Heterogeneous nuclear ribonucleoprotein L

Overview
NameHeterogeneous nuclear ribonucleoprotein L
Smed IDSMED30019298
Length (bp)2156
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Heterogeneous nuclear ribonucleoprotein L (SMED30019298) t-SNE clustered cells

Violin plots show distribution of expression levels for Heterogeneous nuclear ribonucleoprotein L (SMED30019298) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Heterogeneous nuclear ribonucleoprotein L (SMED30019298) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Heterogeneous nuclear ribonucleoprotein L (SMED30019298) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019298

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 17

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30019298SMESG000005298.1 SmedASXL_006284SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30019298SMESG000005298.1 SmedASXL_006284SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30019298SMESG000005298.1 dd_Smed_v4_1327_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30019298SMESG000005298.1 dd_Smed_v4_1327_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30019298SMESG000005298.1 dd_Smed_v4_1327_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30019298SMESG000005298.1 dd_Smed_v4_1327_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30019298SMESG000005298.1 dd_Smed_v4_1327_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30019298SMESG000005298.1 dd_Smed_v4_1327_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30019298SMESG000005298.1 dd_Smed_v4_1327_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30019298SMESG000005298.1 dd_Smed_v4_1327_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30019298SMESG000005298.1 dd_Smed_v4_1327_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30019298SMESG000005298.1 dd_Smed_v4_1327_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019298SMESG000005298.1 Contig47918newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019298SMESG000005298.1 Contig47918uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019298SMESG000005298.1 Contig46380newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019298SMESG000005298.1 Contig46380uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neoblastSMED30019298SMESG000005298.1 dd_Smed_v6_1327_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Human
Match: HNRNPL (heterogeneous nuclear ribonucleoprotein L [Source:HGNC Symbol;Acc:HGNC:5045])

HSP 1 Score: 333.569 bits (854), Expect = 1.356e-105
Identity = 204/515 (39.61%), Postives = 300/515 (58.25%), Query Frame = 3
Query:   81 DDWEDIEPSKVIHIRELAEHTLEIDVSRAMEKFGPIRDIAMIPKRRQALVEFENLVSAQEVVKRYRNDFIHIANRPAKINFSTSEHVLKRSGPLNEAVSTANKVLIFFIYDAVYPINVDVINKICKPHGRVVRVFINRKASIMQALVEFYSLDDAIRVKRNLNGADIYSGCCTLKIEYATTNRVNVIQNSEDSYDFEAPSMGMRSSQSLLGLPSN-NEMASRVSMMGRPYDPPRREQPFNGSYGNIRDEYYDEIREP------NRRMMPLNNSMDHSLG---YDQEYDREPQRN-------YNDGPKVAMIYGLNLEFVNCDNLFNLLCIYGNVIKIKFLKSKEGSAMVQMSDGASIDRMMHLLHNQPLFGKTLQFQISKQPVIMDVPAPYKLPDGTVSFKDYTNCRENRFVTPQLAEKNRVFPPSKTINYWNAPPSFGLEMIQEEFKKYN---AVEPPEFFQL--TNRDKSSSGLLQWASVEEAINAIALCNHIMIESEGAKFPYQLKLSFSES 1559
            DD      S V+HIR L +  +E D+  A+++FGPI  + ++PK+RQALVEFE+++ A   V    ++ I+IA  PA +N+STS+ +  R G  +++ S  N VL+F I + +Y I  DV+  IC P G V R+ I RK  + QA+VEF S+  A R K +LNGADIYSGCCTLKIEYA   R+NV +N +D++D+  P++   S Q   G  SN N+   +  ++G   D P     + G +G     Y+DE   P       RRM P      H  G   Y  +Y   P          + D P V M+YGL+   +NCD +FN+ C+YGNV K+KF+KSK G+AMV+M+DG ++DR +  L+N  +FG+ L   +SKQP IM   + Y L DG+ S+KD++  R NRF TP+ A KNR+  PS  ++++NAP    LE+ +E F +      V+ P   ++     ++SSSGLL+W S  +A+  +   NH  +++    +PY LKL FS +
Sbjct:   34 DDPHKTPASPVVHIRGLIDGVVEADLVEALQEFGPISYVVVMPKKRQALVEFEDVLGACNAVNYAADNQIYIAGHPAFVNYSTSQKI-SRPGDSDDSRSV-NSVLLFTILNPIYSITTDVLYTICNPCGPVQRIVIFRKNGV-QAMVEFDSVQSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDQDTWDYTNPNL---SGQGDPG--SNPNKRQRQPPLLG---DHPAE---YGGPHGGYHSHYHDEGYGPPPPHYEGRRMGPPVGG--HRRGPSRYGPQYGHPPPPPPPPEYGPHADSP-VLMVYGLDQSKMNCDRVFNVFCLYGNVEKVKFMKSKPGAAMVEMADGYAVDRAITHLNNNFMFGQKLNVCVSKQPAIMPGQS-YGLEDGSCSYKDFSESRNNRFSTPEQAAKNRIQHPSNVLHFFNAP----LEVTEENFFEICDELGVKRPSSVKVFSGKSERSSSGLLEWESKSDALETLGFLNHYQMKNPNGPYPYTLKLCFSTA 526          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Human
Match: HNRNPL (heterogeneous nuclear ribonucleoprotein L [Source:HGNC Symbol;Acc:HGNC:5045])

HSP 1 Score: 333.569 bits (854), Expect = 1.356e-105
Identity = 204/515 (39.61%), Postives = 300/515 (58.25%), Query Frame = 3
Query:   81 DDWEDIEPSKVIHIRELAEHTLEIDVSRAMEKFGPIRDIAMIPKRRQALVEFENLVSAQEVVKRYRNDFIHIANRPAKINFSTSEHVLKRSGPLNEAVSTANKVLIFFIYDAVYPINVDVINKICKPHGRVVRVFINRKASIMQALVEFYSLDDAIRVKRNLNGADIYSGCCTLKIEYATTNRVNVIQNSEDSYDFEAPSMGMRSSQSLLGLPSN-NEMASRVSMMGRPYDPPRREQPFNGSYGNIRDEYYDEIREP------NRRMMPLNNSMDHSLG---YDQEYDREPQRN-------YNDGPKVAMIYGLNLEFVNCDNLFNLLCIYGNVIKIKFLKSKEGSAMVQMSDGASIDRMMHLLHNQPLFGKTLQFQISKQPVIMDVPAPYKLPDGTVSFKDYTNCRENRFVTPQLAEKNRVFPPSKTINYWNAPPSFGLEMIQEEFKKYN---AVEPPEFFQL--TNRDKSSSGLLQWASVEEAINAIALCNHIMIESEGAKFPYQLKLSFSES 1559
            DD      S V+HIR L +  +E D+  A+++FGPI  + ++PK+RQALVEFE+++ A   V    ++ I+IA  PA +N+STS+ +  R G  +++ S  N VL+F I + +Y I  DV+  IC P G V R+ I RK  + QA+VEF S+  A R K +LNGADIYSGCCTLKIEYA   R+NV +N +D++D+  P++   S Q   G  SN N+   +  ++G   D P     + G +G     Y+DE   P       RRM P      H  G   Y  +Y   P          + D P V M+YGL+   +NCD +FN+ C+YGNV K+KF+KSK G+AMV+M+DG ++DR +  L+N  +FG+ L   +SKQP IM   + Y L DG+ S+KD++  R NRF TP+ A KNR+  PS  ++++NAP    LE+ +E F +      V+ P   ++     ++SSSGLL+W S  +A+  +   NH  +++    +PY LKL FS +
Sbjct:   34 DDPHKTPASPVVHIRGLIDGVVEADLVEALQEFGPISYVVVMPKKRQALVEFEDVLGACNAVNYAADNQIYIAGHPAFVNYSTSQKI-SRPGDSDDSRSV-NSVLLFTILNPIYSITTDVLYTICNPCGPVQRIVIFRKNGV-QAMVEFDSVQSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDQDTWDYTNPNL---SGQGDPG--SNPNKRQRQPPLLG---DHPAE---YGGPHGGYHSHYHDEGYGPPPPHYEGRRMGPPVGG--HRRGPSRYGPQYGHPPPPPPPPEYGPHADSP-VLMVYGLDQSKMNCDRVFNVFCLYGNVEKVKFMKSKPGAAMVEMADGYAVDRAITHLNNNFMFGQKLNVCVSKQPAIMPGQS-YGLEDGSCSYKDFSESRNNRFSTPEQAAKNRIQHPSNVLHFFNAP----LEVTEENFFEICDELGVKRPSSVKVFSGKSERSSSGLLEWESKSDALETLGFLNHYQMKNPNGPYPYTLKLCFSTA 526          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Human
Match: HNRNPL (heterogeneous nuclear ribonucleoprotein L [Source:HGNC Symbol;Acc:HGNC:5045])

HSP 1 Score: 333.954 bits (855), Expect = 5.910e-105
Identity = 204/515 (39.61%), Postives = 300/515 (58.25%), Query Frame = 3
Query:   81 DDWEDIEPSKVIHIRELAEHTLEIDVSRAMEKFGPIRDIAMIPKRRQALVEFENLVSAQEVVKRYRNDFIHIANRPAKINFSTSEHVLKRSGPLNEAVSTANKVLIFFIYDAVYPINVDVINKICKPHGRVVRVFINRKASIMQALVEFYSLDDAIRVKRNLNGADIYSGCCTLKIEYATTNRVNVIQNSEDSYDFEAPSMGMRSSQSLLGLPSN-NEMASRVSMMGRPYDPPRREQPFNGSYGNIRDEYYDEIREP------NRRMMPLNNSMDHSLG---YDQEYDREPQRN-------YNDGPKVAMIYGLNLEFVNCDNLFNLLCIYGNVIKIKFLKSKEGSAMVQMSDGASIDRMMHLLHNQPLFGKTLQFQISKQPVIMDVPAPYKLPDGTVSFKDYTNCRENRFVTPQLAEKNRVFPPSKTINYWNAPPSFGLEMIQEEFKKYN---AVEPPEFFQL--TNRDKSSSGLLQWASVEEAINAIALCNHIMIESEGAKFPYQLKLSFSES 1559
            DD      S V+HIR L +  +E D+  A+++FGPI  + ++PK+RQALVEFE+++ A   V    ++ I+IA  PA +N+STS+ +  R G  +++ S  N VL+F I + +Y I  DV+  IC P G V R+ I RK  + QA+VEF S+  A R K +LNGADIYSGCCTLKIEYA   R+NV +N +D++D+  P++   S Q   G  SN N+   +  ++G   D P     + G +G     Y+DE   P       RRM P      H  G   Y  +Y   P          + D P V M+YGL+   +NCD +FN+ C+YGNV K+KF+KSK G+AMV+M+DG ++DR +  L+N  +FG+ L   +SKQP IM   + Y L DG+ S+KD++  R NRF TP+ A KNR+  PS  ++++NAP    LE+ +E F +      V+ P   ++     ++SSSGLL+W S  +A+  +   NH  +++    +PY LKL FS +
Sbjct:   93 DDPHKTPASPVVHIRGLIDGVVEADLVEALQEFGPISYVVVMPKKRQALVEFEDVLGACNAVNYAADNQIYIAGHPAFVNYSTSQKI-SRPGDSDDSRSV-NSVLLFTILNPIYSITTDVLYTICNPCGPVQRIVIFRKNGV-QAMVEFDSVQSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDQDTWDYTNPNL---SGQGDPG--SNPNKRQRQPPLLG---DHPAE---YGGPHGGYHSHYHDEGYGPPPPHYEGRRMGPPVGG--HRRGPSRYGPQYGHPPPPPPPPEYGPHADSP-VLMVYGLDQSKMNCDRVFNVFCLYGNVEKVKFMKSKPGAAMVEMADGYAVDRAITHLNNNFMFGQKLNVCVSKQPAIMPGQS-YGLEDGSCSYKDFSESRNNRFSTPEQAAKNRIQHPSNVLHFFNAP----LEVTEENFFEICDELGVKRPSSVKVFSGKSERSSSGLLEWESKSDALETLGFLNHYQMKNPNGPYPYTLKLCFSTA 585          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Human
Match: HNRNPL (heterogeneous nuclear ribonucleoprotein L [Source:HGNC Symbol;Acc:HGNC:5045])

HSP 1 Score: 333.954 bits (855), Expect = 5.910e-105
Identity = 204/515 (39.61%), Postives = 300/515 (58.25%), Query Frame = 3
Query:   81 DDWEDIEPSKVIHIRELAEHTLEIDVSRAMEKFGPIRDIAMIPKRRQALVEFENLVSAQEVVKRYRNDFIHIANRPAKINFSTSEHVLKRSGPLNEAVSTANKVLIFFIYDAVYPINVDVINKICKPHGRVVRVFINRKASIMQALVEFYSLDDAIRVKRNLNGADIYSGCCTLKIEYATTNRVNVIQNSEDSYDFEAPSMGMRSSQSLLGLPSN-NEMASRVSMMGRPYDPPRREQPFNGSYGNIRDEYYDEIREP------NRRMMPLNNSMDHSLG---YDQEYDREPQRN-------YNDGPKVAMIYGLNLEFVNCDNLFNLLCIYGNVIKIKFLKSKEGSAMVQMSDGASIDRMMHLLHNQPLFGKTLQFQISKQPVIMDVPAPYKLPDGTVSFKDYTNCRENRFVTPQLAEKNRVFPPSKTINYWNAPPSFGLEMIQEEFKKYN---AVEPPEFFQL--TNRDKSSSGLLQWASVEEAINAIALCNHIMIESEGAKFPYQLKLSFSES 1559
            DD      S V+HIR L +  +E D+  A+++FGPI  + ++PK+RQALVEFE+++ A   V    ++ I+IA  PA +N+STS+ +  R G  +++ S  N VL+F I + +Y I  DV+  IC P G V R+ I RK  + QA+VEF S+  A R K +LNGADIYSGCCTLKIEYA   R+NV +N +D++D+  P++   S Q   G  SN N+   +  ++G   D P     + G +G     Y+DE   P       RRM P      H  G   Y  +Y   P          + D P V M+YGL+   +NCD +FN+ C+YGNV K+KF+KSK G+AMV+M+DG ++DR +  L+N  +FG+ L   +SKQP IM   + Y L DG+ S+KD++  R NRF TP+ A KNR+  PS  ++++NAP    LE+ +E F +      V+ P   ++     ++SSSGLL+W S  +A+  +   NH  +++    +PY LKL FS +
Sbjct:   93 DDPHKTPASPVVHIRGLIDGVVEADLVEALQEFGPISYVVVMPKKRQALVEFEDVLGACNAVNYAADNQIYIAGHPAFVNYSTSQKI-SRPGDSDDSRSV-NSVLLFTILNPIYSITTDVLYTICNPCGPVQRIVIFRKNGV-QAMVEFDSVQSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDQDTWDYTNPNL---SGQGDPG--SNPNKRQRQPPLLG---DHPAE---YGGPHGGYHSHYHDEGYGPPPPHYEGRRMGPPVGG--HRRGPSRYGPQYGHPPPPPPPPEYGPHADSP-VLMVYGLDQSKMNCDRVFNVFCLYGNVEKVKFMKSKPGAAMVEMADGYAVDRAITHLNNNFMFGQKLNVCVSKQPAIMPGQS-YGLEDGSCSYKDFSESRNNRFSTPEQAAKNRIQHPSNVLHFFNAP----LEVTEENFFEICDELGVKRPSSVKVFSGKSERSSSGLLEWESKSDALETLGFLNHYQMKNPNGPYPYTLKLCFSTA 585          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Human
Match: HNRNPL (heterogeneous nuclear ribonucleoprotein L [Source:HGNC Symbol;Acc:HGNC:5045])

HSP 1 Score: 330.102 bits (845), Expect = 4.621e-104
Identity = 206/541 (38.08%), Postives = 298/541 (55.08%), Query Frame = 3
Query:   81 DDWEDIEPSKVIHIRELAEHTLEIDVSRAMEKFGPIRDIAMIPKRRQALVEFENLVSAQEVVKRYRNDFIHIANRPAKINFSTSEHVLKRSGPLNEAVSTANKVLIFFIYDAVYPINVDVINKICKPHGRVVRVFINRKASIMQALVEFYSLDDAIRVKRNLNGADIYSGCCTLKIEYATTNRVNVIQNSEDSYDFEAPSMG----------MRSSQSLL------------GLPSNNEMAS-----RVSMMGRPYDPPRREQPFNGSYGNIRDEYYDEIREP------NRRMMPLNNSMDHSLG---YDQEYDREPQRN-------YNDGPKVAMIYGLNLEFVNCDNLFNLLCIYGNVIKIKFLKSKEGSAMVQMSDGASIDRMMHLLHNQPLFGKTLQFQISKQPVIMDVPAPYKLPDGTVSFKDYTNCRENRFVTPQLAEKNRVFPPSKTINYWNAPPSFGLEMIQEEFKKYN---AVEPPEFFQL--TNRDKSSSGLLQWASVEEAINAIALCNHIMIESEGAKFPYQLKLSFSES 1559
            DD      S V+HIR L +  +E D+  A+++FGPI  + ++PK+RQALVEFE+++ A   V    ++ I+IA  PA +N+STS+ +  R G  +++ S  N VL+F I + +Y I  DV+  IC P G V R+ I RK  + QA+VEF S+  A R K +LNGADIYSGCCTLKIEYA   R+NV +N +D++D+  P++            R  Q  L            G PS +   S     R      P  P     P  G +G     Y+DE   P       RRM P      H  G   Y  +Y   P          + D P V M+YGL+   +NCD +FN+ C+YGNV K+KF+KSK G+AMV+M+DG ++DR +  L+N  +FG+ L   +SKQP IM   + Y L DG+ S+KD++  R NRF TP+ A KNR+  PS  ++++NAP    LE+ +E F +      V+ P   ++     ++SSSGLL+W S  +A+  +   NH  +++    +PY LKL FS +
Sbjct:    4 DDPHKTPASPVVHIRGLIDGVVEADLVEALQEFGPISYVVVMPKKRQALVEFEDVLGACNAVNYAADNQIYIAGHPAFVNYSTSQKI-SRPGDSDDSRSV-NSVLLFTILNPIYSITTDVLYTICNPCGPVQRIVIFRKNGV-QAMVEFDSVQSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDQDTWDYTNPNLSGQGDPGSNPNKRQRQPPLLGDHPAEYGEGRGFPSVDSRGSCAPARRPPCKFSPVLPLFPSHPPGGPHGGYHSHYHDEGYGPPPPHYEGRRMGPPVGG--HRRGPSRYGPQYGHPPPPPPPPEYGPHADSP-VLMVYGLDQSKMNCDRVFNVFCLYGNVEKVKFMKSKPGAAMVEMADGYAVDRAITHLNNNFMFGQKLNVCVSKQPAIMPGQS-YGLEDGSCSYKDFSESRNNRFSTPEQAAKNRIQHPSNVLHFFNAP----LEVTEENFFEICDELGVKRPSSVKVFSGKSERSSSGLLEWESKSDALETLGFLNHYQMKNPNGPYPYTLKLCFSTA 533          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Celegans
Match: hrpl-1 (Heterogeneous nuclear RibonucleoProtein (HnRNP) L homolog [Source:UniProtKB/TrEMBL;Acc:Q95QR5])

HSP 1 Score: 273.863 bits (699), Expect = 1.950e-82
Identity = 170/512 (33.20%), Postives = 273/512 (53.32%), Query Frame = 3
Query:   66 KRAKPDDWEDIE---PSKVIHIRELAEHTLEIDVSRAMEKFGPIRDIAMIPKRRQALVEFENLVSAQEVVKRYRNDFIHIANRPAKINFSTSEHVLKRSGPLNEAVSTANKVLIFFIYDAVYPINVDVINKICKPHGRVVRVFINRKASIMQALVEFYSLDDAIRVKRNLNGADIYSGCCTLKIEYATTNRVNVIQNSEDSYDFEAP-SMGMRSSQSLLGLPSNNEMASRVSMMGRPYDPPRR-------EQPFNGSY---GNIRDEYYDEIREPNRRMMPLNNSMDHSLGYDQEYDREPQRNYNDGPK-VAMIYGLNLEFVNCDNLFNLLCIYGNVIKIKFLKSKEGSAMVQMSDGASIDRMMHLLHNQPLFGKTLQFQISKQPVIMDVPAPYKLPDGTVSFKDYTNCRENRFVTPQLAEKNRVFPPSKTINYWNAPPSFGLEMIQEEFKKYNAVEPPEFFQLTNR-DKSSSGLLQWASVEEAINAIALCNHIMIESEGAKFPYQLKLSFS 1553
            KR + DD  D     PS V+H+R L +   E D+  A+  FGP+     IP  R ALVEFE++  A+  V    ++ I++  + A  N+STS+ + +    +    +T NKVL+  + +A YPI+ DVI +I    G+V+RV +  K +++QALVEF S++ A   K  +NGADIYSGCCTLK+E+A  +RV V +  +D  DF  P +   + +     +P+  +   R     RPY+  R        + P +  Y   G    +YY   R       P     D+        DR   +    GP  V MIYGL    +NCD LFN+LC YGNV++I F+++K  + ++++        ++  L    LFG TL+F+ S Q  +  +  P+ LPDG+ SFKDY++ R  RF TP+LA KNR+  P+ T++++NAP +   + + +   +    +P +     +R ++S++G  ++ +VE A   +AL NH  + S     P+ +K +++
Sbjct:   15 KRYRRDDNADPTNPNPSIVVHVRNLHQKVTEADLLEALSNFGPVAYATCIPHSRMALVEFEDIEGAKACVNFATSNQINVGGQGALFNYSTSQCIER----MGFESATPNKVLVVTVLNAQYPIDADVIYQISNAQGKVLRVAVMHKPTVVQALVEFESMEVAKAAKHAMNGADIYSGCCTLKVEFAKPDRVRVQRQDKDQRDFTLPDNESFQDTGRKTLIPAKPDDHYR-----RPYEDDRNHYDRHDYQAPSSYGYSSRGGGHSDYYGGDRGGPPHPPPSRYRDDYE-------DRGYAQPAGGGPGCVMMIYGLEHGKINCDMLFNILCQYGNVLRISFMRTKTETGIIELGTPEERQNVLDFLQGSALFGLTLEFKPSHQECVHHLRDPFLLPDGSPSFKDYSSSRNQRFSTPELAAKNRIIFPTNTLHWFNAPGTMDEQALLDLMAEKTEHKPVKIDIFPSRNERSAAGTAEFETVEIANEVLALVNHTPVNSPYGSAPFIVKWAYA 510          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Celegans
Match: hrpl-1 (Heterogeneous nuclear RibonucleoProtein (HnRNP) L homolog [Source:UniProtKB/TrEMBL;Acc:Q95QR5])

HSP 1 Score: 273.863 bits (699), Expect = 1.950e-82
Identity = 170/512 (33.20%), Postives = 273/512 (53.32%), Query Frame = 3
Query:   66 KRAKPDDWEDIE---PSKVIHIRELAEHTLEIDVSRAMEKFGPIRDIAMIPKRRQALVEFENLVSAQEVVKRYRNDFIHIANRPAKINFSTSEHVLKRSGPLNEAVSTANKVLIFFIYDAVYPINVDVINKICKPHGRVVRVFINRKASIMQALVEFYSLDDAIRVKRNLNGADIYSGCCTLKIEYATTNRVNVIQNSEDSYDFEAP-SMGMRSSQSLLGLPSNNEMASRVSMMGRPYDPPRR-------EQPFNGSY---GNIRDEYYDEIREPNRRMMPLNNSMDHSLGYDQEYDREPQRNYNDGPK-VAMIYGLNLEFVNCDNLFNLLCIYGNVIKIKFLKSKEGSAMVQMSDGASIDRMMHLLHNQPLFGKTLQFQISKQPVIMDVPAPYKLPDGTVSFKDYTNCRENRFVTPQLAEKNRVFPPSKTINYWNAPPSFGLEMIQEEFKKYNAVEPPEFFQLTNR-DKSSSGLLQWASVEEAINAIALCNHIMIESEGAKFPYQLKLSFS 1553
            KR + DD  D     PS V+H+R L +   E D+  A+  FGP+     IP  R ALVEFE++  A+  V    ++ I++  + A  N+STS+ + +    +    +T NKVL+  + +A YPI+ DVI +I    G+V+RV +  K +++QALVEF S++ A   K  +NGADIYSGCCTLK+E+A  +RV V +  +D  DF  P +   + +     +P+  +   R     RPY+  R        + P +  Y   G    +YY   R       P     D+        DR   +    GP  V MIYGL    +NCD LFN+LC YGNV++I F+++K  + ++++        ++  L    LFG TL+F+ S Q  +  +  P+ LPDG+ SFKDY++ R  RF TP+LA KNR+  P+ T++++NAP +   + + +   +    +P +     +R ++S++G  ++ +VE A   +AL NH  + S     P+ +K +++
Sbjct:   15 KRYRRDDNADPTNPNPSIVVHVRNLHQKVTEADLLEALSNFGPVAYATCIPHSRMALVEFEDIEGAKACVNFATSNQINVGGQGALFNYSTSQCIER----MGFESATPNKVLVVTVLNAQYPIDADVIYQISNAQGKVLRVAVMHKPTVVQALVEFESMEVAKAAKHAMNGADIYSGCCTLKVEFAKPDRVRVQRQDKDQRDFTLPDNESFQDTGRKTLIPAKPDDHYR-----RPYEDDRNHYDRHDYQAPSSYGYSSRGGGHSDYYGGDRGGPPHPPPSRYRDDYE-------DRGYAQPAGGGPGCVMMIYGLEHGKINCDMLFNILCQYGNVLRISFMRTKTETGIIELGTPEERQNVLDFLQGSALFGLTLEFKPSHQECVHHLRDPFLLPDGSPSFKDYSSSRNQRFSTPELAAKNRIIFPTNTLHWFNAPGTMDEQALLDLMAEKTEHKPVKIDIFPSRNERSAAGTAEFETVEIANEVLALVNHTPVNSPYGSAPFIVKWAYA 510          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Celegans
Match: hrpl-1 (Heterogeneous nuclear RibonucleoProtein (HnRNP) L homolog [Source:UniProtKB/TrEMBL;Acc:Q95QR5])

HSP 1 Score: 174.481 bits (441), Expect = 1.574e-48
Identity = 119/339 (35.10%), Postives = 170/339 (50.15%), Query Frame = 3
Query:   66 KRAKPDDWEDI---EPSKVIHIRELAEHTLEIDVSRAMEKFGPIRDIAMIPKRRQALVEFENLVSAQEVVKRYRNDFIHIANRPAKINFSTSEHVLKRSGPLNEAVSTANKVLIFFIYDAVYPINVDVINKICKPHGRVVRVFINRKASIMQALVEFYSLDDAIRVKRNLNGADIYSGCCTLKIEYATTNRVNVIQNSEDSYDFEAPSMGMRSSQSLLGLPSNNEMASRVSMMGRPYDPPRR-------EQPFNGSY---GNIRDEYYDEIREPNRRMMPLNNSMDHSLGYDQEYDREPQRNYNDGPK-VAMIYGLNLEFVNCDNLFNLLCIYGNVIKI 1040
            KR + DD  D     PS V+H+R L +   E D+  A+  FGP+     IP  R ALVEFE++  A+  V    ++ I++  + A  N+STS+ + +    +    +T NKVL+  + +A YPI+ DVI +I    G+V+RV +  K +++QALVEF S++ A   K  +NGADIYSGCCTLK+E+A  +RV V +  +D  DF               LP N           RPY+  R        + P +  Y   G    +YY   R       P     D+        DR   +    GP  V MIYGL    +NCD LFN+LC YGNV+++
Sbjct:   15 KRYRRDDNADPTNPNPSIVVHVRNLHQKVTEADLLEALSNFGPVAYATCIPHSRMALVEFEDIEGAKACVNFATSNQINVGGQGALFNYSTSQCIER----MGFESATPNKVLVVTVLNAQYPIDADVIYQISNAQGKVLRVAVMHKPTVVQALVEFESMEVAKAAKHAMNGADIYSGCCTLKVEFAKPDRVRVQRQDKDQRDFT--------------LPDNR----------RPYEDDRNHYDRHDYQAPSSYGYSSRGGGHSDYYGGDRGGPPHPPPSRYRDDYE-------DRGYAQPAGGGPGCVMMIYGLEHGKINCDMLFNILCQYGNVLRV 318          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Celegans
Match: ptb-1 (PTB (HnRNP) homolog; Putative RNA-binding protein PTB-1a [Source:UniProtKB/TrEMBL;Acc:Q18999])

