P+  +  +PD+  + +V +  AI+ W
Sbjct:  421 LRLKGVIGFGGHSTQWALWTKDGVAVVYPCHAVIIVLQIDTGQQRFFLGHTDKVSALALNGSDTLLASAQVQP---PSMVRLWDFQTGSCLSLFRSPLHTICSLSFSGSGALLCGVGKDRHGRTVV--------VAWSTEQAGLGGEVVVLAKVHTDFDIRAFQVAFFDETRMASCGRGSVRLWRL--RGGVLRSCAVDLGEYCSLELTDLAFAQALDGHCAPSAGTLFVC-SHSGHILEIDHQRMSVQHVRRLLPARSPGAPLAEKQNFSVGSGIAISSLSVSTATCAVGSEDGYL----------------RLWPLDFSSVLLEAEHDGPVSSVSFSPDGLRVLSTTTSGHLGFLDVPSREYTVLARSHMAPVLALSTEPNRGQMATVSLDHTVRIWDLATLQQLYDFSSSEDTPCAVAFHPTMPNFFCGFSSGAVRSFSLESSGVLVE-HTRHRGAITSLVITLDGRFLFSSCSQGSLVQY---SCADSQCCVLRVAANMV--CQDGRPNPNILAVSGDSCRLAFVGPSKCMVTIVESASLDELLRVDVSTLNLASNHLD-----WAV----------------AICFSPGNSGHLLVSTSSNKVVVLDAVSGHTLRELSSVRSRACCSLALSEDAHLLL-AATDRTITVWDYPTQANPSCQVYIGHSEPVHAVAFTPDQLQVISVGD--AIFLW 1058          
BLAST of wdr-1 vs. Ensembl Mouse
Match: Mapkbp1 (mitogen-activated protein kinase binding protein 1 [Source:MGI Symbol;Acc:MGI:1347004])

HSP 1 Score: 77.411 bits (189), Expect = 5.349e-14
Identity = 70/275 (25.45%), Postives = 114/275 (41.45%), Query Frame = 2
Query:   92 NKLELINVIGFNGTILDGLHVHPDRQHIIYGLGCTVVI-EDLNTKNQCFLQGHTNNVVCITVSNSGKYIASGQITHMGYKADIMLWDYVTKQCVSTFSLHKVKVQSLAFSPNEKYLASLGGQDDGCVVIWSLTKMEPICGSPAQHKSAGITECLVYSNTNDDVFVTAGENTLRVWEL-DVENRKIRPTECSLGA----------IKRSIKCITISKDDSVFFCGTSSGDILGVNMKSCLLSCIG-PEKETFSLGVLSIIRLINGDLIVGAGDGTI 877
            +K+ L  V+G   +   GL   P    + Y  GC VV+      K    L      +  +  S  GKY+ +G+  HM     + +WD   +  V+    HK  V  +AFSP+ KY+ S+G Q D  V +W+  K   +  +    +   ++      + +   FVTAG   ++ W L D +  K+  T   LG           +   + C    K DS  FC TSSG +   + +  L   +     ++F+  V   I +    +  G  DGT+
Sbjct:   38 SKVTLEKVLGVTVSGGRGLACDPRSGLVAYPAGCVVVLFNPRKHKQHHILNSSRKTITALAFSPDGKYLVTGESGHM---PAVRVWDVAERSQVAELQEHKYGVACVAFSPSAKYIVSVGYQHDMIVNVWAWKKNIVVASNKVSSRVTAVS-----FSEDCSYFVTAGNRHIKFWYLDDSKTSKVNATVPLLGRSGLLGELRNNLFTDVACGRGEKADST-FCITSSGLLCEFSDRRLLDKWVELRNTDSFTTTVAHCISVTQEYIFCGCADGTV 303          
BLAST of wdr-1 vs. UniProt/SwissProt
Match: sp|Q8N1V2|CFA52_HUMAN (Cilia- and flagella-associated protein 52 OS=Homo sapiens OX=9606 GN=CFAP52 PE=1 SV=3)

HSP 1 Score: 729.939 bits (1883), Expect = 0.000e+0
Identity = 355/644 (55.12%), Postives = 465/644 (72.20%), Query Frame = 2
Query:   86 EINKLELINVIGFNGTILDGLHVHPDRQHIIYGLGCTVVIEDLNTKNQCFLQGHTNNVVCITVSNSGKYIASGQITHMGYKADIMLWDYVTKQCVSTFSLHKVKVQSLAFSPNEKYLASLGGQDDGCVVIWSLTKMEPICGSPAQHKSAGITECLVYSNTNDDVFVTAGENTLRVWELDVENRKIRPTECSLGAIKRSIKCITISKDDSVFFCGTSSGDILGVNMKSCLLSCIGPEKETFSLGVLSIIRLINGDLIVGAGDGTICQVKVVEKKEGNKIMPKIVKTSNSCMLVGGVSSITLRGQGHQFYAGTEKSHIYRFSLGDFKSELINTAHYSAVNDIVYPNNCPKLFVTCSFQDVRVFHSDSQKELLRINIPNMTCYTCDIFKDGTAIITGWDDSKIRAFYPETGALMYTINDAHKKGVTAIAATSDCRKVVSGGGEGQVRVWRIEECKVSQANTIPHSHGNRKKSNVKSVVYVAHMETAMKEHANAVSCIRMNKDDTQCVSSSADGTCIIWCLIKYTRKQIMFANTLFRCVCWRPDECQIITSGTDRKIGYWEVYDGSLIRELEGSRSGSVNGMDITADGDIFVTGGDDKIVKVWKYNEGYVTHVGLGHSMPITRLRISPDRQLITTVSEDGAIYFWKFP 2017
            ++ +LEL  VIGFNG +  GL  HPD++H+IY LGCTV+I+ +NTK Q FLQGH NNV C+ +S SG+YIASGQ+T MG+KADI+LWDY  ++ ++  SLHK K+++LAFSPN+ YL SLGG DDG VV+WS+ K + ICGSPA   + G    +++S   D++F+TAG  T+RVWELD+ NRKI PTEC  G +KR +  I +  DDS F+ GT++GDIL +N ++ LL+ +GP K+ FSLGV +I  L  G L+VG+G G +    V  K  G K + KI        L GG++SITLRG+GHQF  GTE+SHIYR S  DFK  LI T H+ AV DIV+P    +LF TC+ +D+RV+H+ S +ELLRI +PNMTC+  D  +DG +II+ W+D KIRAF PETG LMY IN+AH+ GVTAIA TSDC++V+SGGGEG+VRVW+I  C+  +                        +E A+KEH ++VSCIR+ +++ +CV++S DGTCIIW L++  R Q++ ANTLF+CVC+ P+E QIITSGTDRKI YWEV+DG++IRELEGS SGS+NGMDIT +G  FVTGG+D +VKVW YNEG VTHVG+GHS  ITR+RISP  Q I +VS DGAI  WK+P
Sbjct:   10 QVAELELDAVIGFNGHVPTGLKCHPDQEHMIYPLGCTVLIQAINTKEQNFLQGHGNNVSCLAISRSGEYIASGQVTFMGFKADIILWDYKNRELLARLSLHKGKIEALAFSPNDLYLVSLGGPDDGSVVVWSIAKRDAICGSPAAGLNVGNATNVIFSRCRDEMFMTAGNGTIRVWELDLPNRKIWPTECQTGQLKRIVMSIGVDDDDSFFYLGTTTGDILKMNPRTKLLTDVGPAKDKFSLGVSAIRCLKMGGLLVGSGAGLL----VFCKSPGYKPIKKI-------QLQGGITSITLRGEGHQFLVGTEESHIYRVSFTDFKETLIATCHFDAVEDIVFPFGTAELFATCAKKDIRVWHTSSNRELLRITVPNMTCHGIDFMRDGKSIISAWNDGKIRAFAPETGRLMYVINNAHRIGVTAIATTSDCKRVISGGGEGEVRVWQI-GCQTQK------------------------LEEALKEHKSSVSCIRVKRNNEECVTASTDGTCIIWDLVRLRRNQMILANTLFQCVCYHPEEFQIITSGTDRKIAYWEVFDGTVIRELEGSLSGSINGMDITQEGVHFVTGGNDHLVKVWDYNEGEVTHVGVGHSGNITRIRISPGNQYIVSVSADGAILRWKYP 617          
BLAST of wdr-1 vs. UniProt/SwissProt
Match: sp|Q5F201|CFA52_MOUSE (Cilia- and flagella-associated protein 52 OS=Mus musculus OX=10090 GN=Cfap52 PE=1 SV=1)

HSP 1 Score: 720.309 bits (1858), Expect = 0.000e+0
Identity = 348/644 (54.04%), Postives = 458/644 (71.12%), Query Frame = 2
Query:   86 EINKLELINVIGFNGTILDGLHVHPDRQHIIYGLGCTVVIEDLNTKNQCFLQGHTNNVVCITVSNSGKYIASGQITHMGYKADIMLWDYVTKQCVSTFSLHKVKVQSLAFSPNEKYLASLGGQDDGCVVIWSLTKMEPICGSPAQHKSAGITECLVYSNTNDDVFVTAGENTLRVWELDVENRKIRPTECSLGAIKRSIKCITISKDDSVFFCGTSSGDILGVNMKSCLLSCIGPEKETFSLGVLSIIRLINGDLIVGAGDGTICQVKVVEKKEGNKIMPKIVKTSNSCMLVGGVSSITLRGQGHQFYAGTEKSHIYRFSLGDFKSELINTAHYSAVNDIVYPNNCPKLFVTCSFQDVRVFHSDSQKELLRINIPNMTCYTCDIFKDGTAIITGWDDSKIRAFYPETGALMYTINDAHKKGVTAIAATSDCRKVVSGGGEGQVRVWRIEECKVSQANTIPHSHGNRKKSNVKSVVYVAHMETAMKEHANAVSCIRMNKDDTQCVSSSADGTCIIWCLIKYTRKQIMFANTLFRCVCWRPDECQIITSGTDRKIGYWEVYDGSLIRELEGSRSGSVNGMDITADGDIFVTGGDDKIVKVWKYNEGYVTHVGLGHSMPITRLRISPDRQLITTVSEDGAIYFWKFP 2017
            ++ +LEL  VIGFNG + +GL  HPD++H+IY LGCTV+I+ +NT  Q FL GH NNV C+T+S  G YIASGQ+T MG+KADI+LWD+  ++ ++  SLHK K+++LAFSPN+ YL SLGG DDG VV+WS+ K + ICGSPA   + G    +V+S   D++FVTAG  T+RVWELD+ NRKI PTEC  G +KR +    ++ DDS F+ GT++GDIL +N K+ LL+  GP K+ FSLGV ++  L  G L+VG+G G +   K    K   K+            L GG++SITLRG+GHQF+ GTE+SHIYR +  DFK  LI T H+ AV DIV+P    +LF TC+ +D+RV+H+ S++ELLRI +PNMTC+  D  +DG +II+ WDD KIRAF PE+G LMYTIN AH+ GVTAIA TSDC++++SGGGEG+VRVW++  C+  +                        +E A+KEH ++VSCIR+ K++ +CV++S DGTCIIW L++  R Q++ ANTLF+CVC+ P+E QIITSGTDRKI YWEV+DGS+IRELEGS SGS+NGMDIT +G  FVTGG D +VKVW YNEG VTHVG+GHS  I  +RISP  Q I +VS DGAI  WK+P
Sbjct:   10 DVAELELQAVIGFNGHVPNGLKCHPDQEHLIYPLGCTVLIQAINTNEQNFLHGHGNNVSCVTISKEGDYIASGQVTFMGFKADIILWDFKKRELIARLSLHKGKIEALAFSPNDLYLVSLGGPDDGSVVVWSIAKRDAICGSPAAGLNVGNATSVVFSRCRDEMFVTAGNGTIRVWELDLPNRKIWPTECQTGQMKRIVLSTGMADDDSFFYLGTTTGDILKMNPKTKLLADTGPVKDKFSLGVSALRCLKMGGLLVGSGAGLLIFCKSPSYKPIKKV-----------QLQGGITSITLRGEGHQFFVGTEESHIYRVNFTDFKETLIATCHFEAVQDIVFPFGTAELFATCAKKDIRVWHTMSKRELLRITVPNMTCHGIDFMRDGKSIISAWDDGKIRAFAPESGRLMYTINSAHRIGVTAIATTSDCKRIISGGGEGEVRVWQV-GCQTQK------------------------LEEALKEHKSSVSCIRVKKNNEECVTASTDGTCIIWDLVRLRRNQMILANTLFQCVCYHPEEFQIITSGTDRKIAYWEVFDGSVIRELEGSLSGSINGMDITQEGGHFVTGGHDHLVKVWDYNEGEVTHVGVGHSGNIMAMRISPGNQYIVSVSADGAILRWKYP 617          
BLAST of wdr-1 vs. UniProt/SwissProt
Match: sp|Q95JL5|CFA52_MACFA (Cilia- and flagella-associated protein 52 OS=Macaca fascicularis OX=9541 GN=CFAP52 PE=2 SV=1)

HSP 1 Score: 637.106 bits (1642), Expect = 0.000e+0
Identity = 321/644 (49.84%), Postives = 425/644 (65.99%), Query Frame = 2
Query:   86 EINKLELINVIGFNGTILDGLHVHPDRQHIIYGLGCTVVIEDLNTKNQCFLQGHTNNVVCITVSNSGKYIASGQITHMGYKADIMLWDYVTKQCVSTFSLHKVKVQSLAFSPNEKYLASLGGQDDGCVVIWSLTKMEPICGSPAQHKSAGITECLVYSNTNDDVFVTAGENTLRVWELDVENRKIRPTECSLGAIKRSIKCITISKDDSVFFCGTSSGDILGVNMKSCLLSCIGPEKETFSLGVLSIIRLINGDLIVGAGDGTICQVKVVEKKEGNKIMPKIVKTSNSCMLVGGVSSITLRGQGHQFYAGTEKSHIYRFSLGDFKSELINTAHYSAVNDIVYPNNCPKLFVTCSFQDVRVFHSDSQKELLRINIPNMTCYTCDIFKDGTAIITGWDDSKIRAFYPETGALMYTINDAHKKGVTAIAATSDCRKVVSGGGEGQVRVWRIEECKVSQANTIPHSHGNRKKSNVKSVVYVAHMETAMKEHANAVSCIRMNKDDTQCVSSSADGTCIIWCLIKYTRKQIMFANTLFRCVCWRPDECQIITSGTDRKIGYWEVYDGSLIRELEGSRSGSVNGMDITADGDIFVTGGDDKIVKVWKYNEGYVTHVGLGHSMPITRLRISPDRQLITTVSEDGAIYFWKFP 2017
            ++ +LEL  VIGFNG +  GL  HPD++H+I+ LGCT++I+ +NT+ Q FLQGH NNV C+ +S SG+YIASGQ+T MG+KADI+LWDY  ++ ++  SLHK K+++LAFSPN+ YL SLGG DDG VV+WS+ K + ICGSPA   + G    +++S   D++FVTAG  T+RVWELD+ NRKI PTEC  G +KR +  I ++ DDS F+ GT++GDIL +N ++ LL+  GP K+ FSLGV +I  L  G L+VG+G G +   K    K   KI  +           GG++SITLRG+GHQF+ GTE+SHIYR S  DFK  LI T H+ AV DIV+P    +LF TC+ +D+RV+H+ S                                                 N AH+ GVTAIA TSDC++V+SGGGEG+VRVW+I  C+  +                        +E A+KEH ++VSCIR+ K++ +CV++S DGTCIIW L++  R Q++ ANTLF+CVC+ P+E QIITSGTDRKI YWEV+DG++IRELEGS SGS+NGMDIT +G  FVTGG+D +VKVW YNEG VTHVG+GHS  ITR+RISP  Q I +VS DGAI  WK+P
Sbjct:   10 QVAELELDAVIGFNGHVPTGLKCHPDQEHLIFPLGCTILIQAINTQEQNFLQGHGNNVSCLAISRSGRYIASGQVTFMGFKADIILWDYKKRELLARLSLHKGKIEALAFSPNDLYLVSLGGPDDGSVVVWSIAKRDAICGSPAAGLNVGNATNVIFSRCRDEMFVTAGNGTIRVWELDLPNRKIWPTECQTGQMKRIVMSIGMADDDSFFYLGTTTGDILKMNPRTKLLTDAGPAKDKFSLGVSAIRCLKMGGLLVGSGAGLLVFCKSPSYKPIKKIQSQ-----------GGITSITLRGEGHQFFVGTEESHIYRVSFTDFKETLIATCHFEAVEDIVFPFGTAELFATCAKKDIRVWHTSS-------------------------------------------------NSAHRIGVTAIATTSDCKRVISGGGEGEVRVWQI-GCQTQK------------------------LEEALKEHKSSVSCIRVKKNNEECVTASTDGTCIIWDLVRLRRNQMILANTLFQCVCYHPEEFQIITSGTDRKIAYWEVFDGTVIRELEGSLSGSINGMDITQEGVHFVTGGNDHLVKVWDYNEGEVTHVGVGHSGNITRIRISPGNQYIVSVSADGAILRWKYP 568          
BLAST of wdr-1 vs. UniProt/SwissProt
Match: sp|A8ILK1|CFA52_CHLRE (Cilia- and flagella-associated protein 52 OS=Chlamydomonas reinhardtii OX=3055 GN=CFAP52 PE=1 SV=1)

HSP 1 Score: 542.732 bits (1397), Expect = 0.000e+0
Identity = 263/643 (40.90%), Postives = 398/643 (61.90%), Query Frame = 2
Query:   98 LELINVIGFNGTILDGLHVHPDRQHIIYGLGCTVVIED-LNTKNQCFLQGHTNNVVCITVSNSGKYIASGQITHMGYKADIMLWDYVTKQCVSTFSLHKVKVQSLAFSPNEKYLASLGGQDDGCVVIWSLTKMEPICGSPAQHKSAGITECLVYSNTNDDVFVTAGENTLRVWELDVENRKIRPTECSLGAIKRSIKCITISKDDSVFFCGTSSGDILGVNMKSCLLSCIGPEKETFSLGVLSIIRLINGDLIVGAGDGTICQVKVVEKKEGNKIMPKIVKTSNSCMLVGGVSSITL---RGQGHQFYAGTEKSHIYRFSLGDFKSELINTAHYSAVNDIVYPNNCPKLFVTCSFQDVRVFHSDSQKELLRINIPNMTCYTCDIFKDGTAIITGWDDSKIRAFYPETGALMYTINDAHKKGVTAIAATSDCRKVVSGGGEGQVRVWRIEECKVSQANTIPHSHGNRKKSNVKSVVYVAHMETAMKEHANAVSCIRMNKDDTQCVSSSADGTCIIWCLIKYTRKQIMFANTLFRCVCWRPDECQIITSGTDRKIGYWEVYDGSLIRELEGSRSGSVNGMDITADGDIFVTGGDDKIVKVWKYNEGYVTHVGLGHSMPITRLRISPDRQLITTVSEDGAIYFWKF 2014
            L L +VIGF G I +GL  HPD + IIY LG T+V+ D  + ++Q FLQGH++ V C+ +S SG+Y+ASGQIT+MG+ ADI++WD  +KQ +   +LHKVKVQ+L FS +E++LASLGGQDD  +V+W +     ICGSP    +   T C+ + N + D  +TAG   + VW  D  N K+RPT+ +LG +KR  K + +  +D   +CGT++GD+L + ++  L    GP K    +GV +   +  GD++VG GDG++  ++ +    G K+              G ++SI L     +G  F+ GT   +IY+ +    K EL+ TAH   +N + +PN   ++F TC    +R++H  + +ELLRI +PN+ C+      DG+AI++GW D KIRAF P++G +++TINDAH+K VTAIA+T+D  +++SGG EG VRVWRI   + SQ                        +E +MK+H   V+CIR+     +CVS+S+DG+CI+W L  + R+  +FANT F+ V + PDE Q++T+GTDRK+ YW+ YDG+ IR ++GS    VN + +  DG+  V+GG DK+VK+W Y+EG+   VG+ HS  IT + ++PD+Q I +V  +G I+ W +
Sbjct:    5 LVLNSVIGFGGAIENGLIAHPDGRTIIYPLGSTIVLRDRADPRSQEFLQGHSDKVSCLALSRSGRYLASGQITYMGFTADIIIWDLESKQLIHRMALHKVKVQALDFSCDERFLASLGGQDDNALVLWDVASGNAICGSPC---NTNFTNCVKFFNNSPDKLITAGNFNMNVWTYDAGNNKLRPTDATLGTLKRVFKSVVVDANDEYAYCGTTTGDVLQIALERVLFKNTGPAKGNVQMGVTATCEVPTGDILVGGGDGSLQLLRKMPALAGTKVE-------------GAITSIALADMNARGFTFFVGTAMCNIYKPATSRLKEELVQTAHNDKINGMAFPNEYSEVFATCGTGFIRLWHLTTCRELLRIAVPNLECFCIAFTTDGSAILSGWSDGKIRAFGPQSGKIIFTINDAHQKAVTAIASTADSSRILSGGEEGMVRVWRIG--RTSQT-----------------------LEASMKDHKGPVNCIRIKGSGDECVSASSDGSCILWDLHTFKRRTSLFANTFFKSVVYHPDESQLVTAGTDRKVTYWDAYDGNAIRIIDGSDLDEVNALAVDRDGEALVSGGGDKLVKLWGYDEGHCYFVGVAHSGAITAVGVTPDKQRIVSVGTEGGIFIWDY 606          
BLAST of wdr-1 vs. UniProt/SwissProt
Match: sp|Q6ZPG2|WDR90_MOUSE (WD repeat-containing protein 90 OS=Mus musculus OX=10090 GN=Wdr90 PE=1 SV=2)