HSP 1 Score: 86.2705 bits (212), Expect = 3.022e-17
Identity = 54/213 (25.35%), Postives = 110/213 (51.64%), Query Frame = 3
Query:   96 IEPSKVIHIRELAEHTLEIDVSRAMEKFGPIRDIAMIPKRRQALVE---------FENLVSAQEVVKRYRNDFIHIANRPAKINFSTSEHVLKRSGPLNEAVST--------ANKVLIFFIYDAVYPINVDVINKICKPHGRVVRVFINRKASIMQALVEFYSLDDAIRVKRNLNGADIYSGCCTLKIEYATTNRVNVIQNSEDSYDFEAPSM 683
            I  SKV+H+R +    +++++ +   ++GP+ +  M+  + QA VE         F + ++A  +  R R  F   +    ++ F  ++ +       N +VS          N VL   I + ++P+++DV+ ++   +G+V+R+    K +  QALV+    + A   K+ L   ++Y+GCCTL+I+Y+  + +NV  N++ S D+  P++
Sbjct:  117 IPVSKVVHVRNIPPDLVDVELMQLCIQYGPVSNYMMLKGKSQAFVEYEEEASAAAFVSGMTAVPIQIRGRTLFAQYSTH-RELKFDKNKAISDTESVANGSVSNFEVGTQQQPNSVLRTIIENMMFPVSLDVLYQLFTRYGKVLRIITFNKNNTFQALVQMSEANSAQLAKQGLENQNVYNGCCTLRIDYSKLSTLNVKYNNDKSRDYTNPNL 328          

HSP 2 Score: 64.6994 bits (156), Expect = 1.426e-10
Identity = 58/208 (27.88%), Postives = 102/208 (49.04%), Query Frame = 3
Query:  951 VAMIYGLNLEFVNCDNLFNLLCIYGNVIKIKFLKSKEGSAMVQMSDGASIDRMMHLLHNQPLFGKTLQFQISKQPVIMDVPAPYK-LPDGTVSFKDYTNCRENRFVTPQLAEKNRVFPPSKTINYWNAPPSFGLEMIQEEFKKYN-AVEPPEFFQLTNRDKSSSGLLQWASVEEAINA-IALCNHIMIESEGAKFPYQLKLSFSESPI 1565
            V ++  L+   V  D LF L  +YG+V+++K L +K+ +A++Q S+       +  L       + ++   SK     +V  P +  PD  ++ +DY +   +RF  P       ++PP  T++  N P S   E ++E F +   AV+  +FF   ++      L Q   +E AI+A IA+ NH + E+        L++SFS+S I
Sbjct:  422 VILVSNLHEMKVTTDALFTLFGVYGDVMRVKILYNKKDNALIQYSEPQQAQLALTHLDKVKWHDRLIRVAPSKH---TNVQMPKEGQPDAGLT-RDYAHSTLHRFKKPGSKNYLNIYPPCATLHLSNIPTSVSEEKLKEMFAEAGFAVKAFKFFPKDHK----MALCQLEDIETAIDALIAMHNHKLAENA------HLRVSFSKSGI 615          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Celegans
Match: ptb-1 (PTB (HnRNP) homolog; Putative RNA-binding protein PTB-1a [Source:UniProtKB/TrEMBL;Acc:Q18999])

HSP 1 Score: 70.8626 bits (172), Expect = 1.295e-12
Identity = 32/100 (32.00%), Postives = 62/100 (62.00%), Query Frame = 3
Query:  384 NKVLIFFIYDAVYPINVDVINKICKPHGRVVRVFINRKASIMQALVEFYSLDDAIRVKRNLNGADIYSGCCTLKIEYATTNRVNVIQNSEDSYDFEAPSM 683
            N VL   I + ++P+++DV+ ++   +G+V+R+    K +  QALV+    + A   K+ L   ++Y+GCCTL+I+Y+  + +NV  N++ S D+  P++
Sbjct:   67 NSVLRTIIENMMFPVSLDVLYQLFTRYGKVLRIITFNKNNTFQALVQMSEANSAQLAKQGLENQNVYNGCCTLRIDYSKLSTLNVKYNNDKSRDYTNPNL 166          

HSP 2 Score: 65.0846 bits (157), Expect = 8.079e-11
Identity = 58/208 (27.88%), Postives = 102/208 (49.04%), Query Frame = 3
Query:  951 VAMIYGLNLEFVNCDNLFNLLCIYGNVIKIKFLKSKEGSAMVQMSDGASIDRMMHLLHNQPLFGKTLQFQISKQPVIMDVPAPYK-LPDGTVSFKDYTNCRENRFVTPQLAEKNRVFPPSKTINYWNAPPSFGLEMIQEEFKKYN-AVEPPEFFQLTNRDKSSSGLLQWASVEEAINA-IALCNHIMIESEGAKFPYQLKLSFSESPI 1565
            V ++  L+   V  D LF L  +YG+V+++K L +K+ +A++Q S+       +  L       + ++   SK     +V  P +  PD  ++ +DY +   +RF  P       ++PP  T++  N P S   E ++E F +   AV+  +FF   ++      L Q   +E AI+A IA+ NH + E+        L++SFS+S I
Sbjct:  260 VILVSNLHEMKVTTDALFTLFGVYGDVMRVKILYNKKDNALIQYSEPQQAQLALTHLDKVKWHDRLIRVAPSKH---TNVQMPKEGQPDAGLT-RDYAHSTLHRFKKPGSKNYLNIYPPCATLHLSNIPTSVSEEKLKEMFAEAGFAVKAFKFFPKDHK----MALCQLEDIETAIDALIAMHNHKLAENA------HLRVSFSKSGI 453          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Fly
Match: sm (gene:FBgn0003435 transcript:FBtr0308796)

HSP 1 Score: 271.937 bits (694), Expect = 7.545e-83
Identity = 158/406 (38.92%), Postives = 238/406 (58.62%), Query Frame = 3
Query:  384 NKVLIFFIYDAVYPINVDVINKICKPHGRVVRVFINRKASIMQALVEFYSLDDAIRVKRNLNGADIYSGCCTLKIEYATTNRVNVIQNSED-SYDFEAPSMGMRSSQSLLGLPSNNEM-ASRVSMMGR-----PYDPPRREQPFNGSYGNIRDEYYDEIREPNRRMMPLNNSMDHSLGYDQEYDREPQRNYNDGPKVAMIYGLNLEFVNCDNLFNLLCIYGNVIKIKFLKSKEGSAMVQMSDGASIDRMMHLLHNQPL-FGKTLQFQISKQPVIMDVPAPYKLPDGTVSFKDYTNCRENRFVTPQLAEKNRVFPPSKTINYWNAPPSFGLEMIQEEFK-KYNAVEPPEFFQLTNRDKSSSGLLQWASVEEAINAIALCNHIMIESEGAKFPYQLKLSFSESPIRHG 1574
            N +L+F I +  YPI VDV++KIC PHG+V+R+ I +K  + QA+VEF +LD A R + NLNGADIY+GCCTLKI+YA   ++NV +N  D S+D+      + + +SL  +P N  M  S+  ++G      P+  P        ++          ++EP   ++P         G +      PQ        V M+YGL+ +  N D LFNL+C+YGNV +IKFLK+KEG+AMVQM D  +++R +  L+N P+  G  +Q   SKQ  + +V  P+ LPD + SFK+YT  + NRF++P  A KNR+ PPSK ++++N PP    + +   F  K         F L   ++SSSGL++++++ +A+ AI  CNH+ IE +G KFP+ +KL FS S   +G
Sbjct:   80 NHILLFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGV-QAMVEFDNLDAATRARENLNGADIYAGCCTLKIDYAKPEKLNVYKNEPDTSWDYT-----LSTGKSLFSIPENVVMLESQPPLLGPGAAFPPFGAPEYHTTTPENWKGAAIHPTGLMKEP-AGVVP---------GRNAPVAFTPQGQAQGA--VMMVYGLDHDTSNTDKLFNLVCLYGNVARIKFLKTKEGTAMVQMGDAVAVERCVQHLNNIPVGTGGKIQIAFSKQNFLSEVINPFLLPDHSPSFKEYTGSKNNRFLSPAQASKNRIQPPSKILHFFNTPPGLTEDQLIGIFNIKDVPATSVRLFPLKT-ERSSSGLIEFSNISQAVLAIMKCNHLPIEGKGTKFPFIMKLCFSSSKSMNG 466          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Fly
Match: sm (gene:FBgn0003435 transcript:FBtr0308785)

HSP 1 Score: 269.626 bits (688), Expect = 5.281e-82
Identity = 159/406 (39.16%), Postives = 238/406 (58.62%), Query Frame = 3
Query:  384 NKVLIFFIYDAVYPINVDVINKICKPHGRVVRVFINRKASIMQALVEFYSLDDAIRVKRNLNGADIYSGCCTLKIEYATTNRVNVIQNSED-SYDFEAPSMGMRSSQSLLGLPSNNEM-ASRVSMMGR-----PYDPPRREQPFNGSYGNIRDEYYDEIREPNRRMMPLNNSMDHSLGYDQEYDREPQRNYNDGPKVAMIYGLNLEFVNCDNLFNLLCIYGNVIKIKFLKSKEGSAMVQMSDGASIDRMMHLLHNQPL-FGKTLQFQISKQPVIMDVPAPYKLPDGTVSFKDYTNCRENRFVTPQLAEKNRVFPPSKTINYWNAPPSFGLEMIQEEFK-KYNAVEPPEFFQLTNRDKSSSGLLQWASVEEAINAIALCNHIMIESEGAKFPYQLKLSFSESPIRHG 1574
            N +L+F I +  YPI VDV++KIC PHG+V+R+ I +K  + QA+VEF +LD A R + NLNGADIY+GCCTLKI+YA   ++NV +N  D S+D+   +  +  S+SL  +P N  M  S+  ++G      P+  P        ++          ++EP   ++P         G +      PQ        V M+YGL+ +  N D LFNL+C+YGNV +IKFLK+KEG+AMVQM D  +++R +  L+N P+  G  +Q   SKQ  + +V  P+ LPD + SFK+YT  + NRF++P  A KNR+ PPSK ++++N PP    + +   F  K         F L   ++SSSGL++++++ +A+ AI  CNH+ I  EG KFP+ +KL FS S   +G
Sbjct:   80 NHILLFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGV-QAMVEFDNLDAATRARENLNGADIYAGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLSTGEILPSKSLFSIPENVVMLESQPPLLGPGAAFPPFGAPEYHTTTPENWKGAAIHPTGLMKEP-AGVVP---------GRNAPVAFTPQGQAQGA--VMMVYGLDHDTSNTDKLFNLVCLYGNVARIKFLKTKEGTAMVQMGDAVAVERCVQHLNNIPVGTGGKIQIAFSKQNFLSEVINPFLLPDHSPSFKEYTGSKNNRFLSPAQASKNRIQPPSKILHFFNTPPGLTEDQLIGIFNIKDVPATSVRLFPLKT-ERSSSGLIEFSNISQAVLAIMKCNHLPI--EGTKFPFIMKLCFSSSKSMNG 469          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Fly
Match: sm (gene:FBgn0003435 transcript:FBtr0310331)

HSP 1 Score: 266.159 bits (679), Expect = 1.851e-80
Identity = 163/420 (38.81%), Postives = 236/420 (56.19%), Query Frame = 3
Query:  384 NKVLIFFIYDAVYPINVDVINKICKPHGRVVRVFINRKASIMQALVEFYSLDDAIRVKRNLNGADIYSGCCTLKIEYATTNRVNVIQNSED-SYDFEAPSMGMRSSQSLLGLPS---------NNEMASRVSMMGRP--YDPPRREQPFNGSYGNIRDEYYDEIREPNRRMMPLNNSMDHSLGYDQE-YDREPQRNY--------NDGPKVAMIYGLNLEFVNCDNLFNLLCIYGNVIKIKFLKSKEGSAMVQMSDGASIDRMMHLLHNQPL-FGKTLQFQISKQPVIMDVPAPYKLPDGTVSFKDYTNCRENRFVTPQLAEKNRVFPPSKTINYWNAPPSFGLEMIQEEFK-KYNAVEPPEFFQLTNRDKSSSGLLQWASVEEAINAIALCNHIMIESEGAKFPYQLKLSFSESPIRHG 1574
            N +L+F I +  YPI VDV++KIC PHG+V+R+ I +K  + QA+VEF +LD A R + NLNGADIY+GCCTLKI+YA   ++NV +N  D S+D+   S G   S  ++ L            N    R+  M +P    P     PF         EY+    E  +       +  H  G  +E     P RN              V M+YGL+ +  N D LFNL+C+YGNV +IKFLK+KEG+AMVQM D  +++R +  L+N P+  G  +Q   SKQ  + +V  P+ LPD + SFK+YT  + NRF++P  A KNR+ PPSK ++++N PP    + +   F  K         F L   ++SSSGL++++++ +A+ AI  CNH+ IE +G KFP+ +KL FS S   +G
Sbjct:   80 NHILLFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGV-QAMVEFDNLDAATRARENLNGADIYAGCCTLKIDYAKPEKLNVYKNEPDTSWDYTL-STGEMQSTVVVALDDAAEERAEKWENSTEKRILWMLQPPLLGPGAAFPPFGAP------EYHTTTPENWK------GAAIHPTGLMKEPAGVVPGRNAPVAFTPQGQAQGAVMMVYGLDHDTSNTDKLFNLVCLYGNVARIKFLKTKEGTAMVQMGDAVAVERCVQHLNNIPVGTGGKIQIAFSKQNFLSEVINPFLLPDHSPSFKEYTGSKNNRFLSPAQASKNRIQPPSKILHFFNTPPGLTEDQLIGIFNIKDVPATSVRLFPLKT-ERSSSGLIEFSNISQAVLAIMKCNHLPIEGKGTKFPFIMKLCFSSSKSMNG 484          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Fly
Match: sm (gene:FBgn0003435 transcript:FBtr0308791)

HSP 1 Score: 266.159 bits (679), Expect = 2.306e-80
Identity = 162/430 (37.67%), Postives = 241/430 (56.05%), Query Frame = 3
Query:  384 NKVLIFFIYDAVYPINVDVINKICKPHGRVVRVFINRKASIMQALVEFYSLDDAIRVKRNLNGADIYSGCCTLKIEYATTNRVNVIQNSED-SYDF---------------------EAPSMGMRS---SQSLLGLPSNNEM-ASRVSMMGR-----PYDPPRREQPFNGSYGNIRDEYYDEIREPNRRMMPLNNSMDHSLGYDQEYDREPQRNYNDGPKVAMIYGLNLEFVNCDNLFNLLCIYGNVIKIKFLKSKEGSAMVQMSDGASIDRMMHLLHNQPL-FGKTLQFQISKQPVIMDVPAPYKLPDGTVSFKDYTNCRENRFVTPQLAEKNRVFPPSKTINYWNAPPSFGLEMIQEEFK-KYNAVEPPEFFQLTNRDKSSSGLLQWASVEEAINAIALCNHIMIESEGAKFPYQLKLSFSESPIRHG 1574
            N +L+F I +  YPI VDV++KIC PHG+V+R+ I +K  + QA+VEF +LD A R + NLNGADIY+GCCTLKI+YA   ++NV +N  D S+D+                     + P  G R    S+SL  +P N  M  S+  ++G      P+  P        ++          ++EP   ++P         G +      PQ        V M+YGL+ +  N D LFNL+C+YGNV +IKFLK+KEG+AMVQM D  +++R +  L+N P+  G  +Q   SKQ  + +V  P+ LPD + SFK+YT  + NRF++P  A KNR+ PPSK ++++N PP    + +   F  K         F L   ++SSSGL++++++ +A+ AI  CNH+ IE +G KFP+ +KL FS S   +G
Sbjct:   75 NHILLFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGV-QAMVEFDNLDAATRARENLNGADIYAGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLSTGEILPIKEIGNGRSPLLQEPLYGTRPQPYSKSLFSIPENVVMLESQPPLLGPGAAFPPFGAPEYHTTTPENWKGAAIHPTGLMKEP-AGVVP---------GRNAPVAFTPQGQAQGA--VMMVYGLDHDTSNTDKLFNLVCLYGNVARIKFLKTKEGTAMVQMGDAVAVERCVQHLNNIPVGTGGKIQIAFSKQNFLSEVINPFLLPDHSPSFKEYTGSKNNRFLSPAQASKNRIQPPSKILHFFNTPPGLTEDQLIGIFNIKDVPATSVRLFPLKT-ERSSSGLIEFSNISQAVLAIMKCNHLPIEGKGTKFPFIMKLCFSSSKSMNG 490          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Fly
Match: sm (gene:FBgn0003435 transcript:FBtr0301609)

HSP 1 Score: 265.003 bits (676), Expect = 2.758e-80
Identity = 154/400 (38.50%), Postives = 229/400 (57.25%), Query Frame = 3
Query:  384 NKVLIFFIYDAVYPINVDVINKICKPHGRVVRVFINRKASIMQALVEFYSLDDAIRVKRNLNGADIYSGCCTLKIEYATTNRVNVIQNSED-SYDFEAPSMGMRSSQSLLGLPSNNEMASRVSMMGRPYDPPRREQPFNGSYGNIRDEYYDEIREPNRRMMPLNNSMDHSLGYDQEYDREPQRNYNDGPKVAMIYGLNLEFVNCDNLFNLLCIYGNVIKIKFLKSKEGSAMVQMSDGASIDRMMHLLHNQPL-FGKTLQFQISKQPVIMDVPAPYKLPDGTVSFKDYTNCRENRFVTPQLAEKNRVFPPSKTINYWNAPPSFGLEMIQEEFK-KYNAVEPPEFFQLTNRDKSSSGLLQWASVEEAINAIALCNHIMIESEGAKFPYQLKLSFSESPIRHG 1574
            N +L+F I +  YPI VDV++KIC PHG+V+R+ I +K  + QA+VEF +LD A R + NLNGADIY+GCCTLKI+YA   ++NV +N  D S+D+   +  +     LLG                P+  P        ++          ++EP   ++P         G +      PQ        V M+YGL+ +  N D LFNL+C+YGNV +IKFLK+KEG+AMVQM D  +++R +  L+N P+  G  +Q   SKQ  + +V  P+ LPD + SFK+YT  + NRF++P  A KNR+ PPSK ++++N PP    + +   F  K         F L   ++SSSGL++++++ +A+ AI  CNH+ IE +G KFP+ +KL FS S   +G
Sbjct:   80 NHILLFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGV-QAMVEFDNLDAATRARENLNGADIYAGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLSTGEILPKPPLLG----------PGAAFPPFGAPEYHTTTPENWKGAAIHPTGLMKEP-AGVVP---------GRNAPVAFTPQGQAQGA--VMMVYGLDHDTSNTDKLFNLVCLYGNVARIKFLKTKEGTAMVQMGDAVAVERCVQHLNNIPVGTGGKIQIAFSKQNFLSEVINPFLLPDHSPSFKEYTGSKNNRFLSPAQASKNRIQPPSKILHFFNTPPGLTEDQLIGIFNIKDVPATSVRLFPLKT-ERSSSGLIEFSNISQAVLAIMKCNHLPIEGKGTKFPFIMKLCFSSSKSMNG 455          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Zebrafish
Match: hnrnpl (heterogeneous nuclear ribonucleoprotein L [Source:ZFIN;Acc:ZDB-GENE-040426-710])

HSP 1 Score: 327.405 bits (838), Expect = 3.018e-103
Identity = 198/530 (37.36%), Postives = 294/530 (55.47%), Query Frame = 3
Query:   66 KRAKPD-DWEDIE---------PSKVIHIRELAEHTLEIDVSRAMEKFGPIRDIAMIPKRRQALVEFENLVSAQEVVKRYRNDFIHIANRPAKINFSTSEHVLKRSGPLNEAVSTANKVLIFFIYDAVYPINVDVINKICKPHGRVVRVFINRKASIMQALVEFYSLDDAIRVKRNLNGADIYSGCCTLKIEYATTNRVNVIQNSEDSYDFEAPSMGMRSSQSLLGLPSN-------NEMASRVSMMGRPYDPPRREQPFNGSYGNIRDEY---YDEIREPNRRMMPLNNSMDHSLGYDQEYDREPQRNYNDGPK-----------VAMIYGLNLEFVNCDNLFNLLCIYGNVIKIKFLKSKEGSAMVQMSDGASIDRMMHLLHNQPLFGKTLQFQISKQPVIMDVPAPYKLPDGTVSFKDYTNCRENRFVTPQLAEKNRVFPPSKTINYWNAPPSFGLEMIQEEFKKYNAVEPPEFFQLTNR-DKSSSGLLQWASVEEAINAIALCNHIMIESEGAKFPYQLKLSFSES 1559
            KR K D D  D E         PS V+H+R L +   E D+  A+++FG I  + ++PK+RQALVEFE++  A   V    N+ I+IA RP+ IN+STS+ + + +   ++   + N VL+  I + +YPI  DV+  IC   G V R+ I RK  + QA+VEF S+  A R K +LNGADIYSGCCTLKIEYA   R+NV +N +D++D+  P++  + + +     ++       N+   + +++G    PP    P  G YG+  D Y           RRM P        +G  +   R     Y  GP            V M+YGL+   +N D +FN+ C+YGNV ++KF+KSK G+AMV+M D  ++DR +  L+N  LFG+ L   +SKQ  IM   + Y+L DG+ SFKD+   R NRF T + A KNR+  PS  ++++N+ P   +E   E  ++     P      T + D+SSSGLL+W SV +A+ A+AL NH  +++    +PY LKL FS +
Sbjct:   17 KRQKTDSDGMDTEGYNDPHKTLPSLVVHVRGLIDGITEADLVEALQEFGTISYVVLMPKKRQALVEFEDMNGASNAVTYANNNQIYIAGRPSYINYSTSQKISRPTD--SDDTRSVNNVLLLTIMNPIYPITSDVLYTICNNCGPVQRIVIFRKNGV-QAMVEFDSVQSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDQDTWDYTNPNLSGQDADADGNWNNSQDPNANPNKRQRQPALLGD--HPPEYGSP-QGGYGHYDDTYGPPPPPPHYEGRRMGP-------PIGRGRGVPRYGGAQYGHGPPPPDYNAHADSPVVMVYGLDPVKINADRVFNIFCLYGNVERVKFMKSKPGAAMVEMGDCYAVDRAVSHLNNTMLFGQKLNVCVSKQQAIMPGQS-YQLEDGSCSFKDFHGYRNNRFTTSEQAAKNRIQQPSNVLHFFNSQPDSSVEAFSEICEELGIKSPVSVKLFTGKVDRSSSGLLEWESVNDAMEALALMNHYQMKNPSGPYPYTLKLCFSTA 532          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Zebrafish
Match: hnrnpl (heterogeneous nuclear ribonucleoprotein L [Source:ZFIN;Acc:ZDB-GENE-040426-710])

HSP 1 Score: 327.405 bits (838), Expect = 3.018e-103
Identity = 198/530 (37.36%), Postives = 294/530 (55.47%), Query Frame = 3
Query:   66 KRAKPD-DWEDIE---------PSKVIHIRELAEHTLEIDVSRAMEKFGPIRDIAMIPKRRQALVEFENLVSAQEVVKRYRNDFIHIANRPAKINFSTSEHVLKRSGPLNEAVSTANKVLIFFIYDAVYPINVDVINKICKPHGRVVRVFINRKASIMQALVEFYSLDDAIRVKRNLNGADIYSGCCTLKIEYATTNRVNVIQNSEDSYDFEAPSMGMRSSQSLLGLPSN-------NEMASRVSMMGRPYDPPRREQPFNGSYGNIRDEY---YDEIREPNRRMMPLNNSMDHSLGYDQEYDREPQRNYNDGPK-----------VAMIYGLNLEFVNCDNLFNLLCIYGNVIKIKFLKSKEGSAMVQMSDGASIDRMMHLLHNQPLFGKTLQFQISKQPVIMDVPAPYKLPDGTVSFKDYTNCRENRFVTPQLAEKNRVFPPSKTINYWNAPPSFGLEMIQEEFKKYNAVEPPEFFQLTNR-DKSSSGLLQWASVEEAINAIALCNHIMIESEGAKFPYQLKLSFSES 1559
            KR K D D  D E         PS V+H+R L +   E D+  A+++FG I  + ++PK+RQALVEFE++  A   V    N+ I+IA RP+ IN+STS+ + + +   ++   + N VL+  I + +YPI  DV+  IC   G V R+ I RK  + QA+VEF S+  A R K +LNGADIYSGCCTLKIEYA   R+NV +N +D++D+  P++  + + +     ++       N+   + +++G    PP    P  G YG+  D Y           RRM P        +G  +   R     Y  GP            V M+YGL+   +N D +FN+ C+YGNV ++KF+KSK G+AMV+M D  ++DR +  L+N  LFG+ L   +SKQ  IM   + Y+L DG+ SFKD+   R NRF T + A KNR+  PS  ++++N+ P   +E   E  ++     P      T + D+SSSGLL+W SV +A+ A+AL NH  +++    +PY LKL FS +
Sbjct:   17 KRQKTDSDGMDTEGYNDPHKTLPSLVVHVRGLIDGITEADLVEALQEFGTISYVVLMPKKRQALVEFEDMNGASNAVTYANNNQIYIAGRPSYINYSTSQKISRPTD--SDDTRSVNNVLLLTIMNPIYPITSDVLYTICNNCGPVQRIVIFRKNGV-QAMVEFDSVQSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDQDTWDYTNPNLSGQDADADGNWNNSQDPNANPNKRQRQPALLGD--HPPEYGSP-QGGYGHYDDTYGPPPPPPHYEGRRMGP-------PIGRGRGVPRYGGAQYGHGPPPPDYNAHADSPVVMVYGLDPVKINADRVFNIFCLYGNVERVKFMKSKPGAAMVEMGDCYAVDRAVSHLNNTMLFGQKLNVCVSKQQAIMPGQS-YQLEDGSCSFKDFHGYRNNRFTTSEQAAKNRIQQPSNVLHFFNSQPDSSVEAFSEICEELGIKSPVSVKLFTGKVDRSSSGLLEWESVNDAMEALALMNHYQMKNPSGPYPYTLKLCFSTA 532          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Zebrafish
Match: hnrnpl2 (heterogeneous nuclear ribonucleoprotein L2 [Source:ZFIN;Acc:ZDB-GENE-040426-2707])

HSP 1 Score: 322.013 bits (824), Expect = 2.087e-101
Identity = 196/500 (39.20%), Postives = 286/500 (57.20%), Query Frame = 3
Query:  102 PSKVIHIRELAEHTLEIDVSRAMEKFGPIRDIAMIPKRRQALVEFENLVSAQEVVKRYRNDFIHIANRPAKINFSTSEHVLKRSGPLNEAVSTANKVLIFFIYDAVYPINVDVINKICKPHGRVVRVFINRKASIMQALVEFYSLDDAIRVKRNLNGADIYSGCCTLKIEYATTNRVNVIQNSEDSYDFEAPSMGMRSSQSLLGLPSNNEMASRVSMMGRPYDPPRREQPFNGSYGNIRDEYYDEIREPNRRMMPLNNSMDHSLGYDQEYDREPQRN----------YNDGPKVAMIYGLNLEFVNCDNLFNLLCIYGNVIKIKFLKSKEGSAMVQMSDGASIDRMMHLLHNQPLFGKTLQFQISKQPVIMDVPAPYKLPDGTVSFKDYTNCRENRFVTPQLAEKNRVFPPSKTINYWNAPPSFGLEMIQEEFKKYNAVEPPE---FFQLTNR-DKSSSGLLQWASVEEAINAIALCNHIMIESEGAKFPYQLKLSFSES 1559
            PS V+H+R L +  LE D+  A+++FG I  + ++PK+RQALVE+E++  +   V    ++ I+IA  PA +N+STS+ + +   P  +   + N VL+  I + +YPI  DV+  IC   G V R+ I RK  + QA+VEF S+  A R K +LNGADIYSGCCTLKIEYA   R+NV +N +D++D+  PS+G   +Q +   P  N+   + +++G   D P    P  G Y    DE Y       RRM P   S     G  Q Y  +              + D P V M+YGL+   +N D +FN+ C+YGNV ++KF+KSK G+AMV+M D  ++DR +  L+N  LF + L   +SKQ  IM   + Y+L DGT SFKDY   R NRF TP+ A KNR+  PS  ++++NA P    EM     +++    P     F    N  D+SSSGLL+W SV +A+ A+A+ NH  +++    +P+ LKL FS +
Sbjct:   40 PSLVVHVRGLVDGVLESDIVEALQEFGTISYVVLMPKKRQALVEYEDMNGSCNAVTYANDNQIYIAGHPAFVNYSTSQKISRPGDP--DDARSVNNVLLLTIMNPIYPITSDVLYTICNNCGPVQRIVIFRKNGV-QAMVEFDSVQSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDQDTWDYTNPSLG---TQDMNANP--NKRQRQPALLG---DHP----PEYGGYPGYPDESYG---YEGRRMGPP-MSAPRRGGASQRYSAQYGGPPPPPPGEYGAHADSP-VIMVYGLDPVKINADRVFNIFCLYGNVERVKFMKSKPGAAMVEMGDCYAVDRAISHLNNNFLFNQKLNLCVSKQQAIMPGQS-YELDDGTNSFKDYHGSRNNRFATPEQAAKNRIQHPSNVLHFFNAVPEATPEMFTRLCEEHGVKNPSNIKIFVAKGNSPDRSSSGLLEWESVNDAMEALAMINHNQMKNPNGPYPFTLKLCFSTA 518          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Zebrafish
Match: hnrnpl (heterogeneous nuclear ribonucleoprotein L [Source:ZFIN;Acc:ZDB-GENE-040426-710])

HSP 1 Score: 319.316 bits (817), Expect = 3.152e-100
Identity = 196/532 (36.84%), Postives = 292/532 (54.89%), Query Frame = 3
Query:   66 KRAKPD-DWEDIE---------PSKVIHIRELAEHTLEIDVSRAMEKFGPIRDIAMIPKRRQALVEFENLVSAQEVVKRYRNDFIHIANRPAKINFSTSEHVLKRSGPLNEAVSTANKVLIFFIYDAVYPINVDVINKICKPHGRVVRVFINRKASIMQALVEF--YSLDDAIRVKRNLNGADIYSGCCTLKIEYATTNRVNVIQNSEDSYDFEAPSMGMRSSQSLLGLPSN-------NEMASRVSMMGRPYDPPRREQPFNGSYGNIRDEY---YDEIREPNRRMMPLNNSMDHSLGYDQEYDREPQRNYNDGPK-----------VAMIYGLNLEFVNCDNLFNLLCIYGNVIKIKFLKSKEGSAMVQMSDGASIDRMMHLLHNQPLFGKTLQFQISKQPVIMDVPAPYKLPDGTVSFKDYTNCRENRFVTPQLAEKNRVFPPSKTINYWNAPPSFGLEMIQEEFKKYNAVEPPEFFQLTNR-DKSSSGLLQWASVEEAINAIALCNHIMIESEGAKFPYQLKLSFSES 1559
            KR K D D  D E         PS V+H+R L +   E D+  A+++FG I  + ++PK+RQALVEFE++  A   V    N+ I+IA RP+ IN+STS+ + + +   ++   + N VL+  I + +YPI  DV+  IC   G V R+ I RK  + QA+VE+       A R K +LNGADIYSGCCTLKIEYA   R+NV +N +D++D+  P++  + + +     ++       N+   + +++G    PP    P  G YG+  D Y           RRM P        +G  +   R     Y  GP            V M+YGL+   +N D +FN+ C+YGNV ++KF+KSK G+AMV+M D  ++DR +  L+N  LFG+ L   +SKQ  IM   + Y+L DG+ SFKD+   R NRF T + A KNR+  PS  ++++N+ P   +E   E  ++     P      T + D+SSSGLL+W SV +A+ A+AL NH  +++    +PY LKL FS +
Sbjct:   17 KRQKTDSDGMDTEGYNDPHKTLPSLVVHVRGLIDGITEADLVEALQEFGTISYVVLMPKKRQALVEFEDMNGASNAVTYANNNQIYIAGRPSYINYSTSQKISRPTD--SDDTRSVNNVLLLTIMNPIYPITSDVLYTICNNCGPVQRIVIFRKNGV-QAMVEYPLSKFQSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDQDTWDYTNPNLSGQDADADGNWNNSQDPNANPNKRQRQPALLGD--HPPEYGSP-QGGYGHYDDTYGPPPPPPHYEGRRMGP-------PIGRGRGVPRYGGAQYGHGPPPPDYNAHADSPVVMVYGLDPVKINADRVFNIFCLYGNVERVKFMKSKPGAAMVEMGDCYAVDRAVSHLNNTMLFGQKLNVCVSKQQAIMPGQS-YQLEDGSCSFKDFHGYRNNRFTTSEQAAKNRIQQPSNVLHFFNSQPDSSVEAFSEICEELGIKSPVSVKLFTGKVDRSSSGLLEWESVNDAMEALALMNHYQMKNPSGPYPYTLKLCFSTA 534          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Zebrafish
Match: hnrnpl2 (heterogeneous nuclear ribonucleoprotein L2 [Source:ZFIN;Acc:ZDB-GENE-040426-2707])

HSP 1 Score: 318.161 bits (814), Expect = 3.633e-100
Identity = 189/490 (38.57%), Postives = 274/490 (55.92%), Query Frame = 3
Query:  102 PSKVIHIRELAEHTLEIDVSRAMEKFGPIRDIAMIPKRRQALVEFENLVSAQEVVKRYRNDFIHIANRPAKINFSTSEHVLKRSGPLNEAVSTANKVLIFFIYDAVYPINVDVINKICKPHGRVVRVFINRKASIMQALVEFYSLDDAIRVKRNLNGADIYSGCCTLKIEYATTNRVNVIQNSEDSYDFEAPSMGMRSSQSLLGLPSNNEMASRVSMMGRPYDPPRREQPFNGSYGNIRDEYYDEIREPNRRMMPLNNSMDHSLGYDQEYDREPQRNYNDGPKVAMIYGLNLEFVNCDNLFNLLCIYGNVIKIKFLKSKEGSAMVQMSDGASIDRMMHLLHNQPLFGKTLQFQISKQPVIMDVPAPYKLPDGTVSFKDYTNCRENRFVTPQLAEKNRVFPPSKTINYWNAPPSFGLEMIQEEFKKYNAVEPPE---FFQLTNR-DKSSSGLLQWASVEEAINAIALCNHIMIESEGAKFPYQLKLSFSES 1559
            PS V+H+R L +  LE D+  A+++FG I  + ++PK+RQALVE+E++  +   V    ++ I+IA  PA +N+STS+ + +   P  +   + N VL+  I + +YPI  DV+  IC   G V R+ I RK  + QA+VEF S+  A R K +LNGADIYSGCCTLKIEYA   R+NV +N +D++D+  PS+G +      G P +         MG P   PRR        G     Y  +   P                   EY       + D P V M+YGL+   +N D +FN+ C+YGNV ++KF+KSK G+AMV+M D  ++DR +  L+N  LF + L   +SKQ  IM   + Y+L DGT SFKDY   R NRF TP+ A KNR+  PS  ++++NA P    EM     +++    P     F    N  D+SSSGLL+W SV +A+ A+A+ NH  +++    +P+ LKL FS +
Sbjct:   40 PSLVVHVRGLVDGVLESDIVEALQEFGTISYVVLMPKKRQALVEYEDMNGSCNAVTYANDNQIYIAGHPAFVNYSTSQKISRPGDP--DDARSVNNVLLLTIMNPIYPITSDVLYTICNNCGPVQRIVIFRKNGV-QAMVEFDSVQSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDQDTWDYTNPSLGTQGGYP--GYP-DESYGYEGRRMGPPMSAPRR--------GGASQRYSAQYGGPPPPPP-------------GEYGA-----HADSP-VIMVYGLDPVKINADRVFNIFCLYGNVERVKFMKSKPGAAMVEMGDCYAVDRAISHLNNNFLFNQKLNLCVSKQQAIMPGQS-YELDDGTNSFKDYHGSRNNRFATPEQAAKNRIQHPSNVLHFFNAVPEATPEMFTRLCEEHGVKNPSNIKIFVAKGNSPDRSSSGLLEWESVNDAMEALAMINHNQMKNPNGPYPFTLKLCFSTA 495          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Xenopus
Match: admp (anti-dorsalizing morphogenic protein [Source:Xenbase;Acc:XB-GENE-485379])

HSP 1 Score: 317.39 bits (812), Expect = 1.691e-99
Identity = 186/509 (36.54%), Postives = 284/509 (55.80%), Query Frame = 3
Query:   81 DDWEDIEPSKVIHIRELAEHTLEIDVSRAMEKFGPIRDIAMIPKRRQALVEFENLVSAQEVVKRYRNDFIHIANRPAKINFSTSEHVLKRSGPLNEAVSTANKVLIFFIYDAVYPINVDVINKICKPHGRVVRVFINRKASIMQALVE-----FYSLDDAIRVKRNLNGADIYSGCCTLKIEYATTNRVNVIQNSEDSYDFEAPSMGMRSSQSLLGLPSNNEMASRVSMMGRPYDPPRREQPFNGSYGNIRDEYYDEI--REPNRRMMP--LNNSMDHSLGYDQEYDREPQRNYND-GPK----VAMIYGLNLEFVNCDNLFNLLCIYGNVIKIKFLKSKEGSAMVQMSDGASIDRMMHLLHNQPLFGKTLQFQISKQPVIMDVPA-PYKLPDGTVSFKDYTNCRENRFVTPQLAEKNRVFPPSKTINYWNAPPSFGLEMIQEEFKKYNAVEPPEFFQLTNR-DKSSSGLLQWASVEEAINAIALCNHIMIESEGAKFPYQLKLSFSES 1559
            DD      S V+H+R L +  +E D++ A+++FG I  + ++PK+RQALVEFE+++ A   V    ++ I++A  PA +N+STS+ +  R     +     N VL+F I + +Y I  DV+  IC P G V R+ I RK  +   +V      F S+  A R K +LNGADIYSGCCTLKIEYA  +R+NV +N +D++D+  P++  + +       + N+      ++G    P     P  G +G+  +E Y        +RRM P  +         Y  +Y   P     + GP     V M+YGL+   +NCD +FN+ C+YGNV K+KF+KSK G+AMV+M+DG ++DR +  L+N  +FG+ L   +SKQ  I  VP   Y L DG+ SFK ++  R NRF +P+ A KNR+  PS  ++++NAPP    E   E   +    +P      + + ++SSSGLL+W S  EA+  + L NH  +++    +PY LKL FS +
Sbjct:   15 DDPHKTAASPVVHVRGLIDGVVEADLAEALQEFGTISYVVVMPKKRQALVEFEDILGACNAVNYAADNQIYVAGHPAFVNYSTSQKI-SRPTDTGDDSRGVNNVLLFTILNPIYSITTDVLYTICNPCGPVQRIVIFRKNGVQVGIVSLTFLTFDSMQSAQRAKASLNGADIYSGCCTLKIEYAKPSRLNVFKNDQDTWDYTNPALSGQGNSLGDAAGNPNKRQRNPPLLGD--HPAEYGGPHAGYHGHYHEEAYGPPPPHYESRRMGPPPVGAPRRGPSRYAPQYGHPPPPPPPEYGPHADSPVLMVYGLDPSKMNCDRVFNVFCLYGNVEKVKFMKSKPGAAMVEMADGYAVDRAITHLNNNFMFGQKLSVCVSKQQSI--VPGQSYGLEDGSCSFKVFSGSRNNRFTSPEQAAKNRIQQPSSVLHFFNAPPEVTEENFIEMCDELGVKKPASIKIFSGKSERSSSGLLEWDSKSEALETLGLMNHYQMKNPNGPYPYTLKLCFSTA 518          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Xenopus
Match: admp (anti-dorsalizing morphogenic protein [Source:Xenbase;Acc:XB-GENE-485379])

HSP 1 Score: 315.849 bits (808), Expect = 3.953e-99
Identity = 188/509 (36.94%), Postives = 283/509 (55.60%), Query Frame = 3
Query:   81 DDWEDIEPSKVIHIRELAEHTLEIDVSRAMEKFGPIRDIAMIPKRRQALVEFENLVSAQEVVKRYRNDFIHIANRPAKINFSTSEHVLKRSGPLNEAVSTANKVLIFFIYDAVYPINVDVINKICKPHGRVVRVFINRKASIMQALVE-----FYSLDDAIRVKRNLNGADIYSGCCTLKIEYATTNRVNVIQNSEDSYDFEAPSMGMRSSQSLLGLPSNNEMASRVSMMGRPYDPPRREQPFNGSYGNIRDEYYDEI--REPNRRMMP--LNNSMDHSLGYDQEYDREPQRNYND-GPK----VAMIYGLNLEFVNCDNLFNLLCIYGNVIKIKFLKSKEGSAMVQMSDGASIDRMMHLLHNQPLFGKTLQFQISKQPVIMDVPA-PYKLPDGTVSFKDYTNCRENRFVTPQLAEKNRVFPPSKTINYWNAPPSFGLEMIQEEFKKYNAVEPPEFFQLTNR-DKSSSGLLQWASVEEAINAIALCNHIMIESEGAKFPYQLKLSFSES 1559
            DD      S V+H+R L +  +E D++ A+++FG I  + ++PK+RQALVEFE+++ A   V    ++ I++A  PA +N+STS+ +  R     +     N VL+F I + +Y I  DV+  IC P G V R+ I RK  +   +V      F S+  A R K +LNGADIYSGCCTLKIEYA  +R+NV +N +D++D+  P+        L G  + N+      ++G    P     P  G +G+  +E Y        +RRM P  +         Y  +Y   P     + GP     V M+YGL+   +NCD +FN+ C+YGNV K+KF+KSK G+AMV+M+DG ++DR +  L+N  +FG+ L   +SKQ  I  VP   Y L DG+ SFK ++  R NRF +P+ A KNR+  PS  ++++NAPP    E   E   +    +P      + + ++SSSGLL+W S  EA+  + L NH  +++    +PY LKL FS +
Sbjct:    9 DDPHKTAASPVVHVRGLIDGVVEADLAEALQEFGTISYVVVMPKKRQALVEFEDILGACNAVNYAADNQIYVAGHPAFVNYSTSQKI-SRPTDTGDDSRGVNNVLLFTILNPIYSITTDVLYTICNPCGPVQRIVIFRKNGVQVGIVSLTFLTFDSMQSAQRAKASLNGADIYSGCCTLKIEYAKPSRLNVFKNDQDTWDYTNPA--------LSGQGNPNKRQRNPPLLGD--HPAEYGGPHAGYHGHYHEEAYGPPPPHYESRRMGPPPVGAPRRGPSRYAPQYGHPPPPPPPEYGPHADSPVLMVYGLDPSKMNCDRVFNVFCLYGNVEKVKFMKSKPGAAMVEMADGYAVDRAITHLNNNFMFGQKLSVCVSKQQSI--VPGQSYGLEDGSCSFKVFSGSRNNRFTSPEQAAKNRIQQPSSVLHFFNAPPEVTEENFIEMCDELGVKKPASIKIFSGKSERSSSGLLEWDSKSEALETLGLMNHYQMKNPNGPYPYTLKLCFSTA 504          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Xenopus
Match: admp (anti-dorsalizing morphogenic protein [Source:Xenbase;Acc:XB-GENE-485379])

HSP 1 Score: 311.997 bits (798), Expect = 6.031e-97
Identity = 188/535 (35.14%), Postives = 290/535 (54.21%), Query Frame = 3
Query:   51 DNFNRKRAKPDDWEDIEPSKVIHIRELAEHTLEIDVSRAMEKFGPIRDIAMIPKRRQALVEFENLVSAQEVVKRYRNDFIHIANRPAKINFSTSEHVLKRSGPLNEAVSTANKVLIFFIYDAVYPINVDVINKICKPHGRVVRVFINRKASIMQALVE-----FYSLDDAIRVKRNLNGADIYSGCCTLKIEYATTNRVNVIQNSEDSYDFEAPSMGMRSSQSLLGLPSNNE-----MASRVSMMGRPYDPPRREQPF-------NGSYGNIRDEYYDEIREP------NRRMMP--LNNSMDHSLGYDQEYDREPQRNYND-GPK----VAMIYGLNLEFVNCDNLFNLLCIYGNVIKIKFLKSKEGSAMVQMSDGASIDRMMHLLHNQPLFGKTLQFQISKQPVIMDVPA-PYKLPDGTVSFKDYTNCRENRFVTPQLAEKNRVFPPSKTINYWNAPPSFGLEMIQEEFKKYNAVEPPEFFQLTNR-DKSSSGLLQWASVEEAINAIALCNHIMIESEGAKFPYQLKLSFSES 1559
            DN        DD      S V+H+R L +  +E D++ A+++FG I  + ++PK+RQALVEFE+++ A   V    ++ I++A  PA +N+STS+ +  R     +     N VL+F I + +Y I  DV+  IC P G V R+ I RK  +   +V      F S+  A R K +LNGADIYSGCCTLKIEYA  +R+NV +N +D++D+  P++  +   +  G P+  +     +    +  G+ Y+     + +        G +      Y++E   P      +RRM P  +         Y  +Y   P     + GP     V M+YGL+   +NCD +FN+ C+YGNV K+KF+KSK G+AMV+M+DG ++DR +  L+N  +FG+ L   +SKQ  I  VP   Y L DG+ SFK ++  R NRF +P+ A KNR+  PS  ++++NAPP    E   E   +    +P      + + ++SSSGLL+W S  EA+  + L NH  +++    +PY LKL FS +
Sbjct:   32 DNVAASAEGYDDPHKTAASPVVHVRGLIDGVVEADLAEALQEFGTISYVVVMPKKRQALVEFEDILGACNAVNYAADNQIYVAGHPAFVNYSTSQKI-SRPTDTGDDSRGVNNVLLFTILNPIYSITTDVLYTICNPCGPVQRIVIFRKNGVQVGIVSLTFLTFDSMQSAQRAKASLNGADIYSGCCTLKIEYAKPSRLNVFKNDQDTWDYTNPALSGQGDAA--GNPNKRQRNPPLLGDHPAEYGKIYNLCCSNRLYFFLLFFVGGPHAGYHGHYHEEAYGPPPPHYESRRMGPPPVGAPRRGPSRYAPQYGHPPPPPPPEYGPHADSPVLMVYGLDPSKMNCDRVFNVFCLYGNVEKVKFMKSKPGAAMVEMADGYAVDRAITHLNNNFMFGQKLSVCVSKQQSI--VPGQSYGLEDGSCSFKVFSGSRNNRFTSPEQAAKNRIQQPSSVLHFFNAPPEVTEENFIEMCDELGVKKPASIKIFSGKSERSSSGLLEWDSKSEALETLGLMNHYQMKNPNGPYPYTLKLCFSTA 561          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Xenopus
Match: admp (anti-dorsalizing morphogenic protein [Source:Xenbase;Acc:XB-GENE-485379])

HSP 1 Score: 309.686 bits (792), Expect = 1.335e-96
Identity = 184/517 (35.59%), Postives = 277/517 (53.58%), Query Frame = 3
Query:   51 DNFNRKRAKPDDWEDIEPSKVIHIRELAEHTLEIDVSRAMEKFGPIRDIAMIPKRRQALVEFENLVSAQEVVKRYRNDFIHIANRPAKINFSTSEHVLKRSGPLNEAVSTANKVLIFFIYDAVYPINVDVINKICKPHGRVVRVFINRKASIMQALVE-----FYSLDDAIRVKRNLNGADIYSGCCTLKIEYATTNRVNVIQNSEDSYDFEAPSMGMRS-----SQSLLGLPSNNEMASRVSM--MGRPYDPPRREQPFNGSYGNIRDEYYDEIREPNRRMMPLNNSMDHSLGYDQEYDREPQRNYNDGPKVAMIYGLNLEFVNCDNLFNLLCIYGNVIKIKFLKSKEGSAMVQMSDGASIDRMMHLLHNQPLFGKTLQFQISKQPVIMDVPA-PYKLPDGTVSFKDYTNCRENRFVTPQLAEKNRVFPPSKTINYWNAPPSFGLEMIQEEFKKYNAVEPPEFFQLTNR-DKSSSGLLQWASVEEAINAIALCNHIMIESEGAKFPYQLKLSFSES 1559
            DN        DD      S V+H+R L +  +E D++ A+++FG I  + ++PK+RQALVEFE+++ A   V    ++ I++A  PA +N+STS+ +  R     +     N VL+F I + +Y I  DV+  IC P G V R+ I RK  +   +V      F S+  A R K +LNGADIYSGCCTLKIEYA  +R+NV +N +D++D+  P++  +       +   G P  +  + R+    +G P   P R  P    YG+       E                                + D P V M+YGL+   +NCD +FN+ C+YGNV K+KF+KSK G+AMV+M+DG ++DR +  L+N  +FG+ L   +SKQ  I  VP   Y L DG+ SFK ++  R NRF +P+ A KNR+  PS  ++++NAPP    E   E   +    +P      + + ++SSSGLL+W S  EA+  + L NH  +++    +PY LKL FS +
Sbjct:   32 DNVAASAEGYDDPHKTAASPVVHVRGLIDGVVEADLAEALQEFGTISYVVVMPKKRQALVEFEDILGACNAVNYAADNQIYVAGHPAFVNYSTSQKI-SRPTDTGDDSRGVNNVLLFTILNPIYSITTDVLYTICNPCGPVQRIVIFRKNGVQVGIVSLTFLTFDSMQSAQRAKASLNGADIYSGCCTLKIEYAKPSRLNVFKNDQDTWDYTNPALSGQGYHGHYHEEAYGPPPPHYESRRMGPPPVGAPRRGPSRYAP---QYGHPPPPPPPEYGP-----------------------------HADSP-VLMVYGLDPSKMNCDRVFNVFCLYGNVEKVKFMKSKPGAAMVEMADGYAVDRAITHLNNNFMFGQKLSVCVSKQQSI--VPGQSYGLEDGSCSFKVFSGSRNNRFTSPEQAAKNRIQQPSSVLHFFNAPPEVTEENFIEMCDELGVKKPASIKIFSGKSERSSSGLLEWDSKSEALETLGLMNHYQMKNPNGPYPYTLKLCFSTA 512          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Xenopus
Match: atp2a1 (ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 [Source:Xenbase;Acc:XB-GENE-975115])

HSP 1 Score: 296.59 bits (758), Expect = 1.658e-91
Identity = 185/499 (37.07%), Postives = 280/499 (56.11%), Query Frame = 3
Query:   96 IEPSKVIHIRELAEHTLEIDVSRAMEKFGPIRDIAMIPKRRQALVEFENLVSAQEVVKRYRNDFIHIANRPAKINFSTSEHVLKRSGPLNEAVSTANKVLIFFIYDAVYPINVDVINKICKPHGRVVRVFINRKASIMQALVEFYSLDDAIRVKRNLNGADIYSGCCTLKIEYATTNRVNVIQNSEDSYDFEAPSMGMRSSQSLLGLPSNNEMASRVSMMGRPYDPPRREQPFNGSYGNIRDEYYDEIREPNRRMMPLNN-----SMDHSLGYDQEYDREPQRNYNDGP---KVAMIYGLNLEFVNCDNLFNLLCIYGNVIKIKFLKSKEGSAMVQMSDGASIDRMMHLLHNQPLFGKTLQFQISKQPVIMDVPAP-YKLPDGTVSFKDYTNCRENRFVTPQLAEKNRVFPPSKTINYWNAPPSFGLEMIQEEFKKYNAVEPPEF--FQLTNRDKSSSGLLQWASVEEAINAIALCNHIMIESEGAKFPYQLKLSFSES 1559
            +  S V+H+R L E  +E D+  A+ KFGPI  + M+P +RQALVEFE++  +++ V    ++ ++IA + A  N+STS+ + + +   NE  S  NKVL+  I + +YPI VDV+  +C P G+V R+ I ++  I QA+VEF S+  A + K +LNGADIY+GCCTLKIEYA   R+NVI+N  DS+D+  P +  R            +   R +++G   D P   + ++G YGN            +  ++PL N     S D          +      + GP    VAM+ GL+ + +NC  +FNL C+YGN+ K+KF+K+  G+A+V+M D  +++R +  L+N  LFGK L   +SKQ  +  VP+  ++L DGT S+KD+   + NRF +   A KN + PPS  ++Y+N P S   EM Q+  + +      +F  F      K+ SGLL+W S  EA+ A+ + NH  I       PY LKL FS S
Sbjct:   61 VSVSPVVHVRGLCESVVEADLVEALTKFGPICYVMMMPFKRQALVEFEDIEFSKKCVAFAASEPVYIAGQQAFFNYSTSKRITRPAN--NEDPSGGNKVLLLSIQNPLYPITVDVLYSVCNPVGKVERIVIFKRNGI-QAMVEFDSVHSAQKAKSSLNGADIYAGCCTLKIEYARPTRLNVIRNDNDSWDYSKPYLSRR---------DRGKGRQRQAILG---DHPSSYR-YDG-YGN------------HGPLLPLPNLYRMGSRDTPELVAYPLPQASSSYMHGGPPVGSVAMVSGLHQQKMNCSRVFNLFCLYGNIEKVKFMKTIPGTALVEMGDEYAVERAVTHLNNVKLFGKRLNVCVSKQHSV--VPSQIFELEDGTSSYKDFAMSKNNRFTSAGQASKNIIQPPSCVLHYYNVPLSVEEEMFQKLCEDHEVSTFIKFKVFDAKPSSKTLSGLLEWESKTEAVEALTVLNHYQIRVPNGSNPYTLKLCFSTS 528          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Mouse
Match: Hnrnpl (heterogeneous nuclear ribonucleoprotein L [Source:MGI Symbol;Acc:MGI:104816])