HSP 1 Score: 114.005 bits (284), Expect = 1.527e-24
Identity = 109/465 (23.44%), Postives = 198/465 (42.58%), Query Frame = 2
Query:   92 NKLELINVIGFNGTILDGLHVHPDRQHIIYGLGCTVVIEDLNTKNQCFLQGHTNNVVCITVSNSGKYIASGQIT-HMGYKADIMLWDYVTKQCVSTFSLHKVKVQSLAFSPNEKYLASLGGQDDGCVVIWSLTKMEPICGSPAQHKSAGITECLVYSNTNDDVFVTAGENTLRVWELDVE--------NRKIRPTECSLGAIKRSIKCITISKDDSVFFCGTSSGD--ILGVNMKSCLLSCIGPEKETFSLGVL--SIIRLINGDLIVGAGDGTICQVKVVE--KKEGNKIMPKIVKTSNSCMLVGGVSSITLRGQGHQFYAGTEKSHIYRFSLGDFKSELINTAHYSAVNDIVYPNNCPKLFVTCSFQDVRVFHSDSQKELLRINIPNMTCY-------TCDIFKDGTAIITGWDDSKIRAFYPETGALMYTINDAHKKGVTAIAATSDCRKVVSGGGEGQVRV 1420
             +L L  ++G+NG     +   PD     Y  G  VV+EDL++  Q    GH+  +  + ++  G+ +AS     +   +  I +WD     C    S H   VQ+LAFSP++++L +LG   D  + +WS+   E +  +       G+     ++  + +  +  G N +  W L           +R+  P E  LGA + +  C   S    + +CG+SSG   +       C L+    E +   +GVL  S  RLI+G          +  V VV   +++G+      V       L G V S +          GT    I+  S  +  S  + + H + VN++V+               VRV+   S + +++  + N +C        +C++  +   ++ G+ D  +R F     A+   ++  H+  +TAIA ++D + ++SG  +G V +
Sbjct: 1230 ERLRLKAIVGYNGNGRANMVWRPDTGFFAYTCGRLVVVEDLHSGTQRHWLGHSQEISTLALNQDGQILASASCCGNTAARCQIRIWDVPKGLCRHLLSHHDTAVQALAFSPDDEFLVTLGDYADRNLALWSMATYELLSSTRLLEPVHGV----AFNPWDANELICVGTNAITFWLLQHHGADTCFQVHREPIPEE--LGASELTSLCYGASP---LLYCGSSSGQVCVWDTGTGHCFLAW---EADDGEIGVLLCSGSRLISGS---NTKRLRLWAVGVVPELRRKGSSARSSSVFMERELTLDGAVVSASFDSGMDMGVVGTTAGTIWYISWTEGTSTRLISGHRTKVNEVVFSPGESHCATCGEDGSVRVWSLASMELVIQFQVLNQSCLCLAWTPPSCEL-PEQQQVVAGYSDGTLRVFSISRTAMELKMH-PHRTALTAIAFSTDGQTILSGDKDGLVAI 1677          

HSP 2 Score: 82.8037 bits (203), Expect = 7.489e-15
Identity = 136/698 (19.48%), Postives = 259/698 (37.11%), Query Frame = 2
Query:   98 LELINVIGFNGTILDGLHVHPDRQHIIYGLGCTVVIEDLNTKNQCFLQGHTNNVVCITVSNSGKYIASGQITHMGYKADIMLWDYVTKQCVSTFSLHKVKVQSLAFSPNEKYLASLGGQDDGCVVIWSLTKMEPICGSPAQHKSAGITECLVYSNTNDDV------------FVTAGENTLRVWELDVENRKIRPTECSLG----------AIKRSIKCITISKDDSVFFCGTSSGDILGVNMKSC-------LLSCIGP-----EKETFSLG---VLSIIRLINGDLIVGAGDGTICQVKVVEKKEGNKIMPKIVKTSNSCMLV-----GGVSSITLRGQGHQFYAGTEKSHIYRFSLGDFKSELINTAHYSAVNDIVYPNNCPKLFVTCSFQDVRVFHSDSQKELLRINIPNMTCYTCDIFKDGTAIITGWDDSKIRAFYPETGALMYTINDAHKKGVTAIAATSDCRKVVSGGGEGQVRVWRIEECKVSQ-------ANTIPHSHGNRKKSNVKSV---------VYVAHMETAMKEHANAVSCIRMNKDDTQCVSSSADGTCIIWCLIKYTRKQIMFANTLFRCVCWRP-DECQIITSGTDRKIGYWEVYDGSLIRELEGSRSGSVNGMDITADGDIFVTGGDDKIVKVWKY--NEGYVTHVGLGHSMPITRLRISPDRQLITTVSEDGAIYFW 2008
            L L  VIGF G          D   ++Y     +++  ++T  Q F  GHT+ V  + ++ S   +AS Q+      + + LWD+ T  C+S F      + SL+FS +   L  +G    G  V+        +  S  Q    G    L   +T+ D+              + G  ++R+W L      +R     LG          A  +++         ++F C + SG IL ++ +         LL    P     EK+ FS+G    +S + +      VG+ DG +                ++     S +L+     G VSS++    G +  + T   H+    +   +  ++  +H + V  +    N  ++        VR++   + ++L   +    T               G+    +R+F  E+  ++   +  H+  +T++  T D R + S   +G +  +    C  SQ       AN +      R   N+ +V         V  +     + E A+    +R++       S+  D     W +                 +C+ P +   ++ S +  K+   +   G  +REL   RS +   + ++ D  + +    D+ + VW Y         V +GHS P+  +  +PD+  + +V +  AI+ W
Sbjct:  421 LRLKGVIGFGGHSTQWALWTKDGVAVVYPCHAVIIVLQIDTGQQRFFLGHTDKVSALALNGSDTLLASAQVQP---PSMVRLWDFQTGSCLSLFRSPLHTICSLSFSGSGALLCGVGKDRHGRTVV--------VAWSTEQAGLGGEVVVLAKVHTDFDIRAFQVAFFDETRMASCGRGSVRLWRL--RGGVLRSCAVDLGEYCSLELTDLAFAQALDGHCAPSAGTLFVC-SHSGHILEIDHQRMSVQHVRRLLPARSPGAPLAEKQNFSVGSGIAISSLSVSTATCAVGSEDGYL----------------RLWPLDFSSVLLEAEHDGPVSSVSFSPDGLRVLSTTTSGHLGFLDVPSREYTVLARSHMAPVLALSTEPNRGQMATVSLDHTVRIWDLATLQQLYDFSSSEDTPCAVAFHPTMPNFFCGFSSGAVRSFSLESSGVLVE-HTRHRGAITSLVITLDGRFLFSSCSQGSLVQY---SCADSQCCVLRVAANMV--CQDGRPNPNILAVSGDSCRLAFVGPSKCMVTIVESASLDELLRVDVSTLNLASNHLD-----WAV----------------AICFSPGNSGHLLVSTSSNKVVVLDAVSGHTLRELSSVRSRACCSLALSEDAHLLL-AATDRTITVWDYPTQANPSCQVYIGHSEPVHAVAFTPDQLQVISVGD--AIFLW 1058          
BLAST of wdr-1 vs. TrEMBL
Match: A0A0A1CTQ1 (Wdr-1 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=wdr-1 PE=2 SV=1)

HSP 1 Score: 1045.42 bits (2702), Expect = 0.000e+0
Identity = 506/506 (100.00%), Postives = 506/506 (100.00%), Query Frame = 2
Query:  176 IYGLGCTVVIEDLNTKNQCFLQGHTNNVVCITVSNSGKYIASGQITHMGYKADIMLWDYVTKQCVSTFSLHKVKVQSLAFSPNEKYLASLGGQDDGCVVIWSLTKMEPICGSPAQHKSAGITECLVYSNTNDDVFVTAGENTLRVWELDVENRKIRPTECSLGAIKRSIKCITISKDDSVFFCGTSSGDILGVNMKSCLLSCIGPEKETFSLGVLSIIRLINGDLIVGAGDGTICQVKVVEKKEGNKIMPKIVKTSNSCMLVGGVSSITLRGQGHQFYAGTEKSHIYRFSLGDFKSELINTAHYSAVNDIVYPNNCPKLFVTCSFQDVRVFHSDSQKELLRINIPNMTCYTCDIFKDGTAIITGWDDSKIRAFYPETGALMYTINDAHKKGVTAIAATSDCRKVVSGGGEGQVRVWRIEECKVSQANTIPHSHGNRKKSNVKSVVYVAHMETAMKEHANAVSCIRMNKDDTQCVSSSADGTCIIWCLIKYTRKQIMFANTLFRCVC 1693
            IYGLGCTVVIEDLNTKNQCFLQGHTNNVVCITVSNSGKYIASGQITHMGYKADIMLWDYVTKQCVSTFSLHKVKVQSLAFSPNEKYLASLGGQDDGCVVIWSLTKMEPICGSPAQHKSAGITECLVYSNTNDDVFVTAGENTLRVWELDVENRKIRPTECSLGAIKRSIKCITISKDDSVFFCGTSSGDILGVNMKSCLLSCIGPEKETFSLGVLSIIRLINGDLIVGAGDGTICQVKVVEKKEGNKIMPKIVKTSNSCMLVGGVSSITLRGQGHQFYAGTEKSHIYRFSLGDFKSELINTAHYSAVNDIVYPNNCPKLFVTCSFQDVRVFHSDSQKELLRINIPNMTCYTCDIFKDGTAIITGWDDSKIRAFYPETGALMYTINDAHKKGVTAIAATSDCRKVVSGGGEGQVRVWRIEECKVSQANTIPHSHGNRKKSNVKSVVYVAHMETAMKEHANAVSCIRMNKDDTQCVSSSADGTCIIWCLIKYTRKQIMFANTLFRCVC
Sbjct:    1 IYGLGCTVVIEDLNTKNQCFLQGHTNNVVCITVSNSGKYIASGQITHMGYKADIMLWDYVTKQCVSTFSLHKVKVQSLAFSPNEKYLASLGGQDDGCVVIWSLTKMEPICGSPAQHKSAGITECLVYSNTNDDVFVTAGENTLRVWELDVENRKIRPTECSLGAIKRSIKCITISKDDSVFFCGTSSGDILGVNMKSCLLSCIGPEKETFSLGVLSIIRLINGDLIVGAGDGTICQVKVVEKKEGNKIMPKIVKTSNSCMLVGGVSSITLRGQGHQFYAGTEKSHIYRFSLGDFKSELINTAHYSAVNDIVYPNNCPKLFVTCSFQDVRVFHSDSQKELLRINIPNMTCYTCDIFKDGTAIITGWDDSKIRAFYPETGALMYTINDAHKKGVTAIAATSDCRKVVSGGGEGQVRVWRIEECKVSQANTIPHSHGNRKKSNVKSVVYVAHMETAMKEHANAVSCIRMNKDDTQCVSSSADGTCIIWCLIKYTRKQIMFANTLFRCVC 506          
BLAST of wdr-1 vs. TrEMBL
Match: A0A074Z155 (WD_REPEATS_REGION domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=T265_11948 PE=4 SV=1)

HSP 1 Score: 858.21 bits (2216), Expect = 0.000e+0
Identity = 398/658 (60.49%), Postives = 500/658 (75.99%), Query Frame = 2
Query:   74 EEVNEINKLELINVIGFNGTILDGLHVHPDRQHIIYGLGCTVVIEDLNTKNQCFLQGHTNNVVCITVSNSGKYIASGQITHMGYKADIMLWDYVTKQCVSTFSLHKVKVQSLAFSPNEKYLASLGGQDDGCVVIWSLTKMEPICGSPAQHKSAGITECLVYSNTNDDVFVTAGENTLRVWELDVENRKIRPTECSLGAIKRSIKCITISKDDSVFFCGTSSGDILGVNMKSCLLSCIGPEKETFSLGVLSIIRLINGDLIVGAGDGTICQVKVVEKKEGNKIMPKIVKTSNSCMLVGGVSSITLRGQGHQFYAGTEKSHIYRFSLGDFKSELINTAHYSAVNDIVYPNNCPKLFVTCSFQDVRVFHSDSQKELLRINIPNMTCYTCDIFKDGTAIITGWDDSKIRAFYPETGALMYTINDAHKKGVTAIAATSDCRKVVSGGGEGQVRVWRIEECKVS----QANTIPHSHGNRK-----KSNVKSVVYVAHMETAMKEHANAVSCIRMNKDDTQCVSSSADGTCIIWCLIKYTRKQIMFANTLFRCVCWRPDECQIITSGTDRKIGYWEVYDGSLIRELEGSRSGSVNGMDITADGDIFVTGGDDKIVKVWKYNEGYVTHVGLGHSMPITRLRISPDRQLITTVSEDGAIYFWKFPN 2020
            EE      L+L  VIG NG I     +HPDRQH ++ LGCTV+I+D+NT  Q FLQGHTNN+VC+TVS +G YIASGQ T+MGYKA I++W+Y T++  + F LHKVKVQ+LAFSPN  YLASLGGQDDG VVIWS+ K E ICGSPAQH+SAGIT  L Y+N +++ F+TAGENT+R+W+LD+ENRKIRP +C+LG IKR++ CI +  DD +FFCGTSSGDILG+NM S LL  + PEK  +SLGV +I  + N  L++G GDG + +  +   +EG++  PK+ +T     L G V++I+LRG+GHQFY  T+K ++Y F   DF  ELI ++HY+AVNDI +PN C +LF TCS+QDVRVF++ +Q+ELLRI IPNMTCY  DI  DGTAI++GWDDSKIRAFYPETG LMY+I++AHKKGVTAI +TS C +++SGGGEG +RVW I+E +          + H H   +      + +    +V  +  AM EH NAVSCI+++KDD  CVS+SAD TCIIWCL  + R+QI+F+NTLFRC+C+ P ECQ+ITSGTDRKIGYWEVYDGSLIR+L+GSRSGSVNGMDIT DG  FVT GDDKIVKVWKYNEG VTHVG+GHS P+TRLRISPD+  + TVSEDGAIY W  P 
Sbjct:    6 EEDLGFEHLKLSGVIGLNGKIPHSFTMHPDRQHAVFALGCTVIIQDMNTHEQHFLQGHTNNIVCLTVSKNGMYIASGQTTYMGYKASIIVWNYETREKYAEFVLHKVKVQALAFSPNSMYLASLGGQDDGSVVIWSIGKKEAICGSPAQHQSAGITLALAYANLDEEKFITAGENTVRIWQLDLENRKIRPRDCALGQIKRTVLCIAVYPDDDLFFCGTSSGDILGINMHSALLQIVSPEKNKYSLGVSTITAMSNSTLLIGTGDGVVQECAISYNREGHRCYPKLSRTKQEQKLSGKVTAISLRGEGHQFYVATDKCNLYLFKHADFSQELIYSSHYAAVNDIRFPNKCSELFATCSYQDVRVFNTGTQQELLRITIPNMTCYCLDILTDGTAILSGWDDSKIRAFYPETGRLMYSIHNAHKKGVTAICSTSKCNRIISGGGEGHLRVWDIKEIRPKIEKFGHRRLRHRHSAGRLEAGDDAGIPESSFVTVLVAAMHEHTNAVSCIQISKDDKSCVSASADSTCIIWCLETFRRRQIIFSNTLFRCICYHPTECQVITSGTDRKIGYWEVYDGSLIRQLDGSRSGSVNGMDITGDGKTFVTAGDDKIVKVWKYNEGEVTHVGIGHSSPVTRLRISPDQSKVITVSEDGAIYIWDMPQ 663          
BLAST of wdr-1 vs. TrEMBL
Match: A0A4V3SFP3 (WD_REPEATS_REGION domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_003820 PE=4 SV=1)

HSP 1 Score: 857.055 bits (2213), Expect = 0.000e+0
Identity = 398/659 (60.39%), Postives = 499/659 (75.72%), Query Frame = 2
Query:   74 EEVNEINKLELINVIGFNGTILDGLHVHPDRQHIIYGLGCTVVIEDLNTKNQCFLQGHTNNVVCITVSNSGKYIASGQITHMGYKADIMLWDYVTKQCVSTFSLHKVKVQSLAFSPNEKYLASLGGQDDGCVVIWSLTKMEPICGSPAQHKSAGITECLVYSNTNDDVFVTAGENTLRVWELDVENRKIRPTECSLGAIKRSIKCITISKDDSVFFCGTSSGDILGVNMKSCLLSCIGPEKETFSLGVLSIIRLINGDLIVGAGDGTICQVKVVEKKEGNKIMPKIVKTSNSCMLVGGVSSITLRGQGHQFYAGTEKSHIYRFSLGDFKSELINTAHYSAVNDIVYPNNCPKLFVTCSFQDVRVFHSDSQKELLRINIPNMTCYTCDIFKDGTAIITGWDDSKIRAFYPETGALMYTINDAHKKGVTAIAATSDCRKVVSGGGEGQVRVWRIEECKVSQANTIPHSHGNRKKSN----------VKSVVYVAHMETAMKEHANAVSCIRMNKDDTQCVSSSADGTCIIWCLIKYTRKQIMFANTLFRCVCWRPDECQIITSGTDRKIGYWEVYDGSLIRELEGSRSGSVNGMDITADGDIFVTGGDDKIVKVWKYNEGYVTHVGLGHSMPITRLRISPDRQLITTVSEDGAIYFWKFPN 2020
            EE      L+L  VIG NG I     +HPDRQH ++ LGCTV+I+D+NT  Q FLQGHTNN+VC+TVS +G YIASGQ T+MGYKA I++W Y T++  + F LHKVKVQ+LAFSPN  YLASLGGQDDG VV+WS+ K E ICGSPAQH+SAGIT  L Y+N +++ FVTAGENT+R+W+LD+ENRKIRP +C+LG IKR++ CI +  DD +FFCGTSSGDILG+NM+S LL  + PEK  +SLGV +I  L N  L++G GDG + +  +   +EG++  PK+ +T     L G V++I+LRG+GHQFY  T+K ++Y F   D   ELI ++HY+AVNDI +PN C +LF TCS+QDVRVF++ +Q+ELLRI IPNMTCY  DI  DGTAI++GWDDSKIRAFYPETG LMY+I++AHKKGVTA+ +TS C +++SGGGEG +RVW I+E +  +     H    R+ S           +    +V  +  AM EH NAVSCI+++KDD  CVS+SAD TCIIWCL  + R+QI+F+NTLFRC+C+ P ECQ+ITSGTDRKIGYWEVYDGSLIR+L+GSRSGSVNGMDIT DG  FVT GDDKIVKVWKYNEG VTHVG+GHS P+TRLRISPD+  + TVSEDGAIY W  P 
Sbjct:    6 EEDLGFEHLKLSGVIGLNGKIPHSFTMHPDRQHAVFALGCTVIIQDMNTHEQHFLQGHTNNIVCLTVSKNGMYIASGQTTYMGYKASIIVWKYETREKYAEFVLHKVKVQALAFSPNSMYLASLGGQDDGSVVVWSIGKKEAICGSPAQHQSAGITLALAYANLDEEKFVTAGENTVRIWQLDLENRKIRPRDCALGHIKRTVLCIAVYPDDDLFFCGTSSGDILGINMQSALLQIVSPEKNKYSLGVSTITALSNSTLLIGTGDGVVQECAISYNREGHRCYPKLSRTKQEQKLSGKVTAISLRGEGHQFYVATDKCNLYLFKHADLSQELIYSSHYAAVNDIRFPNKCSELFATCSYQDVRVFNTGTQQELLRITIPNMTCYCLDILADGTAILSGWDDSKIRAFYPETGRLMYSIHNAHKKGVTALCSTSKCNRIISGGGEGHLRVWDIKEIR-PKIEKFGHRRPRRRHSTGRPEAGDDAGIPESTFVTVLVAAMHEHTNAVSCIQISKDDKSCVSASADSTCIIWCLETFRRRQIIFSNTLFRCICYHPTECQVITSGTDRKIGYWEVYDGSLIRQLDGSRSGSVNGMDITGDGKTFVTAGDDKIVKVWKYNEGEVTHVGIGHSSPVTRLRISPDQSKVITVSEDGAIYIWGMPQ 663          
BLAST of wdr-1 vs. TrEMBL
Match: A0A3R7GMT1 (Cilia-and flagella-associated protein 52 OS=Clonorchis sinensis OX=79923 GN=CFAP52 PE=4 SV=1)