HSP 1 Score: 332.798 bits (852), Expect = 9.099e-105
Identity = 201/516 (38.95%), Postives = 297/516 (57.56%), Query Frame = 3
Query:   81 DDWEDIEPSKVIHIRELAEHTLEIDVSRAMEKFGPIRDIAMIPKRRQALVEFENLVSAQEVVKRYRNDFIHIANRPAKINFSTSEHVLKRSGPLNEAVSTANKVLIFFIYDAVYPINVDVINKICKPHGRVVRVFINRKASIMQALVEFYSLDDAIRVKRNLNGADIYSGCCTLKIEYATTNRVNVIQNSEDSYDFEAPSMGMRSSQSLLGLPSN-NEMASRVSMMGRPYDPPRREQPFNGSYGNIRDEYYDEIREP------NRRMMP-----------LNNSMDHSLGYDQEYDREPQRNYNDGPKVAMIYGLNLEFVNCDNLFNLLCIYGNVIKIKFLKSKEGSAMVQMSDGASIDRMMHLLHNQPLFGKTLQFQISKQPVIMDVPAPYKLPDGTVSFKDYTNCRENRFVTPQLAEKNRVFPPSKTINYWNAPPSFGLEMIQEEFKKYN---AVEPPEFFQL--TNRDKSSSGLLQWASVEEAINAIALCNHIMIESEGAKFPYQLKLSFSES 1559
            DD      S V+HIR L +  +E D+  A+++FGPI  + ++PK+RQALVEFE+++ A   V    ++ I+IA  PA +N+STS+ +  R G  +++ S  N VL+F I + +Y I  DV+  IC P G V R+ I RK  + QA+VEF S+  A R K +LNGADIYSGCCTLKIEYA   R+NV +N +D++D+  P++   S Q   G  SN N+   +  ++G   D P     + G +G     Y+DE   P       RRM P                 H        D  P   + D P V M+YGL+   +NCD +FN+ C+YGNV K+KF+KSK G+AMV+M+DG ++DR +  L+N  +FG+ +   +SKQP IM   + Y L DG+ S+KD++  R NRF TP+ A KNR+  PS  ++++NAP    LE+ +E F +      V+ P   ++     ++SSSGLL+W S  +A+  +   NH  +++    +PY LKL FS +
Sbjct:   90 DDPHKTPASPVVHIRGLIDGVVEADLVEALQEFGPISYVVVMPKKRQALVEFEDVLGACNAVNYAADNQIYIAGHPAFVNYSTSQKI-SRPGDSDDSRSV-NSVLLFTILNPIYSITTDVLYTICNPCGPVQRIVIFRKNGV-QAMVEFDSVQSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDQDTWDYTNPNL---SGQGDPG--SNPNKRQRQPPLLG---DHPAE---YGGPHGGYHSHYHDEGYGPPPPHYEGRRMGPPVGGHRRGPSRYGPQYGHPPPPPPPPDYGP---HADSP-VLMVYGLDQSKMNCDRVFNVFCLYGNVEKVKFMKSKPGAAMVEMADGYAVDRAITHLNNNFMFGQKMNVCVSKQPAIMPGQS-YGLEDGSCSYKDFSESRNNRFSTPEQAAKNRIQHPSNVLHFFNAP----LEVTEENFFEICDELGVKRPTSVKVFSGKSERSSSGLLEWDSKSDALETLGFLNHYQMKNPNGPYPYTLKLCFSTA 582          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Mouse
Match: Hnrnpl (heterogeneous nuclear ribonucleoprotein L [Source:MGI Symbol;Acc:MGI:104816])

HSP 1 Score: 332.798 bits (852), Expect = 9.099e-105
Identity = 201/516 (38.95%), Postives = 297/516 (57.56%), Query Frame = 3
Query:   81 DDWEDIEPSKVIHIRELAEHTLEIDVSRAMEKFGPIRDIAMIPKRRQALVEFENLVSAQEVVKRYRNDFIHIANRPAKINFSTSEHVLKRSGPLNEAVSTANKVLIFFIYDAVYPINVDVINKICKPHGRVVRVFINRKASIMQALVEFYSLDDAIRVKRNLNGADIYSGCCTLKIEYATTNRVNVIQNSEDSYDFEAPSMGMRSSQSLLGLPSN-NEMASRVSMMGRPYDPPRREQPFNGSYGNIRDEYYDEIREP------NRRMMP-----------LNNSMDHSLGYDQEYDREPQRNYNDGPKVAMIYGLNLEFVNCDNLFNLLCIYGNVIKIKFLKSKEGSAMVQMSDGASIDRMMHLLHNQPLFGKTLQFQISKQPVIMDVPAPYKLPDGTVSFKDYTNCRENRFVTPQLAEKNRVFPPSKTINYWNAPPSFGLEMIQEEFKKYN---AVEPPEFFQL--TNRDKSSSGLLQWASVEEAINAIALCNHIMIESEGAKFPYQLKLSFSES 1559
            DD      S V+HIR L +  +E D+  A+++FGPI  + ++PK+RQALVEFE+++ A   V    ++ I+IA  PA +N+STS+ +  R G  +++ S  N VL+F I + +Y I  DV+  IC P G V R+ I RK  + QA+VEF S+  A R K +LNGADIYSGCCTLKIEYA   R+NV +N +D++D+  P++   S Q   G  SN N+   +  ++G   D P     + G +G     Y+DE   P       RRM P                 H        D  P   + D P V M+YGL+   +NCD +FN+ C+YGNV K+KF+KSK G+AMV+M+DG ++DR +  L+N  +FG+ +   +SKQP IM   + Y L DG+ S+KD++  R NRF TP+ A KNR+  PS  ++++NAP    LE+ +E F +      V+ P   ++     ++SSSGLL+W S  +A+  +   NH  +++    +PY LKL FS +
Sbjct:   90 DDPHKTPASPVVHIRGLIDGVVEADLVEALQEFGPISYVVVMPKKRQALVEFEDVLGACNAVNYAADNQIYIAGHPAFVNYSTSQKI-SRPGDSDDSRSV-NSVLLFTILNPIYSITTDVLYTICNPCGPVQRIVIFRKNGV-QAMVEFDSVQSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDQDTWDYTNPNL---SGQGDPG--SNPNKRQRQPPLLG---DHPAE---YGGPHGGYHSHYHDEGYGPPPPHYEGRRMGPPVGGHRRGPSRYGPQYGHPPPPPPPPDYGP---HADSP-VLMVYGLDQSKMNCDRVFNVFCLYGNVEKVKFMKSKPGAAMVEMADGYAVDRAITHLNNNFMFGQKMNVCVSKQPAIMPGQS-YGLEDGSCSYKDFSESRNNRFSTPEQAAKNRIQHPSNVLHFFNAP----LEVTEENFFEICDELGVKRPTSVKVFSGKSERSSSGLLEWDSKSDALETLGFLNHYQMKNPNGPYPYTLKLCFSTA 582          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Mouse
Match: Hnrnpl (heterogeneous nuclear ribonucleoprotein L [Source:MGI Symbol;Acc:MGI:104816])

HSP 1 Score: 329.717 bits (844), Expect = 3.464e-103
Identity = 205/545 (37.61%), Postives = 299/545 (54.86%), Query Frame = 3
Query:   81 DDWEDIEPSKVIHIRELAEHTLEIDVSRAMEKFGPIRDIAMIPKRRQALVEFENLVSAQEVVKRYRNDFIHIANRPAKINFSTSEHVLKRSGPLNEAVSTANKVLIFFIYDAVYPINVDVINKICKPHGRVVRVFINRKASIMQALVEFYSLDDAIRVKRNLNGADIYSGCCTLKIEYATTNRVNVIQNSEDSYDFEAPSMG----------MRSSQSLL------------GLPSNNEMASRVSMMGRPYDPPRR---------EQPFNGSYGNIRDEYYDEIREP------NRRMMPLNNSMDHSLG---YDQEYDREPQRN-------YNDGPKVAMIYGLNLEFVNCDNLFNLLCIYGNVIKIKFLKSKEGSAMVQMSDGASIDRMMHLLHNQPLFGKTLQFQISKQPVIMDVPAPYKLPDGTVSFKDYTNCRENRFVTPQLAEKNRVFPPSKTINYWNAPPSFGLEMIQEEFKKYN---AVEPPEFFQL--TNRDKSSSGLLQWASVEEAINAIALCNHIMIESEGAKFPYQLKLSFSES 1559
            DD      S V+HIR L +  +E D+  A+++FGPI  + ++PK+RQALVEFE+++ A   V    ++ I+IA  PA +N+STS+ +  R G  +++ S  N VL+F I + +Y I  DV+  IC P G V R+ I RK  + QA+VEF S+  A R K +LNGADIYSGCCTLKIEYA   R+NV +N +D++D+  P++            R  Q  L            G PS +   S          PPR+           P  G +G     Y+DE   P       RRM P      H  G   Y  +Y   P          + D P V M+YGL+   +NCD +FN+ C+YGNV K+KF+KSK G+AMV+M+DG ++DR +  L+N  +FG+ +   +SKQP IM   + Y L DG+ S+KD++  R NRF TP+ A KNR+  PS  ++++NAP    LE+ +E F +      V+ P   ++     ++SSSGLL+W S  +A+  +   NH  +++    +PY LKL FS +
Sbjct:   82 DDPHKTPASPVVHIRGLIDGVVEADLVEALQEFGPISYVVVMPKKRQALVEFEDVLGACNAVNYAADNQIYIAGHPAFVNYSTSQKI-SRPGDSDDSRSV-NSVLLFTILNPIYSITTDVLYTICNPCGPVQRIVIFRKNGV-QAMVEFDSVQSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDQDTWDYTNPNLSGQGDPGSNPNKRQRQPPLLGDHPAEYGEGRGFPSVDSRGSCAPAR----RPPRKFSPVLPLFPSHPPGGPHGGYHSHYHDEGYGPPPPHYEGRRMGPPVGG--HRRGPSRYGPQYGHPPPPPPPPDYGPHADSP-VLMVYGLDQSKMNCDRVFNVFCLYGNVEKVKFMKSKPGAAMVEMADGYAVDRAITHLNNNFMFGQKMNVCVSKQPAIMPGQS-YGLEDGSCSYKDFSESRNNRFSTPEQAAKNRIQHPSNVLHFFNAP----LEVTEENFFEICDELGVKRPTSVKVFSGKSERSSSGLLEWDSKSDALETLGFLNHYQMKNPNGPYPYTLKLCFSTA 611          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Mouse
Match: Hnrnpl (heterogeneous nuclear ribonucleoprotein L [Source:MGI Symbol;Acc:MGI:104816])

HSP 1 Score: 301.982 bits (772), Expect = 1.450e-94
Identity = 186/475 (39.16%), Postives = 273/475 (57.47%), Query Frame = 3
Query:  204 IPKRRQALVEFENLVSAQEVVKRYRNDFIHIANRPAKINFSTSEHVLKRSGPLNEAVSTANKVLIFFIYDAVYPINVDVINKICKPHGRVVRVFINRKASIMQALVEFYSLDDAIRVKRNLNGADIYSGCCTLKIEYATTNRVNVIQNSEDSYDFEAPSMGMRSSQSLLGLPSN-NEMASRVSMMGRPYDPPRREQPFNGSYGNIRDEYYDEIREP------NRRMMP-----------LNNSMDHSLGYDQEYDREPQRNYNDGPKVAMIYGLNLEFVNCDNLFNLLCIYGNVIKIKFLKSKEGSAMVQMSDGASIDRMMHLLHNQPLFGKTLQFQISKQPVIMDVPAPYKLPDGTVSFKDYTNCRENRFVTPQLAEKNRVFPPSKTINYWNAPPSFGLEMIQEEFKKYN---AVEPPEFFQL--TNRDKSSSGLLQWASVEEAINAIALCNHIMIESEGAKFPYQLKLSFSES 1559
            +PK+RQALVEFE+++ A   V    ++ I+IA  PA +N+STS+ +  R G  +++ S  N VL+F I + +Y I  DV+  IC P G V R+ I RK  + QA+VEF S+  A R K +LNGADIYSGCCTLKIEYA   R+NV +N +D++D+  P++   S Q   G  SN N+   +  ++G   D P     + G +G     Y+DE   P       RRM P                 H        D  P   + D P V M+YGL+   +NCD +FN+ C+YGNV K+KF+KSK G+AMV+M+DG ++DR +  L+N  +FG+ +   +SKQP IM   + Y L DG+ S+KD++  R NRF TP+ A KNR+  PS  ++++NAP    LE+ +E F +      V+ P   ++     ++SSSGLL+W S  +A+  +   NH  +++    +PY LKL FS +
Sbjct:    1 MPKKRQALVEFEDVLGACNAVNYAADNQIYIAGHPAFVNYSTSQKI-SRPGDSDDSRSV-NSVLLFTILNPIYSITTDVLYTICNPCGPVQRIVIFRKNGV-QAMVEFDSVQSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDQDTWDYTNPNL---SGQGDPG--SNPNKRQRQPPLLG---DHPAE---YGGPHGGYHSHYHDEGYGPPPPHYEGRRMGPPVGGHRRGPSRYGPQYGHPPPPPPPPDYGP---HADSP-VLMVYGLDQSKMNCDRVFNVFCLYGNVEKVKFMKSKPGAAMVEMADGYAVDRAITHLNNNFMFGQKMNVCVSKQPAIMPGQS-YGLEDGSCSYKDFSESRNNRFSTPEQAAKNRIQHPSNVLHFFNAP----LEVTEENFFEICDELGVKRPTSVKVFSGKSERSSSGLLEWDSKSDALETLGFLNHYQMKNPNGPYPYTLKLCFSTA 452          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Mouse
Match: Hnrnpll (heterogeneous nuclear ribonucleoprotein L-like [Source:MGI Symbol;Acc:MGI:1919942])

HSP 1 Score: 285.804 bits (730), Expect = 7.377e-87
Identity = 182/495 (36.77%), Postives = 272/495 (54.95%), Query Frame = 3
Query:   96 IEPSKVIHIRELAEHTLEIDVSRAMEKFGPIRDIAMIPKRRQALVEFENLVSAQEVVKRYRNDFIHIANRPAKINFSTSEHVLKRSGPLNEAVSTANKVLIFFIYDAVYPINVDVINKICKPHGRVVRVFINRKASIMQALVEFYSLDDAIRVKRNLNGADIYSGCCTLKIEYATTNRVNVIQNSEDSYDFEAPSMGMRSSQSLLGLPSNNEMASRVSMMGRPYDPPRREQPFNGSYGNIRDEYYDEIREPNRRMMPLNNSMDHSLGYDQEYDREPQRNYNDGPKVAMIYGLNLEFVNCDNLFNLLCIYGNVIKIKFLKSKEGSAMVQMSDGASIDRMMHLLHNQPLFGKTLQFQISKQPVIMDVPAP-YKLPDGTVSFKDYTNCRENRFVTPQLAEKNRVFPPSKTINYWNAPPSFGLEMIQEEFKKY---NAVEP---PEFFQLTNRDKSSSGLLQWASVEEAINAIALCNHIMIESEGAKFPYQLKLSFSES 1559
            +  S V+H+R L E  +E D+  A+EKFG I  + M+P +RQALVEFEN+ SA+E V    +  ++IA + A  N+STS+ +  R G  ++  S  NKVL+  I + +YPI VDV+  +C P G+V R+ I ++  I QA+VEF S+  A + K  LNGADIY+GCCTLKIEYA   R+NVI+N  DS+D+  P +G R            +   R +++G    P        GS+G +       +  P+R  M   ++ +       +         +    V M+ GL+   +NC  +FNL C+YGN+ K+KF+K+  G+A+V+M D  +++R +  L+N  LFGK L   +SKQ  +  VP+  ++L DGT S+KD+   + NRF +   A KN + PPS  ++Y+N P    L + +E F K    + V P    + F      K+ SGLL+W    +A+ A+   NH  I       PY LKL FS S
Sbjct:  121 VSVSPVVHVRGLCESVVEADLVEALEKFGTICYVMMMPFKRQALVEFENIDSAKECVTFAADVPVYIAGQQAFFNYSTSKRI-TRPGNTDDP-SGGNKVLLLSIQNPLYPITVDVLYTVCNPVGKVQRIVIFKRNGI-QAMVEFESVLCAQKAKAALNGADIYAGCCTLKIEYARPTRLNVIRNDNDSWDYTKPYLGRR---------DRGKGRQRQAILGD--HPSSFRHDGYGSHGPL-------LPLPSRYRMGSRDTPELVAYPLPQASSSYMHGGSPSGSVVMVSGLHQLKMNCSRVFNLFCLYGNIEKVKFMKTIPGTALVEMGDEYAVERAVTHLNNVKLFGKRLNVCVSKQHSV--VPSQIFELEDGTSSYKDFAMSKNNRFTSAGQASKNIIQPPSCVLHYYNVP----LCVTEETFTKLCNDHEVLPFIKYKVFDAKASAKTLSGLLEWKCKTDAVEALTALNHYQIRVPNGSNPYTLKLCFSTS 588          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. UniProt/SwissProt
Match: sp|P14866|HNRPL_HUMAN (Heterogeneous nuclear ribonucleoprotein L OS=Homo sapiens OX=9606 GN=HNRNPL PE=1 SV=2)

HSP 1 Score: 333.954 bits (855), Expect = 2.838e-104
Identity = 204/515 (39.61%), Postives = 300/515 (58.25%), Query Frame = 3
Query:   81 DDWEDIEPSKVIHIRELAEHTLEIDVSRAMEKFGPIRDIAMIPKRRQALVEFENLVSAQEVVKRYRNDFIHIANRPAKINFSTSEHVLKRSGPLNEAVSTANKVLIFFIYDAVYPINVDVINKICKPHGRVVRVFINRKASIMQALVEFYSLDDAIRVKRNLNGADIYSGCCTLKIEYATTNRVNVIQNSEDSYDFEAPSMGMRSSQSLLGLPSN-NEMASRVSMMGRPYDPPRREQPFNGSYGNIRDEYYDEIREP------NRRMMPLNNSMDHSLG---YDQEYDREPQRN-------YNDGPKVAMIYGLNLEFVNCDNLFNLLCIYGNVIKIKFLKSKEGSAMVQMSDGASIDRMMHLLHNQPLFGKTLQFQISKQPVIMDVPAPYKLPDGTVSFKDYTNCRENRFVTPQLAEKNRVFPPSKTINYWNAPPSFGLEMIQEEFKKYN---AVEPPEFFQL--TNRDKSSSGLLQWASVEEAINAIALCNHIMIESEGAKFPYQLKLSFSES 1559
            DD      S V+HIR L +  +E D+  A+++FGPI  + ++PK+RQALVEFE+++ A   V    ++ I+IA  PA +N+STS+ +  R G  +++ S  N VL+F I + +Y I  DV+  IC P G V R+ I RK  + QA+VEF S+  A R K +LNGADIYSGCCTLKIEYA   R+NV +N +D++D+  P++   S Q   G  SN N+   +  ++G   D P     + G +G     Y+DE   P       RRM P      H  G   Y  +Y   P          + D P V M+YGL+   +NCD +FN+ C+YGNV K+KF+KSK G+AMV+M+DG ++DR +  L+N  +FG+ L   +SKQP IM   + Y L DG+ S+KD++  R NRF TP+ A KNR+  PS  ++++NAP    LE+ +E F +      V+ P   ++     ++SSSGLL+W S  +A+  +   NH  +++    +PY LKL FS +
Sbjct:   93 DDPHKTPASPVVHIRGLIDGVVEADLVEALQEFGPISYVVVMPKKRQALVEFEDVLGACNAVNYAADNQIYIAGHPAFVNYSTSQKI-SRPGDSDDSRSV-NSVLLFTILNPIYSITTDVLYTICNPCGPVQRIVIFRKNGV-QAMVEFDSVQSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDQDTWDYTNPNL---SGQGDPG--SNPNKRQRQPPLLG---DHPAE---YGGPHGGYHSHYHDEGYGPPPPHYEGRRMGPPVGG--HRRGPSRYGPQYGHPPPPPPPPEYGPHADSP-VLMVYGLDQSKMNCDRVFNVFCLYGNVEKVKFMKSKPGAAMVEMADGYAVDRAITHLNNNFMFGQKLNVCVSKQPAIMPGQS-YGLEDGSCSYKDFSESRNNRFSTPEQAAKNRIQHPSNVLHFFNAP----LEVTEENFFEICDELGVKRPSSVKVFSGKSERSSSGLLEWESKSDALETLGFLNHYQMKNPNGPYPYTLKLCFSTA 585          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. UniProt/SwissProt
Match: sp|Q8R081|HNRPL_MOUSE (Heterogeneous nuclear ribonucleoprotein L OS=Mus musculus OX=10090 GN=Hnrnpl PE=1 SV=2)

HSP 1 Score: 332.798 bits (852), Expect = 6.365e-104
Identity = 201/516 (38.95%), Postives = 297/516 (57.56%), Query Frame = 3
Query:   81 DDWEDIEPSKVIHIRELAEHTLEIDVSRAMEKFGPIRDIAMIPKRRQALVEFENLVSAQEVVKRYRNDFIHIANRPAKINFSTSEHVLKRSGPLNEAVSTANKVLIFFIYDAVYPINVDVINKICKPHGRVVRVFINRKASIMQALVEFYSLDDAIRVKRNLNGADIYSGCCTLKIEYATTNRVNVIQNSEDSYDFEAPSMGMRSSQSLLGLPSN-NEMASRVSMMGRPYDPPRREQPFNGSYGNIRDEYYDEIREP------NRRMMP-----------LNNSMDHSLGYDQEYDREPQRNYNDGPKVAMIYGLNLEFVNCDNLFNLLCIYGNVIKIKFLKSKEGSAMVQMSDGASIDRMMHLLHNQPLFGKTLQFQISKQPVIMDVPAPYKLPDGTVSFKDYTNCRENRFVTPQLAEKNRVFPPSKTINYWNAPPSFGLEMIQEEFKKYN---AVEPPEFFQL--TNRDKSSSGLLQWASVEEAINAIALCNHIMIESEGAKFPYQLKLSFSES 1559
            DD      S V+HIR L +  +E D+  A+++FGPI  + ++PK+RQALVEFE+++ A   V    ++ I+IA  PA +N+STS+ +  R G  +++ S  N VL+F I + +Y I  DV+  IC P G V R+ I RK  + QA+VEF S+  A R K +LNGADIYSGCCTLKIEYA   R+NV +N +D++D+  P++   S Q   G  SN N+   +  ++G   D P     + G +G     Y+DE   P       RRM P                 H        D  P   + D P V M+YGL+   +NCD +FN+ C+YGNV K+KF+KSK G+AMV+M+DG ++DR +  L+N  +FG+ +   +SKQP IM   + Y L DG+ S+KD++  R NRF TP+ A KNR+  PS  ++++NAP    LE+ +E F +      V+ P   ++     ++SSSGLL+W S  +A+  +   NH  +++    +PY LKL FS +
Sbjct:   90 DDPHKTPASPVVHIRGLIDGVVEADLVEALQEFGPISYVVVMPKKRQALVEFEDVLGACNAVNYAADNQIYIAGHPAFVNYSTSQKI-SRPGDSDDSRSV-NSVLLFTILNPIYSITTDVLYTICNPCGPVQRIVIFRKNGV-QAMVEFDSVQSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDQDTWDYTNPNL---SGQGDPG--SNPNKRQRQPPLLG---DHPAE---YGGPHGGYHSHYHDEGYGPPPPHYEGRRMGPPVGGHRRGPSRYGPQYGHPPPPPPPPDYGP---HADSP-VLMVYGLDQSKMNCDRVFNVFCLYGNVEKVKFMKSKPGAAMVEMADGYAVDRAITHLNNNFMFGQKMNVCVSKQPAIMPGQS-YGLEDGSCSYKDFSESRNNRFSTPEQAAKNRIQHPSNVLHFFNAP----LEVTEENFFEICDELGVKRPTSVKVFSGKSERSSSGLLEWDSKSDALETLGFLNHYQMKNPNGPYPYTLKLCFSTA 582          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. UniProt/SwissProt
Match: sp|F1LQ48|HNRPL_RAT (Heterogeneous nuclear ribonucleoprotein L OS=Rattus norvegicus OX=10116 GN=Hnrnpl PE=1 SV=2)

HSP 1 Score: 329.331 bits (843), Expect = 3.707e-102
Identity = 203/546 (37.18%), Postives = 296/546 (54.21%), Query Frame = 3
Query:   81 DDWEDIEPSKVIHIRELAEHTLEIDVSRAMEKFGPIRDIAMIPKRRQALVEFENLVSAQEVVKRYRNDFIHIANRPAKINFSTSEHVLKRSGPLNEAVSTANKVLIFFIYDAVYPINVDVINKICKPHGRVVRVFINRKASIMQALVEFYSLDDAIRVKRNLNGADIYSGCCTLKIEYATTNRVNVIQNSEDSYDFEAPSMG----------MRSSQSLL------------GLPSNNEMASRVSMMGRPYDPPRR---------EQPFNGSYGNIRDEYYDEIREP------NRRMMP-----------LNNSMDHSLGYDQEYDREPQRNYNDGPKVAMIYGLNLEFVNCDNLFNLLCIYGNVIKIKFLKSKEGSAMVQMSDGASIDRMMHLLHNQPLFGKTLQFQISKQPVIMDVPAPYKLPDGTVSFKDYTNCRENRFVTPQLAEKNRVFPPSKTINYWNAPPSFGLEMIQEEFKKYN---AVEPPEFFQL--TNRDKSSSGLLQWASVEEAINAIALCNHIMIESEGAKFPYQLKLSFSES 1559
            DD      S V+HIR L +  +E D+  A+++FGPI  + ++PK+RQALVEFE+++ A   V    ++ I+IA  PA +N+STS+ +  R G  +++ S  N VL+F I + +Y I  DV+  IC P G V R+ I RK  + QA+VEF S+  A R K +LNGADIYSGCCTLKIEYA   R+NV +N +D++D+  P++            R  Q  L            G PS +   S          PPR+           P  G +G     Y+DE   P       RRM P                 H        D  P   + D P V M+YGL+   +NCD +FN+ C+YGNV K+KF+KSK G+AMV+M+DG ++DR +  L+N  +FG+ +   +SKQP IM   + Y L DG+ S+KD++  R NRF TP+ A KNR+  PS  ++++NAP    LE+ +E F +      V+ P   ++     ++SSSGLL+W S  +A+  +   NH  +++    +PY LKL FS +
Sbjct:   90 DDPHKTPASPVVHIRGLIDGVVEADLVEALQEFGPISYVVVMPKKRQALVEFEDVLGACNAVNYAADNQIYIAGHPAFVNYSTSQKI-SRPGDSDDSRSV-NSVLLFTILNPIYSITTDVLYTICNPCGPVQRIVIFRKNGV-QAMVEFDSVQSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDQDTWDYTNPNLSGQGDPGSNPNKRQRQPPLLGDHPAEYGEGRGFPSVDSRGSCAPAR----RPPRKFSPVLPLFPSHPPGGPHGGYHSHYHDEGYGPPPPHYEGRRMGPPVGGHRRGPSRYGPQYGHPPPPPPPPDYGP---HADSP-VLMVYGLDQSKMNCDRVFNVFCLYGNVEKVKFMKSKPGAAMVEMADGYAVDRAITHLNNNFMFGQKMNVCVSKQPAIMPGQS-YGLEDGSCSYKDFSESRNNRFSTPEQAAKNRIQHPSNVLHFFNAP----LEVTEENFFEICDELGVKRPTSVKVFSGKSERSSSGLLEWDSKSDALETLGFLNHYQMKNPNGPYPYTLKLCFSTA 619          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. UniProt/SwissProt
Match: sp|Q8WVV9|HNRLL_HUMAN (Heterogeneous nuclear ribonucleoprotein L-like OS=Homo sapiens OX=9606 GN=HNRNPLL PE=1 SV=1)