HSP 1 Score: 855.899 bits (2210), Expect = 0.000e+0
Identity = 401/661 (60.67%), Postives = 501/661 (75.79%), Query Frame = 2
Query:   74 EEVNEINKLELINVIGFNGT---ILDGLHVHPDRQHIIYGLGCTVVIEDLNTKNQCFLQGHTNNVVCITVSNSGKYIASGQITHMGYKADIMLWDYVTKQCVSTFSLHKVKVQSLAFSPNEKYLASLGGQDDGCVVIWSLTKMEPICGSPAQHKSAGITECLVYSNTNDDVFVTAGENTLRVWELDVENRKIRPTECSLGAIKRSIKCITISKDDSVFFCGTSSGDILGVNMKSCLLSCIGPEKETFSLGVLSIIRLINGDLIVGAGDGTICQVKVVEKKEGNKIMPKIVKTSNSCMLVGGVSSITLRGQGHQFYAGTEKSHIYRFSLGDFKSELINTAHYSAVNDIVYPNNCPKLFVTCSFQDVRVFHSDSQKELLRINIPNMTCYTCDIFKDGTAIITGWDDSKIRAFYPETGALMYTINDAHKKGVTAIAATSDCRKVVSGGGEGQVRVWRIEECKVS------QANTIPHSHGNRKK---SNVKSVVYVAHMETAMKEHANAVSCIRMNKDDTQCVSSSADGTCIIWCLIKYTRKQIMFANTLFRCVCWRPDECQIITSGTDRKIGYWEVYDGSLIRELEGSRSGSVNGMDITADGDIFVTGGDDKIVKVWKYNEGYVTHVGLGHSMPITRLRISPDRQLITTVSEDGAIYFWKFPN 2020
            EE      L+L  VIG NG    I     +HPDRQH ++ LGCTV+I+D+NT  Q FLQGHTNN+VC+TVS +G YIASGQ T+MGYKA I++W Y T++  + F LHKVKVQ+LAFSPN  YLASLGGQDDG VVIWS+ K E ICGSPAQH+SAGIT  L Y+N +++ FVTAGENT+R+W+LD+ENRKIRP +C+LG IKR++ CI +  DD +FFCGTSSGDILG+NM S LL  + PEK  +SLGV +I  + N  L++G GDG + +  +   +EG++  PK+ +T     L G V++I+LRG+GHQFY  T+K ++YRF   DF  ELI ++HY+AVNDI +PN C +LF TCS+QDVRVF++ +Q+ELLRI IPNMTCY  DI  DGTAI++GWDDSKIRAFYPETG LMY+I++AHKKGVTAI +TS C +++SGGGEG +RVW I+E +        +     HS G  +    + +    +V  +  AM EH NAVSCI+++KDD  CVS+SAD TCIIWCL  + R+QI+F+NTLFRC+C+ P ECQ+ITSGTDRKIGYWEVYDGSLIR+L+GSRSGSVNGMDIT DG  FVT GDDKIVKVWKYNEG VTHVG+GHS P+TRLRISPD+  + TVSEDGAIY W  P 
Sbjct:    6 EEDLGFEHLKLSGVIGLNGKERKIPHSFTMHPDRQHAVFALGCTVIIQDMNTHEQEFLQGHTNNIVCLTVSKNGMYIASGQTTYMGYKASIIVWKYETREKYAEFVLHKVKVQALAFSPNSMYLASLGGQDDGSVVIWSIGKKEAICGSPAQHQSAGITLALAYANLDEEKFVTAGENTVRIWQLDLENRKIRPRDCALGQIKRTVLCIAVYPDDDLFFCGTSSGDILGINMHSALLQIVSPEKNKYSLGVSTITAMSNSTLLIGTGDGVVQECAISYTREGHRCYPKLSRTKQEQKLSGKVTAISLRGEGHQFYVATDKCNLYRFKHADFSQELIYSSHYAAVNDIRFPNKCSELFATCSYQDVRVFNTGTQQELLRITIPNMTCYCLDILTDGTAILSGWDDSKIRAFYPETGRLMYSIHNAHKKGVTAICSTSKCNRIISGGGEGHLRVWDIKEIRPKIERFGHRRPRRRHSAGRLEAGDDAGIPESTFVTVLVAAMHEHTNAVSCIQISKDDKSCVSASADSTCIIWCLETFRRRQIIFSNTLFRCICYHPTECQVITSGTDRKIGYWEVYDGSLIRQLDGSRSGSVNGMDITGDGKTFVTAGDDKIVKVWKYNEGEVTHVGIGHSSPVTRLRISPDQSKVITVSEDGAIYIWNMPQ 666          
BLAST of wdr-1 vs. TrEMBL
Match: A0A1I8FUM8 (WD_REPEATS_REGION domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 848.195 bits (2190), Expect = 0.000e+0
Identity = 396/654 (60.55%), Postives = 503/654 (76.91%), Query Frame = 2
Query:   65 MSGEEVNEIN--KLELINVIGFNGTILDGLHVHPDRQHIIYGLGCTVVIEDLNTKNQCFLQGHTNNVVCITVSNSGKYIASGQITHMGYKADIMLWDYVTKQCVSTFSLHKVKVQSLAFSPNEKYLASLGGQDDGCVVIWSLTKMEPICGSPAQHKSAGITECLVYSNTNDDVFVTAGENTLRVWELDVENRKIRPTECSLGAIKRSIKCITISKDDSVFFCGTSSGDILGVNMKSCLLSCIGPEKETFSLGVLSIIRLINGDLIVGAGDGTICQVKVVEKKE-GNKIMPKIVKTSNSCMLVGGVSSITLRGQGHQFYAGTEKSHIYRFSLGDFKSELINTAHYSAVNDIVYPNNCPKLFVTCSFQDVRVFHSDSQKELLRINIPNMTCYTCDIFKDGTAIITGWDDSKIRAFYPETGALMYTINDAHKKGVTAIAATSDCRKVVSGGGEGQVRVWRIEECKVSQANTIPHSHGNRKKSNVKSVVYVAHMETAMKEHANAVSCIRMNKDDTQCVSSSADGTCIIWCLIKYTRKQIMFANTLFRCVCWRPDECQIITSGTDRKIGYWEVYDGSLIRELEGSRSGSVNGMDITADGDIFVTGGDDKIVKVWKYNEGYVTHVGLGHSMPITRLRISPDRQLITTVSEDGAIYFWKFP 2017
            M+ EE  +++  +LE+ ++IGFNG++L GL++HPD+QH IY +G T+V+EDL ++ Q FL GH +++ CIT+S SG++IASGQITHMG+KADI++WD+ T+   + F LHKVK+Q LAFSPN+K+L SLGGQDDG VV+WSL K E ICGSPAQ KS+G T CL YSN  D +FVTAG+N LRVWELDVENRKIRPT+   G  KR I CI+++ DD   +CGT++GD+LG+NM+S L   IGPEKE FSLGV +I  L  G+ ++GAGDGT+  ++  E+   G K   K VKT     L  GV+SI+LRG+GH+F+  TEKS IY+F+L DF   L+NT HYSA+NDI +P     LF TCS+QD+RV+H+ SQKELLRI +PNMTC+  D  +DG+ I++GWDDSKIR F+PETG LMY INDAHKKGVTAI ATSDC +++SGGGEG VRVWR+EE                 KS  K+  +V  +E A+KEHANAVSCIR++KD++QCVS+S+DG+CI+W L  + RKQIMFANTLFRCVC+ P+ECQ+ITSGTDRKI YWE+YDG+LIREL+GSRSGSVNGMDI+ DG  +VT GDDKIVKVW+Y EG VTHVG GHS PI R +I P+ +LI TVS+DG I+ WKFP
Sbjct:    1 MAHEEQEDVDFQQLEVQSIIGFNGSVLGGLNIHPDKQHQIYSIGSTLVVEDLQSRKQEFLHGHHSDIACITISRSGRFIASGQITHMGFKADIIVWDFNTRTEFARFVLHKVKIQGLAFSPNDKFLVSLGGQDDGSVVVWSLDKKEAICGSPAQSKSSGNTMCLTYSNNTDYLFVTAGDNNLRVWELDVENRKIRPTDVGTGQTKRIITCISLTMDDKTLYCGTTTGDVLGINMESRLFQHIGPEKEKFSLGVTAIALLETGEFLIGAGDGTVQIMRASEQAAPGGKKALKFVKTKKQQKLESGVTSISLRGRGHEFFVATEKSQIYKFNLADFSHTLVNTCHYSAINDIAFPFGTSDLFATCSYQDIRVWHTPSQKELLRITVPNMTCFAIDFLRDGSGIVSGWDDSKIRVFFPETGRLMYAINDAHKKGVTAITATSDCSRIISGGGEGHVRVWRVEE--------------RIAKSGQKT--FVTELEEALKEHANAVSCIRVSKDNSQCVSASSDGSCIVWDLRSFRRKQIMFANTLFRCVCFEPEECQVITSGTDRKICYWELYDGTLIRELDGSRSGSVNGMDISLDGQYYVTAGDDKIVKVWRYAEGDVTHVGQGHSSPIMRAKICPNNRLIVTVSDDGGIFVWKFP 638          
BLAST of wdr-1 vs. Ensembl Cavefish
Match: cfap52 (cilia and flagella associated protein 52 [Source:NCBI gene;Acc:103047323])

HSP 1 Score: 689.493 bits (1778), Expect = 0.000e+0
Identity = 337/658 (51.22%), Postives = 460/658 (69.91%), Query Frame = 2
Query:   65 MSGEEVNEINKLELINVIGFNGTILDGLHVHPDRQHIIYGLGCTVVIEDLNTKNQCFLQGHTNNVVCITVSNSGKYIASGQITHMGYKADIMLWDYVTKQCVSTFSLHKVKVQSLAFSPNEKYLASLGGQDDGCVVIWSLTKMEPICGSPAQHKSAGITECLVYSNTNDDVFVTAGENTLRVWELDVENRKIRPTECSLGAIKRSIKCITISKDDSVFFCGTSSGDILGVNMKSCLLSCIGPEKETFSLGVLSIIRLINGDLIVGAGDG--TIC---QVKVVEKKEGNKIMPKIVKTSNSCMLVGGVSSITLRGQGHQFYAGTEKSHIYRFSLGDFKSELINTAHYSAVNDIVYPNNCPKLFVTCSFQDVRVFHSDSQKELLRINIPNMTCYTCDIFKDGTAIITGWDDSKIRAFYPETGALMYTINDAHKKGVTAIAATSDCRKVVSGGGEGQVRVWRIEECKVSQANTIPHSHGNRKKSNVKSVVYVAHMETAMKEHANAVSCIRMNKDDTQCVSSSADGTCIIWCLIKYTRKQIMFANTLFRCVCWRPDECQIITSGTDRKIGYWEVYDGSLIRELEGSRSGSVNGMDITADGDIFVTGGDDKIVKVWKYNEGYVTHVGLGHSMPITRLRISPDRQLITTVSEDGAIYFWKFPNN 2023
            M+GEE  +++KLEL  VIGFNG +L GL  HPDR+H+IY LGCT++I++LN+  Q FL GHTNNV C+TVS SG+YIASGQ+T MG+KAD+++WDY  ++  +   LHKVKV++LAFSPNEK+L +LGGQDDG +V+W + K E ICGSPA    AG    + +S+ +D++F++AG NTLRVWELD  NRKI PT+C  G +KR IKCI I +DDS F+CGT+SGDIL VN+KS L++  GP K+ FS GV ++  L  GDL+VG+GDG  ++C     K++++ E                L G V+S+ LRG+G Q + GT  + IYRF   DFK ELI+T+H SAV+D  +P  C +LF TCS  D+RV+ +DS KE+LRI +PNMTC    I +DG +I + W+D KIR F PE+G L   I++AH  GVTAIA+  D  +++SGGGEGQVRVW I +                      S   VA    +MKEH  +V+ I++  +  +CV++S+DG CIIW L+++ R Q++ ANT F+ VC+ P+E QIITSGTDRKIGYWEV+DGS IREL GS +G++N MDI+ +G+ FVTGGD+K++KVW Y +G VTHVG+GHS  I+ +RI P+ ++I + S DGAI  W++P++
Sbjct:    1 MAGEE-QQVSKLELEAVIGFNGHVLSGLQSHPDREHVIYPLGCTLIIKNLNSGKQSFLHGHTNNVSCLTVSKSGRYIASGQVTFMGFKADVIVWDYSKREIYAQLILHKVKVEALAFSPNEKFLVTLGGQDDGSIVVWDVEKKEAICGSPASTDMAGHCLTVAFSSHSDNIFISAGNNTLRVWELDHTNRKIHPTQCQTGKLKRIIKCIEIPEDDSFFYCGTTSGDILKVNLKSRLMNSCGPVKQKFSKGVNTLKMLRTGDLLVGSGDGAFSLCSSTNFKIIKRVE----------------LEGAVTSVALRGEGQQMFVGTNAAQIYRFGYTDFKPELISTSHSSAVSDTAFPYGCSELFATCSQDDIRVWRTDSCKEVLRIKVPNMTCNALGITRDGHSIYSAWNDGKIRMFTPESGRLKLIIHNAHSLGVTAIASGKDSNRLISGGGEGQVRVWEIMQ---------------------DSYRLVA----SMKEHKASVNAIKIKSNGQECVTASSDGACIIWDLVRFVRNQMVLANTQFQTVCYHPEEYQIITSGTDRKIGYWEVFDGSAIRELYGSLTGAINSMDISQEGEHFVTGGDEKLIKVWHYTDGDVTHVGVGHSSSISSIRICPNSKVIISTSTDGAILRWRYPHS 616          
BLAST of wdr-1 vs. Ensembl Cavefish
Match: ENSAMXT00000006286.2 (mitogen-activated protein kinase-binding protein 1-like [Source:NCBI gene;Acc:103025404])

HSP 1 Score: 84.3445 bits (207), Expect = 3.142e-16
Identity = 73/254 (28.74%), Postives = 108/254 (42.52%), Query Frame = 2
Query:   53 KKLRMSGEEVNEINKLELINVIGFNGTILDGLHVHPDRQHIIYGLGCTVVIEDLNTK---NQCFLQGHTNNVVCITVSNSGKYIASGQITHMGYKADIMLWDYVTKQCVSTFSLHKVKVQSLAFSPNEKYLASLGGQDDGCVVIWSLTKMEPICGSPAQHKSAGITECLVYSNTNDDVFVTAGENTLRVWELDVENRKIRPTECS--------LGAIKRSIKCITI---SKDDSVFFCGTSSGDILGVNMKSCL 772
            KK R    + +  NK+ L  V+G   +   GL   P    + Y  GC VV+  LN K    Q  +      +  +  S+ GKY+ +G+  H+     + +WD      V     HK  V  +AFSPN KY+ S+G Q D  V +W+  K   +    A +K +     + +S  +   FVTAG   +R W L+  N   +PT           LG ++ +  C       K     FC TSSG +   N K  L
Sbjct:   26 KKNRPRANKESLSNKVTLERVLGITTSGSSGLTCDPYSGTVAYPAGCVVVL--LNPKKNRQQHIINTSRKTITTLAFSSDGKYLVTGESGHL---PAVRVWDAAEGSQVVELQEHKYGVACVAFSPNSKYIVSVGYQHDMSVNVWAWKKNTLV----ATNKVSSKVTAVSFSE-DSSYFVTAGNRHVRFWYLEPCNSNKQPTAPVPLLGRSGLLGELQNNFFCDVACGHGKKSESTFCITSSGLLCEFNAKRML 269          
BLAST of wdr-1 vs. Ensembl Cavefish
Match: mapkbp1 (mitogen-activated protein kinase-binding protein 1 [Source:NCBI gene;Acc:103030470])

HSP 1 Score: 82.8037 bits (203), Expect = 8.801e-16
Identity = 74/275 (26.91%), Postives = 116/275 (42.18%), Query Frame = 2
Query:   92 NKLELINVIGFNGTILDGLHVHPDRQHIIYGLGCTVVI-EDLNTKNQCFLQGHTNNVVCITVSNSGKYIASGQITHMGYKADIMLWDYVTKQCVSTFSLHKVKVQSLAFSPNEKYLASLGGQDDGCVVIWSLTKMEPICGSPAQHKSAGITECLVYSNTNDDVFVTAGENTLRVWELDVE-NRKIRPTECSLGA----------IKRSIKCITISKDDSVFFCGTSSGDILGVNMKSCLLSCIGPEK-ETFSLGVLSIIRLINGDLIVGAGDGTI 877
            NK+ L  V+G       GL   P    + Y  GC VV+      K    L      +  +  S  GKY+ +G+  HM     + +WD   +  V+    HK  V  +AFSPN KY+ S+G Q D  V +W+  K   +  +    K   ++    +S+ +   FVTAG   ++ W LD + + K+  T   LG               + C    K  S  FC TSSG +   N K  L   +   K ++ + G+ + + +    +  G  DGT+
Sbjct:   37 NKVTLEKVLGITSAGNRGLACDPRSGLVAYPAGCVVVLLNPKKNKQHHILNSSKKTITTVAFSPDGKYVVTGESGHM---PAVRVWDVAERTQVAELQEHKYGVACVAFSPNSKYIVSVGYQHDMIVNVWAWKKNVVVAANKVSSKVTAVS----FSD-DSSYFVTAGNRHVKFWYLDHDKSSKVNATVPLLGRSGLLGELRNNFFSDVACGKGRKAAST-FCITSSGLLCEFNDKRLLDKWVELRKNDSITTGLATSLSVTEDLIFCGCADGTV 302          
BLAST of wdr-1 vs. Ensembl Cavefish
Match: mapkbp1 (mitogen-activated protein kinase-binding protein 1 [Source:NCBI gene;Acc:103030470])

HSP 1 Score: 80.4925 bits (197), Expect = 4.615e-15
Identity = 73/274 (26.64%), Postives = 112/274 (40.88%), Query Frame = 2
Query:   92 NKLELINVIGFNGTILDGLHVHPDRQHIIYGLGCTVVI-EDLNTKNQCFLQGHTNNVVCITVSNSGKYIASGQITHMGYKADIMLWDYVTKQCVSTFSLHKVKVQSLAFSPNEKYLASLGGQDDGCVVIWSLTKMEPICGSPAQHKSAGITECLVYSNTNDDVFVTAGENTLRVWELDVE-NRKIRPTECSLGA----------IKRSIKCITISKDDSVFFCGTSSGDILGVNMKSCLLSCIGPEKETFSLGVLSIIRLINGDLIVGAGDGTI 877
            NK+ L  V+G       GL   P    + Y  GC VV+      K    L      +  +  S  GKY+ +G+  HM     + +WD   +  V+    HK  V  +AFSPN KY+ S+G Q D  V +W+  K   +  +    K   ++    +S+ +   FVTAG   ++ W LD + + K+  T   LG               + C    K  S  FC TSSG +   N K  L   +         G+ + + +    +  G  DGT+
Sbjct:   37 NKVTLEKVLGITSAGNRGLACDPRSGLVAYPAGCVVVLLNPKKNKQHHILNSSKKTITTVAFSPDGKYVVTGESGHM---PAVRVWDVAERTQVAELQEHKYGVACVAFSPNSKYIVSVGYQHDMIVNVWAWKKNVVVAANKVSSKVTAVS----FSD-DSSYFVTAGNRHVKFWYLDHDKSSKVNATVPLLGRSGLLGELRNNFFSDVACGKGRKAAST-FCITSSGLLCEFNDKRLLDKWV-----ELRTGLATSLSVTEDLIFCGCADGTV 296          
BLAST of wdr-1 vs. Ensembl Cavefish
Match: EML6 (EMAP like 6 [Source:NCBI gene;Acc:103028254])

HSP 1 Score: 70.0922 bits (170), Expect = 7.984e-12
Identity = 50/182 (27.47%), Postives = 83/182 (45.60%), Query Frame = 2
Query:   89 INKLELINVIGFNG-TILDGLHVHPDRQHIIYGLGCTVVIEDLNTKNQCFLQGHTNNVVCITVSNSGKY---IASGQITHMGYKADIMLWDYVTKQCVSTFSL-HKVKVQSLAFSPNEKYLASLGGQDDGCVVIWSLTKMEPICGSPAQHKSAGITECLVYSNTNDDVFVTAGENTLRVWEL 619
            + +L L +V G+ G    + LH   D   II+      VI++L+   Q F   HT++++C+TV+   KY   IA+GQI   G    I +WD ++KQ +S     H   V  + FS   K L S+G   +  + +W   +   +           + E   +   +D  FV+ G   ++ W L
Sbjct: 1350 VEELALDHVFGYRGFDCRNNLHYLNDGADIIFHTAAAAVIQNLSAGTQSFYLEHTDDILCLTVNQHPKYQNIIATGQI---GLAPSIHVWDAMSKQTLSVLRCSHAKGVGYVNFSATGKLLLSVGVDPEHTITVWRWQEGSKVSSKAGHSDRIFVVE---FRPDSDTQFVSVGIKHIKFWTL 1525          

HSP 2 Score: 53.9138 bits (128), Expect = 6.922e-7
Identity = 45/196 (22.96%), Postives = 86/196 (43.88%), Query Frame = 2
Query:  173 IIYGLGCTVVIEDLNTKNQCFLQGHTNNVVCITVSNSGKYIASGQITHMGYKADIMLWDYVTKQCVSTF-SLHKVKVQSLAFSPNEKYLASLGGQDDGCVVIWSLTKMEPICGSPAQHKSAGITECLVYSNTND---DVFVTAGENTLRVWELDVENRKI-RPTECSLGAIKRSIKCITISKDDSVFFCGTSSGDI 745
            ++Y +    V+ +     Q F  GH ++++ +T      Y+A+GQ+   G    I +WD  T +C+S     H+  V +L F+ + K L S+G  +   +V+W   K E +       K+ G  + +     N    D  VT G   ++ W+         R    +LG  + ++      + + + F G ++GD+
Sbjct:  695 VVYHVAAVGVVYNRQQHTQRFYLGHDDDILSLTAHPLKDYVATGQV---GRDPAIHVWDIQTLKCLSLLRGQHQRGVCALEFTADGKSLVSVGIDEGHSIVMWDWKKGEKLA------KARGHKDKIFVVKGNPFRMDKLVTVGIKHIKFWQHTGGGLTFKRGIFGNLGK-QETMMSACYGRSEDLVFSGATTGDV 880          
BLAST of wdr-1 vs. Ensembl Sea Lamprey
Match: cfap52 (cilia and flagella associated protein 52 [Source:ZFIN;Acc:ZDB-GENE-050522-296])

HSP 1 Score: 709.909 bits (1831), Expect = 0.000e+0
Identity = 341/648 (52.62%), Postives = 461/648 (71.14%), Query Frame = 2
Query:   95 KLELINVIGFNGTILDGLHVHPDRQHIIYGLGCTVVIEDLNTKNQCFLQGHTNNVVCITVSNSGKYIASGQITHMGYKADIMLWDYVTKQCVSTFSLHKVKVQSLAFSPNEKYLASLGGQDDGCVVIWSLTKMEPICGSPAQHKSAGITECLVYSNTNDDVFVTAGENTLRVWELDVENRKIRPTECSLGAIKRSIKCITISKDDSVFFCGTSSGDILGVNMKSCLLSCIGPEKETFSLGVLSIIRLINGDLIVGAGDGTICQVKVVEKKEGNKIMPKIVKTSNSCMLVGGVSSITLRGQGHQFYAGTEKSHIYRFSLGDFKSELINTAHYSAVNDIVYP---NNCPKLFVTCSFQDVRVFHSDSQKELLRINIPNMTCYTCDIFKDGTAIITGWDDSKIRAFYPETGALMYTINDAHKKGVTAIAATSDCRKVVSGGGEGQVRVWRIEECKVSQANTIPHSHGNRKKSNVKSVVYVAHMETAMKEHANAVSCIRMNKDDTQCVSSSADGTCIIWCLIKYTRKQIMFANTLFRCVCWRPDECQIITSGTDRKIGYWEVYDGSLIRELEGSRSGSVNGMDITADGDIFVT--GGDDKIVKVWKYNEGYVTHVGLGHSMPITRLRISPDRQLITTVSEDGAIYFWKFPNN 2023
            +LEL +VIGFNG +  GL  HPD +H++Y LGCTVVI  L    Q FL GHTNNV C+ VSNSG Y+ASGQ+T+MG+KAD++LW++  ++  +  +LHKVKV++LAFSPN+ YLASLGGQDDG VVIW++TK E +CG+     +AG T  + ++NT+D  F+TAG +T+RVW+LD+ NRKIRPT+C  G +KR IKC+ ++ DDS F+CGT+SGDIL VN+K+ LL+  GP K   +LGV ++  L +G+L+VG GDG +        KE N       KT     L G V+SI+LRGQGHQF+AGT  + IY+F+L +F  E+I T H   VND+ +P   +   +LF TCS QD+RV+H+ S KELLRI +PNMTC++    ++G  I++GW+D KIRAF PE+G LMY I++AH  GVT ++ T DC++++SGG  GQVRVW +               G + +  V+          AMKEH +++SCIR+  +D +CVS+S DGTCIIW L ++ RKQI+ ANTLF+C C+ P+E QIITSGTDRKIG+WEV+DGSLIRELE S+SGS+NGMD++ DG+ FVT  GGDDK++KVW YN+G VT VG GHS  +TRL + P+R  I +VS DGAI  W++P++
Sbjct:   13 RLELESVIGFNGQVPSGLVSHPDCEHLLYPLGCTVVIRSLKGARQSFLHGHTNNVSCLAVSNSGHYVASGQVTYMGFKADVILWNFEKRELHARLTLHKVKVEALAFSPNDLYLASLGGQDDGSVVIWNVTKKEAVCGNAVSLPTAGTTNTVRFTNTSDLSFITAGNDTIRVWQLDIPNRKIRPTDCQTGQLKRIIKCVAVAPDDSFFYCGTTSGDILKVNLKTKLLNSYGPAKNKLTLGVTALSLLKSGELLVGTGDGVVALC-----KEAN------FKTMQKVALEGAVTSISLRGQGHQFFAGTAVAQIYQFNLPEFTHEMIATCHSEPVNDVAFPFITSGTSELFATCSSQDIRVWHTQSGKELLRITVPNMTCHSIQFARNGKNIVSGWNDGKIRAFTPESGRLMYIIDNAHGMGVTTVSLTGDCKRIISGGVSGQVRVWEL---------------GTQSQRLVE----------AMKEHKSSISCIRLKHNDKECVSASTDGTCIIWDLERFVRKQIVMANTLFKCACYHPEEFQIITSGTDRKIGFWEVFDGSLIRELEASQSGSINGMDVSPDGEYFVTVKGGDDKLIKVWSYNDGDVTFVGKGHSGNVTRLCVCPNRWHILSVSTDGAILRWRYPHS 624          
BLAST of wdr-1 vs. Ensembl Sea Lamprey
Match: wdr90 (WD repeat domain 90 [Source:ZFIN;Acc:ZDB-GENE-070424-67])

HSP 1 Score: 98.2117 bits (243), Expect = 3.246e-21
Identity = 150/713 (21.04%), Postives = 278/713 (38.99%), Query Frame = 2
Query:   53 KKLRMSGEEVNEINKLELINVIGFNGTILDGLHVHPDRQHIIYGLGCTVVIEDLNTKNQCFLQGHTNNVVCITVSNSGKYIASGQITHMGYKADIMLWDYVTKQCVSTFSLHKVKVQSLAFSPNEKYLASLGGQDDGCVVIWSLTKMEPI-----CGSPAQHKSAGITECLVYSNTNDDVFVTAG---------ENTLRVWELDVENRKIRPTECSLGAIKRSIKCITISKDDSVFFCGTSSGDILGVN--MKSCLLSCIGPEKETFSLGVLSIIRLINGDLIVGAGDGTICQVKVVEKKEGNKIMPKIVKTSNSCMLVGGVSSITLRGQGHQF-------YAGTEKSHIYRFSLGDFKSELINTAHYSAVNDIVYPNNCPKLFVTCSFQDVRVFHSDSQKELLRINIPNMTCYTCDIFKDGTA--------IITGWDDSKIRAFYPETGALMYTINDAHKKGVTAIAATSDCRK-VVSGGGEGQVRVWRIEECKVSQANTIPHSHGNRKKSNVKSVVYVAHMET-AMKEHANAVSCIRMNKDDTQCVSSSADGTCIIWCLIKYTRKQIMFANTL-FRCVCWRPDECQIITS---------------------GTDRKIGYWEVYDGSLIRELEGSRSGSVNGMDITADGDIFVTGGDDKIVKVWKYNEGYVTHVGLGHSMPITRLRISPD-RQLITTVSEDGAIYFWKFPNN 2023
            K+ +       E+  L L  V+G+NG     L   PD   + Y  GC VV+E+L + +Q  L GH   +  + +S+  + + S     M       +WD  +  C S  S H+  VQ+LAFS ++++L SLG   DG + +W++ +   +     C  PA          L +       FV A          E   R + L ++   + P    LG  + +  C        V F GTSSG +   +   KSC L+    E ++ +LGVL       G  +V AG G   +   V   +  ++  +  + ++ C+++     +        F         GT    ++     +  S  + + H   V  + +  +      + +   +RV+ + S +  ++  +   TC  C  +    A        +  G+ D  +R F   +  ++  +  +H   VTA+A ++D  + +VSG  +G V V  +     ++  T      + + S + ++  V   E   +  H   +            +++S D    IW    + R +    + L F  +    D+ Q   S                     G  R+I ++ +    ++R+L          +D++ +GD+   G  +++V +     G    V  GH   +   R SP  R+L T  +  GAI+ W+  N+
Sbjct: 1183 KQQQQQPTTAGELPGLRLKAVVGYNGNGRGNLVWRPDNGLLAYSSGCVVVVEELRSGDQRHLLGHQREISTLAISHDAQTLVSASCGQM------CMWDVASGVCRSGPSHHRGDVQALAFSRDDRFLLSLGDGRDGSLALWAVQQDVSLLASVRCPVPAH--------ALAFRPGRAGEFVCAASGHIAFGLVEQRGREFGLSLDMVAVPP---ELGGAEVTCVCYGAG---GVVFAGTSSGLVSAWDSERKSCFLTW---EADSLALGVLE----CRGHSLVTAGAGRRLRRWSVASVDAARVQERGTRGAD-CVVLEAELRLDASAVSAAFDDDLDMGVVGTAVGTVWFIGWAECSSMRLVSGHAEQVTGLAFSPDEALFASSAADGSLRVWDARSLELSVQFQVLQQTC-ECVAWSRVPARRSRFSRLVAAGYGDGAVRLFSLRSVEMVLKMR-SHGSAVTALAFSTDAGEFLVSGARDGLVVVSSLHTGATARVVT------DHRPSPISAIDCVHSQERLVIGSHGGEM-----------WLAASRDSRVSIWS-CDWLRDRCDLVDWLTFPALSAGLDDTQSGRSTPPSLAVFCPGDVDTVVYAGYGLQREIVFYSLRLKQVVRKLP--LDNWALSLDLSCNGDLIAVGTYERLVGLMDPASGRFRSV-WGHEDAVRACRFSPSGRRLFT--AAHGAIFVWEVCNS 1842          

HSP 2 Score: 93.5893 bits (231), Expect = 8.235e-20
Identity = 144/695 (20.72%), Postives = 271/695 (38.99%), Query Frame = 2
Query:   98 LELINVIGFNGTILDGLHVHPDRQH--IIYGLGCTVVIEDLNTKNQCFLQGHTNNVVCITVSNSGKYIASGQITHMGYKADIMLWDYVTKQCVSTFSLHKVKVQSLAFSPNEKYLASLG--GQDDGCVVIWSLTKMEPICGSPAQHKSAGITECLVYSNTNDDV------------FVTAGENTLRVWELDVENRKIRPTECSLG----------AIKRSIKCITISKDDSVFFCGTSSGDILGVNMKSC-------LLSCIGPEKETFSL----GV-LSIIRLINGDLIVGAGDGTICQVKVVEKKEGNKIMPKIVKTSNSCMLV-----GGVSSITLRGQGHQFYAGTEKSHIYRFSLGDFKSELINTAHYSAVNDIV--YPNNCPKLFVTCSFQ-DVRVFHSDSQKELLRIN----IPNMTCYTCDIFKDGTAIITGWDDSKIRAFYPETGALMYTINDAHKKGVTAIAATSDCRKVVSGGGEGQVRVWRIEECKVSQANTIPHSHGNRKKSNVKSVVYVA---HMETAMKEHANAVSCIRMNKDDTQCVSSSADGTCIIWCLIKYTRK-QIMFANTLFRCVCWRPDECQIITSGTDRKIGYWEVYDGSLIRELEGSRSGSVNGMDITADGDIFVTGGDDKIVKVWKYNEGYVT--HVGLGHSMPITRLRISPDRQLITTVSEDGAIYFWKF 2014
            L L  VIGF G      H    RQ   I+Y     ++  ++ T NQ FL GH++ V  +T++ +   +AS Q    G  + + +WD+ + +C+S F+ H   + SL+FS +   L  +G    +   VV+W  +++          ++ G+   +  ++T+ D+             V+ G  ++R+W   V    +R     L           A +  +       D ++F C + SG IL ++ K+        LL   G     +S+    G+ ++ + +  G    G+ DG +                ++     S ML+       VS++ +   G +  A T           +  S    T   S    ++    +   +  VT      VRV+ SD+ ++LL  +    +P + C  C   +    +  G+ D  +RAF   + AL+   +  H+  +TA+A +     + S    G + ++   +  +     +          +  SV+ ++        +    +AV+ +     +     S + GT          R   + FA          PD  +++     R+I   +   G  +REL  +        D++ DG  F T G D++VKVW     + T     +GHS  +  +  +PD+  + +V +  AI  W F
Sbjct:  374 LALRRVIGFGGGTTR--HALWTRQGDVIVYPCHAIIIAVEITTGNQRFLTGHSDKVTALTMNGASTLLASAQ---AGAVSLLRVWDFSSGECLSVFTPHLHALSSLSFSHSGAVLCGVGKDSHEKNTVVVWDTSRL----------RTGGLVSVVARTHTDVDLHTIKIASFDDTRMVSCGRGSVRLWR--VRGSALRSCPVDLAEFHAAHFTDVAFEEGLPADREPHDRTLFAC-SKSGHILEIDYKNVTIRNVRRLLPSPGVRASEYSIPSGPGIGINSMSVSEGLCATGSDDGFL----------------RLWLLDFSTMLLEAEHEAPVSAVAISADGRRVLAATAGPAGASLGFLEVASRHYATLARSHAGPVLGCSADGARRHLVTVGRDASVRVWDSDNGQQLLDFSTLAVVPCVVC--CHPVRQ--LLACGFSDGSLRAFSVASTALLAE-HKQHRGQITALAFSRSGEFMYSACSLGSLAMYDASDDDLPALRVLGEPACQYDGDDAPSVLALSTDGRRLAFVGPSQDAVTVMDARSLEEVLRVSVSAGTATGHEDPGPERALAVRFAP---------PDSSRLLVLMRSRRIVVLDAATGRNLRELSAAHHTRCVSTDVSEDGRFFATAG-DRVVKVWDARAQHRTDAQTFIGHSESVRHVMFTPDQLGLVSVGD--AILIWDF 1017          
BLAST of wdr-1 vs. Ensembl Sea Lamprey
Match: wdr90 (WD repeat domain 90 [Source:ZFIN;Acc:ZDB-GENE-070424-67])

HSP 1 Score: 94.3597 bits (233), Expect = 5.006e-20
Identity = 145/688 (21.08%), Postives = 273/688 (39.68%), Query Frame = 2
Query:   98 LELINVIGFNGTILDGLHVHPDRQH--IIYGLGCTVVIEDLNTKNQCFLQGHTNNVVCITVSNSGKYIASGQITHMGYKADIMLWDYVTKQCVSTFSLHKVKVQSLAFSPNEKYLASLG--GQDDGCVVIWSLTKMEPICGSPAQHKSAGITECLVYSNTNDDV------------FVTAGENTLRVWELDVENRKIRPTECSLG----------AIKRSIKCITISKDDSVFFCGTSSGDILGVNMKSCLLSCIGPEKETFSLGVLS-IIRLINGDLIVGAGDGT-ICQVKVVE---KKEGNKIMPKIVKTSNSCMLV-----GGVSSITLRGQGHQFYAGTEKSHIYRFSLGDFKSELINTAHYSAVNDIV--YPNNCPKLFVTCSFQ-DVRVFHSDSQKELLRIN----IPNMTCYTCDIFKDGTAIITGWDDSKIRAFYPETGALMYTINDAHKKGVTAIAATSDCRKVVSGGGEGQVRVWRIEECKVSQANTIPHSHGNRKKSNVKSVVYVA---HMETAMKEHANAVSCIRMNKDDTQCVSSSADGTCIIWCLIKYTRK-QIMFANTLFRCVCWRPDECQIITSGTDRKIGYWEVYDGSLIRELEGSRSGSVNGMDITADGDIFVTGGDDKIVKVWKYNEGYVT--HVGLGHSMPITRLRISPDRQLITTVSEDGAIYFWKF 2014
            L L  VIGF G      H    RQ   I+Y     ++  ++ T NQ FL GH++ V  +T++ +   +AS Q    G  + + +WD+ + +C+S F+ H   + SL+FS +   L  +G    +   VV+W  +++          ++ G+   +  ++T+ D+             V+ G  ++R+W   V    +R     L           A +  +       D ++F C + SG IL ++ K+  +  +   +   S GV + I+ L   +  + +G G  I  + V E       +    ++     S ML+       VS++ +   G +  A T           +  S    T   S    ++    +   +  VT      VRV+ SD+ ++LL  +    +P + C  C   +    +  G+ D  +RAF   + AL+   +  H+  +TA+A +     + S    G + ++   +  +     +          +  SV+ ++        +    +AV+ +     +     S + GT          R   + FA          PD  +++     R+I   +   G  +REL  +        D++ DG  F T G D++VKVW     + T     +GHS  +  +  +PD+  + +V +  AI  W F
Sbjct:  363 LALRRVIGFGGGTTR--HALWTRQGDVIVYPCHAIIIAVEITTGNQRFLTGHSDKVTALTMNGASTLLASAQ---AGAVSLLRVWDFSSGECLSVFTPHLHALSSLSFSHSGAVLCGVGKDSHEKNTVVVWDTSRL----------RTGGLVSVVARTHTDVDLHTIKIASFDDTRMVSCGRGSVRLWR--VRGSALRSCPVDLAEFHAAHFTDVAFEEGLPADREPHDRTLFAC-SKSGHILEIDYKNVTIRNV--RRLLPSPGVRARIMTLSPCEYSIPSGPGIGINSMSVSEGLCATGSDDGFLRLWLLDFSTMLLEAEHEAPVSAVAISADGRRVLAATAGPAGASLGFLEVASRHYATLARSHAGPVLGCSADGARRHLVTVGRDASVRVWDSDNGQQLLDFSTLAVVPCVVC--CHPVRQ--LLACGFSDGSLRAFSVASTALLAE-HKQHRGQITALAFSRSGEFMYSACSLGSLAMYDASDDDLPALRVLGEPACQYDGDDAPSVLALSTDGRRLAFVGPSQDAVTVMDARSLEEVLRVSVSAGTATGHEDPGPERALAVRFAP---------PDSSRLLVLMRSRRIVVLDAATGRNLRELSAAHHTRCVSTDVSEDGRFFATAG-DRVVKVWDARAQHRTDAQTFIGHSESVRHVMFTPDQLGLVSVGD--AILIWDF 1013          

HSP 2 Score: 89.7373 bits (221), Expect = 1.192e-18
Identity = 151/705 (21.42%), Postives = 274/705 (38.87%), Query Frame = 2
Query:   98 LELINVIGFNGTILDGLHVHPDRQHIIYGLGCTVVIEDLNTKNQCFLQGHTNNVVCITVSNSGK-----YIASGQITHMGYKA--DIMLWDYVTKQCVSTFSLHKVKVQSLAFSPNEKYLASLGGQDDGCVVIWSLTKMEPI-----CGSPAQHKSAGITECLVYSNTNDDVFVTAG---------ENTLRVWELDVENRKIRPTECSLGAIKRSIKCITISKDDSVFFCGTSSGDILGVN--MKSCLLSCIGPEKETFSLGVLSIIRLINGDLIVGAGDGTICQVKVVEKKEGNKIMPKIVKTSNSCMLVGGVSSITLRGQGHQF-------YAGTEKSHIYRFSLGDFKSELINTAHYSAVNDIVYPNNCPKLFVTCSFQDVRVFHSDSQKELLRINIPNMTCYTCDIFKDGTA--------IITGWDDSKIRAFYPETGALMYTINDAHKKGVTAIAATSDCRK-VVSGGGEGQVRVWRIEECKVSQANTIPHSHGNRKKSNVKSVVYVAHMET-AMKEHANAVSCIRMNKDDTQCVSSSADGTCIIWCLIKYTRKQIMFANTL-FRCVCWRPDECQIITS---------------------GTDRKIGYWEVYDGSLIRELEGSRSGSVNGMDITADGDIFVTGGDDKIVKVWKYNEGYVTHVGLGHSMPITRLRISPD-RQLITTVSEDGAIYFWKFPNN 2023
            L L  V+G+NG     L   PD   + Y  GC VV+E+L + +Q  L GH   +  + +S+  +       AS Q   +   +   + +WD  +  C S  S H+  VQ+LAFS ++++L SLG   DG + +W++ +   +     C  PA          L +       FV A          E   R + L ++   + P    LG  + +  C        V F GTSSG +   +   KSC L+    E ++ +LGVL       G  +V AG G   +   V   +  ++      TS  C+++     +        F         GT    ++     +  S  + + H   V  + +  +      + +   +RV+ + S +  ++  +   TC  C  +    A        +  G+ D  +R F   +  ++  +  +H   VTA+A ++D  + +VSG  +G V V  +     ++  T      + + S + ++  V   E   +  H   +            +++S D    IW    + R +    + L F  +    D+ Q   S                     G  R+I ++ +    ++R+L          +D++ +GD+   G  +++V +     G    V  GH   +   R SP  R+L T  +  GAI+ W+  N+
Sbjct: 1126 LRLKAVVGYNGNGRGNLVWRPDNGLLAYSSGCVVVVEELRSGDQRHLLGHQREISTLAISHDAQVSKSPLPASVQTPTLVSASCGQMCMWDVASGVCRSGPSHHRGDVQALAFSRDDRFLLSLGDGRDGSLALWAVQQDVSLLASVRCPVPAH--------ALAFRPGRAGEFVCAASGHIAFGLVEQRGREFGLSLDMVAVPP---ELGGAEVTCVCYGAG---GVVFAGTSSGLVSAWDSERKSCFLTW---EADSLALGVLE----CRGHSLVTAGAGRRLRRWSVASVDAARVQ----CTSADCVVLEAELRLDASAVSAAFDDDLDMGVVGTAVGTVWFIGWAECSSMRLVSGHAEQVTGLAFSPDEALFASSAADGSLRVWDARSLELSVQFQVLQQTC-ECVAWSRVPARRSRFSRLVAAGYGDGAVRLFSLRSVEMVLKMR-SHGSAVTALAFSTDAGEFLVSGARDGLVVVSSLHTGATARVVT------DHRPSPISAIDCVHSQERLVIGSHGGEM-----------WLAASRDSRVSIWS-CDWLRDRCDLVDWLTFPALSAGLDDTQSGRSTPPSLAVFCPGDVDTVVYAGYGLQREIVFYSLRLKQVVRKLP--LDNWALSLDLSCNGDLIAVGTYERLVGLMDPASGRFRSV-WGHEDAVRACRFSPSGRRLFT--AAHGAIFVWEVCNS 1780          
BLAST of wdr-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009420.1 (pep scaffold:Pmarinus_7.0:GL476782:177851:212676:1 gene:ENSPMAG00000008506.1 transcript:ENSPMAT00000009420.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 90.1225 bits (222), Expect = 1.023e-18
Identity = 101/461 (21.91%), Postives = 184/461 (39.91%), Query Frame = 2
Query:   98 LELINVIGFNGTILDGLHVHPDRQHIIYGLGCTVVIEDLNTKNQCFLQGHTNNVVCITVSNSGKYIASGQITHMGYKADIMLWDYVTKQCVSTFSLHKVKVQSLAFSPNEKYLASLGGQDDGCVVIW------------SLTKMEPICGSPAQHKSAGITECLVYSNTNDDVFVTAGENTLRVWELDVENRKIRPTECSLGAIKRSIKCITISKDDSVFFCGTSSGDILG--VNMKSCLLSCIGPEKETFSLGVLSIIRLINGDLIVGAGDGTICQVKVVEKKEG----NKIMPKIVKTSNSCMLVGGVSSITLRGQGHQFYAGTEKSHIYRFSLGDFKSELINTAHYSAVNDIVYPNNCPKLFVTCSFQDVRVFHSDSQKELLRINIPNMTCYTCDIFKDGTA----IITGWDDSKIRAFYPETGALMYTINDAHKKGVTAIAATSDCRKVVSGGGEGQV 1414
            L L  V+GFNG     +  +PD     Y  G  +V+EDL+T  Q  LQ HT  +  +  S+  + +AS         + I +WD     C    S H+ +VQ++AFS +   L S+G   +  VV+W            S+  +  +C  P+   +AG   C+    +    F  A      + E  V      P     GA + S     +   DS+ F  ++ G +     + + CLLS    + +T  +GVL      +G+ ++        ++  VE             + V      +L G V S            GT    ++  +  +     + + H   VNDI +  +  +L        +RV+     + +++  + + +C TC  ++   A    +  G+ D  +R F   +   ++ +   H   +  +A +SD   +++GG +G+V
Sbjct: 1096 LRLSMVVGFNGNARGNVIWNPDSGLFAYTCGSLLVLEDLHTGAQRHLQAHTEEISTLASSHDAEVLASASGGRGDTGSQICVWDARRGSCERVLSRHRHEVQAMAFSADNSVLLSVGDYREMMVVLWDTRTYAVIAATRSVFPINDVCPDPS---AAGAFLCV---GSGAIAFCRAQN----LGETAVLQLSAAPLPNGAGASELS---AAVMGPDSLLFTASACGRVAAWDADRRRCLLSW---DADTADIGVL----CCHGNRLLSGSSSKRIRLWCVESVSATICVTSTASEFVSMEGEMVLDGAVVSAAFDDVMEMGIVGTAAGTLWYINWTERACVRLVSGHRGKVNDIAFSPDGSQLVSGSEDGLLRVWSVPEMELVVQFQVLHRSC-TCVAWRPSGAAPSQVAAGFGDGTLRLFGVASARTLHKLQ-PHGAAIRCVAFSSDGEVMLTGGADGRV 1534          