HSP 1 Score: 289.656 bits (740), Expect = 5.073e-88
Identity = 184/495 (37.17%), Postives = 273/495 (55.15%), Query Frame = 3
Query:   96 IEPSKVIHIRELAEHTLEIDVSRAMEKFGPIRDIAMIPKRRQALVEFENLVSAQEVVKRYRNDFIHIANRPAKINFSTSEHVLKRSGPLNEAVSTANKVLIFFIYDAVYPINVDVINKICKPHGRVVRVFINRKASIMQALVEFYSLDDAIRVKRNLNGADIYSGCCTLKIEYATTNRVNVIQNSEDSYDFEAPSMGMRSSQSLLGLPSNNEMASRVSMMGRPYDPPRREQPFNGSYGNIRDEYYDEIREPNRRMMPLNNSMDHSLGYDQEYDREPQRNYNDGPKVAMIYGLNLEFVNCDNLFNLLCIYGNVIKIKFLKSKEGSAMVQMSDGASIDRMMHLLHNQPLFGKTLQFQISKQPVIMDVPAP-YKLPDGTVSFKDYTNCRENRFVTPQLAEKNRVFPPSKTINYWNAPPSFGLEMIQEEFKKY-NAVEPPEFFQLTNRD-----KSSSGLLQWASVEEAINAIALCNHIMIESEGAKFPYQLKLSFSES 1559
            +  S V+H+R L E  +E D+  A+EKFG I  + M+P +RQALVEFEN+ SA+E V    ++ ++IA + A  N+STS+ +  R G  ++  S  NKVL+  I + +YPI VDV+  +C P G+V R+ I ++  I QA+VEF S+  A + K  LNGADIY+GCCTLKIEYA   R+NVI+N  DS+D+  P +G R            +   R +++G    P        GS+G +       +  P+R  M   ++ +       +         N    V M+ GL+   +NC  +FNL C+YGN+ K+KF+K+  G+A+V+M D  +++R +  L+N  LFGK L   +SKQ  +  VP+  ++L DGT S+KD+   + NRF +   A KN + PPS  ++Y+N P    L + +E F K  N  E   F +    D     K+ SGLL+W    +A+ A+   NH  I       PY LKL FS S
Sbjct:   72 VSVSPVVHVRGLCESVVEADLVEALEKFGTICYVMMMPFKRQALVEFENIDSAKECVTFAADEPVYIAGQQAFFNYSTSKRI-TRPGNTDDP-SGGNKVLLLSIQNPLYPITVDVLYTVCNPVGKVQRIVIFKRNGI-QAMVEFESVLCAQKAKAALNGADIYAGCCTLKIEYARPTRLNVIRNDNDSWDYTKPYLGRRD---------RGKGRQRQAILGE--HPSSFRHDGYGSHGPL-------LPLPSRYRMGSRDTPELVAYPLPQASSSYMHGGNPSGSVVMVSGLHQLKMNCSRVFNLFCLYGNIEKVKFMKTIPGTALVEMGDEYAVERAVTHLNNVKLFGKRLNVCVSKQHSV--VPSQIFELEDGTSSYKDFAMSKNNRFTSAGQASKNIIQPPSCVLHYYNVP----LCVTEETFTKLCNDHEVLTFIKYKVFDAKPSAKTLSGLLEWECKTDAVEALTALNHYQIRVPNGSNPYTLKLCFSTS 539          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. UniProt/SwissProt
Match: sp|Q921F4|HNRLL_MOUSE (Heterogeneous nuclear ribonucleoprotein L-like OS=Mus musculus OX=10090 GN=Hnrnpll PE=1 SV=3)

HSP 1 Score: 285.804 bits (730), Expect = 5.160e-86
Identity = 182/495 (36.77%), Postives = 272/495 (54.95%), Query Frame = 3
Query:   96 IEPSKVIHIRELAEHTLEIDVSRAMEKFGPIRDIAMIPKRRQALVEFENLVSAQEVVKRYRNDFIHIANRPAKINFSTSEHVLKRSGPLNEAVSTANKVLIFFIYDAVYPINVDVINKICKPHGRVVRVFINRKASIMQALVEFYSLDDAIRVKRNLNGADIYSGCCTLKIEYATTNRVNVIQNSEDSYDFEAPSMGMRSSQSLLGLPSNNEMASRVSMMGRPYDPPRREQPFNGSYGNIRDEYYDEIREPNRRMMPLNNSMDHSLGYDQEYDREPQRNYNDGPKVAMIYGLNLEFVNCDNLFNLLCIYGNVIKIKFLKSKEGSAMVQMSDGASIDRMMHLLHNQPLFGKTLQFQISKQPVIMDVPAP-YKLPDGTVSFKDYTNCRENRFVTPQLAEKNRVFPPSKTINYWNAPPSFGLEMIQEEFKKY---NAVEP---PEFFQLTNRDKSSSGLLQWASVEEAINAIALCNHIMIESEGAKFPYQLKLSFSES 1559
            +  S V+H+R L E  +E D+  A+EKFG I  + M+P +RQALVEFEN+ SA+E V    +  ++IA + A  N+STS+ +  R G  ++  S  NKVL+  I + +YPI VDV+  +C P G+V R+ I ++  I QA+VEF S+  A + K  LNGADIY+GCCTLKIEYA   R+NVI+N  DS+D+  P +G R            +   R +++G    P        GS+G +       +  P+R  M   ++ +       +         +    V M+ GL+   +NC  +FNL C+YGN+ K+KF+K+  G+A+V+M D  +++R +  L+N  LFGK L   +SKQ  +  VP+  ++L DGT S+KD+   + NRF +   A KN + PPS  ++Y+N P    L + +E F K    + V P    + F      K+ SGLL+W    +A+ A+   NH  I       PY LKL FS S
Sbjct:  121 VSVSPVVHVRGLCESVVEADLVEALEKFGTICYVMMMPFKRQALVEFENIDSAKECVTFAADVPVYIAGQQAFFNYSTSKRI-TRPGNTDDP-SGGNKVLLLSIQNPLYPITVDVLYTVCNPVGKVQRIVIFKRNGI-QAMVEFESVLCAQKAKAALNGADIYAGCCTLKIEYARPTRLNVIRNDNDSWDYTKPYLGRR---------DRGKGRQRQAILGD--HPSSFRHDGYGSHGPL-------LPLPSRYRMGSRDTPELVAYPLPQASSSYMHGGSPSGSVVMVSGLHQLKMNCSRVFNLFCLYGNIEKVKFMKTIPGTALVEMGDEYAVERAVTHLNNVKLFGKRLNVCVSKQHSV--VPSQIFELEDGTSSYKDFAMSKNNRFTSAGQASKNIIQPPSCVLHYYNVP----LCVTEETFTKLCNDHEVLPFIKYKVFDAKASAKTLSGLLEWKCKTDAVEALTALNHYQIRVPNGSNPYTLKLCFSTS 588          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. TrEMBL
Match: A0A183NEZ5 (Uncharacterized protein OS=Schistosoma mattheei OX=31246 GN=SMTD_LOCUS681 PE=4 SV=1)

HSP 1 Score: 439.499 bits (1129), Expect = 4.154e-143
Identity = 234/518 (45.17%), Postives = 330/518 (63.71%), Query Frame = 3
Query:   60 NRKRAKPDDWEDIEPSKVIHIRELAEHTLEIDVSRAMEKFGPIRDIAMIPKRRQALVEFENLVSAQEVVKRYRNDFIHIANRPAKINFSTSEHVLKRSGPL-----NEAVSTANKVLIFFIYDAVYPINVDVINKICKPHGRVVRVFINRKASIMQALVEFYSLDDAIRVKRNLNGADIYSGCCTLKIEYATTNRVNVIQNSEDSYDFEAPSMGMRSSQSLLGLPSNNEMASR--VSMMGRPYDPPRREQPFNGSYGNIRDEYYDEIREPNRRMM--PLNNSMDHSLGYDQEYDREPQRNYNDGP------KVAMIYGLNLEFVNCDNLFNLLCIYGNVIKIKFLKSKEGSAMVQMSDGASIDRMMHLLHNQPLFGKTLQFQISKQPVIMDVPAPYKLPDGTVSFKDYTNCRENRFVTPQLAEKNRVFPPSKTINYWNAPPSFGLEMIQEEFKKYNAVEPPEFFQLTN-RDKSSSGLLQWASVEEAINAIALCNHIMIESEGAKFPYQLKLSFSESPI 1565
            NRKR +P+DWED+EPS VIHIREL EHTLE+D+ R  E+FG IRDIAMIP + QAL+EF+++ SA+  V R   + +  AN   K+N+STS+ V+ R  PL     +  +   ++VL+  +Y+A YPI VDVI++I   HGRV+R+ I RK  I QA+VEF + ++A   KR+LNGADIYSGCCTLK+E+A   R+ V +N +DS+DFE P         LL   S NE   R  +S++GR ++  R     + S       Y+D   + N   +  P  + +D  L  +    R      N  P       V M+Y ++++ +NCD LFNLLC+YGNV++IKFL++KEGSAM QM D  S+DR++  L   PL G  L  + SKQ +I+DVP P++LPDGT SFKDY+ CRENR++ P  A KNR++PPS T++YWN PPS+  E +++   +  A  P +        D+SSSGL++W + +EA+ A+ALCNH  I +   ++P+ LKLSFS SP+
Sbjct:   12 NRKRNRPEDWEDLEPSPVIHIRELPEHTLELDLIRVFEQFGSIRDIAMIPHKGQALIEFDDINSAERAVARCSENAVMFANHRLKVNYSTSKRVVHR--PLENDNQHSELPPESRVLMLTVYNAQYPITVDVIHQITAKHGRVLRIVILRKTRI-QAMVEFKNTEEARTAKRHLNGADIYSGCCTLKVEFARPTRLTVTRNDQDSWDFENP---------LLLSTSLNEADGRGDISLLGR-FERSRARHESSRSVNGGNFGYHDGFIKQNAVGLSVPPASFLDQ-LALNYHVSRRGLDGLNGQPFARAATAVIMVYNMDMDHMNCDRLFNLLCLYGNVVRIKFLRTKEGSAMAQMGDNVSVDRVITNLSEVPLMGNALSIRPSKQQLILDVPKPFELPDGTPSFKDYSGCRENRYINPDKASKNRIYPPSHTLHYWNCPPSYTPEELRKLIVECGASPPRQIAPFPRISDRSSSGLVEWGTKDEAVTALALCNHQAIPNTEGRYPFLLKLSFSSSPV 515          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. TrEMBL
Match: A0A094ZF59 (Heterogeneous nuclear ribonucleoprotein L OS=Schistosoma haematobium OX=6185 GN=MS3_00528 PE=4 SV=1)

HSP 1 Score: 439.113 bits (1128), Expect = 4.578e-143
Identity = 234/518 (45.17%), Postives = 330/518 (63.71%), Query Frame = 3
Query:   60 NRKRAKPDDWEDIEPSKVIHIRELAEHTLEIDVSRAMEKFGPIRDIAMIPKRRQALVEFENLVSAQEVVKRYRNDFIHIANRPAKINFSTSEHVLKRSGPL-----NEAVSTANKVLIFFIYDAVYPINVDVINKICKPHGRVVRVFINRKASIMQALVEFYSLDDAIRVKRNLNGADIYSGCCTLKIEYATTNRVNVIQNSEDSYDFEAPSMGMRSSQSLLGLPSNNEMASR--VSMMGRPYDPPRREQPFNGSYGNIRDEYYDEIREPNRRMM--PLNNSMDHSLGYDQEYDREPQRNYNDGP------KVAMIYGLNLEFVNCDNLFNLLCIYGNVIKIKFLKSKEGSAMVQMSDGASIDRMMHLLHNQPLFGKTLQFQISKQPVIMDVPAPYKLPDGTVSFKDYTNCRENRFVTPQLAEKNRVFPPSKTINYWNAPPSFGLEMIQEEFKKYNAVEPPEFFQLTN-RDKSSSGLLQWASVEEAINAIALCNHIMIESEGAKFPYQLKLSFSESPI 1565
            NRKR +P+DWED+EPS VIHIREL EHTLE+D+ R  E+FG IRDIAMIP + QAL+EF+++ SA+  V R   + +  AN   K+N+STS+ V+ R  PL     +  +   ++VL+  +Y+A YPI VDVI++I   HGRV+R+ I RK  I QA+VEF + ++A   KR+LNGADIYSGCCTLK+E+A   R+ V +N +DS+DFE P         LL   S NE   R  +S++GR ++  R     + S       Y+D   + N   +  P  + +D  L  +    R      N  P       V M+Y ++++ +NCD LFNLLC+YGNV++IKFL++KEGSAM QM D  S+DR++  L   PL G  L  + SKQ +I+DVP P++LPDGT SFKDY+ CRENR++ P  A KNR++PPS T++YWN PPS+  E +++   +  A  P +        D+SSSGL++W + +EA+ A+ALCNH  I +   ++P+ LKLSFS SP+
Sbjct:   12 NRKRNRPEDWEDLEPSPVIHIRELPEHTLELDLIRVFEQFGSIRDIAMIPHKGQALIEFDDINSAERAVARCSENAVMFANHRLKVNYSTSKRVVHR--PLENDNQHSELPPESRVLMLTVYNAQYPITVDVIHQITAKHGRVLRIVILRKTRI-QAMVEFKNTEEARTAKRHLNGADIYSGCCTLKVEFARPTRLTVTRNDQDSWDFENP---------LLLSTSLNEADGRGDISLLGR-FERSRARHESSRSVNGGNFGYHDGFIKQNAVGLSVPPASFLDQ-LALNYHVSRRGLDGLNGQPYARAATAVIMVYNMDMDHMNCDRLFNLLCLYGNVVRIKFLRTKEGSAMAQMGDNVSVDRVITNLSEVPLMGNALSIRPSKQQLILDVPKPFELPDGTPSFKDYSGCRENRYINPDKASKNRIYPPSHTLHYWNCPPSYTPEELRKLIVECGASPPRQIAPFPRISDRSSSGLVEWGTKDEAVTALALCNHQAIPNTEGRYPFLLKLSFSSSPV 515          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. TrEMBL
Match: C4QB35 (Heterogeneous nuclear ribonucleoprotein l (Hnrnp l), putative OS=Schistosoma mansoni OX=6183 GN=Smp_051530 PE=4 SV=1)

HSP 1 Score: 439.113 bits (1128), Expect = 5.994e-143
Identity = 236/522 (45.21%), Postives = 331/522 (63.41%), Query Frame = 3
Query:   60 NRKRAKPDDWEDIEPSKVIHIRELAEHTLEIDVSRAMEKFGPIRDIAMIPKRRQALVEFENLVSAQEVVKRYRNDFIHIANRPAKINFSTSEHVLKRSGPL-----NEAVSTANKVLIFFIYDAVYPINVDVINKICKPHGRVVRVFINRKASIMQALVEFYSLDDAIRVKRNLNGADIYSGCCTLKIEYATTNRVNVIQNSEDSYDFEAPSMGMRSSQSLLGLPSNNEMASR--VSMMGRPYDPPRREQPF----NGSYGNIRDEYYDEIREPNRRMM--PLNNSMDHSLGYDQEYDREPQRNYNDGP------KVAMIYGLNLEFVNCDNLFNLLCIYGNVIKIKFLKSKEGSAMVQMSDGASIDRMMHLLHNQPLFGKTLQFQISKQPVIMDVPAPYKLPDGTVSFKDYTNCRENRFVTPQLAEKNRVFPPSKTINYWNAPPSFGLEMIQEEFKKYNAVEPPEFFQLTN-RDKSSSGLLQWASVEEAINAIALCNHIMIESEGAKFPYQLKLSFSESPI 1565
            NRKR +P+DWED+EPS VIHIREL EHTLE+D+ R  E+FG IRDIAMIP + QAL+EF+++ SA+  V R   + +  AN   K+N+STS+ V+ R  PL     +  +   ++VL+  +Y+A YPI VDVI++I   HGRV+R+ I RK  I QA+VEF + ++A   KR+LNGADIYSGCCTLK+E+A   R+ V +N +DS+DFE P         LL   S NE   R  +S++GR      R +       GS+G     Y+D   + N   +  P  + +D  L  +    R      N  P       V M+Y ++++ +NCD LFNLLC+YGNV++IKFL++KEGSAM QM D  S+DR++  L   PL G  L  + SKQ +I+DVP P++LPDGT SFKDY+ CRENR++ P  A KNR++PPS T++YWN PP++  E +++   +  A  P +        D+SSSGL++W + +EA+ A+ALCNH  I +   ++PY LKLSFS SP+
Sbjct:   12 NRKRNRPEDWEDLEPSPVIHIRELPEHTLELDLIRVFEQFGSIRDIAMIPHKGQALIEFDDINSAERAVARCSENAVMFANHRLKVNYSTSKRVVHR--PLENDNQHSELPPESRVLMLTVYNAQYPITVDVIHQITAKHGRVLRIVILRKTRI-QAMVEFKNTEEARTAKRHLNGADIYSGCCTLKVEFARPTRLTVTRNDQDSWDFENP---------LLLSTSLNESDGRGDISLLGRFERSRARHESSRSVNGGSFG-----YHDGFIKQNAVGLSVPPASFLDQ-LALNYHVSRRGLDGLNGQPYARASTAVIMVYNMDMDHMNCDRLFNLLCLYGNVVRIKFLRTKEGSAMAQMGDNVSVDRVITNLSEVPLMGNALSIRPSKQQLILDVPKPFELPDGTPSFKDYSGCRENRYINPDKASKNRIYPPSHTLHYWNCPPNYTPEELRKLIVECGASPPRQIAPFPRISDRSSSGLVEWGTKDEAVTALALCNHQAIPNTEGRYPYLLKLSFSSSPV 515          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. TrEMBL
Match: C1LFX1 (Heterogeneous nuclear ribonucleoprotein L OS=Schistosoma japonicum OX=6182 GN=hnRNP-L PE=2 SV=1)

HSP 1 Score: 438.343 bits (1126), Expect = 8.030e-143
Identity = 233/517 (45.07%), Postives = 329/517 (63.64%), Query Frame = 3
Query:   60 NRKRAKPDDWEDIEPSKVIHIRELAEHTLEIDVSRAMEKFGPIRDIAMIPKRRQALVEFENLVSAQEVVKRYRNDFIHIANRPAKINFSTSEHVLKRSGPL-----NEAVSTANKVLIFFIYDAVYPINVDVINKICKPHGRVVRVFINRKASIMQALVEFYSLDDAIRVKRNLNGADIYSGCCTLKIEYATTNRVNVIQNSEDSYDFEAPSMGMRSSQSLLGLPSNN-EMASRVSMMGRPYDPPRREQPFNGSYGNIRDEYYDEIREPNRR--MMPLNNSMDHSLGYDQEYDREPQRNYNDGP------KVAMIYGLNLEFVNCDNLFNLLCIYGNVIKIKFLKSKEGSAMVQMSDGASIDRMMHLLHNQPLFGKTLQFQISKQPVIMDVPAPYKLPDGTVSFKDYTNCRENRFVTPQLAEKNRVFPPSKTINYWNAPPSFGLEMIQEEFKKYNAVEPPEFFQLTN-RDKSSSGLLQWASVEEAINAIALCNHIMIESEGAKFPYQLKLSFSESPI 1565
            NRKR +P+DWED+EPS VIHIREL EHTLE+D+ R  E+FG IRDIAMIP + QAL+EF+++ SA+  V R   + +  AN   K+N+STS+ V+ R  PL     +  +   ++VLI  +Y+A YPI VDVI++I   HGRV+R+ I RK  I QA+VEF + ++A   KR+LNGADIYSGCCTLK+E+A   R+ V +N +DS+DFE P         LL  P N  +    +S++GR ++  R     + S       Y+D   + N     +P  + +D  L  +    R      N  P       V M+Y ++++ +NCD LFNLLC+YGNV++IKFL++KEGSAM QM D  S+DR++  L   PL G  L  + SKQ +I+DVP PY+LPDGT SFKDY+ CRENR++ P  A KNR++PPS T++YWN PP++  E +++   +  A  P +        D+SSSGL++W + +EA+ A+ALCNH  I +   ++P+ LKLSFS SP+
Sbjct:    3 NRKRNRPEDWEDLEPSPVIHIRELPEHTLELDLIRVFEQFGSIRDIAMIPHKGQALIEFDDINSAERAVARCSENAVMFANHRLKVNYSTSKRVIHR--PLENDNQHPELPPESRVLILTVYNAQYPITVDVIHQITAKHGRVLRIVILRKTRI-QAMVEFKNTEEARTAKRHLNGADIYSGCCTLKVEFARPTRLTVTRNDQDSWDFENPL--------LLSSPLNEADGRGDISLLGR-FERSRARHESSRSVNGGAFGYHDGFMKQNAVGISVPPASFLDQ-LALNYHVSRRGLDGLNGQPYTRAATPVIMVYNMDMDHMNCDRLFNLLCLYGNVVRIKFLRTKEGSAMAQMGDNLSVDRVITNLSEVPLMGNALSIRPSKQQLILDVPKPYELPDGTPSFKDYSGCRENRYINPDKASKNRIYPPSNTLHYWNCPPNYTTEELRKLIVECGASPPRQIAPFPRISDRSSSGLVEWGTKDEAVTALALCNHQAIPNTEGRYPFLLKLSFSSSPV 506          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. TrEMBL
Match: A0A3S5BVH4 (Uncharacterized protein OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS13646 PE=4 SV=1)

HSP 1 Score: 433.335 bits (1113), Expect = 1.102e-140
Identity = 231/528 (43.75%), Postives = 332/528 (62.88%), Query Frame = 3
Query:   57 FNRKRAKPDDWEDIEPSKVIHIRELAEHTLEIDVSRAMEKFGPIRDIAMIPKRRQALVEFENLVSAQEVVKRYRNDFIHIANRPAKINFSTSEHVLKRS----------GPLNEAVSTANKVLIFFIYDAVYPINVDVINKICKPHGRVVRVFINRKASIMQALVEFYSLDDAIRVKRNLNGADIYSGCCTLKIEYATTNRVNVIQNSEDSYDFEAPSMGMRSSQSLL-GLPSNNEMASRVSMMGRPYDPPRREQPFNGSYGNIRDEY-----YDEIREPNRRMMPLNNSMD------HSLGYDQEYDREPQRNYNDGPKVAMIYGLNLEFVNCDNLFNLLCIYGNVIKIKFLKSKEGSAMVQMSDGASIDRMMHLLHNQPLFGKTLQFQIS-KQPVIMDVPAPYKLPDGTVSFKDYTNCRENRFVTPQLAEKNRVFPPSKTINYWNAPPSFGLEMIQEEFKKYNAVEPPEFFQLT-NRDKSSSGLLQWASVEEAINAIALCNHIMIESEGAKFPYQLKLSFSESPIR 1568
             NRKR +P+DWEDI+PS VIHIREL EHTLEID+ RA E +G IRDI M+P + QAL+EF ++ SA+ V+ R   + + +ANR  K+NFSTS+ +++R+          GP+    S  N +L+  IY+  YPI VDVIN+I   HGRV+R+ I RK+ + QA+VEF ++D+A   KR+LNGADIYSGCCTLK+EYA  +R++V +N +D++DFE P     +  S+L G   NN      S++G     PR    F+     I + Y        I     ++M   N+M        + G   + +  P   +     V M+Y L+L  +NCD LFN+LC++GNV +IKFL++KEGSAMVQM D AS+DR +  L    LFG  LQ  +S +Q V++DVP P+ LPD + SFKDYT  RENR++ P++A KNR++P S+T+++WN PP+F    ++  F    AV P +F   +   +KSSSGL++W +  +A++ + LCNH ++     +FP+ +KLSFS S IR
Sbjct:    3 MNRKRNRPEDWEDIKPSPVIHIRELPEHTLEIDLQRAFEVYGRIRDITMLPTKCQALLEFHDISSAEAVIMRSAEEVVTVANRRVKVNFSTSKRIMQRTSASASDNSVDGPV---ASAENNILLLTIYNPQYPITVDVINQITSRHGRVLRIVIFRKSGV-QAMVEFQTIDEAKTAKRHLNGADIYSGCCTLKVEYARPSRLSVSKNDQDTWDFENPMPSSGAGGSVLDGRNQNN-----ASLLG---GYPR----FDSGRNTIANIYGMPSGAVGITAAGTQVM---NAMGVPGASVTAGGMPIQVEHAPNLYHGSNTSVLMVYNLDLTRMNCDRLFNILCLFGNVWRIKFLRTKEGSAMVQMGDSASVDRAIPSLAGLTLFGNRLQASLSTRQQVLLDVPQPFDLPDSSSSFKDYTGSRENRYINPEMALKNRIYPASRTLHFWNCPPNFSATDMRHVFVNNGAVPPEQFLAFSKGGEKSSSGLVEWNNRGDALDGLVLCNHTVVPYPEGRFPFMMKLSFSASSIR 511          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Cavefish
Match: hnrnpl2 (heterogeneous nuclear ribonucleoprotein L [Source:NCBI gene;Acc:103041983])

HSP 1 Score: 321.627 bits (823), Expect = 2.476e-101
Identity = 190/505 (37.62%), Postives = 289/505 (57.23%), Query Frame = 3
Query:   81 DDWEDIEPSKVIHIRELAEHTLEIDVSRAMEKFGPIRDIAMIPKRRQALVEFENLVSAQEVVKRYRNDFIHIANRPAKINFSTSEHVLKRSGPLNEAVSTANKVLIFFIYDAVYPINVDVINKICKPHGRVVRVFINRKASIMQALVEFYSLDDAIRVKRNLNGADIYSGCCTLKIEYATTNRVNVIQNSEDSYDFEAPSMGMRSSQSLLGLPSNNEMASRVSMMGRPYDPPRREQPFNGSYGNIRDEYYDEIREPNRRMMPLNNS---MDHSLGYDQEYDREP----QRNYNDGPKVAMIYGLNLEFVNCDNLFNLLCIYGNVIKIKFLKSKEGSAMVQMSDGASIDRMMHLLHNQPLFGKTLQFQISKQPVIMDVPAPYKLPDGTVSFKDYTNCRENRFVTPQLAEKNRVFPPSKTINYWNAPPSFGLEMIQEEFKKYNAVEPPEFFQLTNR-----DKSSSGLLQWASVEEAINAIALCNHIMIESEGAKFPYQLKLSFSES 1559
            DD     PS V+H+R L +  LE D+  A+++FG I  + ++PK+RQALVE+E++  +   V    ++ I+IA  PA +N+STS+ + +   P  +   + N VL+F I + +YPI  DV+  IC   G V R+ I RK  + QA+VEF S+  A R K +LNGADIYSGCCTLKIEYA   R+NV +N +D++D+  P++   SSQ +   P+ N+   + +++G   D P    P  G Y   +D+ Y       RRM P          S  Y  +Y   P    + + +    V M+YGL    +N D +FN+ C+YGNV ++KF+KSK G+AMV+M D  ++DR +  L+N  LF + L   +SKQ  IM   + Y+L DG+ SFKD+   R NRF +P+ A KNR+  PS  ++++NA P    ++  E  ++     P        +     ++SSSGLL+W SV +A+ A+A+ NH  +++    +PY LKL FS +
Sbjct:   33 DDPHKPLPSLVVHVRGLVDGVLEADLVEALQEFGTISYVVLMPKKRQALVEYEDMSGSCNAVTYANDNQIYIAGNPAFVNYSTSQKISRPGDP--DDSRSVNNVLLFTIMNPIYPITTDVLYTICNNCGPVQRIVIFRKNGV-QAMVEFDSVQSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDQDTWDYTNPNL---SSQDMN--PNPNKRPRQPALLG---DHP----PEYGGYHGYQDDSYGGYE--GRRMAPSMGGPRRGGASQRYGGQYGAPPPPPGEYSAHAESPVMMVYGLEPTKINADRVFNIFCLYGNVERVKFMKSKPGAAMVEMGDCYAVDRAICHLNNHFLFNQKLNVCVSKQQAIMPGQS-YELDDGSNSFKDFHGSRNNRFTSPEQAAKNRIQHPSNVLHFFNAAPEAAGDVFSEICEELGVKSPSNVKNFAAKGGASSERSSSGLLEWESVNDAMEALAMMNHYQMKNPNGPYPYTLKLCFSTA 519          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Cavefish
Match: hnrnpl2 (heterogeneous nuclear ribonucleoprotein L [Source:NCBI gene;Acc:103041983])

HSP 1 Score: 318.161 bits (814), Expect = 8.506e-100
Identity = 188/509 (36.94%), Postives = 285/509 (55.99%), Query Frame = 3
Query:   81 DDWEDIEPSKVIHIRELAEHTLEIDVSRAMEKFGPIRDIAMIPKRRQALVEFENLVSAQEVVKRYRNDFIHIANRPAKINFSTSEHVLKRSGPLNEAVSTANKVLIFFIYDAVYPINVDVINKICKPHGRVVRVFINRKASIMQALVEFYSLDDAIRVKRNLNGADIYSGCCTLKIEYATTNRVNVIQNSEDSYDFEAPSMGMRSSQSLL--GLPSNNEMASRVSMMGRPYDPP--RREQPFNGSYGNIRDEYYDEIREPNRRMMPLNNS---MDHSLGYDQEYDREP----QRNYNDGPKVAMIYGLNLEFVNCDNLFNLLCIYGNVIKIKFLKSKEGSAMVQMSDGASIDRMMHLLHNQPLFGKTLQFQISKQPVIMDVPAPYKLPDGTVSFKDYTNCRENRFVTPQLAEKNRVFPPSKTINYWNAPPSFGLEMIQEEFKKYNAVEPPEFFQLTNR-----DKSSSGLLQWASVEEAINAIALCNHIMIESEGAKFPYQLKLSFSES 1559
            DD     PS V+H+R L +  LE D+  A+++FG I  + ++PK+RQALVE+E++  +   V    ++ I+IA  PA +N+STS+ + +   P  +   + N VL+F I + +YPI  DV+  IC   G V R+ I RK  + QA+VEF S+  A R K +LNGADIYSGCCTLKIEYA   R+NV +N +D++D+  P++  + + +    G P  N   ++     RP  P       P  G Y   +D+ Y       RRM P          S  Y  +Y   P    + + +    V M+YGL    +N D +FN+ C+YGNV ++KF+KSK G+AMV+M D  ++DR +  L+N  LF + L   +SKQ  IM   + Y+L DG+ SFKD+   R NRF +P+ A KNR+  PS  ++++NA P    ++  E  ++     P        +     ++SSSGLL+W SV +A+ A+A+ NH  +++    +PY LKL FS +
Sbjct:   33 DDPHKPLPSLVVHVRGLVDGVLEADLVEALQEFGTISYVVLMPKKRQALVEYEDMSGSCNAVTYANDNQIYIAGNPAFVNYSTSQKISRPGDP--DDSRSVNNVLLFTIMNPIYPITTDVLYTICNNCGPVQRIVIFRKNGV-QAMVEFDSVQSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDQDTWDYTNPNLSSQGADADGNGGDPDMNPNPNK-----RPRQPALLGDHPPEYGGYHGYQDDSYGGYE--GRRMAPSMGGPRRGGASQRYGGQYGAPPPPPGEYSAHAESPVMMVYGLEPTKINADRVFNIFCLYGNVERVKFMKSKPGAAMVEMGDCYAVDRAICHLNNHFLFNQKLNVCVSKQQAIMPGQS-YELDDGSNSFKDFHGSRNNRFTSPEQAAKNRIQHPSNVLHFFNAAPEAAGDVFSEICEELGVKSPSNVKNFAAKGGASSERSSSGLLEWESVNDAMEALAMMNHYQMKNPNGPYPYTLKLCFSTA 530          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Cavefish
Match: hnrnpl2 (heterogeneous nuclear ribonucleoprotein L [Source:NCBI gene;Acc:103041983])

HSP 1 Score: 315.849 bits (808), Expect = 3.306e-99
Identity = 187/505 (37.03%), Postives = 279/505 (55.25%), Query Frame = 3
Query:   81 DDWEDIEPSKVIHIRELAEHTLEIDVSRAMEKFGPIRDIAMIPKRRQALVEFENLVSAQEVVKRYRNDFIHIANRPAKINFSTSEHVLKRSGPLNEAVSTANKVLIFFIYDAVYPINVDVINKICKPHGRVVRVFINRKASIMQALVEFYSLDDAIRVKRNLNGADIYSGCCTLKIEYATTNRVNVIQNSEDSYDFEAPSMGMRSSQSLLGLPSNNEMASRVSMMGRPYDPPRREQPFNGSYGNIRDEYYDEIREPNRRMMPLNNS---MDHSLGYDQEYDREP----QRNYNDGPKVAMIYGLNLEFVNCDNLFNLLCIYGNVIKIKFLKSKEGSAMVQMSDGASIDRMMHLLHNQPLFGKTLQFQISKQPVIMDVPAPYKLPDGTVSFKDYTNCRENRFVTPQLAEKNRVFPPSKTINYWNAPPSFGLEMIQEEFKKYNAVEPPEFFQLTNR-----DKSSSGLLQWASVEEAINAIALCNHIMIESEGAKFPYQLKLSFSES 1559
            DD     PS V+H+R L +  LE D+  A+++FG I  + ++PK+RQALVE+E++  +   V    ++ I+IA  PA +N+STS+ + +   P  +   + N VL+F I + +YPI  DV+  IC   G V R+ I RK  + QA+VEF S+  A R K +LNGADIYSGCCTLKIEYA   R+NV +N +D++D+  P++   SSQ                  G   DP        G Y   +D+ Y       RRM P          S  Y  +Y   P    + + +    V M+YGL    +N D +FN+ C+YGNV ++KF+KSK G+AMV+M D  ++DR +  L+N  LF + L   +SKQ  IM   + Y+L DG+ SFKD+   R NRF +P+ A KNR+  PS  ++++NA P    ++  E  ++     P        +     ++SSSGLL+W SV +A+ A+A+ NH  +++    +PY LKL FS +
Sbjct:   33 DDPHKPLPSLVVHVRGLVDGVLEADLVEALQEFGTISYVVLMPKKRQALVEYEDMSGSCNAVTYANDNQIYIAGNPAFVNYSTSQKISRPGDP--DDSRSVNNVLLFTIMNPIYPITTDVLYTICNNCGPVQRIVIFRKNGV-QAMVEFDSVQSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDQDTWDYTNPNL---SSQG-------------ADADGNGGDP--------GGYHGYQDDSYGGYE--GRRMAPSMGGPRRGGASQRYGGQYGAPPPPPGEYSAHAESPVMMVYGLEPTKINADRVFNIFCLYGNVERVKFMKSKPGAAMVEMGDCYAVDRAICHLNNHFLFNQKLNVCVSKQQAIMPGQS-YELDDGSNSFKDFHGSRNNRFTSPEQAAKNRIQHPSNVLHFFNAAPEAAGDVFSEICEELGVKSPSNVKNFAAKGGASSERSSSGLLEWESVNDAMEALAMMNHYQMKNPNGPYPYTLKLCFSTA 507          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Cavefish
Match: hnrnpl2 (heterogeneous nuclear ribonucleoprotein L [Source:NCBI gene;Acc:103041983])

HSP 1 Score: 311.612 bits (797), Expect = 9.427e-98
Identity = 184/505 (36.44%), Postives = 276/505 (54.65%), Query Frame = 3
Query:   81 DDWEDIEPSKVIHIRELAEHTLEIDVSRAMEKFGPIRDIAMIPKRRQALVEFENLVSAQEVVKRYRNDFIHIANRPAKINFSTSEHVLKRSGPLNEAVSTANKVLIFFIYDAVYPINVDVINKICKPHGRVVRVFINRKASIMQALVEFYSLDDAIRVKRNLNGADIYSGCCTLKIEYATTNRVNVIQNSEDSYDFEAPSMGMRSSQSLLGLPSNNEMASRVSMMGRPYDPPRREQPFNGSYGNIRDEYYDEIREPNRRMMPLNNS---MDHSLGYDQEYDREP----QRNYNDGPKVAMIYGLNLEFVNCDNLFNLLCIYGNVIKIKFLKSKEGSAMVQMSDGASIDRMMHLLHNQPLFGKTLQFQISKQPVIMDVPAPYKLPDGTVSFKDYTNCRENRFVTPQLAEKNRVFPPSKTINYWNAPPSFGLEMIQEEFKKYNAVEPPEFFQLTNR-----DKSSSGLLQWASVEEAINAIALCNHIMIESEGAKFPYQLKLSFSES 1559
            DD     PS V+H+R L +  LE D+  A+++FG I  + ++PK+RQALVE+E++  +   V    ++ I+IA  PA +N+STS+ + +   P  +   + N VL+F I + +YPI  DV+  IC   G V R+ I RK  + QA+VEF S+  A R K +LNGADIYSGCCTLKIEYA   R+NV +N +D++D+  P++   SSQ                                G Y   +D+ Y       RRM P          S  Y  +Y   P    + + +    V M+YGL    +N D +FN+ C+YGNV ++KF+KSK G+AMV+M D  ++DR +  L+N  LF + L   +SKQ  IM   + Y+L DG+ SFKD+   R NRF +P+ A KNR+  PS  ++++NA P    ++  E  ++     P        +     ++SSSGLL+W SV +A+ A+A+ NH  +++    +PY LKL FS +
Sbjct:   33 DDPHKPLPSLVVHVRGLVDGVLEADLVEALQEFGTISYVVLMPKKRQALVEYEDMSGSCNAVTYANDNQIYIAGNPAFVNYSTSQKISRPGDP--DDSRSVNNVLLFTIMNPIYPITTDVLYTICNNCGPVQRIVIFRKNGV-QAMVEFDSVQSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDQDTWDYTNPNL---SSQ--------------------------------GGYHGYQDDSYGGYE--GRRMAPSMGGPRRGGASQRYGGQYGAPPPPPGEYSAHAESPVMMVYGLEPTKINADRVFNIFCLYGNVERVKFMKSKPGAAMVEMGDCYAVDRAICHLNNHFLFNQKLNVCVSKQQAIMPGQS-YELDDGSNSFKDFHGSRNNRFTSPEQAAKNRIQHPSNVLHFFNAAPEAAGDVFSEICEELGVKSPSNVKNFAAKGGASSERSSSGLLEWESVNDAMEALAMMNHYQMKNPNGPYPYTLKLCFSTA 496          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Cavefish
Match: hnrnpl (heterogeneous nuclear ribonucleoprotein L [Source:ZFIN;Acc:ZDB-GENE-040426-710])

HSP 1 Score: 310.457 bits (794), Expect = 3.527e-96
Identity = 191/505 (37.82%), Postives = 289/505 (57.23%), Query Frame = 3
Query:   81 DDWEDIEPSKVIHIRELAEHTLEIDVSRAMEKFGPIRDIAMIPKRRQALVEFENLVSAQEVVKRYRNDFIHIANRPAKINFSTSEHVLKRSGPLNEAVSTANKVLIFFIYDAVYPINVDVINKICKPHGRVVRVFINRKASIMQALVEFYSLDDAIRVKRNLNGADIYSGCCTLKIEYATTNRVNVIQNSEDSYDFEAPSMGMRSSQSLLGLPSNNEMASRVSMMGRPYDPPRREQPFNGSYGNIRDEYYDEIREP------NRRMMP-LNNSMDHSLGYDQEYDREPQRNYN---DGPKVAMIYGLNLEFVNCDNLFNLLCIYGNVIKIKFLKSKEGSAMVQMSDGASIDRMMHLLHNQPLFGKTLQFQISKQPVIMDVPAPYKLPDGTVSFKDYTNCRENRFVTPQLAEKNRVFPPSKTINYWNAPPSFGLEMIQEEFKKYNAVEPPEFFQL--TNRDKSSSGLLQWASVEEAINAIALCNHIMIESEGAKFPYQLKLSFSES 1559
            DD     PS V+HIR L +   E D+  A+ +FG I  + ++P +RQALVE+E++  +   V    ++ ++IA RP  IN+STS+ +  R G   +A S  N +L+F I + +YPI  DV+  IC   G V R+ I RK  + QA+VE Y L  A R K +LNGADIYSGCCTLKIEYA   R+NV +N +D++D+  P++   S Q     P  N+   + +++G    PP    P +G YG     +YD+   P       RRM P L            +Y   P   Y    D P V M+YGL+   +N D +FN+ C+YGNV ++KF+KSK G+AMV+M D  +++R +  L++  LF + L   +SKQ  I+   + Y+L DG+ SFKD+   R NRF +P+ A KNR+  PS  ++++N  P    E+  +   +  A++PP   +L     ++S+SGLL+W SV +A+ A+++ NH  +++    +PY LKL FS +
Sbjct:  108 DDPHKTLPSLVVHIRGLIDGITESDLVEALREFGTISYVVLMPNKRQALVEYEDMSGSCNAVTYANDNQVYIAGRPCYINYSTSQKI-SRPGDSGDAPSV-NNILLFTIMNPIYPITTDVLYTICNNCGPVQRIVIFRKNGV-QAMVE-YPLQSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDQDTWDYTNPTL---SGQDPNANP--NKRQRQPALLGD--HPPEYGGPQSG-YG-----HYDDTYGPPPPHYEGRRMGPPLARGRGGPRYGAPQYGHGPPPEYASQADSP-VIMVYGLDPYKINADRIFNVFCLYGNVERVKFMKSKPGAAMVEMGDCYAVERAISHLNHTMLFNQKLNICVSKQQAIIPGQS-YQLEDGSCSFKDFHGSRNNRFTSPEQAAKNRIQRPSNVLHFFNGQPDSSTEIFSQISDEL-AIKPPTNVKLFTGKSERSASGLLEWESVNDAMEALSMMNHYQMKNPSGPYPYTLKLCFSTA 592          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Sea Lamprey
Match: HNRNPLL (heterogeneous nuclear ribonucleoprotein L like [Source:HGNC Symbol;Acc:HGNC:25127])

HSP 1 Score: 283.878 bits (725), Expect = 1.116e-88
Identity = 172/468 (36.75%), Postives = 251/468 (53.63%), Query Frame = 3
Query:   81 DDWEDIEPSKVIHIRELAEHTLEIDVSRAMEKFGPIRDIAMIPKRRQALVEFENLVSAQEVVKRYRNDFIHIANRPAKINFSTSEHVLKRSGPLNEAVSTANKVLIFFIYDAVYPINVDVINKICKPHGRVVRVFINRKASIMQALVEFYSLDDAIRVKRNLNGADIYSGCCTLKIEYATTN---RVNVIQNSEDSYDF--EAPSM--GMRSSQ-SLLG----------------LPSNNEMASRVSMMGRPYDPPRREQPFNGSYGNIRDEYYDEIREPNRRMMPLNNSMDHSLGYDQEYDREPQRNYNDGPKVAMIYGLNLEFVNCDNLFNLLCIYGNVIKIKFLKSKEGSAMVQMSDGASIDRMMHLLHNQPLFGKTLQFQISKQPVIMDVPAPYKLPDGTVSFKDYTNCRENRFVTPQLAEKNRVFPPSKTINYWNAPPSFGLEMIQEEFKKYNAVEPPEFFQL 1412
            +D +   PS V+HIR LA    E  V  A+++FG +R + M+P RRQALVEFE L  A+  V     D +++  +PA  NFSTS+ + ++ G   + V+  N +L+  + +A+YPI  +VI+ IC P+G V R+ I +K  + QAL  F S+  A + K +LNGADIYSGCCTLKIEYA      R+NV +N  +++D+  E P +  G +  Q +LLG                 P N    +  S  G P+   R   P +G               P+    P+  S  +                    +V M+Y +N   +NC  LFNL+C+YGNV KIKFLKSK G  M+QM+D AS+DR +  L+   LFG+ L   +SKQ  I+   A ++L DG+ SF+D+   R NRF T + A KNR+ PPS  +++++APP F  E    +  +   V+ P  F+L
Sbjct:    3 EDPKKPAPSPVVHIRGLASSADESQVMEALQEFGTVRHVVMMPHRRQALVEFERLEDARACVAGTAGDPVYVGGQPAYCNFSTSQRISRKGGTPADDVARTNHILLLTVNNALYPITTEVIHTICSPYGVVQRIVIFKKNGV-QALRTFDSIPSAQQAKSSLNGADIYSGCCTLKIEYAKERKPARLNVYRNDSETWDYTLEGPCVPNGQQKKQPALLGDHPSTMRGYGNQQGTYCPQNYSFNNYTS--GSPFGNARPTTPMSG----------PGTCAPHNNPCPMGGSAAN--------------------RVMMVYNMNPSVMNCSRLFNLVCLYGNVEKIKFLKSKPGVGMIQMADAASVDRAVANLNTAQLFGQKLSLSVSKQQEIVAGQA-FELEDGSDSFRDFVGSRHNRFSTHEQASKNRILPPSAILHFYSAPPEFS-EQAFIQICEETGVKKPNAFKL 435          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Sea Lamprey
Match: HNRNPLL (heterogeneous nuclear ribonucleoprotein L like [Source:HGNC Symbol;Acc:HGNC:25127])

HSP 1 Score: 171.4 bits (433), Expect = 3.282e-46
Identity = 85/207 (41.06%), Postives = 130/207 (62.80%), Query Frame = 3
Query:  942 GPKVAMIYGLNLEFVNCDNLFNLLCIYGNVIKIKFLKSKEGSAMVQMSDGASIDRMMHLLHNQPLFGKTLQFQISKQPVIMDVPAPYKLPDGTVSFKDYTNCRENRFVTPQLAEKNRVFPPSKTINYWNAPPSFGLEMIQEEFKKYNAVEPPEFFQLTNR-DKSSSGLLQWASVEEAINAIALCNHIMIESEGAKFPYQLKLSFSES 1559
            G KV M+YG + E +NCD +FN+LC++GNV K+KFLKSK G+AMV+M D  ++DR +  L+   +FGK +   +SKQ  I+   A Y+LPDGT S+KD+T  R NRF   + A KNR+  P+  ++++NAP     E+  +   + +   P  F   + + DKS SGL++W +  +A+ A+A  NH  +++    +PY LKL FS +
Sbjct:  313 GNKVLMVYGFDAERINCDRVFNILCLFGNVEKVKFLKSKPGAAMVEMGDPYAVDRAVSHLNMSQIFGKKINLCVSKQQSIVPGQA-YELPDGTNSYKDFTGSRNNRFANAEKAAKNRIQQPTTVLHFFNAPMDITAEIFMQLCDEMSIARPLSFKAFSGKSDKSMSGLMEWENKNDAMEALACINHHSLKNANGPYPYTLKLCFSTA 518          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006507.1 (pep scaffold:Pmarinus_7.0:GL480554:3468:10153:1 gene:ENSPMAG00000005883.1 transcript:ENSPMAT00000006507.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 98.2117 bits (243), Expect = 4.736e-23
Identity = 65/233 (27.90%), Postives = 115/233 (49.36%), Query Frame = 3
Query:   66 KRAKPDDWEDIEPSKVIHIRELAEHTLEIDVSRAMEKFGPIRDIAMIPKRRQALVEFENLVSAQEVVKRYRNDFIHIANRPAKINFSTSEHV-------------LKRSGPLNEAVSTANK--------------VLIFFIYDAVYPINVDVINKICKPHGRVVRVFINRKASIMQALVEFYSLDDAIRVKRNLNGADIYSGCCTLKIEYATTNRVNVIQNSEDSYDFEAPSM 683
            K+ K D  +++ PSKV+HIR+L E+  E +V      FG + +I M+  + QA +E  +  +A   V  Y  D   + N+P  + +ST + +              +R      A+  AN               +L   + + +YPI ++V++ +   +G V+++ I  K S  QAL++F    +A + K  L+G +IY+GCCTL++ ++    +NV  N+E S D   P +
Sbjct:   14 KKFKGDSSDEL-PSKVLHIRKLPENATEAEVVTLALPFGRVTNILMLKGKSQAFLEMASEEAAVAAVTFYSTDPPVLRNQPVYVQYSTYKSLKTDNSAYQAARSHARREQKAQAAMMVANGSDSEETNSAAPQSPILHIIVENLLYPITLEVLHHVFSKYGTVLKIIIFNKNSQYQALMQFADASNAHQAKTMLDGQNIYNGCCTLRVGFSRLTNLNVKYNNEKSRDLTRPDL 245          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008247.1 (pep scaffold:Pmarinus_7.0:GL480157:26501:33582:-1 gene:ENSPMAG00000007456.1 transcript:ENSPMAT00000008247.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 83.1889 bits (204), Expect = 1.731e-19
Identity = 40/94 (42.55%), Postives = 61/94 (64.89%), Query Frame = 3
Query:   51 DNFNRKRAKPDDWEDIEPSKVIHIRELAEHTLEIDVSRAMEKFGPIRDIAMIPKRRQALVEFENLVSAQEVVKRYRNDFIHIANRPAKINFSTS 332
            D+ +  R   +D     PS V+H+R LAEH +E D+  A++ FGPI  + ++PK+RQALVEFE+L SA+  V     + I+++ +PA  N+STS
Sbjct:   19 DDGHNGRESYEDPLKPSPSPVVHVRGLAEHAVETDLVEALQHFGPIGYVVIMPKKRQALVEFEDLESARSCVTFTVGNPIYVSGQPAYFNYSTS 112          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008211.1 (pep scaffold:Pmarinus_7.0:GL488597:1016:4303:-1 gene:ENSPMAG00000007427.1 transcript:ENSPMAT00000008211.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 83.1889 bits (204), Expect = 1.731e-19
Identity = 40/94 (42.55%), Postives = 61/94 (64.89%), Query Frame = 3
Query:   51 DNFNRKRAKPDDWEDIEPSKVIHIRELAEHTLEIDVSRAMEKFGPIRDIAMIPKRRQALVEFENLVSAQEVVKRYRNDFIHIANRPAKINFSTS 332
            D+ +  R   +D     PS V+H+R LAEH +E D+  A++ FGPI  + ++PK+RQALVEFE+L SA+  V     + I+++ +PA  N+STS
Sbjct:   19 DDGHNGRESYEDPLKPSPSPVVHVRGLAEHAVETDLVEALQHFGPIGYVVIMPKKRQALVEFEDLESARSCVTFTVGNPIYVSGQPAYFNYSTS 112          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Nematostella
Match: EDO39119 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAW4])

HSP 1 Score: 274.248 bits (700), Expect = 7.487e-84
Identity = 172/503 (34.19%), Postives = 268/503 (53.28%), Query Frame = 3
Query:   99 EPSKVIHIRELAEHTLEIDVSRAMEKFGPIRDIAMIPKRRQALVEFENLVSAQEVVKRYR-NDFIHIANRPAKINFSTSEHVLKRSGPLNEAVSTANKVLIFFIYDAVYPINVDVINKICKPHGRVVRVFINRKASIMQALVE---FYSLDDAIRVKRNLNGADIYSGCCTLKIE-YATTNRVNVIQNSEDSYDF---EAPSMGMRSSQSLLGLPSNNEMASRVSMMGRPYDPPRREQPFNGSYGNIRDEYYDEIREPNRRMMPLNNSMDHSLGYDQEYDREPQ----RNYNDGPKVAMIYGLNLEFVNCDNLFNLLCIYGNVIKIKFLKSKEGSAMVQMSDGASIDRMMHLLHNQPLFGKTLQFQISKQPVIMDVPAPYKLPDGTVSFKDYTNCRENRFVTPQLAEKNRVFPPSKTINYWNAPPSFGLEMIQEEFKKYNAVEPP---EFFQLTNRDKSSSGLLQWASVEEAINAIALCNHIMIESEGAKFPYQLKLSFSESP 1562
            EPS+V+H+R +A+   E D+ + + ++G I  I M+PK RQALVEFE +  A  +V + +  + + +  RPA  N+S S+ + +     +E  +  NK+L+  I +  Y +  D+++ I    G V R+ I RK+  +QA+VE   F  ++ A   K  LNGADIY+GC TLKIE      ++NV +N  ++YD+   + P M                       +G P  PP++        G +          P       N      +GY  +  + PQ    RN+  G  V M+YGL+ + +NCD LFNLLC YGNVIKIKFL  K G+AM ++ +  + + +M  L    LF + L+F  SKQ  +++      LPDG+ SFK + N + NRF +   + KNRVF P K ++++NAP     E I+ E  +   V PP   + F  +   ++SSGL++W SV +A+ A+ +CNH +I +  AK  + +KL+FS +P
Sbjct:   45 EPSRVVHVRGVADEAREQDLMQCLSQYGNISCITMMPKIRQALVEFEEIACANTLVNQTQMGNPVILCGRPAYANYSKSKQISRNVHVRSE--TQPNKILLITIINPQYVVTTDILHTIFSKQGMVQRIVIFRKSG-LQAMVEESRFDCVEAARHAKETLNGADIYTGCNTLKIESQGYAQQLNVRKNDSETYDYTQDKGPGM-----------------------LGHP--PPKQ--------GLLSPPPPAYGGGPPAYGGAPNYGGAPPMGYGAQPMQAPQMQTYRNHPSGGNVIMVYGLDKDKMNCDRLFNLLCCYGNVIKIKFLLGKPGTAMAELHEHVACNTVMENLSKMTLFDQQLEFSFSKQDYLVEPANVPNLPDGSPSFKSFDNSKNNRFTSATASSKNRVFTPMKVLHFFNAPVDCTEEQIR-EMCQVCGVAPPKTIKMFSPSGNARTSSGLIEWESVTQALEALVMCNHYVIRNSTAKTIFTVKLAFSSTP 510          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Nematostella
Match: EDO35537 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLA1])

HSP 1 Score: 134.42 bits (337), Expect = 4.191e-36
Identity = 77/200 (38.50%), Postives = 123/200 (61.50%), Query Frame = 3
Query:  102 PSKVIHIRELAEHTLEIDVSRAMEKFGPIRDIAMIPKRRQALVEFENLVSAQEVVKRYRNDFIHIANRPAKINFSTSEHVLKR----SGPLNEAVSTANKVLIFFIYDAVYPINVDVINKICKPHGRVVRVFINRKASIMQALVEFYSLDDAIRVKRNLNGADIYSGCCTLKIEYA-TTNRVNVIQNSEDSYDFEAPSMG 686
            PS+VIH R +A+   E D+ + ++ FG I  + ++PK RQALVEFE+L SA  VV   +   + +  R   +N+S S+ + KR    +G  N A + A+ +L+  I + ++PINV +++KIC P G+V+R+ I  K   +QAL    S + A+ V   LNG DIY+GCCTLKI+Y+    ++NV +N ++++D+     G
Sbjct:    5 PSRVIHCRAVADGCKETDLIQVLQPFGTITYVTLLPKIRQALVEFESLESAIAVVTYSQTSPLTVLGRQMFVNYSKSQEI-KRDKVLNGDSNGACAEASNILLLTIINPLHPINVKILHKICSPSGKVLRIVIFHKNG-LQAL----SAERALAV---LNGQDIYAGCCTLKIDYSKKAKKLNVFKNDDETWDYTGALNG 195          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Nematostella
Match: EDO35536 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLA0])