HSP 2 Score: 77.7962 bits (190), Expect = 6.996e-15
Identity = 137/686 (19.97%), Postives = 258/686 (37.61%), Query Frame = 2
Query:   98 LELINVIGFNGTILDGLHVHPDRQ--HIIYGLGCTVVIEDLNTKNQCFLQGHTNNVVCITVSNSGKYIASGQITHMGYKADIMLWDYVTKQCVSTFSLHKVKVQSLAFSPNEKYLASLGGQDDG--CVVIW---SLTKMEPICGSPAQHKSAGITECLVYSNTNDDVFVTAGENTLRVWELDVENRKIRPTECSLGAIKRSIKCITIS----KDDSVFFCGTSSGDILGVNMKSCLL------------------------SCIGPEKETFSLGVLSIIRLINGDLIVGAGDGTICQVKVVEKKEGNKIMPKIVKTSNSCMLVGGVSSITLRGQGHQFYAGTEKSHIYRFSLGDFKSELINTAHYSAVNDIVYPNNCPKLFVTCSFQDVRVFHSDSQKELLRINIPNMTCYTCDIFKDGTAIITGWDDSKIRAFYPETGALMYTINDAHKKGVTAIAATSDCRKVVSGGGEGQVRVWRIEECKVSQANTIPHSHGNRKKSNVKSVVYV----AHMETAMKEH-----ANAVSCIRMNKDDTQCVSSSADGTCIIWCLIKYTRKQIMFANTLFRCVCWRPDECQIITSGTDRKIGYWEVYDGSLIRELEGSRSGSVNGMDITADGDIFVTGGDDKIVKVWKYNEGY---VTHVGLGHSMPITRLRISPDRQLITTVSEDGAIYFWKF 2014
            L+L  V+GF G     +     R    ++Y     +V  D+ T +Q FL GH++ V  +    + + +ASGQ    G +A + +W++    C++ F  H   + SL+FS +   L+ +G    G   VV+W    +T    +      H    + + +V S  ++   V+ G + +RVW L  +N  +R     LG +  S +   ++    +D S  F  T SG IL ++ K  ++                        +C+G E    +L  L++ R      + G+ DGT+               P   +      L G VS + +   G    AGT   H+ R  +G      +  +    + D        ++    +   + ++   + ++L   +    +  T            G+    +R F    GA +   +  H+  +T +  + +   + S    G + ++    CK      +      R  S   S + V    AH+            A+A S   + + D   V +S+        L +  R            VC+ P   Q++ +    K+ +++   G L++E+   +    + + ++ DG I V    D  ++ W    G     +   +GHS  + RLR +   +    VS  G I+ W  
Sbjct:  359 LKLRRVVGFGGETNGYVQALWTRNGATLVYPCHAVIVALDVETSSQHFLTGHSDKVSALAFDGNTEILASGQ---SGPQAIVRIWNFQKGSCLAMFKTHAHSLFSLSFSWSGDVLSGVGRDSHGKTMVVVWDTSGVTHRRDVLILAKAHTGVDV-QTMVISPFDESRLVSCGRDNVRVWRL--QNGSLRSCAVDLGDLH-STEVTDVAFQQHRDSSRRFACTRSGHILDIDYKHNVVREVTRLRQPPSRSPRERLPDQGASACVGFE---LALTRLAVSRWF---CVTGSEDGTV-----------RVWSPDFSRVLLQTDLGGAVSLLGVSADGRHVLAGTRTGHLARLDVGGRSYATVTRSPVGPLLDFSLDLERQRVAAVSTNGSLTIWDLGTGQQLYEFSGAEDSACTVSCHPQLERFACGFSSGSVRVF-DVVGARLLAQHRQHRGEITGLEFSPNGEHMYSCDARGSLALYS-AICKEHTLVRLLSGVVARGTSYAPSALAVSGDGAHLAFVGPSEFAVTVADARSLCELLRVDVSIVDASSP------TLDQAER------------VCFGP-AGQLLVATASGKVLWFDARTGRLLKEVRDVQGAGCSALQVSEDGAI-VAMASDATLRAWDPGSGLEVQPSQAFVGHSQEVRRLRFT--GRCPGLVSGGGTIFMWDL 996          
BLAST of wdr-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009409.1 (pep scaffold:Pmarinus_7.0:GL476782:177851:212682:1 gene:ENSPMAG00000008506.1 transcript:ENSPMAT00000009409.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 89.7373 bits (221), Expect = 1.232e-18
Identity = 106/467 (22.70%), Postives = 187/467 (40.04%), Query Frame = 2
Query:   98 LELINVIGFNGTILDGLHVHPDRQHIIYGLGCTVVIEDLNTKNQCFLQGHTNNVVCITVSNSGKYIASGQITHMGYKADIMLWDYVTKQCVSTFSLHKVKVQSLAFSPNEKYLASLGGQDDGCVVIW------------SLTKMEPICGSPAQHKSAGITECLVYSNTNDDVFVTAGENTLRVWELDVENRKIRPTECSLGAIKRSIKCITISKDDSVFFCGTSSGDILG--VNMKSCLLSCIGPEKETFSLGVLSIIRLINGD-LIVGAGDGTI---CQVKVVEKKEG------NKIMPKIVKTSNSCMLVGGVSSITLRGQGHQFYAGTEKSHIYRFSLGDFKSELINTAHYSAVNDIVYPNNCPKLFVTCSFQDVRVFHSDSQKELLRINIPNMTCYTCDIFKDGTA----IITGWDDSKIRAFYPETGALMYTINDAHKKGVTAIAATSDCRKVVSGGGEGQV 1414
            L L  V+GFNG     +  +PD     Y  G  +V+EDL+T  Q  LQ HT  +  +  S+  + +AS         + I +WD     C    S H+ +VQ++AFS +   L S+G   +  VV+W            S+  +  +C  P+   +AG   C+    +    F  A      + E  V      P     GA + S     +   DS+ F  ++ G +     + + CLLS    + +T  +GVL      +G+ L+ G+    I   C   V    EG           + V      +L G V S            GT    ++  +  +     + + H   VNDI +  +  +L        +RV+     + +++  + + +C TC  ++   A    +  G+ D  +R F   +   ++ +   H   +  +A +SD   +++GG +G+V
Sbjct: 1190 LRLSMVVGFNGNARGNVIWNPDSGLFAYTCGSLLVLEDLHTGAQRHLQAHTEEISTLASSHDAEVLASASGGRGDTGSQICVWDARRGSCERVLSRHRHEVQAMAFSADNSVLLSVGDYREMMVVLWDTRTYAVIAATRSVFPINDVCPDPS---AAGAFLCV---GSGAIAFCRAQN----LGETAVLQLSAAPLPNGAGASELS---AAVMGPDSLLFTASACGRVAAWDADRRRCLLSW---DADTADIGVL----CCHGNRLLSGSSSKRIRLWCVESVSATMEGGVRESVTSTASEFVSMEGEMVLDGAVVSAAFDDVMEMGIVGTAAGTLWYINWTERACVRLVSGHRGKVNDIAFSPDGSQLVSGSEDGLLRVWSVPEMELVVQFQVLHRSC-TCVAWRPSGAAPSQVAAGFGDGTLRLFGVASARTLHKLQ-PHGAAIRCVAFSSDGEVMLTGGADGRV 1634          

HSP 2 Score: 83.1889 bits (204), Expect = 1.455e-16
Identity = 135/683 (19.77%), Postives = 255/683 (37.34%), Query Frame = 2
Query:   98 LELINVIGFNGTILDGLHVHPDRQHIIYGLGCTVVIEDLNTKNQCFLQGHTNNVVCITVSNSGKYIASGQITHMGYKADIMLWDYVTKQCVSTFSLHKVKVQSLAFSPNEKYLASLGGQDDG--CVVIW---SLTKMEPICGSPAQHKSAGITECLVYSNTNDDVFVTAGENTLRVWELDVENRKIRPTECSLGAIKR------SIKCITISKDDSVFFCGTSSGDILGVNMKSCLL------------------------SCIGPEKETFSLGVLSIIRLINGDLIVGAGDGTICQVKVVEKKEGNKIMPKIVKTSNSCMLVGGVSSITLRGQGHQFYAGTEKSHIYRFSLGDFKSELINTAHYSAVNDIVYPNNCPKLFVTCSFQDVRVFHSDSQKELLRINIPNMTCYTCDIFKDGTAIITGWDDSKIRAFYPETGALMYTINDAHKKGVTAIAATSDCRKVVSGGGEGQVRVWRIEECKVSQANTIPHSHGNRKKSNVKSVVYV----AHMETAMKEH-----ANAVSCIRMNKDDTQCVSSSADGTCIIWCLIKYTRKQIMFANTLFRCVCWRPDECQIITSGTDRKIGYWEVYDGSLIRELEGSRSGSVNGMDITADGDIFVTGGDDKIVKVWKYNEGYVTHVGLGHSMPITRLRISPDRQLITTVSEDGAIYFWKF 2014
            L+L  V+GF G          +   ++Y     +V  D+ T +Q FL GH++ V  +    + + +ASGQ    G +A + +W++    C++ F  H   + SL+FS +   L+ +G    G   VV+W    +T    +      H    + + +V S  ++   V+ G + +RVW L  +N  +R     LG +        + +  + + DD   F  T SG IL ++ K  ++                        +C+G E    +L  L++ R      + G+ DGT+               P   +      L G VS + +   G    AGT   H+ R  +G      +  +    + D        ++    +   + ++   + ++L   +    +  T            G+    +R F    GA +   +  H+  +T +  + +   + S    G + ++    CK      +      R  S   S + V    AH+            A+A S   + + D   V +S+        L +  R            VC+ P   Q++ +    K+ +++   G L++E+   +    + + ++ DG I V    D  ++ W    G      +GHS  + RLR +   +    VS  G I+ W  
Sbjct:  376 LKLRRVVGFGGETNGYALWTRNGATLVYPCHAVIVALDVETSSQHFLTGHSDKVSALAFDGNTEILASGQ---SGPQAIVRIWNFQKGSCLAMFKTHAHSLFSLSFSWSGDVLSGVGRDSHGKTMVVVWDTSGVTHRRDVLILAKAHTGVDV-QTMVISPFDESRLVSCGRDNVRVWRL--QNGSLRSCAVDLGDLHSTEVTDVAFQERSPALDDKRLFACTRSGHILDIDYKHNVVREVTRLRQPPSRSPRERLPDQGASACVGFE---LALTRLAVSRWF---CVTGSEDGTV-----------RVWSPDFSRVLLQTDLGGAVSLLGVSADGRHVLAGTRTGHLARLDVGGRSYATVTRSPVGPLLDFSLDLERQRVAAVSTNGSLTIWDLGTGQQLYEFSGAEDSACTVSCHPQLERFACGFSSGSVRVF-DVVGARLLAQHRQHRGEITGLEFSPNGEHMYSCDARGSLALYS-AICKEHTLVRLLSGVVARGTSYAPSALAVSGDGAHLAFVGPSEFAVTVADARSLCELLRVDVSIVDASSP------TLDQAER------------VCFGP-AGQLLVATASGKVLWFDARTGRLLKEVRDVQGAGCSALQVSEDGAI-VAMASDATLRAWDPGSGLEVQAFVGHSQEVRRLRFT--GRCPGLVSGGGTIFMWDL 1011          
BLAST of wdr-1 vs. Ensembl Yeast
Match: DIP2 (Nucleolar protein; specifically associated with the U3 snoRNA, part of the large ribonucleoprotein complex known as the small subunit (SSU) processome, required for 18S rRNA biogenesis, part of the active pre-rRNA processing complex [Source:SGD;Acc:S000004119])

HSP 1 Score: 64.6994 bits (156), Expect = 3.858e-11
Identity = 59/265 (22.26%), Postives = 111/265 (41.89%), Query Frame = 2
Query: 1220 CYTCDIFKDGTAIITGWDDSKIRAFYPETGALMYTINDAHKKGVTAIAATSDCRKVVSGGGEGQVRVWRIEECKVSQANTIPHSHGNRKKSNVKSVVYVAHMETAMKEHANAVSCIRMNKDDTQCVSSSADGTCIIWCLIKYTRKQIMFANTL-FRCVCWRPDECQIITSGTDRKIGYWEVYDGSLIRELEGSRSGSVNGMDITADGDIFVTGGDDKIVKVWKYNEGYVTHVGLGHSMPITRLRISPDRQLITTVSEDGAIYFWK 2011
              TC     G  +I G  + +++ F   + +L+ TI DAH   + ++  TSD +++V+G  +  V+ W   + KV + + +P +     K+    V+ + H  T   E  + + C+R++ DD     S  D T  ++ L        ++ + L    +    D   IITS  D+ I  W +  G   + L  +   S+  +        F +   D +VK W   +         H   +  L ++ D   + + S D +I  W+
Sbjct:  433 ALTCKFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFW---DFKV-ENSLVPGT-----KNKFLPVLKLHHDTTL--ELTDDILCVRVSPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSL-FAHQDSIMNVKFLPQSHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAVATDGGFVVSSSHDHSIRIWE 685          
BLAST of wdr-1 vs. Ensembl Yeast
Match: HIR1 (Subunit of the HIR complex; HIR is a nucleosome assembly complex involved in regulation of histone gene transcription; contributes to nucleosome formation, heterochromatic gene silencing, and formation of functional kinetochores [Source:SGD;Acc:S000000104])

HSP 1 Score: 60.077 bits (144), Expect = 1.021e-9
Identity = 44/212 (20.75%), Postives = 90/212 (42.45%), Query Frame = 2
Query: 1331 DAHKKGVTAIAATSDCRKVVSGGGEGQVRVWRIE---ECKVSQANT--IPHSHGNRKKSNVKSVVYVAHMETAMKEHANAVSCIRMNKDDTQCVSSSADGTCIIWCLIKY-----------------TRKQIMFANTLFRCVCWRPDECQIITSGTDRKIGYWEVYDGSLIRELE--GSRSGSVNGMDITADGDIFVTGGDDKIVKVWKYNE 1894
            ++ K  +  +  + D +++ +GG +G++R+W I+    C   ++ T  IP                +     +M  H  +++C++ + D     S S D   +IW L +                   RK+++  +   + +CW PD   ++T G DR +  W   +GS   +L+        V G+        F T  DD+ +K+++Y++
Sbjct:   14 ESRKYEIYTVDVSHDGKRLATGGLDGKIRIWSIDSILRCMELESLTPEIPLPQD------------LQMPLCSMSRHTGSITCVKFSPDGKYLASGSDDRILLIWALDEEQSSQPAFGSEHEREHWTVRKRLVAHDNDIQDICWAPDSSILVTVGLDRSVIVW---NGSTFEKLKRFDVHQSLVKGVVFDPANKYFATTSDDRTMKIFRYHK 210          
BLAST of wdr-1 vs. Ensembl Yeast
Match: SOF1 (Protein required for biogenesis of 40S (small) ribosomal subunit; has similarity to the beta subunit of trimeric G-proteins and the splicing factor Prp4p; essential gene [Source:SGD;Acc:S000003934])

HSP 1 Score: 58.9214 bits (141), Expect = 1.377e-9
Identity = 35/158 (22.15%), Postives = 79/158 (50.00%), Query Frame = 2
Query: 1547 ANAVSCIRMNKDDTQCVSSS-ADGTCIIWCLIKYTRKQIMFANTLFRCVCWRPDEC-QIITSGTDRKIGYWEVYDGSLIRELEGSRSGSVNGMDITADGDIFVTGGDDKIVKVWKYNEGYVTHVGLGHSMP-ITRLRISPDRQLITTVSEDGAIYFWK 2011
            A+ ++ ++ N+++T  ++S+ +D + +++ L   +  Q +        +CW P E    +T+  D    Y+++ + S    +      +V  +D +  GD  VTG  DK ++++K N G+   +     M  + +++ S D + I + S+DG +  W+
Sbjct:  219 ADNITSLKFNQNETDILASTGSDNSIVLYDLRTNSPTQKIVQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNVFKDHVSAVMDVDFSPTGDEIVTGSYDKSIRIYKTNHGHSREIYHTKRMQHVFQVKYSMDSKYIISGSDDGNVRLWR 376          
BLAST of wdr-1 vs. Ensembl Yeast
Match: TUP1 (General repressor of transcription; forms complex with Cyc8p, involved in the establishment of repressive chromatin structure through interactions with histones H3 and H4, appears to enhance expression of some genes [Source:SGD;Acc:S000000680])

HSP 1 Score: 58.9214 bits (141), Expect = 1.873e-9
Identity = 61/276 (22.10%), Postives = 113/276 (40.94%), Query Frame = 2
Query: 1133 FVTCSFQD--VRVFHSDSQKELLRINIPNMTCYTCDIFKDGTAIITGWDDSKIRAFYPETG--ALMYTINDAHKKGVTAIAATS-DCRKVVSGGGEGQVRVWRIEECKVSQANTIPHSHGNRKKSNVKSVVYVAHMETAMKEHANAVSCIRMNKDDTQCVSSSADGTCIIWCLIKYTRKQ--------------IMFANTLFRCVCWRPDECQIITSGTDRKIGYWEVYDGSLIRELEGSRSGSV-----NGMDITADGDIFVTGGDDKIVKVWKY 1888
            F+    +D  +R++  +++K ++ +       Y+ D F  G  +++G  D  +R +   TG  +L  +I D    GVT +A +  D + + +G  +  VRVW  E   + +     +  G   K +V SVV+                     +D    VS S D +  +W L     K               I   + +      + DE  I++   DR + +W+   G+ +  L+G R+  +     NG  +  + ++F TG  D   ++WKY
Sbjct:  457 FLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIED----GVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENESGTGHKDSVYSVVFT--------------------RDGQSVVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEY-ILSGSKDRGVLFWDKKSGNPLLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKARIWKY 707          

HSP 2 Score: 48.521 bits (114), Expect = 3.056e-6
Identity = 31/111 (27.93%), Postives = 52/111 (46.85%), Query Frame = 2
Query: 1679 FRCVCWRPDECQIITSGTDRKIGYWEVYDGSLIRELEGSRSGSVNGMDITADGDIFVTGGDDKIVKVWKYNEGYVTHVGLGHSMPITRLRISP-DRQLITTVSEDGAIYFW 2008
             R VC+ PD   + T   DR I  W++ +  ++  L+G     +  +D    GD  V+G  D+ V++W    G  + + L     +T + +SP D + I   S D A+  W
Sbjct:  446 IRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQ-DIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCS-LTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVW 554          
BLAST of wdr-1 vs. Ensembl Yeast
Match: PFS2 (Integral subunit of the pre-mRNA CPF complex; the cleavage and polyadenylation factor (CPF) complex plays an essential role in mRNA 3'-end formation by bridging different processing factors and thereby promoting the assembly of the processing complex [Source:SGD;Acc:S000005261])