HSP 1 Score: 130.568 bits (327), Expect = 1.004e-34
Identity = 72/198 (36.36%), Postives = 112/198 (56.57%), Query Frame = 3
Query:  957 MIYGLNLEFVNCDNLFNLLCIYGNVIKIKFLKSKEGSAMVQMSDGASIDRMMHLLHNQPLFGKTLQFQISKQPVIMDVPAPYKLPDGTVSFKDYTNCRENRFVTPQLAEKNRVF---PPSKTINYWNAPPSFGLEMIQEEFKKYNAVEPPE--FFQLTNRDKSSSGLLQWASVEEAINAIALCNHIMIESEGAKFPYQ 1535
            M+YGLN E +NC+ +FNL C+YGNVIK+KFL +K G+ MVQMSD  + + ++  L    +F   +    SK P I D      LPD + S  ++ + R NRF    +   + V    PP++ ++++NAPP+  ++ +++   K  A+ P +  FF   N  KSS+GLL+   +  A+ A+ L NH  I   G  +P Q
Sbjct:    3 MVYGLNHEKMNCERIFNLFCLYGNVIKVKFLTNKPGACMVQMSDKIASEMIIRNLSGATIFDNKINIMFSKHPFIADSSVVTALPDSSPSAMNFADNRNNRFKYDNMPFLDSVVGYQPPTRMLHFFNAPPNCTVDQLRDVSTKAGALAPLKGTFFSKANT-KSSAGLLEMPDIRSAMEALILTNHYTINPPGNLYPNQ 199          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Nematostella
Match: EDO43995 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXA3])

HSP 1 Score: 137.502 bits (345), Expect = 1.173e-34
Identity = 128/512 (25.00%), Postives = 227/512 (44.34%), Query Frame = 3
Query:  105 SKVIHIRELAEHTLEIDVSRAMEKFGPIRDIAMIPKRRQALVEFENLVSAQEVVKRYRNDFIHIANRPAKINFS-------------------TSEHVLKRSGPLNEAVSTANK-------VLIFFIYDAVYPINVDVINKICKPHGRVVRVFINRKASIMQALVEFYSLDDAIRVKRNLNGADIYSGCCTLKIEYATTNRVNVIQNSEDSYDFEAPSMGMRSSQSLLGLPSNNEMASRVSMMGRPYDPPRREQPFNGSYGNIRDEYYDEIREPNRRMMPLNNSMDHSLGYDQEYDREPQRNYNDGPKVAMIYGLNLEFVNCDNLFNLLCIYGNVIKIKFLKSKEGSAMVQMSDGASIDRMMHLLHNQPLFGKTLQFQISKQPVIMDVPAPYKLPDGTVSFKDYTNCRENRFVTPQLAEKNRVFPPSKTINYWNAPPSFGLEMIQEEFKKYNAVEPPEFFQLTNRDKSSSGLLQWASVEEAINA-IALCNHIMIESEGAKFPYQLKLSFSES 1559
            SKV+H+R +A    + ++      +G + ++ M+  + QA +E +   +A  ++  Y      I  R   I +S                   +S H+    G L   +  A +       +L   + + +YPI ++V+N+I   +G V+++ I  + +  QALV+F    +A   K +L+G +IY+GCCTL+I+Y+    ++V  N++ + D+  P            LPS  E     S +G           F G   ++       +  P   +                 +  PQR     P V ++  LN E ++CD LF L   YG+V ++K L +K+ +A+VQ ++       +  L+   +FGK ++   SK      V  P +  D  ++ KDY N   +RF  P       +FPPS+T++  N P S   E +   F+    V     F+   +D+  +  L  A+ EEAI+A I + N+ + E+      + L++SF+ S
Sbjct:    2 SKVLHLRNVAAEATDAEIIALGIPYGRVTNVLMLKGKNQAFLEMKTKENAMALMNSYSYIPPSIRGRQIYIQYSNHQELTTNESQHSPGVRGLSSSHLGAGIGSLTSGLGIAGELPSVNGCILRIIVENMLYPITIEVLNQIFTKYGTVLKIVIFTRNNQFQALVQFSQSTEARAAKCSLDGQNIYNGCCTLRIDYSKLKTLSVKYNNDKTRDYTRPD-----------LPS-GESTPDPSALG-----------FAGLGTSV-------LGSPAALLGFPGLGGLPLANLASLANAAPQRMPMGSPLV-LVSNLNEEMISCDALFTLFGCYGDVQRVKILFNKKDTALVQFANVHQAQTAIGHLNGVRVFGKEMKVTNSKH---TSVSLPKEGEDTNLT-KDYMNSPLHRFKKPGSKNFQNIFPPSRTLHLSNIPESVTEEELTSMFEDCGDVAD---FRFLPKDRKMAH-LSMATTEEAIDALIKMHNYKISET------HHLRVSFARS 468          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Nematostella
Match: EDO26232 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TCJ0])

HSP 1 Score: 46.595 bits (109), Expect = 3.395e-6
Identity = 42/143 (29.37%), Postives = 69/143 (48.25%), Query Frame = 3
Query: 1134 LFGKTLQFQISKQPVIMDVPAPYKLPDGTVSFKDYTNCRENRFVTPQLAEKNRVFPPSKTINYWNAPPSFGLEMIQEEFKKYNAVEPPEFFQLTNRDKSSSGLLQWASVEEAINA-IALCNHIMIESEGAKFPYQLKLSFSES 1559
            +FGK ++   SK      V  P +  D  ++ KDY N   +RF  P       +FPPS+T++  N P S   E +   F+    V     F+   +D+  +  L  A+ EEAI+A I + N+ + E+      + L++SF+ S
Sbjct:   10 VFGKEMKVTNSKH---TSVSLPKEGEDTNLT-KDYMNSPLHRFKKPGSKNFQNIFPPSRTLHLSNIPESVTEEELTSMFEDCGDVAD---FRFLPKDRKMAH-LSMATTEEAIDALIKMHNYKISET------HHLRVSFARS 138          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Medaka
Match: ENSORLT00000000593.2 (heterogeneous nuclear ribonucleoprotein L [Source:NCBI gene;Acc:101166731])

HSP 1 Score: 318.161 bits (814), Expect = 3.994e-100
Identity = 198/501 (39.52%), Postives = 288/501 (57.49%), Query Frame = 3
Query:   81 DDWEDIEPSKVIHIRELAEHTLEIDVSRAMEKFGPIRDIAMIPKRRQALVEFENLVSAQEVVKRYRNDFIHIANRPAKINFSTSEHVLKRSGPLNEAVSTANKVLIFFIYDAVYPINVDVINKICKPHGRVVRVFINRKASIMQALVEFYSLDDAIRVKRNLNGADIYSGCCTLKIEYATTNRVNVIQNSEDSYDFEAPSMGMRSSQSLLGLPSNNEMASRVSMMGRPYDPPRREQPFNGSYGNIRDEYYDEIREPNRRMMPLNNSMDHSLGYDQEYDREPQRN------YNDGPKVAMIYGLNLEFVNCDNLFNLLCIYGNVIKIKFLKSKEGSAMVQMSDGASIDRMMHLLHNQPLFGKTLQFQISKQPVIMDVPA-PYKLPDGTVSFKDYTNCRENRFVTPQLAEKNRVFPPSKTINYWNAPPSFGLEMIQEEFKKYNAVEPPEFFQLTNR-DKSSSGLLQWASVEEAINAIALCNHIMIESEGAKFPYQLKLSFSES 1559
            DD     PS V+HIR L +  +E D+  A+++FG I  + M+PK+RQALVE+E++ ++   V     + ++IA  PA IN+STS+ +  R G  ++  S  N VL+  I + +YPI  DV+  IC   G V R+ I RK  + QA+VEF S+  A R K +LNGADIYSGCCTLKIEYA   R+NV +N +D++D+  P++   SSQ     P  N+   + +++G    PP    P  GSY    D+ Y     P+R    LN+SM       Q Y             + D P V M+YGL    +N D +FN+ C+YGNV ++KF+KSK G+AMV+M D  S+DR +  L+N  LFG+ L   +SKQ  I  VP   Y+L D T SFKD+   R NRF +P+ A KNR+  PS  ++++NA P    E   +  ++     P      T + ++SSSGLL+W S+ +A+ A+A+ NH  +++    +PY LKL FS +
Sbjct:   32 DDPHKPLPSPVVHIRGLVDGVMEADLVDALQEFGAISYVVMMPKKRQALVEYEDVNASCNAVTFAAENQVYIAGHPAFINYSTSQKI-SRPGDSDDTRSV-NNVLLLTILNPIYPITTDVLYTICNNCGPVQRIVIFRKNGV-QAMVEFDSVQSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDQDTWDYTNPNL---SSQDPNANP--NKRQRQPALLGD--HPPDYGGP-QGSYHAYNDDAYGP-PPPHR----LNSSMGGRGRGGQRYGAGYGPPPPDYGPHADSP-VLMVYGLEPSKINADKVFNIFCLYGNVERVKFMKSKPGAAMVEMGDCYSVDRAITHLNNNFLFGQKLNVCVSKQQAI--VPGQSYQLEDNTSSFKDFHGSRNNRFTSPEQAAKNRIQHPSNVLHFFNAQPDISEETFSQICEELGIKSPASVKLFTGKSERSSSGLLEWESINDAMEALAMINHYQMKNPSGPYPYTLKLCFSTT 513          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Medaka
Match: ENSORLT00000000591.2 (heterogeneous nuclear ribonucleoprotein L [Source:NCBI gene;Acc:101166731])

HSP 1 Score: 313.923 bits (803), Expect = 3.021e-98
Identity = 198/511 (38.75%), Postives = 289/511 (56.56%), Query Frame = 3
Query:   81 DDWEDIEPSKVIHIRELAEHTLEIDVSRAMEKFGPIRDIAMIPKRRQALVEFENLVSAQEVVKRYRNDFIHIANRPAKINFSTSEHVLKRSGPLNEAVSTANKVLIFFIYDAVYPINVDVINKICKPHGRVVRVFINRKASIMQALVEFYSLDDAIRVKRNLNGADIYSGCCTLKIEYATTNRVNVIQNSEDSYDFEAPSMGMRSSQSLLGL----------PSNNEMASRVSMMGRPYDPPRREQPFNGSYGNIRDEYYDEIREPNRRMMPLNNSMDHSLGYDQEYDREPQRN------YNDGPKVAMIYGLNLEFVNCDNLFNLLCIYGNVIKIKFLKSKEGSAMVQMSDGASIDRMMHLLHNQPLFGKTLQFQISKQPVIMDVPA-PYKLPDGTVSFKDYTNCRENRFVTPQLAEKNRVFPPSKTINYWNAPPSFGLEMIQEEFKKYNAVEPPEFFQLTNR-DKSSSGLLQWASVEEAINAIALCNHIMIESEGAKFPYQLKLSFSES 1559
            DD     PS V+HIR L +  +E D+  A+++FG I  + M+PK+RQALVE+E++ ++   V     + ++IA  PA IN+STS+ +  R G  ++  S  N VL+  I + +YPI  DV+  IC   G V R+ I RK  + QA+VEF S+  A R K +LNGADIYSGCCTLKIEYA   R+NV +N +D++D+  P++   SSQ   G            + N+   + +++G    PP    P  GSY    D+ Y     P+R    LN+SM       Q Y             + D P V M+YGL    +N D +FN+ C+YGNV ++KF+KSK G+AMV+M D  S+DR +  L+N  LFG+ L   +SKQ  I  VP   Y+L D T SFKD+   R NRF +P+ A KNR+  PS  ++++NA P    E   +  ++     P      T + ++SSSGLL+W S+ +A+ A+A+ NH  +++    +PY LKL FS +
Sbjct:   32 DDPHKPLPSPVVHIRGLVDGVMEADLVDALQEFGAISYVVMMPKKRQALVEYEDVNASCNAVTFAAENQVYIAGHPAFINYSTSQKI-SRPGDSDDTRSV-NNVLLLTILNPIYPITTDVLYTICNNCGPVQRIVIFRKNGV-QAMVEFDSVQSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDQDTWDYTNPNL---SSQDADGEGNWNNSQDPNANPNKRQRQPALLGD--HPPDYGGP-QGSYHAYNDDAYGP-PPPHR----LNSSMGGRGRGGQRYGAGYGPPPPDYGPHADSP-VLMVYGLEPSKINADKVFNIFCLYGNVERVKFMKSKPGAAMVEMGDCYSVDRAITHLNNNFLFGQKLNVCVSKQQAI--VPGQSYQLEDNTSSFKDFHGSRNNRFTSPEQAAKNRIQHPSNVLHFFNAQPDISEETFSQICEELGIKSPASVKLFTGKSERSSSGLLEWESINDAMEALAMINHYQMKNPSGPYPYTLKLCFSTT 525          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Medaka
Match: hnrnpl (heterogeneous nuclear ribonucleoprotein L [Source:NCBI gene;Acc:101175582])

HSP 1 Score: 310.842 bits (795), Expect = 5.441e-97
Identity = 196/535 (36.64%), Postives = 288/535 (53.83%), Query Frame = 3
Query:   45 NMDNFNRKRAKPDD----WEDIE---PSKVIHIRELAEHTLEIDVSRAMEKFGPIRDIAMIPKRRQALVEFENLVSAQEVVKRYRNDFIHIANRPAKINFSTSEHVLKRSGPLNEAVSTANKVLIFFIYDAVYPINVDVINKICKPHGRVVRVFINRKASIMQALVEFYSLDDAIRVKRNLNGADIYSGCCTLKIEYATTNRVNVIQNSEDSYDFEAPSMGMRSSQSLLGLPSNNEMASRVSMMGRPYDPPRR-----EQP--FNGSYGNIRDEYYDEIREPNRRMMPL----NNSMDHSLGYDQEYDREPQRNYNDGPKVAMIYGLNLEFVNCDNLFNLLCIYGNVIKIKFLKSKEGSAMVQMSDGASIDRMMHLLHNQPLFGKTLQFQISKQPVIMDVPA-PYKLPDGTVSFKDYTNCRENRFVTPQLAEKNRVFPPSKTINYWNAPPSFGLEMIQEEFKKYNAVEPPEFFQLTNR------DKSSSGLLQWASVEEAINAIALCNHIMIES-------EGAKFPYQLKLSFS 1553
            N D    KR K D     +ED     PS V+H+R L +   E D+  A+++FG I  + ++P +RQALVE+E++  +   V    ++ ++IA  PA IN+STS+ +  R G  +++ S  N VL+F I + +YPI  DV+  IC   G V R+ I RK  + QA+VEF S+  A R K +LNGADIYSGCCTLKIEYA   R+NV +N +D++D+  P++G           ++   +S   M   P   PR+     + P  + G Y    DE Y       RRM P                          + D P V M+YGL+   +N D +FN+ C+YGNV ++KF+KSK G+ MV+M D  ++DR +  L+N  LFG+ L   +SKQ  I  VP   Y+L DG+ SFKD+   R NRF +P+ A KNR+  PS  ++++NA P    E+  E  ++     P      T +      D+S+SGLL+W S+ +A+ A+AL NH  +++           +PY LKL FS
Sbjct:   10 NEDGRATKRQKTDGMATGYEDPHKTLPSVVVHVRGLVDGVTEADLVEALQEFGAISYVVVMPNKRQALVEYEDMNGSSTAVTYAADNQVYIAGHPAFINYSTSKKI-SRPGDSDDSRSV-NNVLLFTIMNPIYPITTDVLYTICNNCGPVQRIVIFRKNGV-QAMVEFDSVQSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDQDTWDYTNPNLGGPDGD------ADGNGSSAEDMNANPNKRPRQPALLGDHPPEYGGGYHGY-DENYGSPPYEGRRMGPTMRGRGGRSYGPNYGPPPPPPGEYGAHADSP-VVMVYGLDPVKMNADRVFNIFCLYGNVERVKFMKSKPGACMVEMGDCYAVDRAITHLNNNFLFGQKLNVCVSKQQAI--VPGQSYELEDGSSSFKDFHGSRNNRFTSPEQAAKNRIQHPSNVLHFFNAQPDVTTEIFSEICEEIGVKSPVNVKMFTGKSGAAPSDRSASGLLEWESINDAMEALALMNHYQMKNPESVVCVPAGPYPYTLKLCFS 531          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Medaka
Match: hnrnpl (heterogeneous nuclear ribonucleoprotein L [Source:NCBI gene;Acc:101175582])

HSP 1 Score: 308.916 bits (790), Expect = 1.739e-96
Identity = 194/528 (36.74%), Postives = 289/528 (54.73%), Query Frame = 3
Query:   45 NMDNFNRKRAKPDD----WED---IEPSKVIHIRELAEHTLEIDVSRAMEKFGPIRDIAMIPKRRQALVEFENLVSAQEVVKRYRNDFIHIANRPAKINFSTSEHVLKRSGPLNEAVSTANKVLIFFIYDAVYPINVDVINKICKPHGRVVRVFINRKASIMQALVEFYSLDDAIRVKRNLNGADIYSGCCTLKIEYATTNRVNVIQNSEDSYDFEAPSMGMRSSQSLLGLPSNNEMASRVSMMGRPYDPPRREQPFNGSYGNIRDEYYDEIREPNRRMMPL----NNSMDHSLGYDQEYDREPQRNYNDGPKVAMIYGLNLEFVNCDNLFNLLCIYGNVIKIKFLKSKEGSAMVQMSDGASIDRMMHLLHNQPLFGKTLQFQISKQPVIMDVPA-PYKLPDGTVSFKDYTNCRENRFVTPQLAEKNRVFPPSKTINYWNAPPSFGLEMIQEEFKKYNAVEPPEFFQLTNR------DKSSSGLLQWASVEEAINAIALCNHIMIES-------EGAKFPYQLKLSFS 1553
            N D    KR K D     +ED     PS V+H+R L +   E D+  A+++FG I  + ++P +RQALVE+E++  +   V    ++ ++IA  PA IN+STS+ +  R G  +++ S  N VL+F I + +YPI  DV+  IC   G V R+ I RK  + QA+VEF S+  A R K +LNGADIYSGCCTLKIEYA   R+NV +N +D++D+  P++G    + +   P  N+   + +++G    PP     ++G      DE Y       RRM P                          + D P V M+YGL+   +N D +FN+ C+YGNV ++KF+KSK G+ MV+M D  ++DR +  L+N  LFG+ L   +SKQ  I  VP   Y+L DG+ SFKD+   R NRF +P+ A KNR+  PS  ++++NA P    E+  E  ++     P      T +      D+S+SGLL+W S+ +A+ A+AL NH  +++           +PY LKL FS
Sbjct:   10 NEDGRATKRQKTDGMATGYEDPHKTLPSVVVHVRGLVDGVTEADLVEALQEFGAISYVVVMPNKRQALVEYEDMNGSSTAVTYAADNQVYIAGHPAFINYSTSKKI-SRPGDSDDSRSV-NNVLLFTIMNPIYPITTDVLYTICNNCGPVQRIVIFRKNGV-QAMVEFDSVQSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDQDTWDYTNPNLG--GPEDMNANP--NKRPRQPALLGD--HPPEYGGGYHG-----YDENYGSPPYEGRRMGPTMRGRGGRSYGPNYGPPPPPPGEYGAHADSP-VVMVYGLDPVKMNADRVFNIFCLYGNVERVKFMKSKPGACMVEMGDCYAVDRAITHLNNNFLFGQKLNVCVSKQQAI--VPGQSYELEDGSSSFKDFHGSRNNRFTSPEQAAKNRIQHPSNVLHFFNAQPDVTTEIFSEICEEIGVKSPVNVKMFTGKSGAAPSDRSASGLLEWESINDAMEALALMNHYQMKNPESVVCVPAGPYPYTLKLCFS 520          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Medaka
Match: hnrnpl (heterogeneous nuclear ribonucleoprotein L [Source:NCBI gene;Acc:101175582])

HSP 1 Score: 298.13 bits (762), Expect = 1.288e-92
Identity = 188/523 (35.95%), Postives = 277/523 (52.96%), Query Frame = 3
Query:   45 NMDNFNRKRAKPDD----WED---IEPSKVIHIRELAEHTLEIDVSRAMEKFGPIRDIAMIPKRRQALVEFENLVSAQEVVKRYRNDFIHIANRPAKINFSTSEHVLKRSGPLNEAVSTANKVLIFFIYDAVYPINVDVINKICKPHGRVVRVFINRKASIMQALVEF-----YSLDD-AIRVKRNLNGADIYSGCCTLKIEYATTNRVNVIQNSEDSYDFEAPSMGMRSSQSLLGLPSNNEMASRVSMMGRPYDPPRREQPFNGSYGNIRDEYYDEIREPNRRMMPL----NNSMDHSLGYDQEYDREPQRNYNDGPKVAMIYGLNLEFVNCDNLFNLLCIYGNVIKIKFLKSKEGSAMVQMSDGASIDRMMHLLHNQPLFGKTLQFQISKQPVIMDVPA-PYKLPDGTVSFKDYTNCRENRFVTPQLAEKNRVFPPSKTINYWNAPPSFGLEMIQEEFKKYNAVEPPEFFQLTNR--DKSSSGLLQWASVEEAINAIALCNHIMIESEGAKFPYQLKLSFS 1553
            N D    KR K D     +ED     PS V+H+R L +   E D+  A+++FG I  + ++P +RQALVE+E++  +   V    ++ ++IA  PA IN+STS+ +  R G  +++ S  N VL+F I + +YPI  DV+  IC   G V R+ I RK  + QA+VE+     + L+  A R K +LNGADIYSGCCTLKIEYA   R+NV +N +D++D+  P++G                          YD      P+ G                 RRM P                          + D P V M+YGL+   +N D +FN+ C+YGNV ++KF+KSK G+ MV+M D  ++DR +  L+N  LFG+ L   +SKQ  I  VP   Y+L DG+ SFKD+   R NRF +P+ A KNR+  PS  ++++NA P    E+  E  ++     P      T +  D+S+SGLL+W S+ +A+ A+AL NH  +++    +PY LKL FS
Sbjct:   10 NEDGRATKRQKTDGMATGYEDPHKTLPSVVVHVRGLVDGVTEADLVEALQEFGAISYVVVMPNKRQALVEYEDMNGSSTAVTYAADNQVYIAGHPAFINYSTSKKI-SRPGDSDDSRSV-NNVLLFTIMNPIYPITTDVLYTICNNCGPVQRIVIFRKNGV-QAMVEYPFFFCFLLNKIAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDQDTWDYTNPNLGGPGGY-------------------HGYDENYGSPPYEG-----------------RRMGPTMRGRGGRSYGPNYGPPPPPPGEYGAHADSP-VVMVYGLDPVKMNADRVFNIFCLYGNVERVKFMKSKPGACMVEMGDCYAVDRAITHLNNNFLFGQKLNVCVSKQQAI--VPGQSYELEDGSSSFKDFHGSRNNRFTSPEQAAKNRIQHPSNVLHFFNAQPDVTTEIFSEICEEIGVKSPVNVKMFTGKSDDRSASGLLEWESINDAMEALALMNHYQMKNPAGPYPYTLKLCFS 490          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Planmine SMEST
Match: SMESG000005298.1 (SMESG000005298.1)

HSP 1 Score: 1122.84 bits (2903), Expect = 0.000e+0
Identity = 541/541 (100.00%), Postives = 541/541 (100.00%), Query Frame = 3
Query:   48 MDNFNRKRAKPDDWEDIEPSKVIHIRELAEHTLEIDVSRAMEKFGPIRDIAMIPKRRQALVEFENLVSAQEVVKRYRNDFIHIANRPAKINFSTSEHVLKRSGPLNEAVSTANKVLIFFIYDAVYPINVDVINKICKPHGRVVRVFINRKASIMQALVEFYSLDDAIRVKRNLNGADIYSGCCTLKIEYATTNRVNVIQNSEDSYDFEAPSMGMRSSQSLLGLPSNNEMASRVSMMGRPYDPPRREQPFNGSYGNIRDEYYDEIREPNRRMMPLNNSMDHSLGYDQEYDREPQRNYNDGPKVAMIYGLNLEFVNCDNLFNLLCIYGNVIKIKFLKSKEGSAMVQMSDGASIDRMMHLLHNQPLFGKTLQFQISKQPVIMDVPAPYKLPDGTVSFKDYTNCRENRFVTPQLAEKNRVFPPSKTINYWNAPPSFGLEMIQEEFKKYNAVEPPEFFQLTNRDKSSSGLLQWASVEEAINAIALCNHIMIESEGAKFPYQLKLSFSESPIRHGPPKKEGFESATFNRKPRGRPIFSGIPNKRGKF 1670
            MDNFNRKRAKPDDWEDIEPSKVIHIRELAEHTLEIDVSRAMEKFGPIRDIAMIPKRRQALVEFENLVSAQEVVKRYRNDFIHIANRPAKINFSTSEHVLKRSGPLNEAVSTANKVLIFFIYDAVYPINVDVINKICKPHGRVVRVFINRKASIMQALVEFYSLDDAIRVKRNLNGADIYSGCCTLKIEYATTNRVNVIQNSEDSYDFEAPSMGMRSSQSLLGLPSNNEMASRVSMMGRPYDPPRREQPFNGSYGNIRDEYYDEIREPNRRMMPLNNSMDHSLGYDQEYDREPQRNYNDGPKVAMIYGLNLEFVNCDNLFNLLCIYGNVIKIKFLKSKEGSAMVQMSDGASIDRMMHLLHNQPLFGKTLQFQISKQPVIMDVPAPYKLPDGTVSFKDYTNCRENRFVTPQLAEKNRVFPPSKTINYWNAPPSFGLEMIQEEFKKYNAVEPPEFFQLTNRDKSSSGLLQWASVEEAINAIALCNHIMIESEGAKFPYQLKLSFSESPIRHGPPKKEGFESATFNRKPRGRPIFSGIPNKRGKF
Sbjct:    1 MDNFNRKRAKPDDWEDIEPSKVIHIRELAEHTLEIDVSRAMEKFGPIRDIAMIPKRRQALVEFENLVSAQEVVKRYRNDFIHIANRPAKINFSTSEHVLKRSGPLNEAVSTANKVLIFFIYDAVYPINVDVINKICKPHGRVVRVFINRKASIMQALVEFYSLDDAIRVKRNLNGADIYSGCCTLKIEYATTNRVNVIQNSEDSYDFEAPSMGMRSSQSLLGLPSNNEMASRVSMMGRPYDPPRREQPFNGSYGNIRDEYYDEIREPNRRMMPLNNSMDHSLGYDQEYDREPQRNYNDGPKVAMIYGLNLEFVNCDNLFNLLCIYGNVIKIKFLKSKEGSAMVQMSDGASIDRMMHLLHNQPLFGKTLQFQISKQPVIMDVPAPYKLPDGTVSFKDYTNCRENRFVTPQLAEKNRVFPPSKTINYWNAPPSFGLEMIQEEFKKYNAVEPPEFFQLTNRDKSSSGLLQWASVEEAINAIALCNHIMIESEGAKFPYQLKLSFSESPIRHGPPKKEGFESATFNRKPRGRPIFSGIPNKRGKF 541          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Planmine SMEST
Match: SMESG000068328.1 (SMESG000068328.1)