HSP 1 Score: 57.3806 bits (137), Expect = 4.439e-9
Identity = 36/164 (21.95%), Postives = 77/164 (46.95%), Query Frame = 2
Query: 1520 HMETAMKEHANAVSCIRMNKDDTQCVSSSADGTCIIWCLIKYTRKQIMFA-NTLFRCVCWRPDECQIITSGTDRKIGYWEVYDGSLIRELEGSRSGSVNGMDITADGDIFVTGGDDKIVKVWKYNEGYVTHVGLGHSMPITRLRISPDRQLITTVSEDGAIYFW 2008
            H+ +   +H   +  I+   +  + V ++  G   +W    +T + +M A ++    + +  D   +I+   D  I  W+  + S+++E++ + + S+  M  +++   FVT  DD I+K+W ++ G    V  GH   +      P+  LI + S+D  +  W
Sbjct:   86 HLSSNKVKHV--IPAIQWTPEGRRLVVATYSGEFSLWNASSFTFETLMQAHDSAVTTMKYSHDSDWMISGDADGMIKIWQP-NFSMVKEIDAAHTESIRDMAFSSNDSKFVTCSDDNILKIWNFSNGKQERVLSGHHWDVKSCDWHPEMGLIASASKDNLVKLW 246          
BLAST of wdr-1 vs. Ensembl Nematostella
Match: EDO48010 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKM0])

HSP 1 Score: 704.516 bits (1817), Expect = 0.000e+0
Identity = 343/657 (52.21%), Postives = 453/657 (68.95%), Query Frame = 2
Query:   65 MSGEEVNEINKLELINVIGFNGTILDGLHVHPDRQHIIYGLGCTVVIEDLNTKNQCFLQGHTNNVVCITVSNSGKYIASGQITHMGYKADIMLWDYVTKQCVSTFSLHKVKVQSLAFSPNEKYLASLGGQDDGCVVIWSLTKMEPICGSPAQHKSAGITECLVYSNTNDDVFVTAGENTLRVWELDVENRKIRPTECSLGAIKRSIKCITISKDDSVFFCGTSSGDILGVNMKSCLLSCIGPEKETFSLGVLSIIRLING--DLIVGAGDGTICQVKVVEKKEGNKIMPKIVKTSNS--CMLVGGVSSITLRGQGHQFYAGTEKSHIYRFSLGDFKSELINTAHYSAVNDIVYPNNCPKLFVTCSFQDVRVFHSDSQKELLRINIPNMTCYTCDIFKDGTAIITGWDDSKIRAFYPETGALMYTINDAHKKGVTAIAATSDCRKVVSGGGEGQVRVWRIEECKVSQANTIPHSHGNRKKSNVKSVVYVAHMETAMKEHANAVSCIRMNKDDTQCVSSSADGTCIIWCLIKYTRKQIMFANTLFRCVCWRPDECQIITSGTDRKIGYWEVYDGSLIRELEGSRSGSVNGMDITADGDI--FVTGGDDKIVKVWKYNEGYVTHVGLGHSMPITRLRISPDRQLITTVSEDGAIYFWKFP 2017
            MS +E +++ +LEL +VIGF G + +GL VHPDR H+IY LG TVVIE + T  Q  L GHT+NV C+ VS SG+Y+ASGQ  HMG+KA +++WDY  K+     +LHKVKV++LAFSPN++YL SLGGQDDG VV+W L   E +CGSPA   SAG T  + ++N ND++F+T G  TLRVWELD  NRKIRPTEC++G +KR + CI +++DD+ FFCGT+SGDIL +N+++ L    GP KE FS GV + + LI G  +L+VGAGDGT+  V     K         V  +NS  C + G ++SI LRGQGHQF+ GT+ S +YRF+  +F  E INT HY  VND+V+P     +F TCS  ++RV+++++ KELLRI +PN+TC T DI KDG A ++GWDD KIR F PE+G L Y I+DAH KGVTA+   S C K+VSGGGEGQVRVW  ++                             +   MKEH  +V+CI++ +DDT+CVS+S DGTCIIW L  + R QI+FANT+F  VC+ P +CQIIT+GTDRKI YWE +DG+LIR+LEGS +GS+ GMDI  D  +  FVTGG DK++KVW Y+ G VTH+G GHS  ITR++I P+ + I +VS DGAI  W++P
Sbjct:    1 MSNKEASDVGRLELESVIGFAGAVPNGLLVHPDRDHLIYPLGNTVVIEQIKTGKQSCLSGHTDNVTCVAVSKSGRYLASGQQAHMGFKASVIVWDYAEKKLKYQLTLHKVKVEALAFSPNDEYLVSLGGQDDGSVVVWDLQAGEAVCGSPAAVPSAGTTNAVAFANHNDNLFITGGNKTLRVWELDRPNRKIRPTECNMGQLKRIVNCIKVTEDDTHFFCGTTSGDILMINIQNRLFRHYGPAKEKFSQGVTA-MELIKGGQELLVGAGDGTVAVVDCKNFK---------VSKANSKLCKVEGDITSIALRGQGHQFFVGTKLSQMYRFNFPEFTYERINTCHYDKVNDVVFPFGFSDIFATCSKNEIRVWNTNTSKELLRIVVPNVTCNTVDIQKDGKAFVSGWDDGKIRVFRPESGQLFYEISDAHSKGVTAVIVNSTCSKIVSGGGEGQVRVWEGKK-----------------------------LLGMMKEHKGSVTCIKLKRDDTECVSASTDGTCIIWNLESFVRSQIVFANTMFEAVCYHPSDCQIITAGTDRKIAYWETFDGALIRDLEGSSAGSIQGMDIALDDSVTHFVTGGADKLLKVWDYDAGQVTHLGGGHSGDITRVKICPNSRWIVSVSADGAILRWRYP 618          
BLAST of wdr-1 vs. Ensembl Nematostella
Match: EDO36826 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHH0])

HSP 1 Score: 96.6709 bits (239), Expect = 1.378e-20
Identity = 153/700 (21.86%), Postives = 275/700 (39.29%), Query Frame = 2
Query:   98 LELINVIGFNGTILDGLHVHPDRQHIIYGLGCTVVIEDLNTKNQCFLQGHTNNVVCITVSNSGKYI-ASGQITHMGYKADIMLWDYVTKQCVSTFSLHKVKVQSLAFSPNEKYLASLGGQDDGCVVIWSLTKMEPICGSPAQHKSAGITECLVYSNTNDDVFVTAGE-NTLRVWELD--VENRKIRPTECSLGA-IKRSIK---------CITISKDDSVFFCGTSSGDILGVNMK--SCLLSCIGPEKETFSLGVLSIIRLIN--GDLIVGAGDGTI---CQVKVVEKK---EGNKIMPKIVKTSNSC--------------MLVGGVSSITLRGQGHQFYAGTEKSHIYRFSLGDFKSELINTAHYSAVNDIVYPNNCPKLFVTCSFQDVRVFHSDSQKELLRINIPNMTCYTCDIFKDGTAIIT----------GWDDSKIRAFYPETGAL-MYTINDAHKKGVTAIAATSDCRKVVSGGGEGQVRV------WRIEECKVSQANTIPHSHGNRKKSNVKSVVYVAHMETAMKEHANAVSCIRMNKDDTQCV--------SSSADGTCIIWCLIKYTRKQIMFANTLFRCVCWRPDECQIITSGTDRKIGYWEVYDGSLIRELEGSRSGSVNGMDITADGDIFVTGGDDKIVKVWKYNEGYVTHVGLGHSMPITRLRISPDRQLITTVSEDGAIYFW 2008
            ++L +V+G+NG   + +    D     Y  G  VVIEDL++  Q  L GH   V  IT  N G  + ++   +     + I +WD   + C    S H  +V  LA+S +++ L S+G   D  VV+W+    + I  S A+     I    ++     + F T GE  ++  W +D  + N  ++  E ++ + +  SIK         C++ +  DSV + G S G +   + +  SC L     + E        I+ LI+  G LI G+  G +     V V E +   E N++  + V  S  C              +L G + S +          GT    ++  +  +  S  + + H   + +IV+  +  K F TC+   V    +    E ++  +   +C          A  T          G+ D  +R F  + G + M+     H   VT I  + D   V+SGG +G + +        +      +   I   H + +      ++++A    A  +   +V     +KD  + V        + + DG  +      Y  +      +L R     PD          R + ++ +    ++R    + +     +DI+  G +   G  ++++K+  YNEG       GHS  ++ +R SP   L+ T S  G +  W
Sbjct:  255 MQLKSVLGYNGAGRNNMVWKYDTGLFAYTSGSIVVIEDLHSGGQKHLIGHVEEVSTITCQNDGLVLASASGSSETSESSQIYIWDIQEETCTKVLSYHPHEVVCLAYSRDDRMLISVGDFRDCSVVVWNTQTYDVITSSYARLPVHDI----LWDPYTVNEFATVGEGGSVMFWLVDETIPNISLKVHEPAVPSELTTSIKPDKPTVHFTCLSYAG-DSVMYAGNSEGVLSAWDTRQNSCFLHWQADKTE--------IVVLISHRGQLIAGSSGGNLRLWSVVGVAEMRLPGENNRLFNETVCVSTLCFRLSSDSLTMEDEMVLDGAIISTSFDDVLETGIVGTASGTLWYINWSERTSIRLVSGHAEQITNIVFSGSDDKYFATCAKDGVLHLWTTDNLEHMQFQVVGQSCNCVAFCPIPPATPTNAIHPSHCAAGYSDGTVRMF--DLGKVEMFMKMQPHACAVTVIGFSVDGHVVISGGSDGVLAISSPSTGLTVRLLNDHKGVPITDLHVSAQYRLTCPLMWLA----ASADSRVSVWSADWSKDFCELVDWLTFPSPAIAPDGKAL---RKSYPGEYSKLPPSLARFSPSDPDIIVFTGYSMQRVVHFYSLAQRKVVR--TAALTHWALSLDISPKGHLIAIGTQERLIKLMDYNEGSFQDF-TGHSDAVSEVRFSPSGHLLYTCSH-GDVLIW 928          
BLAST of wdr-1 vs. Ensembl Nematostella
Match: EDO49767 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFR6])

HSP 1 Score: 91.2781 bits (225), Expect = 2.707e-20
Identity = 69/286 (24.13%), Postives = 122/286 (42.66%), Query Frame = 2
Query: 1157 VRVFHSDSQKELLRINIPNMTCYTCDIFKDGTAIITGWDDSKIRAFYPETGALMYTINDAHKKGVTAIAATSDCRKVVSGGGEGQVRVWRIEECKVSQANTIPHSHGNRKKSNVKSVVYVAHMETAMKEHANAVSCIRMNKDDTQCVSSSADGTCIIWCLIKYTRKQIM--FANTLFRCVCWRPDECQIITSGTDRKIGYWEVYDGSLIRELEGSRSGSVNGMDITADGDIFVTGGDDKIVKVWKYNEGYVTHVGLGHSMPITRLRISPDRQLITTVSEDGAIYFW 2008
            +RV+  ++ KEL ++       YT  +      +++G  D  ++ +  +T +L++T+   HK  V+ +  T D ++++S   +  V++W +E C                               ++  H   V  I +  D  + VS+S D T  IW L  +     +   + T++ CVC  PD+   I+   D  +  W++     +R L G  S  +  + +T DG   ++ GDD  VKVW    G       GHS  +  + +SPD   I + SED     W
Sbjct:   37 IRVWDYETGKELNKLLDHTKLVYTLALSPHADFLVSGAFDHTVKIWDMDTLSLVHTLK-GHKNWVSGVLVTPDSKRIISSSYDKTVKIWDVETCA---------------------------FVNSLDGHDGHVRGIAITSDGRRLVSASQDRTLRIWNLETFAHVSTLRGHSETVY-CVCCSPDDKFAISGSEDTMVKIWDLESAKEVRSLVGHTS-DIFAVAVTPDGSKVISSGDDTQVKVWSLESGEELASLHGHSESVRIVTVSPDGLTIVSGSEDATFKIW 292          
BLAST of wdr-1 vs. Ensembl Nematostella
Match: EDO44093 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWV7])

HSP 1 Score: 70.8626 bits (172), Expect = 5.710e-13
Identity = 53/215 (24.65%), Postives = 99/215 (46.05%), Query Frame = 2
Query: 1373 DCRKVVSGGGEGQVRVWRIEECKVSQANTIPHSHGNRKKSNVKSVVYVAHMETAMKEHANAVSCIRMNKDDTQCVSSSADGTCIIWCLIKYTRKQIMFANTLFRCV-CWRPDECQIITSGTDRKIGYWEVYDGSLIRELEGSRSGSVNGMDITADGDIFVTGGDDKIVKVWKYNEGYVTHVGLGHSMPITRLRISPDRQLITTVSEDGAIYFWKF 2014
            D R+VV+G  +  +R+W +                 R   +++           MK H   V C++   D+ + +S S D T ++W ++K+TR  +++ +    CV C R DE  +++   D  I  W++     +  L+G   G+V+ ++   D    ++G  DK +K+W    G   +   GH+  +T +++    +LI + S DG I FW  
Sbjct:  158 DRRRVVTGSSDRTIRMWDV-----------------RSGRSIRK----------MKGHKGGVRCLQF--DNERIISGSWDMTIMVWHIVKFTRLHVLYGHK--GCVSCLRFDENTLVSGSHDSTIRVWDMRTWECVLVLQG-HEGAVSCLEF--DAPFVLSGSADKTIKLWNVESGDCLNTLRGHADAVTSVKVIG--ELILSGSADGMILFWDL 336          
BLAST of wdr-1 vs. Ensembl Nematostella
Match: EDO46331 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQB4])

HSP 1 Score: 64.3142 bits (155), Expect = 4.593e-11
Identity = 68/346 (19.65%), Postives = 138/346 (39.88%), Query Frame = 2
Query:  881 QVKVVEKKEGNKIMPKIVKTSNSCMLV-----GGVSSITLRGQGHQFYAGTEKSHIYRFSL-GDFKSELINTAHYSAVNDIVYPNNCPKLFVTCSFQDVRVFHSDSQKELLRINIPNMTCYTCDIFKDGTA-IITGWDDSKIRAFYPETGALMYTINDAHKKGVTAIAATSDCRKVVSGGGEGQVRVWRIEECKVSQANTIPHSHGNRKKSNVKSVVYVAHMETAMKEHANAVSCIRMNKDDTQCVSSSADGTCIIW----------CLIKYTRKQIMFANTLFRCVCWRPDECQIITSGTDRKIGYWEVYDGSLIRELEGSRSGSVNGMDITADGDIFVTGGDDK 1867
            Q+ V++ K   + +P       S +++     G + S      G    +      IY +++ G+ ++  +   H  A+ D+ +  +   +F   + + V ++  ++   + R+        +C   + G   +++G DDS I+ +         T  +  +  VTA+A +    ++ SGG + +++VW + +                       V+Y       M  H + V+ ++++ D +  +S+S D T  +W          CL  +   Q  F   L +C  W PD   I     DR +  W+     ++ +L G  +GSVN         I ++ G DK
Sbjct:   27 QLSVIDPKNAIQALPNRTSALESPIMLLTGHEGEIYSSRFHPSGETLASVGFDRLIYLWNVYGECENFAVLKGHTGAIMDVHFSTDGNTMFTASTDKTVALWDYETGARMKRLKGHTSFVNSCCPSRRGMQYVVSGSDDSTIKLWDTRKRGCAQTFQNVFQ--VTAVAFSDASDQIFSGGIDNEIKVWDLRK---------------------NDVLY------KMSGHTDTVTGVQLSPDGSFLLSNSMDNTVRMWDVRAFAPMERCLKVFLGAQHNFEKNLIKC-SWSPDGLMIAAGSADRFVYVWDTNSRRILYKLPG-HAGSVNDAHFHPTEPILLSCGSDK 341          
BLAST of wdr-1 vs. Ensembl Medaka
Match: cfap52 (cilia and flagella associated protein 52 [Source:NCBI gene;Acc:101170899])

HSP 1 Score: 667.152 bits (1720), Expect = 0.000e+0
Identity = 333/638 (52.19%), Postives = 434/638 (68.03%), Query Frame = 2
Query:  122 FNGTILDGLHVHPDRQHIIYGLGCTVVIEDLNTKNQCFLQGHTNNVVCITVSNSGKYIASGQITHMGYKADIMLWDYVTKQCVSTFSLHKVKVQSLAFSPNEKYLASLGGQDDGCVVIWSLTKMEPICGSPAQHKSAGITECLV--YSNTNDDVFVTAGENTLRVWELDVENRKIRPTECSLGAIKRSIKCITISKDDSVFFCGTSSGDILGVNMKSCLLSCIGPEKETFSLGVLSIIRLI-NGDLIVGAGDG--TICQVKVVEKKEGNKIMPKIVKTSNSCMLVGGVSSITLRGQGHQFYAGTEKSHIYRFSLGDFKSELINTAHYSAVNDIVYPNNCPKLFVTCSFQDVRVFHSDSQKELLRINIPNMTCYTCDIFKDGTAIITGWDDSKIRAFYPETGALMYTINDAHKKGVTAIAATSDCRKVVSGGGEGQVRVWRIEECKVSQANTIPHSHGNRKKSNVKSVVYVAHMETAMKEHANAVSCIRMNKDDTQCVSSSADGTCIIWCLIKYTRKQIMFANTLFRCVCWRPDECQIITSGTDRKIGYWEVYDGSLIRELEGSRSGSVNGMDITADGDIFVTGGDDKIVKVWKYNEGYVTHVGLGHSMPITRLRISPDRQLITTVSEDGAIYFWKFPN 2020
             +G +  GL +HPD+QH+IY LGCTV++  ++   Q FL GHTNNV C++VS SG YIASGQI  +G+K  + +WDY  +   +   LHK KV+SLAFSPN+KYL SLGGQDD  +V+W++   + ICGS A    A    CLV  YSNT+D+VFV+AG  TLRVWELDV NRKIRPTEC LG ++R+IKC+ IS DD   FCGT+SGDIL VN+++ LLS  GP K   SLGV S++R++ +GDL+VG+G G  T+C       K   K++  I        L  GV+SIT++  G QF+ GTE   IYR S  DFK+E++ T+H SAV D+V P    +LF TCS  D+R++H D  KELLRI +PNMTC   D   DG ++I+ W+D KIRAF PETG LM+TINDAHK GVTAIA T DC+++VSGGG+GQVRVW +          +PH H                +   MKEH   VS +++  +D +CV++S DGTCI+W L ++   Q M ANT+FR +C+ P+E QIITSGTDRKI YW+VYDGS+IRELEGS+SG++N M IT DG  FVTGGDD++V+VW Y EG VTHVG+     IT ++I  + +++ T S DGAI  WKFP+
Sbjct:   34 LSGRVPSGLRLHPDKQHLIYPLGCTVILRSISDDKQEFLHGHTNNVCCLSVSRSGTYIASGQINFLGFKTTVFIWDYAQRSVYAELVLHKAKVESLAFSPNDKYLVSLGGQDDDSIVVWNIETKQAICGSTATSHVA--RHCLVVQYSNTDDNVFVSAGSGTLRVWELDVANRKIRPTECKLGKLQRNIKCVEISNDDQFLFCGTTSGDILKVNLRTGLLSDFGPVKAKHSLGV-SVLRVMESGDLLVGSGSGVLTLCS------KTNFKMLQSI-------QLEKGVTSITIKDTGQQFFVGTEAGLIYRMSSDDFKAEVVFTSHTSAVKDVVMPFGTSELFATCSDDDIRLWHIDKPKELLRIPVPNMTCNALDFMIDGHSLISAWNDCKIRAFGPETGRLMFTINDAHKMGVTAIAGTRDCKRIVSGGGDGQVRVWEL----------LPHCH---------------RLVEIMKEHKATVSSLKIKSNDKECVTASVDGTCIVWDLERFVGLQRMIANTVFRAMCYHPEEHQIITSGTDRKIAYWDVYDGSIIRELEGSQSGAINAMHITKDGGYFVTGGDDRVVRVWSYMEGVVTHVGIAQGGSITSMKICSNNRILVTTSADGAIMQWKFPH 630          
BLAST of wdr-1 vs. Ensembl Medaka
Match: ENSORLT00000011953.2 (pep primary_assembly:ASM223467v1:24:2099458:2106800:1 gene:ENSORLG00000009530.2 transcript:ENSORLT00000011953.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 81.2629 bits (199), Expect = 2.770e-16
Identity = 71/246 (28.86%), Postives = 109/246 (44.31%), Query Frame = 2
Query:   83 NEINKLELINVIGFNGTILDGLHVHPDRQHIIYGLGCTVVIED-LNTKNQCFLQGHTNNVVCITVSNSGKYIASGQITHMGYKADIMLWDYVTKQCVSTFSLHKVKVQSLAFSPNEKYLASLGGQDDGCVVIWSLTKMEPICGSPAQHKSAGITECLVYSNTNDDVFVTAGENTLRVWELDVENRKIRPTECS-----------LGAIKRS----IKCITISKDDSVFFCGTSSGDILGVNMKSCL 772
            N   K+ L  V+G   +   GL   P    I Y  GC VV+ D  N +    +      +  +  S  G+++ +G+  HM     + LWD   ++ V+    HK  V  +AFSPN KY+ S+G Q D  V +W+  KM+ +    A   S+ +T   V  + +   FVT G   ++ W LD      R ++ S           LG ++ +    + C   SK DS  FC TSSG +  +N    L
Sbjct:   30 NLSRKVTLEKVLGVTASGNSGLACDPKSGLIAYPAGCVVVLLDPRNNRQNHIINTSRKAITALAFSPDGRFLVTGESGHM---PAVRLWDVAERRHVAELQEHKYGVSCVAFSPNSKYIVSVGNQHDMMVNVWAW-KMDVVVA--ANKVSSKVTA--VSFSEDRSYFVTVGNRHVKFWYLD----HCRASKVSAPVPLLGRVGLLGELRNNFFCDVACGRGSKCDST-FCITSSGLLCELNRSRTL 262          
BLAST of wdr-1 vs. Ensembl Medaka
Match: wdr62 (WD repeat-containing protein 62 [Source:NCBI gene;Acc:101162822])

HSP 1 Score: 82.8037 bits (203), Expect = 8.376e-16
Identity = 161/718 (22.42%), Postives = 287/718 (39.97%), Query Frame = 2
Query:   53 KKLRMSGEEVNEINKLELINVIGFNGTILDGLHVHPDRQHIIYGLGCTVVI-EDLNTKNQCFLQGHTNNVVCITVSNSGKYIASGQITHMGYKADIMLWDYVTKQCVSTFSLHKVKVQSLAFSPNEKYLASLGGQDDGCVVIWSLTKMEPICGSPAQHKSAGITECLVYSNTNDDVFVTAGENTLRVWELDVENRKIRPTECSLGAIKRSIKCITISKDDSVFFCG---------------TSSGDI----------LGVNMKSCLLSCIGPEKETFSLGVLS-IIRLINGDLIVGAGDGTICQVKVVEKKEGNKIMPKIVKTSNSCMLVGGVSSITLRGQGHQFYAGTEKSHIYRFSLGDFKS-ELINTAHYSAVN--------DIVYPNNCP---KLFVTCSFQD-VRVFHSDSQK-----ELLRI-NI------------PNMTCYTCDIFKDGTAIITGWDDSKIRAFYPETGALMYTINDAHKKGVTAI---AATSDCRKVVSGGGEGQVRVWRIEECKVSQANTIPHSHGNRKKSNVKSVVYVAHMETAMKEHANAVSCIRMNKDDTQCVSSSADGTCIIWCLIKYTRKQIMFANT-LFRCVCWRPDECQIITSGTDRKIGYWEVYDGSLIRELEGSRS--GSVNGMDITADGDIFVTGGDDKIVKVWKYNEGYVTHVGLGHSMPITRLRISPDRQLITTVSEDGAIYFWKF 2014
            ++ R S ++    +++ L  V+G       GL   P+   I Y  G  VV+   L  +    L         +  S+ GK++A+G+    G++  + +W+    Q V+    HK +V  +AFS N  Y+ S+G Q D  V +W   K   +    +   S+G+    V  + +   FVTAG   ++ W LD  +R+ R      G +    +   ++   +  FCG               TSSG +            V++K+   SC+   ++    G    +IR+ + D +      T+ +  ++  ++G       ++ S S  L     ++TL               IY + + D  S E I  A Y + +        +  YP++ P     F++CS  + VR +++ S +     +LLRI N+            P +      +  DG  +  G     +R F  +    +  I +AH   V  +    A++  R + S G +  + V+  +    S   T+     N   +++ +V +     T      + V+C      + Q    +ADG         ++R+  +   T L+   C R    Q + +  DR I  + V  G L R L+GS S  G++  + +   G  F T   +K ++V+ Y  G       GHS  +T LR S D   + + S D  I+ WK 
Sbjct:   65 RQNRQSTQKKTSGSQVILEKVLGITTVSSSGLTSDPNTGLIAYPAGSVVVLLHPLRNQQNHILNWSKKLFTAVAFSHDGKHLATGE---SGHRPCVRVWEVGGSQ-VAEVQSHKHRVSCVAFSSNSGYIVSVGYQHDMTVSVWDWRKGSIVA---SNKVSSGVLS--VSFSQDSSYFVTAGNRHVKFWYLDA-SREQR----VYGTVPLIGRSGLLNDHKTRVFCGVACGRGLMASNTYCVTSSGLLCLFNRVRYLEAWVDLKTSSASCLTVSEDFIFCGCADGVIRVFSPDRLQYL--TTLQRPHLLGAEQG-------LQASVSDALYPPTLALTLDPCNQLLTCVYGDHSIYVWDVHDVHSVEKIYWARYHSSSVWSLEVYPERPYPSHAPLPASSFLSCSSDNTVRFWNAASHRNLCGDDLLRILNLGAAQQGEAVDGKPGVRVLA--VSPDGQHLAVGDRSGDLRVFGLQFLDQLVKI-EAHDLEVLCLEYSPASTGVRLLASAGRDRLIHVFDPDR-NYSLLQTL-----NDHSASISAVRF-----TGESPEVHLVTCSVDKSINFQTAEQTADGP-------GFSRRHCVVEKTSLYDMDCSR---TQAVVACQDRNIRVYGVDSGKLQRCLKGSTSDRGALLKVRMDPSGSFFATSCSNKNIEVFDYETGECVASLFGHSEAVTCLRFSWDCTRLVSASADSCIFVWKL 735          
BLAST of wdr-1 vs. Ensembl Medaka
Match: mapkbp1 (mitogen-activated protein kinase-binding protein 1 [Source:NCBI gene;Acc:105356884])

HSP 1 Score: 76.6406 bits (187), Expect = 6.024e-14
Identity = 76/290 (26.21%), Postives = 118/290 (40.69%), Query Frame = 2
Query:   56 KLRMSG--EEVNEINKLELINVIGFNGTILDGLHVHPDRQHIIYGLGCTVVIED-LNTKNQCFLQGHTNNVVCITVSNSGKYIASGQITHMGYKADIMLWDYVTKQCVSTFSLHKVKVQSLAFSPNEKYLASLGGQDDGCVVIWSLTKMEPICGSPAQHKSAGITECLVYSNTNDDVFVTAGENTLRVWELDVENRKIRPTECSLGAIKRS-------------IKCITISKDDSVFFCGTSSGDILGVNMKSCLLSCIGPEKETFSLGVLSIIRLINGDLIVGAGDGTI 877
            KLR SG   + +  NK+ L  V+G        L   P    + Y  GC VV+ +    K           +  +  S  GKY+ +G+  HM     + +WD   +  VS    HK  V  +AFSPN KY+ S+G + D  V +W+  K   +  +    K   ++    +S+ +   FVTAG   ++ W LD  + K      ++  + RS             + C    +  S  FC TSSG +   N +  L   +  E  T     LS+       +  G  DGT+
Sbjct:   22 KLRRSGARHKRDLSNKVTLEKVLGITAEGNRALACEPRTGLLAYPAGCVVVLLNPRKNKQHHIFNSSRKAITTLAFSPDGKYVVTGESGHM---PAVRVWDVSERLQVSELQEHKYGVACVAFSPNGKYIISVGYEHDMMVNVWNWKKNVVVAANKVSSKVTAVS----FSD-DSSYFVTAGNRHVKFWYLD--HNKTSKVNATVPLLGRSGLLGELRNNFFSDVACGRGRRSSST-FCITSSGLLCEFNERRLLDKWV--ELRTSQATCLSVTEEF---IFCGCSDGTV 295          
BLAST of wdr-1 vs. Ensembl Medaka
Match: mapkbp1 (mitogen-activated protein kinase-binding protein 1 [Source:NCBI gene;Acc:105356884])

HSP 1 Score: 76.6406 bits (187), Expect = 6.066e-14
Identity = 76/290 (26.21%), Postives = 118/290 (40.69%), Query Frame = 2
Query:   56 KLRMSG--EEVNEINKLELINVIGFNGTILDGLHVHPDRQHIIYGLGCTVVIED-LNTKNQCFLQGHTNNVVCITVSNSGKYIASGQITHMGYKADIMLWDYVTKQCVSTFSLHKVKVQSLAFSPNEKYLASLGGQDDGCVVIWSLTKMEPICGSPAQHKSAGITECLVYSNTNDDVFVTAGENTLRVWELDVENRKIRPTECSLGAIKRS-------------IKCITISKDDSVFFCGTSSGDILGVNMKSCLLSCIGPEKETFSLGVLSIIRLINGDLIVGAGDGTI 877
            KLR SG   + +  NK+ L  V+G        L   P    + Y  GC VV+ +    K           +  +  S  GKY+ +G+  HM     + +WD   +  VS    HK  V  +AFSPN KY+ S+G + D  V +W+  K   +  +    K   ++    +S+ +   FVTAG   ++ W LD  + K      ++  + RS             + C    +  S  FC TSSG +   N +  L   +  E  T     LS+       +  G  DGT+
Sbjct:   22 KLRRSGARHKRDLSNKVTLEKVLGITAEGNRALACEPRTGLLAYPAGCVVVLLNPRKNKQHHIFNSSRKAITTLAFSPDGKYVVTGESGHM---PAVRVWDVSERLQVSELQEHKYGVACVAFSPNGKYIISVGYEHDMMVNVWNWKKNVVVAANKVSSKVTAVS----FSD-DSSYFVTAGNRHVKFWYLD--HNKTSKVNATVPLLGRSGLLGELRNNFFSDVACGRGRRSSST-FCITSSGLLCEFNERRLLDKWV--ELRTSQATCLSVTEEF---IFCGCSDGTV 295          
BLAST of wdr-1 vs. Planmine SMEST
Match: SMESG000045753.1 (SMESG000045753.1)

HSP 1 Score: 1247.26 bits (3226), Expect = 0.000e+0
Identity = 603/604 (99.83%), Postives = 604/604 (100.00%), Query Frame = 2
Query:   65 MSGEEVNEINKLELINVIGFNGTILDGLHVHPDRQHIIYGLGCTVVIEDLNTKNQCFLQGHTNNVVCITVSNSGKYIASGQITHMGYKADIMLWDYVTKQCVSTFSLHKVKVQSLAFSPNEKYLASLGGQDDGCVVIWSLTKMEPICGSPAQHKSAGITECLVYSNTNDDVFVTAGENTLRVWELDVENRKIRPTECSLGAIKRSIKCITISKDDSVFFCGTSSGDILGVNMKSCLLSCIGPEKETFSLGVLSIIRLINGDLIVGAGDGTICQVKVVEKKEGNKIMPKIVKTSNSCMLVGGVSSITLRGQGHQFYAGTEKSHIYRFSLGDFKSELINTAHYSAVNDIVYPNNCPKLFVTCSFQDVRVFHSDSQKELLRINIPNMTCYTCDIFKDGTAIITGWDDSKIRAFYPETGALMYTINDAHKKGVTAIAATSDCRKVVSGGGEGQVRVWRIEECKVSQANTIPHSHGNRKKSNVKSVVYVAHMETAMKEHANAVSCIRMNKDDTQCVSSSADGTCIIWCLIKYTRKQIMFANTLFRCVCWRPDECQIITSGTDRKIGYWEVYDGSLIRELEGSRSGSVNGMDITADGDIFVTGGDDKIVK 1876
            MSGEEVNEINKLELINVIGFNGTILDGLHVHPDRQHIIYGLGCTVVIEDLNTKNQCFLQGHTNNVVCITVSNSGKYIASGQITHMGYKADIMLWDYVTKQCVSTFSLHKVKVQSLAFSPNEKYLASLGGQDDGCVVIWSLTKMEPICGSPAQHKSAGITECLVYSNTNDDVFVTAGENTLRVWELDVENRKIRPTECSLGAIKRSIKCITISKDDSVFFCGTSSGDILGVNMKSCLLSCIGPEKETFSLGVLSIIRLINGDLIVGAGDGTICQVKVVEKKEGNKIMPKI+KTSNSCMLVGGVSSITLRGQGHQFYAGTEKSHIYRFSLGDFKSELINTAHYSAVNDIVYPNNCPKLFVTCSFQDVRVFHSDSQKELLRINIPNMTCYTCDIFKDGTAIITGWDDSKIRAFYPETGALMYTINDAHKKGVTAIAATSDCRKVVSGGGEGQVRVWRIEECKVSQANTIPHSHGNRKKSNVKSVVYVAHMETAMKEHANAVSCIRMNKDDTQCVSSSADGTCIIWCLIKYTRKQIMFANTLFRCVCWRPDECQIITSGTDRKIGYWEVYDGSLIRELEGSRSGSVNGMDITADGDIFVTGGDDKIVK
Sbjct:    1 MSGEEVNEINKLELINVIGFNGTILDGLHVHPDRQHIIYGLGCTVVIEDLNTKNQCFLQGHTNNVVCITVSNSGKYIASGQITHMGYKADIMLWDYVTKQCVSTFSLHKVKVQSLAFSPNEKYLASLGGQDDGCVVIWSLTKMEPICGSPAQHKSAGITECLVYSNTNDDVFVTAGENTLRVWELDVENRKIRPTECSLGAIKRSIKCITISKDDSVFFCGTSSGDILGVNMKSCLLSCIGPEKETFSLGVLSIIRLINGDLIVGAGDGTICQVKVVEKKEGNKIMPKIIKTSNSCMLVGGVSSITLRGQGHQFYAGTEKSHIYRFSLGDFKSELINTAHYSAVNDIVYPNNCPKLFVTCSFQDVRVFHSDSQKELLRINIPNMTCYTCDIFKDGTAIITGWDDSKIRAFYPETGALMYTINDAHKKGVTAIAATSDCRKVVSGGGEGQVRVWRIEECKVSQANTIPHSHGNRKKSNVKSVVYVAHMETAMKEHANAVSCIRMNKDDTQCVSSSADGTCIIWCLIKYTRKQIMFANTLFRCVCWRPDECQIITSGTDRKIGYWEVYDGSLIRELEGSRSGSVNGMDITADGDIFVTGGDDKIVK 604          
BLAST of wdr-1 vs. Planmine SMEST
Match: SMESG000037894.1 (SMESG000037894.1)

HSP 1 Score: 1108.59 bits (2866), Expect = 0.000e+0
Identity = 558/637 (87.60%), Postives = 567/637 (89.01%), Query Frame = 2
Query:   65 MSGEEVNEINKLELINVIGFNGTILDGLHVHPDRQHIIYGLGCTVVIEDLNTKNQCFLQGHTNNVVCITVSNSGKYIASGQITHMGYKADIMLWDYVTKQCVSTFSLHKVKVQSLAFSPNEKYLASLGGQDDGCVVIWSLTKMEPICGSPAQHKSAGITECLVYSNTNDDVFVTAGENTLRVWELDVENRKIRPTECSLGAIKRSIKCITISKDDSVFFCGTSSGDILGVNMKSCLLSCIGPEKETFSLGVLSIIRLINGDLIVGAGDGTICQVKVVEKKEGNKIMPKIVKTSNSCMLVGGVSSITLRGQGHQFYAGTEKSHIYRFSLGDFKSELINTAHYSAVNDIVYPNNCPKLFVTCSFQDVRVFHSDSQKELLRINIPNMTCYTCDIFKDGTAIITGWDDSKIRAFYPETGALMYTINDAHKKGVTAIAATSDCRKVVSGGGEGQVRVWRIEECKVSQANTIPHSHGNRKKSNVKSVVYVAHMETAMKEHANAVSCIRMNKDDTQCVSSSADGTCIIWCLIKYTRKQIMFANTLFRCVCWRPDECQIITSGTDRKIGYWEVYDGSLIRELEGSRSGSVNGMDITADGDIFVTGGDDKIVKVWKYNEGYVTHVGLGHS--MPITRLRISPDRQL 1969
            MSGEEVNEINKLELINVIGFNGTILDGLHVHPDRQHIIYGLGCTVVIEDLNTKNQCFLQGHTNNVVCITVSNSGKYIASGQITHMGYKADIMLWDYVTKQCVSTFSLHKVKVQSLAFSPNEKYLASLGGQDDGCVVIWSLTKMEPICGSPAQHKSAGITECLVYSNTNDDVFVTAGENTLRVWELDVENRKIRPTECSLGAIKRSIKCITISKDDSVFFCGTSSGDILGVNMKSCLLSCIGPEKETFSLGVLSIIRLINGDLIVGAGDGTICQVKVVEKKEGNKIMPKIVKTSNSCMLVGGVSSITLRGQGHQFYAGTEKSHIYRFSLGDFKSELINTAHYSAVNDIVYPNNCPKLFVTCSFQDVRVFHSDSQKELLRINIPNMTCYTCDIFKDGTAIITGWDDSKIRAFYPETGALMYTINDAHKKGVTAIAATSDCRKVVSGGGEGQVRVWRIEECKVSQANTIP                              V+ I  N+   Q            W  IKYTRKQIMFANTLFRCVCWRPDECQIITSGTDRKIGYWEVYDGSLIRELEGSRSGSVNGMDITADGDIFVTGGDDKIVK     + Y+ + G      +P+  L I  + +L
Sbjct:    1 MSGEEVNEINKLELINVIGFNGTILDGLHVHPDRQHIIYGLGCTVVIEDLNTKNQCFLQGHTNNVVCITVSNSGKYIASGQITHMGYKADIMLWDYVTKQCVSTFSLHKVKVQSLAFSPNEKYLASLGGQDDGCVVIWSLTKMEPICGSPAQHKSAGITECLVYSNTNDDVFVTAGENTLRVWELDVENRKIRPTECSLGAIKRSIKCITISKDDSVFFCGTSSGDILGVNMKSCLLSCIGPEKETFSLGVLSIIRLINGDLIVGAGDGTICQVKVVEKKEGNKIMPKIVKTSNSCMLVGGVSSITLRGQGHQFYAGTEKSHIYRFSLGDFKSELINTAHYSAVNDIVYPNNCPKLFVTCSFQDVRVFHSDSQKELLRINIPNMTCYTCDIFKDGTAIITGWDDSKIRAFYPETGALMYTINDAHKKGVTAIAATSDCRKVVSGGGEGQVRVWRIEECKVSQANTIP-----------------------------IVTEIGRNQMSNQ------------WS-IKYTRKQIMFANTLFRCVCWRPDECQIITSGTDRKIGYWEVYDGSLIRELEGSRSGSVNGMDITADGDIFVTGGDDKIVK-----KDYIVYKGRLRKAFVPMKNLAIDSNVEL 590          
BLAST of wdr-1 vs. Planmine SMEST
Match: SMESG000045753.1 (SMESG000045753.1)

HSP 1 Score: 1081.24 bits (2795), Expect = 0.000e+0
Identity = 523/525 (99.62%), Postives = 525/525 (100.00%), Query Frame = 2
Query:   65 MSGEEVNEINKLELINVIGFNGTILDGLHVHPDRQHIIYGLGCTVVIEDLNTKNQCFLQGHTNNVVCITVSNSGKYIASGQITHMGYKADIMLWDYVTKQCVSTFSLHKVKVQSLAFSPNEKYLASLGGQDDGCVVIWSLTKMEPICGSPAQHKSAGITECLVYSNTNDDVFVTAGENTLRVWELDVENRKIRPTECSLGAIKRSIKCITISKDDSVFFCGTSSGDILGVNMKSCLLSCIGPEKETFSLGVLSIIRLINGDLIVGAGDGTICQVKVVEKKEGNKIMPKIVKTSNSCMLVGGVSSITLRGQGHQFYAGTEKSHIYRFSLGDFKSELINTAHYSAVNDIVYPNNCPKLFVTCSFQDVRVFHSDSQKELLRINIPNMTCYTCDIFKDGTAIITGWDDSKIRAFYPETGALMYTINDAHKKGVTAIAATSDCRKVVSGGGEGQVRVWRIEECKVSQANTIPHSHGNRKKSNVKSVVYVAHMETAMKEHANAVSCIRMNKDDTQCVSSSADGTCIIWCLI 1639
            MSGEEVNEINKLELINVIGFNGTILDGLHVHPDRQHIIYGLGCTVVIEDLNTKNQCFLQGHTNNVVCITVSNSGKYIASGQITHMGYKADIMLWDYVTKQCVSTFSLHKVKVQSLAFSPNEKYLASLGGQDDGCVVIWSLTKMEPICGSPAQHKSAGITECLVYSNTNDDVFVTAGENTLRVWELDVENRKIRPTECSLGAIKRSIKCITISKDDSVFFCGTSSGDILGVNMKSCLLSCIGPEKETFSLGVLSIIRLINGDLIVGAGDGTICQVKVVEKKEGNKIMPKI+KTSNSCMLVGGVSSITLRGQGHQFYAGTEKSHIYRFSLGDFKSELINTAHYSAVNDIVYPNNCPKLFVTCSFQDVRVFHSDSQKELLRINIPNMTCYTCDIFKDGTAIITGWDDSKIRAFYPETGALMYTINDAHKKGVTAIAATSDCRKVVSGGGEGQVRVWRIEECKVSQANTIPHSHGNRKKSNVKSVVYVAHMETAMKEHANAVSCIRMNKDDTQCVSSSADGTCIIWCL+
Sbjct:    1 MSGEEVNEINKLELINVIGFNGTILDGLHVHPDRQHIIYGLGCTVVIEDLNTKNQCFLQGHTNNVVCITVSNSGKYIASGQITHMGYKADIMLWDYVTKQCVSTFSLHKVKVQSLAFSPNEKYLASLGGQDDGCVVIWSLTKMEPICGSPAQHKSAGITECLVYSNTNDDVFVTAGENTLRVWELDVENRKIRPTECSLGAIKRSIKCITISKDDSVFFCGTSSGDILGVNMKSCLLSCIGPEKETFSLGVLSIIRLINGDLIVGAGDGTICQVKVVEKKEGNKIMPKIIKTSNSCMLVGGVSSITLRGQGHQFYAGTEKSHIYRFSLGDFKSELINTAHYSAVNDIVYPNNCPKLFVTCSFQDVRVFHSDSQKELLRINIPNMTCYTCDIFKDGTAIITGWDDSKIRAFYPETGALMYTINDAHKKGVTAIAATSDCRKVVSGGGEGQVRVWRIEECKVSQANTIPHSHGNRKKSNVKSVVYVAHMETAMKEHANAVSCIRMNKDDTQCVSSSADGTCIIWCLM 525          
BLAST of wdr-1 vs. Planmine SMEST
Match: SMESG000037894.1 (SMESG000037894.1)