HSP 1 Score: 189.119 bits (479), Expect = 9.599e-52
Identity = 161/555 (29.01%), Postives = 265/555 (47.75%), Query Frame = 3
Query:   51 DNFNRKRAKPD-----DWEDIEPSKVIHIRELAEHTLEIDVSRAMEKFGPIRDIAMIPKRRQALVEFENLVSAQEVVKRYRNDFIHIANRPAKINFS--TSEHVLKRSGPLNEAVSTANKVLIFFIYDAVYPINVDVINKICKPHGRVVRVFINRK---ASIMQALVEFYSLDDAIRVKRNLNGADIYSGCCTLKIEYATTNRVNVIQNSEDSYDFE-APSMGMRSSQSLLGLPSNNEMASRVSMMGRPYDPPRREQP--------FNGSYGNIRDEYYDEIREPNRRMMPLNNSMDHSLGYDQEYDREPQRNYNDGPKVAMIYGLNLEF-VNCDNLFNLLCIYGNVIKIKFL-KSKEGSAMVQMSDGASIDRMMHLLHNQPLFGKTLQFQISKQPVIMDVPAPYKLPDGTVSFKDYTNCRENRFVTPQLAEKNRVFPPSKTINYWNAPPSFGLEMIQEEFKKYNAVEPPEFFQLTNRDKSS-----SGLLQWASVEEAINAIALCNHIMIESEGAKFPYQLKLSFSESPIRHGPPKKEGFESATF-NRKPRGRP 1634
            DN ++  AKP      + +  +P K + + +L++ + E ++       G +  + M+     ALVEF N  + +E+V   +     I     K++FS  T +     S P         KVL F I +AVY I VDV+NKIC P+G+VVR++I +K    + ++ALVEF + +DA  VK NL+G DIYSGCC+LK+ Y+  +++ V +N  +S+D+   P  G      LLG P + +      +M   Y       P        F+                 N   + ++     S  +  + D   Q    +  +  +++  NL   +  DNLFNL C+YGNV KIK   ++   SA VQMS+  + +  + +++   +FGK ++  ISK   I D   P K P  +  + D+ N  ++ F     + K +VF PS+T++++N P +F  E I + F      +P +      ++ S      +GL+++ SV EAI  + + NH  +       P+ +KLSFS + I      +   E+    N KP  RP
Sbjct:    3 DNPSKTTAKPTQEKFFNLKSEKPGKALLVTDLSKTSTESEIKAIFNAHGTVDRVLMLTNNTSALVEFTNNKTLRELVYDSKVSPYKIGYHDVKLSFSQLTIDEYKSISKP--NFGRNITKVLHFLITNAVYSITVDVLNKICTPYGKVVRIYIGKKNEQDNSIEALVEFSTDNDAKIVKDNLDGNDIYSGCCSLKLSYSKIHKIYVEKNDTESFDYTIVPKTG------LLGPPPDPQ-----PIMNNNYQSYIPPIPIPYSIPPMFSPPPLYSLPYPIPPPFPYNHNPLSISEKKKSSTCFHYKSDSTVQ----EAIEGVVLFCANLSSKIQPDNLFNLFCLYGNVEKIKMGPETGLKSAFVQMSNREAAEFCL-MVNGYEIFGKPVEISISKFSDITDT-IPNKDPVQSF-YSDFYNRFKSSF-----SSKTKVFFPSQTLHFFNVPSTFTAEEIADVFISAKVKDPSQVVIFPRKNSSQRGSLVTGLIEFDSVSEAIEGVVMVNHTRLLLPQVSHPFHIKLSFSPARISEQHILRSTGETIQLDNEKPAKRP 532          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Planmine SMEST
Match: SMESG000058661.1 (SMESG000058661.1)

HSP 1 Score: 187.193 bits (474), Expect = 2.506e-50
Identity = 129/483 (26.71%), Postives = 242/483 (50.10%), Query Frame = 3
Query:  147 EIDVSRAMEKFGPIRDIAMIPKRRQALVEFENLVSAQEVVKRYRNDFIHIANRPAKINFSTSEHVLKRSGPLNEAVSTANKVLIFFIYDAVYPINVDVINKICKPHGRVVRVFINRKA--SIMQALVEFYSLDDAIRVKRNLNGADIYSGCCTLKIEYATTNRVNVIQNSEDSYDFEAPSMGMRSSQSLLGLPSNNEMASRVSMMGRPYDPPRREQPFNGSYGNIRDEYYDEIREPNRRMMPLN--NSMDHSLGYDQEYDREPQRNYN------DGPKVAMIYGLNLEFVNC-DNLFNLLCIYGNVIKIKFLKSKEGSAMVQMSDGASIDRMMHLLHNQPLFGKTLQFQISKQPVIMDVPAPYKLPDGTVSFKDYTNCRENRFVTPQLAEKNRVFPPSKTINYWNAPPSFGLEMIQEEFKKYNAVEPPEFFQLTNRD---KSSSGLLQWASVEEAINAIALCNHIMIESEGAKFPYQLKLSFS 1553
            E ++ +  +++G +  I  +      L+EF    +A  +V+  +    +I +   K+ +S+       +   N+++  +  +L   + +  YPI VD+I +IC   G+++R+FI +K   +I++ LVEF  + +A   K  L+G DIYSGCC+L ++Y+  + V V++N ++S+DF    +     Q +L  P N  ++S    M +  +P                 Y++ I  P   M P    N + +     +    +P+ + N      +   V M+Y  NL F  C D+LFN+ C+YGNV K++FL ++ G+AMVQM   +S+D  +   +++ LFG+ ++     +P I        LP+GT +FKD+++   NRF+       N++  P++T++++NAP +F    +     +     P       N++   K   GL ++  +E+++ A+++ NH  I        + LKL+FS
Sbjct:   30 ESELYKIFKQYGSVNKIQKLSNLSCCLIEFSESNTATTLVQNSKIKPFYIESHKIKLEYSSQS----INSIDNKSLDHSTNILNINVSNVKYPITVDIIKQICLKFGKILRIFIGKKNLDNIVECLVEFDKISEAKSAKEALHGEDIYSGCCSLDVKYSKMSSVPVLRNDDESWDFTKSQV----KQGILKPPVNGSVSSNTINMFQAGNPSMYPP---IYNYPPPISYHNPI--PVTPMHPFGCPNLLYNYTNLQKNSKIKPKLDINKDAFVIESGVVFMVY--NLPFTICVDHLFNIFCLYGNVSKVRFLLNQPGTAMVQMGSKSSVDTCIQYYNSKNLFGQEMRLVKCSKPEIFPSKTIEFLPNGTPAFKDFSSDANNRFLNDHGINSNKILEPNRTLHFFNAPYTFLESDLSNMIMQSGVPRPLNIIIFNNKNDHVKKCIGLFEFHRLEDSLVALSVLNHKPIIIPDTNQVFHLKLTFS 497          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Planmine SMEST
Match: SMESG000033951.1 (SMESG000033951.1)

HSP 1 Score: 118.242 bits (295), Expect = 2.001e-27
Identity = 137/553 (24.77%), Postives = 241/553 (43.58%), Query Frame = 3
Query:   42 LNMDNFNRKRAKPDDWEDIEPSKVIHIRELAEHTLEIDVSRAMEKFGPIRDIAMIPKRRQALVEFENLVSAQEVVKRYRNDFIHIANRPAKINFS---TSEHVLKRSGPLNEAVSTANKV--------------------LIFFIYDAV--YPINVDVINKICKPHGRVVRVFINRKASIMQALVEFYSLDDAIRVK---RNLNGADIYSGCCTLKIEYA-TTNRVNVIQNSEDSYDFEAPSMGMRSSQSLLGLPSNNEMASRV------SMMGRPYDPPRREQPF------NGSYGNIRDEYYDEIREPNRRMMP---LNNSMDHSLGYDQEYDREPQRNYNDGPKVAMIYGLNLEFVNCDNLFNLLCIYGNVIKIKFLKSKEGSAMVQMSDGASIDRMMHLLHNQPLFGKTLQFQISKQPVIMDVPAPYKLPDGTVSFKDYTNCRENRFVTPQLAEKNRVFPPSKTINYWNAPPSFGLEMIQEEFKKYNAVEPPEFFQLTNRDKSSSGLLQWASVEEAINA-IALCNHIMIESEGAKFPYQLKLSFSESPI 1565
            +++D+   K++K +   + EPSKV+HIR +A    E D+S     FG IR +    K  QAL+E E    A  +   Y         R   + +S   + E  LK S  ++ +V  ANK+                    ++  + + +  Y IN  VI K+ +  G+V+R+ I  K    Q LVE   LD++I       +LNG D+++ CC LKIE++  T+ + + + ++   D+    +      SL  L    +  S V      S+   P    + ++P       N  +  +    +    +P+   +P   L +    +  Y +   + P         + ++  LN E VN D++F L  +YG+V K+       G+A+V M   +  +     L+  PLFGK +   +    ++       +L +  +  K +TN   +RF  P       ++PPS  ++  N P SF  E +   F   N  +     ++  +DK    L +  S+E+AI+A I+L N  + +S        L++SFS++ I
Sbjct:  102 IDVDSNESKKSKLEPSTNTEPSKVLHIRNIASRAQESDLSLLAVPFGKIRSMVYAKKTNQALLELEKASEATRMFDYYTRYPPCFNGREMIVQYSKHVSLELKLKNSN-IDASVDAANKMNEKHRSIVDEWSSENKSDRRILRVVIENLKNYNINHLVILKVFQRFGKVLRIIIFTKNMQCQCLVE---LDNSISAHVSLLHLNGQDLFNDCCRLKIEFSKNTDSLQIQRQNDKCRDYTVSPLQEDEQFSLHFLDWQAKSVSTVPPQQYPSLSTVPLLQTQVQKPLYSDFLPNNLFYTVMPNVFKSTFQPSPVAIPESLLISDCAINPLYQEPIVKPPSSANAIDSSIILVSNLNYEKVNTDSIFTLFGVYGDVSKVCISPPSVGAALVYMQTNSQAETACRHLNLVPLFGKIISTYLLPGEIVAQSIFNTEL-NSDIEVKHFTNTPLHRFKKPNSKNHFNIYPPSSVLHLSNIPLSFKEEDLLTLFHD-NGFQCSS-LRIFQKDK-KMALAKMTSLEDAISALISLHNWKLTDSS------HLRVSFSKALI 640          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Planmine SMEST
Match: SMESG000033951.1 (SMESG000033951.1)

HSP 1 Score: 118.242 bits (295), Expect = 2.110e-27
Identity = 137/553 (24.77%), Postives = 241/553 (43.58%), Query Frame = 3
Query:   42 LNMDNFNRKRAKPDDWEDIEPSKVIHIRELAEHTLEIDVSRAMEKFGPIRDIAMIPKRRQALVEFENLVSAQEVVKRYRNDFIHIANRPAKINFS---TSEHVLKRSGPLNEAVSTANKV--------------------LIFFIYDAV--YPINVDVINKICKPHGRVVRVFINRKASIMQALVEFYSLDDAIRVK---RNLNGADIYSGCCTLKIEYA-TTNRVNVIQNSEDSYDFEAPSMGMRSSQSLLGLPSNNEMASRV------SMMGRPYDPPRREQPF------NGSYGNIRDEYYDEIREPNRRMMP---LNNSMDHSLGYDQEYDREPQRNYNDGPKVAMIYGLNLEFVNCDNLFNLLCIYGNVIKIKFLKSKEGSAMVQMSDGASIDRMMHLLHNQPLFGKTLQFQISKQPVIMDVPAPYKLPDGTVSFKDYTNCRENRFVTPQLAEKNRVFPPSKTINYWNAPPSFGLEMIQEEFKKYNAVEPPEFFQLTNRDKSSSGLLQWASVEEAINA-IALCNHIMIESEGAKFPYQLKLSFSESPI 1565
            +++D+   K++K +   + EPSKV+HIR +A    E D+S     FG IR +    K  QAL+E E    A  +   Y         R   + +S   + E  LK S  ++ +V  ANK+                    ++  + + +  Y IN  VI K+ +  G+V+R+ I  K    Q LVE   LD++I       +LNG D+++ CC LKIE++  T+ + + + ++   D+    +      SL  L    +  S V      S+   P    + ++P       N  +  +    +    +P+   +P   L +    +  Y +   + P         + ++  LN E VN D++F L  +YG+V K+       G+A+V M   +  +     L+  PLFGK +   +    ++       +L +  +  K +TN   +RF  P       ++PPS  ++  N P SF  E +   F   N  +     ++  +DK    L +  S+E+AI+A I+L N  + +S        L++SFS++ I
Sbjct:  104 IDVDSNESKKSKLEPSTNTEPSKVLHIRNIASRAQESDLSLLAVPFGKIRSMVYAKKTNQALLELEKASEATRMFDYYTRYPPCFNGREMIVQYSKHVSLELKLKNSN-IDASVDAANKMNEKHRSIVDEWSSENKSDRRILRVVIENLKNYNINHLVILKVFQRFGKVLRIIIFTKNMQCQCLVE---LDNSISAHVSLLHLNGQDLFNDCCRLKIEFSKNTDSLQIQRQNDKCRDYTVSPLQEDEQFSLHFLDWQAKSVSTVPPQQYPSLSTVPLLQTQVQKPLYSDFLPNNLFYTVMPNVFKSTFQPSPVAIPESLLISDCAINPLYQEPIVKPPSSANAIDSSIILVSNLNYEKVNTDSIFTLFGVYGDVSKVCISPPSVGAALVYMQTNSQAETACRHLNLVPLFGKIISTYLLPGEIVAQSIFNTEL-NSDIEVKHFTNTPLHRFKKPNSKNHFNIYPPSSVLHLSNIPLSFKEEDLLTLFHD-NGFQCSS-LRIFQKDK-KMALAKMTSLEDAISALISLHNWKLTDSS------HLRVSFSKALI 642          
The following BLAST results are available for this feature:
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HNRNPL1.356e-10539.61heterogeneous nuclear ribonucleoprotein L [Source:... [more]
HNRNPL1.356e-10539.61heterogeneous nuclear ribonucleoprotein L [Source:... [more]
HNRNPL5.910e-10539.61heterogeneous nuclear ribonucleoprotein L [Source:... [more]
HNRNPL5.910e-10539.61heterogeneous nuclear ribonucleoprotein L [Source:... [more]
HNRNPL4.621e-10438.08heterogeneous nuclear ribonucleoprotein L [Source:... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hrpl-11.950e-8233.20Heterogeneous nuclear RibonucleoProtein (HnRNP) L ... [more]
hrpl-11.950e-8233.20Heterogeneous nuclear RibonucleoProtein (HnRNP) L ... [more]
hrpl-11.574e-4835.10Heterogeneous nuclear RibonucleoProtein (HnRNP) L ... [more]
ptb-13.022e-1725.35PTB (HnRNP) homolog; Putative RNA-binding protein ... [more]
ptb-11.295e-1232.00PTB (HnRNP) homolog; Putative RNA-binding protein ... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sm7.545e-8338.92gene:FBgn0003435 transcript:FBtr0308796[more]
sm5.281e-8239.16gene:FBgn0003435 transcript:FBtr0308785[more]
sm1.851e-8038.81gene:FBgn0003435 transcript:FBtr0310331[more]
sm2.306e-8037.67gene:FBgn0003435 transcript:FBtr0308791[more]
sm2.758e-8038.50gene:FBgn0003435 transcript:FBtr0301609[more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hnrnpl3.018e-10337.36heterogeneous nuclear ribonucleoprotein L [Source:... [more]
hnrnpl3.018e-10337.36heterogeneous nuclear ribonucleoprotein L [Source:... [more]
hnrnpl22.087e-10139.20heterogeneous nuclear ribonucleoprotein L2 [Source... [more]
hnrnpl3.152e-10036.84heterogeneous nuclear ribonucleoprotein L [Source:... [more]
hnrnpl23.633e-10038.57heterogeneous nuclear ribonucleoprotein L2 [Source... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
admp1.691e-9936.54anti-dorsalizing morphogenic protein [Source:Xenba... [more]
admp3.953e-9936.94anti-dorsalizing morphogenic protein [Source:Xenba... [more]
admp6.031e-9735.14anti-dorsalizing morphogenic protein [Source:Xenba... [more]
admp1.335e-9635.59anti-dorsalizing morphogenic protein [Source:Xenba... [more]
atp2a11.658e-9137.07ATPase, Ca++ transporting, cardiac muscle, fast tw... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hnrnpl9.099e-10538.95heterogeneous nuclear ribonucleoprotein L [Source:... [more]
Hnrnpl9.099e-10538.95heterogeneous nuclear ribonucleoprotein L [Source:... [more]
Hnrnpl3.464e-10337.61heterogeneous nuclear ribonucleoprotein L [Source:... [more]
Hnrnpl1.450e-9439.16heterogeneous nuclear ribonucleoprotein L [Source:... [more]
Hnrnpll7.377e-8736.77heterogeneous nuclear ribonucleoprotein L-like [So... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P14866|HNRPL_HUMAN2.838e-10439.61Heterogeneous nuclear ribonucleoprotein L OS=Homo ... [more]
sp|Q8R081|HNRPL_MOUSE6.365e-10438.95Heterogeneous nuclear ribonucleoprotein L OS=Mus m... [more]
sp|F1LQ48|HNRPL_RAT3.707e-10237.18Heterogeneous nuclear ribonucleoprotein L OS=Rattu... [more]
sp|Q8WVV9|HNRLL_HUMAN5.073e-8837.17Heterogeneous nuclear ribonucleoprotein L-like OS=... [more]
sp|Q921F4|HNRLL_MOUSE5.160e-8636.77Heterogeneous nuclear ribonucleoprotein L-like OS=... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183NEZ54.154e-14345.17Uncharacterized protein OS=Schistosoma mattheei OX... [more]
A0A094ZF594.578e-14345.17Heterogeneous nuclear ribonucleoprotein L OS=Schis... [more]
C4QB355.994e-14345.21Heterogeneous nuclear ribonucleoprotein l (Hnrnp l... [more]
C1LFX18.030e-14345.07Heterogeneous nuclear ribonucleoprotein L OS=Schis... [more]
A0A3S5BVH41.102e-14043.75Uncharacterized protein OS=Protopolystoma xenopodi... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hnrnpl22.476e-10137.62heterogeneous nuclear ribonucleoprotein L [Source:... [more]
hnrnpl28.506e-10036.94heterogeneous nuclear ribonucleoprotein L [Source:... [more]
hnrnpl23.306e-9937.03heterogeneous nuclear ribonucleoprotein L [Source:... [more]
hnrnpl29.427e-9836.44heterogeneous nuclear ribonucleoprotein L [Source:... [more]
hnrnpl3.527e-9637.82heterogeneous nuclear ribonucleoprotein L [Source:... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HNRNPLL1.116e-8836.75heterogeneous nuclear ribonucleoprotein L like [So... [more]
HNRNPLL3.282e-4641.06heterogeneous nuclear ribonucleoprotein L like [So... [more]
ENSPMAT00000006507.14.736e-2327.90pep scaffold:Pmarinus_7.0:GL480554:3468:10153:1 ge... [more]
ENSPMAT00000008247.11.731e-1942.55pep scaffold:Pmarinus_7.0:GL480157:26501:33582:-1 ... [more]
ENSPMAT00000008211.11.731e-1942.55pep scaffold:Pmarinus_7.0:GL488597:1016:4303:-1 ge... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO391197.487e-8434.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO355374.191e-3638.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO355361.004e-3436.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO439951.173e-3425.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO262323.395e-629.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000000593.23.994e-10039.52heterogeneous nuclear ribonucleoprotein L [Source:... [more]
ENSORLT00000000591.23.021e-9838.75heterogeneous nuclear ribonucleoprotein L [Source:... [more]
hnrnpl5.441e-9736.64heterogeneous nuclear ribonucleoprotein L [Source:... [more]
hnrnpl1.739e-9636.74heterogeneous nuclear ribonucleoprotein L [Source:... [more]
hnrnpl1.288e-9235.95heterogeneous nuclear ribonucleoprotein L [Source:... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000005298.10.000e+0100.00SMESG000005298.1[more]
SMESG000068328.19.599e-5229.01SMESG000068328.1[more]
SMESG000058661.12.506e-5026.71SMESG000058661.1[more]
SMESG000033951.12.001e-2724.77SMESG000033951.1[more]
SMESG000033951.12.110e-2724.77SMESG000033951.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019298 ID=SMED30019298|Name=Heterogeneous nuclear ribonucleoprotein L|organism=Schmidtea mediterranea sexual|type=transcript|length=2156bp
ATTTGTTTTAGTGCTTACTTTTTAAATATATCAACAATAAATTAAATATG
GACAATTTTAATCGTAAAAGAGCTAAGCCAGATGATTGGGAAGATATCGA
ACCATCTAAAGTAATACACATAAGAGAATTAGCCGAACACACATTAGAAA
TAGATGTTTCACGTGCAATGGAAAAGTTTGGCCCCATTCGTGATATCGCA
ATGATACCTAAAAGACGGCAAGCCCTCGTTGAATTTGAGAATTTGGTTTC
AGCACAAGAAGTTGTTAAAAGATATCGTAACGACTTCATTCATATTGCAA
ATAGACCCGCTAAAATTAATTTTAGTACATCTGAACATGTTTTAAAACGA
AGTGGGCCTCTAAATGAAGCTGTGTCTACAGCTAACAAAGTTTTAATATT
TTTTATCTACGATGCGGTTTATCCAATAAATGTTGATGTAATTAATAAAA
TATGCAAGCCACATGGTAGAGTGGTACGTGTATTTATAAATCGAAAAGCA
TCAATAATGCAGGCGCTTGTCGAATTCTATTCTCTCGATGATGCAATTAG
GGTGAAACGTAATTTAAATGGTGCTGACATATACTCTGGATGCTGTACTT
TGAAGATTGAATACGCTACAACTAACCGTGTAAATGTTATTCAGAATTCG
GAAGATAGTTATGATTTTGAAGCTCCAAGTATGGGAATGCGTAGTTCTCA
GTCCCTTTTGGGCCTCCCTAGTAATAATGAAATGGCATCGAGAGTTAGTA
TGATGGGTAGACCATATGATCCTCCTAGAAGAGAACAGCCATTTAATGGA
TCTTACGGGAATATTAGAGATGAATATTATGATGAAATACGCGAGCCAAA
CAGGCGAATGATGCCATTAAACAATTCAATGGATCATTCATTAGGTTACG
ATCAAGAATATGATCGTGAACCACAACGAAATTATAACGATGGGCCAAAA
GTTGCCATGATCTATGGTCTAAATTTAGAATTTGTTAATTGCGATAATTT
ATTTAATCTACTTTGCATTTATGGAAATGTTATTAAAATTAAATTTCTTA
AAAGTAAAGAAGGCTCAGCAATGGTACAAATGAGTGACGGAGCATCTATT
GATCGGATGATGCACCTGTTACACAATCAACCACTTTTTGGGAAAACATT
GCAATTTCAAATATCCAAACAGCCAGTAATTATGGATGTTCCAGCTCCAT
ATAAGCTTCCAGATGGAACCGTGTCCTTTAAAGATTATACAAATTGTCGT
GAAAATCGTTTTGTAACACCGCAATTAGCGGAAAAAAATCGTGTTTTTCC
ACCATCCAAAACAATCAACTACTGGAACGCTCCTCCTAGTTTTGGATTAG
AAATGATTCAAGAAGAATTTAAAAAATATAACGCTGTTGAACCACCAGAA
TTTTTCCAATTAACTAATCGGGATAAGTCTTCTTCAGGGTTATTACAGTG
GGCATCTGTAGAAGAAGCAATTAACGCAATAGCTCTTTGTAATCATATTA
TGATAGAAAGTGAAGGAGCTAAGTTTCCTTATCAATTAAAACTAAGCTTT
TCTGAAAGCCCTATTAGACATGGGCCACCTAAAAAAGAAGGTTTTGAATC
TGCGACGTTTAATCGAAAACCTAGAGGGAGACCGATATTTAGTGGAATAC
CTAATAAACGTGGAAAGTTTTAAACACATCAGGCAGAAATACACGCTGGA
ACATATTGGCATTGCAAATACATCAGTTACATTATAAATGTTCGTCATTC
ACACGTTTGTTATTCGTACAAATATATAGTTGCATTTTTAATTCTTTGCA
TGGTGCAATTTAATATTCATTTAAATATCCATTAAAAATAAAAACAAAAC
ATGGGCAAATATTTTAATTACATTACAAAATGGATCGGAACGATTTTTGT
CTTATTTAATATTGCTCATTTTTGTTTTGATAGTTTATAAAAATTGTTCT
TCGCAAGCTGTTGGATATACTGACGTGCTTATTTCTTGAAAAAACTAAAG
TTAATATAAATTAAAAAAAGCCGTCGTAACTTTATGTTAATCGAAAGCGA
ATTAGACGTCATATTTACAAATCGTTATATTAGTAAATCGATATATTTTG
TATATTTATTTAAGTTTGTTAATGTTTATACAAACGTAGCATAAAGTTCA
ACTGTC
back to top

protein sequence of SMED30019298-orf-1

>SMED30019298-orf-1 ID=SMED30019298-orf-1|Name=SMED30019298-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=542bp
MDNFNRKRAKPDDWEDIEPSKVIHIRELAEHTLEIDVSRAMEKFGPIRDI
AMIPKRRQALVEFENLVSAQEVVKRYRNDFIHIANRPAKINFSTSEHVLK
RSGPLNEAVSTANKVLIFFIYDAVYPINVDVINKICKPHGRVVRVFINRK
ASIMQALVEFYSLDDAIRVKRNLNGADIYSGCCTLKIEYATTNRVNVIQN
SEDSYDFEAPSMGMRSSQSLLGLPSNNEMASRVSMMGRPYDPPRREQPFN
GSYGNIRDEYYDEIREPNRRMMPLNNSMDHSLGYDQEYDREPQRNYNDGP
KVAMIYGLNLEFVNCDNLFNLLCIYGNVIKIKFLKSKEGSAMVQMSDGAS
IDRMMHLLHNQPLFGKTLQFQISKQPVIMDVPAPYKLPDGTVSFKDYTNC
RENRFVTPQLAEKNRVFPPSKTINYWNAPPSFGLEMIQEEFKKYNAVEPP
EFFQLTNRDKSSSGLLQWASVEEAINAIALCNHIMIESEGAKFPYQLKLS
FSESPIRHGPPKKEGFESATFNRKPRGRPIFSGIPNKRGKF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR021790PTBP1_RRM
IPR006536HnRNP-L/PTB
IPR035979RBD_domain_sf
IPR000504RRM_dom
IPR012677Nucleotide-bd_a/b_plait_sf
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
GO:0003723RNA binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0019013viral nucleocapsid
GO:0030529intracellular ribonucleoprotein complex
Vocabulary: biological process
TermDefinition
GO:0006397mRNA processing
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000504RNA recognition motif domainSMARTSM00360rrm1_1coord: 302..371
e-value: 0.011
score: 24.1
coord: 117..186
e-value: 0.026
score: 20.7
coord: 22..91
e-value: 1.6E-6
score: 37.7
IPR000504RNA recognition motif domainPFAMPF00076RRM_1coord: 25..80
e-value: 1.6E-5
score: 24.6
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 303..375
score: 8.808
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 21..95
score: 10.002
IPR021790PTBP1, RNA recognition motif 2-likePFAMPF11835RRM_8coord: 111..190
e-value: 4.3E-9
score: 36.4
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 114..214
e-value: 1.9E-25
score: 90.7
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 4..113
e-value: 1.1E-17
score: 66.1
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 300..398
e-value: 3.0E-25
score: 90.3
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 409..501
e-value: 5.8E-22
score: 79.6
IPR006536HnRNP-L/PTBTIGRFAMTIGR01649TIGR01649coord: 19..504
e-value: 3.1E-114
score: 380.6
NoneNo IPR availablePFAMPF13893RRM_5coord: 299..399
e-value: 3.0E-36
score: 123.7
NoneNo IPR availablePANTHERPTHR23189:SF79HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEIN L2coord: 12..503
NoneNo IPR availablePANTHERPTHR23189RNA RECOGNITION MOTIF-CONTAININGcoord: 12..503
NoneNo IPR availableCDDcd12424RRM3_hnRNPL_likecoord: 302..370
e-value: 5.08333E-30
score: 109.975
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 10..101
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 313..487
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 114..212