HSP 1 Score: 962.214 bits (2486), Expect = 0.000e+0
Identity = 467/467 (100.00%), Postives = 467/467 (100.00%), Query Frame = 2
Query:   65 MSGEEVNEINKLELINVIGFNGTILDGLHVHPDRQHIIYGLGCTVVIEDLNTKNQCFLQGHTNNVVCITVSNSGKYIASGQITHMGYKADIMLWDYVTKQCVSTFSLHKVKVQSLAFSPNEKYLASLGGQDDGCVVIWSLTKMEPICGSPAQHKSAGITECLVYSNTNDDVFVTAGENTLRVWELDVENRKIRPTECSLGAIKRSIKCITISKDDSVFFCGTSSGDILGVNMKSCLLSCIGPEKETFSLGVLSIIRLINGDLIVGAGDGTICQVKVVEKKEGNKIMPKIVKTSNSCMLVGGVSSITLRGQGHQFYAGTEKSHIYRFSLGDFKSELINTAHYSAVNDIVYPNNCPKLFVTCSFQDVRVFHSDSQKELLRINIPNMTCYTCDIFKDGTAIITGWDDSKIRAFYPETGALMYTINDAHKKGVTAIAATSDCRKVVSGGGEGQVRVWRIEECKVSQANTIP 1465
            MSGEEVNEINKLELINVIGFNGTILDGLHVHPDRQHIIYGLGCTVVIEDLNTKNQCFLQGHTNNVVCITVSNSGKYIASGQITHMGYKADIMLWDYVTKQCVSTFSLHKVKVQSLAFSPNEKYLASLGGQDDGCVVIWSLTKMEPICGSPAQHKSAGITECLVYSNTNDDVFVTAGENTLRVWELDVENRKIRPTECSLGAIKRSIKCITISKDDSVFFCGTSSGDILGVNMKSCLLSCIGPEKETFSLGVLSIIRLINGDLIVGAGDGTICQVKVVEKKEGNKIMPKIVKTSNSCMLVGGVSSITLRGQGHQFYAGTEKSHIYRFSLGDFKSELINTAHYSAVNDIVYPNNCPKLFVTCSFQDVRVFHSDSQKELLRINIPNMTCYTCDIFKDGTAIITGWDDSKIRAFYPETGALMYTINDAHKKGVTAIAATSDCRKVVSGGGEGQVRVWRIEECKVSQANTIP
Sbjct:    1 MSGEEVNEINKLELINVIGFNGTILDGLHVHPDRQHIIYGLGCTVVIEDLNTKNQCFLQGHTNNVVCITVSNSGKYIASGQITHMGYKADIMLWDYVTKQCVSTFSLHKVKVQSLAFSPNEKYLASLGGQDDGCVVIWSLTKMEPICGSPAQHKSAGITECLVYSNTNDDVFVTAGENTLRVWELDVENRKIRPTECSLGAIKRSIKCITISKDDSVFFCGTSSGDILGVNMKSCLLSCIGPEKETFSLGVLSIIRLINGDLIVGAGDGTICQVKVVEKKEGNKIMPKIVKTSNSCMLVGGVSSITLRGQGHQFYAGTEKSHIYRFSLGDFKSELINTAHYSAVNDIVYPNNCPKLFVTCSFQDVRVFHSDSQKELLRINIPNMTCYTCDIFKDGTAIITGWDDSKIRAFYPETGALMYTINDAHKKGVTAIAATSDCRKVVSGGGEGQVRVWRIEECKVSQANTIP 467          
BLAST of wdr-1 vs. Planmine SMEST
Match: SMESG000080852.1 (SMESG000080852.1)

HSP 1 Score: 73.559 bits (179), Expect = 4.507e-13
Identity = 54/195 (27.69%), Postives = 82/195 (42.05%), Query Frame = 2
Query:   83 NEINKLELINVIGFNGTILDGLHVHPDRQHIIYGLGCTVVIEDLNTKNQCFLQGHTNN-VVCITVSNSGKYIASGQITHMGYKADIMLWDYVTKQCVSTFSLHKVKVQSLAFSPNEKYLASLGGQDDGCVVIWSLTKMEPICGSPAQHKSAGITECLVYSNTNDDVFVTAGENTLRVWELDVENRKIRPTECSLG 664
            NE N+L L  V GF       + + P    + +  GC VV        Q F+     + +  I  +  GK +A+G+    G    + +W   T   +  FS H  +V +LAFS N +++ S+G Q+D  + +W L     +  S    K   I     +S      FVT G   +R W LD    K + T   LG
Sbjct:   18 NENNQLSLEKVFGFTIQNNAAVSLDPTSGIVAFPAGCVVVGYSAKRSKQFFIHNAVKSPITAIAFNREGKLLATGE---SGKSPKVRIWSVETHSQLFEFSGHNYRVGALAFSHNSRFVVSVGSQEDTSINVWELNTNTKMASSKVTSKVIAI----AFSEAG-QFFVTVGVRHVRFWYLDNSRSKSKATTPLLG 204          
The following BLAST results are available for this feature:
BLAST of wdr-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CFAP520.000e+055.12cilia and flagella associated protein 52 [Source:H... [more]
CFAP520.000e+054.27cilia and flagella associated protein 52 [Source:H... [more]
CFAP523.034e-2758.33cilia and flagella associated protein 52 [Source:H... [more]
CFAP521.110e-2558.11cilia and flagella associated protein 52 [Source:H... [more]
WDR902.436e-1924.10WD repeat domain 90 [Source:HGNC Symbol;Acc:HGNC:2... [more]
back to top
BLAST of wdr-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pfs-26.216e-1023.18Polyadenylation Factor Subunit homolog [Source:Un... [more]
sel-109.466e-1026.64F-box/WD repeat-containing protein sel-10 [Source... [more]
sel-109.466e-1026.64F-box/WD repeat-containing protein sel-10 [Source... [more]
sel-109.571e-1026.64F-box/WD repeat-containing protein sel-10 [Source... [more]
smu-12.160e-927.10Smu-1 suppressor of mec-8 and unc-52 protein [Sou... [more]
back to top
BLAST of wdr-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG100642.185e-12533.23gene:FBgn0035724 transcript:FBtr0076937[more]
Poc16.054e-1125.61gene:FBgn0036354 transcript:FBtr0075863[more]
CG39096.663e-1124.88gene:FBgn0027524 transcript:FBtr0082172[more]
Poc11.560e-1025.15gene:FBgn0036354 transcript:FBtr0321318[more]
wds3.076e-1024.26gene:FBgn0040066 transcript:FBtr0308566[more]
back to top
BLAST of wdr-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cfap520.000e+052.61cilia and flagella associated protein 52 [Source:Z... [more]
cfap520.000e+052.45cilia and flagella associated protein 52 [Source:Z... [more]
cfap520.000e+052.45cilia and flagella associated protein 52 [Source:Z... [more]
mapkbp15.425e-1526.21mitogen-activated protein kinase binding protein 1... [more]
mapkbp17.212e-1526.21mitogen-activated protein kinase binding protein 1... [more]
back to top
BLAST of wdr-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gucy1a20.000e+053.37guanylate cyclase 1, soluble, alpha 2 [Source:Xenb... [more]
gucy1a20.000e+053.21guanylate cyclase 1, soluble, alpha 2 [Source:Xenb... [more]
gucy1a20.000e+053.54guanylate cyclase 1, soluble, alpha 2 [Source:Xenb... [more]
gucy1a20.000e+052.87guanylate cyclase 1, soluble, alpha 2 [Source:Xenb... [more]
gucy1a20.000e+053.39guanylate cyclase 1, soluble, alpha 2 [Source:Xenb... [more]
back to top
BLAST of wdr-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cfap520.000e+054.04cilia and flagella associated protein 52 [Source:M... [more]
Cfap521.524e-11951.60cilia and flagella associated protein 52 [Source:M... [more]
Wdr901.675e-2523.44WD repeat domain 90 [Source:MGI Symbol;Acc:MGI:192... [more]
Wdr902.183e-2523.44WD repeat domain 90 [Source:MGI Symbol;Acc:MGI:192... [more]
Mapkbp15.349e-1425.45mitogen-activated protein kinase binding protein 1... [more]
back to top
BLAST of wdr-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8N1V2|CFA52_HUMAN0.000e+055.12Cilia- and flagella-associated protein 52 OS=Homo ... [more]
sp|Q5F201|CFA52_MOUSE0.000e+054.04Cilia- and flagella-associated protein 52 OS=Mus m... [more]
sp|Q95JL5|CFA52_MACFA0.000e+049.84Cilia- and flagella-associated protein 52 OS=Macac... [more]
sp|A8ILK1|CFA52_CHLRE0.000e+040.90Cilia- and flagella-associated protein 52 OS=Chlam... [more]
sp|Q6ZPG2|WDR90_MOUSE1.527e-2423.44WD repeat-containing protein 90 OS=Mus musculus OX... [more]
back to top
BLAST of wdr-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0A1CTQ10.000e+0100.00Wdr-1 (Fragment) OS=Schmidtea mediterranea OX=7932... [more]
A0A074Z1550.000e+060.49WD_REPEATS_REGION domain-containing protein OS=Opi... [more]
A0A4V3SFP30.000e+060.39WD_REPEATS_REGION domain-containing protein OS=Opi... [more]
A0A3R7GMT10.000e+060.67Cilia-and flagella-associated protein 52 OS=Clonor... [more]
A0A1I8FUM80.000e+060.55WD_REPEATS_REGION domain-containing protein OS=Mac... [more]
back to top
BLAST of wdr-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cfap520.000e+051.22cilia and flagella associated protein 52 [Source:N... [more]
ENSAMXT00000006286.23.142e-1628.74mitogen-activated protein kinase-binding protein 1... [more]
mapkbp18.801e-1626.91mitogen-activated protein kinase-binding protein 1... [more]
mapkbp14.615e-1526.64mitogen-activated protein kinase-binding protein 1... [more]
EML67.984e-1227.47EMAP like 6 [Source:NCBI gene;Acc:103028254][more]
back to top
BLAST of wdr-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cfap520.000e+052.62cilia and flagella associated protein 52 [Source:Z... [more]
wdr903.246e-2121.04WD repeat domain 90 [Source:ZFIN;Acc:ZDB-GENE-0704... [more]
wdr905.006e-2021.08WD repeat domain 90 [Source:ZFIN;Acc:ZDB-GENE-0704... [more]
ENSPMAT00000009420.11.023e-1821.91pep scaffold:Pmarinus_7.0:GL476782:177851:212676:1... [more]
ENSPMAT00000009409.11.232e-1822.70pep scaffold:Pmarinus_7.0:GL476782:177851:212682:1... [more]
back to top
BLAST of wdr-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
DIP23.858e-1122.26Nucleolar protein; specifically associated with th... [more]
HIR11.021e-920.75Subunit of the HIR complex; HIR is a nucleosome as... [more]
SOF11.377e-922.15Protein required for biogenesis of 40S (small) rib... [more]
TUP11.873e-922.10General repressor of transcription; forms complex ... [more]
PFS24.439e-921.95Integral subunit of the pre-mRNA CPF complex; the ... [more]
back to top
BLAST of wdr-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO480100.000e+052.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO368261.378e-2021.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO497672.707e-2024.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO440935.710e-1324.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO463314.593e-1119.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of wdr-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cfap520.000e+052.19cilia and flagella associated protein 52 [Source:N... [more]
ENSORLT00000011953.22.770e-1628.86pep primary_assembly:ASM223467v1:24:2099458:210680... [more]
wdr628.376e-1622.42WD repeat-containing protein 62 [Source:NCBI gene;... [more]
mapkbp16.024e-1426.21mitogen-activated protein kinase-binding protein 1... [more]
mapkbp16.066e-1426.21mitogen-activated protein kinase-binding protein 1... [more]
back to top
BLAST of wdr-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000045753.10.000e+099.83SMESG000045753.1[more]
SMESG000037894.10.000e+087.60SMESG000037894.1[more]
SMESG000045753.10.000e+099.62SMESG000045753.1[more]
SMESG000037894.10.000e+0100.00SMESG000037894.1[more]
SMESG000080852.14.507e-1327.69SMESG000080852.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30019305
GenBankAIX99552.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019305 ID=SMED30019305|Name=wdr-1|organism=Schmidtea mediterranea sexual|type=transcript|length=2163bp
TTTTACTTCTGTTGTTAAGCAACTGAAATTTTAATTTTGTTAAAATTGAA
ATAAGAAATTAAGAATGAGTGGTGAAGAAGTCAATGAAATAAATAAACTA
GAGCTAATTAATGTTATTGGTTTCAATGGAACCATTTTAGATGGATTGCA
TGTTCATCCAGACAGGCAACATATTATTTACGGGCTGGGTTGCACAGTCG
TCATCGAAGATTTAAATACTAAAAACCAATGTTTTCTTCAAGGTCACACA
AACAATGTCGTATGCATAACTGTGTCTAACTCGGGTAAATATATCGCGTC
AGGGCAAATAACCCATATGGGTTATAAAGCTGACATAATGCTATGGGATT
ACGTTACTAAGCAATGCGTGTCCACATTCAGTTTACACAAAGTTAAAGTT
CAGAGTTTAGCATTTTCTCCGAATGAGAAATATCTGGCATCTCTTGGTGG
TCAAGACGACGGCTGTGTTGTCATCTGGTCATTAACAAAAATGGAACCGA
TTTGCGGGTCCCCAGCACAACACAAAAGCGCTGGAATCACAGAATGCCTT
GTATATTCAAATACAAACGATGACGTTTTCGTAACTGCTGGAGAAAATAC
TTTGAGAGTTTGGGAATTGGATGTGGAAAATAGGAAAATCAGGCCCACTG
AATGCAGCCTTGGAGCTATTAAACGATCTATTAAATGTATCACGATTTCG
AAAGATGATTCTGTGTTTTTCTGTGGAACATCATCGGGAGATATTCTTGG
AGTGAACATGAAATCTTGCTTATTGAGCTGTATCGGACCTGAGAAAGAAA
CATTCAGTTTAGGCGTTCTCTCTATAATTCGACTGATTAATGGAGACCTG
ATTGTTGGTGCTGGAGATGGCACGATCTGTCAAGTGAAAGTTGTCGAGAA
AAAAGAAGGCAACAAAATAATGCCGAAAATCGTCAAAACAAGCAATTCAT
GTATGCTTGTTGGCGGAGTTTCTAGCATCACTCTGCGTGGACAGGGACAT
CAGTTTTACGCAGGAACGGAAAAATCTCACATTTATCGCTTCTCGCTTGG
AGACTTCAAATCGGAACTCATCAACACGGCCCACTATTCAGCTGTCAACG
ATATCGTATATCCCAATAATTGTCCAAAACTTTTTGTCACGTGCTCATTC
CAAGATGTCAGAGTGTTCCATTCTGATTCCCAGAAAGAATTATTGAGAAT
TAATATTCCAAATATGACTTGCTATACCTGCGATATTTTTAAAGATGGAA
CTGCTATAATAACTGGATGGGATGACAGTAAAATCAGAGCTTTTTATCCA
GAAACTGGGGCTCTTATGTACACAATAAATGATGCACATAAGAAAGGGGT
TACGGCCATAGCTGCAACATCTGACTGTAGAAAGGTGGTCAGTGGAGGCG
GAGAAGGCCAAGTGAGAGTGTGGAGAATTGAAGAATGCAAAGTATCTCAA
GCAAATACCATTCCCCATAGTCACGGTAATCGGAAGAAATCAAATGTCAA
ATCAGTGGTCTATGTAGCTCACATGGAAACCGCAATGAAAGAACATGCTA
ATGCTGTGTCTTGTATCAGAATGAATAAGGATGATACTCAATGTGTCTCT
TCATCAGCTGACGGCACATGCATTATTTGGTGTCTCATAAAATATACAAG
AAAACAAATAATGTTTGCAAACACATTGTTTCGTTGTGTTTGCTGGCGCC
CAGATGAGTGCCAAATTATTACTTCTGGAACTGATAGAAAAATTGGTTAT
TGGGAAGTTTATGACGGATCACTGATCAGGGAACTTGAAGGCTCAAGATC
TGGATCAGTCAATGGAATGGATATAACGGCTGATGGAGACATTTTTGTGA
CAGGTGGAGATGATAAAATTGTCAAGGTGTGGAAATATAATGAAGGATAC
GTAACCCATGTCGGCCTCGGACACAGCATGCCAATTACTCGTCTCCGAAT
CAGTCCGGATAGGCAACTCATCACTACTGTCAGCGAAGATGGAGCGATAT
ACTTTTGGAAATTTCCTAATAATTGAGTTACTTCAAGAACTCTATAAACC
TTGTGATTGATTCTTGTACCTTTATTATGAATATGTTGCTAGATTAAGTA
TTGTACTAAGTGTGATAAATATTAACATTGATATTCACATAAATTTAGCC
ATGTCGTACCGGG
back to top

protein sequence of SMED30019305-orf-1

>SMED30019305-orf-1 ID=SMED30019305-orf-1|Name=SMED30019305-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=654bp
MSGEEVNEINKLELINVIGFNGTILDGLHVHPDRQHIIYGLGCTVVIEDL
NTKNQCFLQGHTNNVVCITVSNSGKYIASGQITHMGYKADIMLWDYVTKQ
CVSTFSLHKVKVQSLAFSPNEKYLASLGGQDDGCVVIWSLTKMEPICGSP
AQHKSAGITECLVYSNTNDDVFVTAGENTLRVWELDVENRKIRPTECSLG
AIKRSIKCITISKDDSVFFCGTSSGDILGVNMKSCLLSCIGPEKETFSLG
VLSIIRLINGDLIVGAGDGTICQVKVVEKKEGNKIMPKIVKTSNSCMLVG
GVSSITLRGQGHQFYAGTEKSHIYRFSLGDFKSELINTAHYSAVNDIVYP
NNCPKLFVTCSFQDVRVFHSDSQKELLRINIPNMTCYTCDIFKDGTAIIT
GWDDSKIRAFYPETGALMYTINDAHKKGVTAIAATSDCRKVVSGGGEGQV
RVWRIEECKVSQANTIPHSHGNRKKSNVKSVVYVAHMETAMKEHANAVSC
IRMNKDDTQCVSSSADGTCIIWCLIKYTRKQIMFANTLFRCVCWRPDECQ
IITSGTDRKIGYWEVYDGSLIRELEGSRSGSVNGMDITADGDIFVTGGDD
KIVKVWKYNEGYVTHVGLGHSMPITRLRISPDRQLITTVSEDGAIYFWKF
PNN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0031514motile cilium
GO:0005737cytoplasm
GO:0042995cell projection
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR033015CFAP52
IPR036322WD40_repeat_dom_sf
IPR001680WD40_repeat
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR017986WD40_repeat_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 144..184
e-value: 98.0
score: 4.4
coord: 526..564
e-value: 1.6
score: 15.8
coord: 567..607
e-value: 1.7E-5
score: 34.3
coord: 610..649
e-value: 0.0012
score: 28.1
coord: 192..231
e-value: 210.0
score: 2.3
coord: 98..139
e-value: 9.9E-5
score: 31.7
coord: 372..411
e-value: 66.0
score: 5.5
coord: 484..523
e-value: 0.0034
score: 26.6
coord: 51..95
e-value: 0.13
score: 21.4
coord: 330..369
e-value: 9.5
score: 10.8
coord: 414..454
e-value: 1.1E-4
score: 31.6
IPR001680WD40 repeatPFAMPF00400WD40coord: 492..522
e-value: 0.036
score: 15.0
coord: 54..95
e-value: 0.0077
score: 17.1
coord: 423..453
e-value: 0.11
score: 13.5
coord: 615..649
e-value: 0.0067
score: 17.3
coord: 569..607
e-value: 1.1E-4
score: 22.9
coord: 100..139
e-value: 7.3E-5
score: 23.5
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 575..616
score: 10.876
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 491..522
score: 9.74
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 617..653
score: 12.213
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 422..463
score: 11.277
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 25..336
e-value: 8.0E-50
score: 171.6
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 337..536
e-value: 9.2E-23
score: 83.2
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 537..653
e-value: 1.3E-24
score: 88.6
NoneNo IPR availablePANTHERPTHR13720WD-40 REPEAT PROTEINcoord: 10..652
IPR033015Cilia- and flagella-associated protein 52PANTHERPTHR13720:SF14CILIA- AND FLAGELLA-ASSOCIATED PROTEIN 52coord: 10..652
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 58..653
score: 28.792
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 300..652
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 11..348