Reticulocalbin 3

Overview
NameReticulocalbin 3
Smed IDSMED30019288
Length (bp)1292
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Reticulocalbin 3 (SMED30019288) t-SNE clustered cells

Violin plots show distribution of expression levels for Reticulocalbin 3 (SMED30019288) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Reticulocalbin 3 (SMED30019288) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Reticulocalbin 3 (SMED30019288) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019288

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30019288SMESG000012033.1 dd_Smed_v4_1417_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30019288SMESG000012033.1 dd_Smed_v4_1417_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30019288SMESG000012033.1 dd_Smed_v4_1417_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30019288SMESG000012033.1 dd_Smed_v4_1417_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30019288SMESG000012033.1 dd_Smed_v4_1417_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30019288SMESG000012033.1 dd_Smed_v4_1417_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30019288SMESG000012033.1 dd_Smed_v4_1417_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30019288SMESG000012033.1 dd_Smed_v4_1417_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30019288SMESG000012033.1 dd_Smed_v4_1417_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019288SMESG000012033.1 Contig42258newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019288SMESG000012033.1 Contig42258uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
progenitor cellSMED30019288SMESG000012033.1 dd_Smed_v6_1417_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30019288SMESG000012033.1 dd_Smed_v6_1417_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynx progenitor cellSMED30019288SMESG000012033.1 dd_Smed_v6_1417_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Reticulocalbin 3 vs. Ensembl Human
Match: CALU (calumenin [Source:HGNC Symbol;Acc:HGNC:1458])

HSP 1 Score: 266.544 bits (680), Expect = 6.053e-86
Identity = 147/316 (46.52%), Postives = 207/316 (65.51%), Query Frame = 3
Query:  114 MNIIYFISIIFLVTTFVTCKPPDAKRVLDHELSXXXXXXXXXXXXXXXXXXAFLGKDESSKYKNMSPEESKEKLSKIVDKIDVNSDGKIYPDELKHWITIQSQRYLREDTDKNWADYTIEKDKLT----FENXXXXXX-------XXXXXXXMVKRDERRWAKADIDGDNLLTKEEFFDFLHPEESEKMRDIVIQETIDDMDKNKDGAIDLDEYIRDMFNPEKDEEEPDWVKTERAQFKDHRDLNKDGKLDREEVGQWILPPDHNHVTSETSHLMEQTDANKDGHLTKEEILEKYDVFIGSQATDFGDALTRHSEL 1028
            M++  F+  + L T F   KP + K  + HE   +     +D    +YDHDAFLG +E+  +  ++PEESKE+L KIV KID + DG +  DELK WI    +R++ ED ++ W  + + +D L     ++N             +  +   M+ RDERR+  AD DGD + TKEEF  FLHPEE + M+DIV+QET++D+DKN DG IDL+EYI DM++ + + +EP+WVKTER QF + RD N+DGK+D+EE   WILP D++H  +E  HL+ ++D NKDG LTKEEI++KYD+F+GSQATDFG+AL RH E 
Sbjct:    1 MDLRQFLMCLSLCTAFALSKPTEKKDRVHHE-PQLSDKVHNDAQSFDYDHDAFLGAEEAKTFDQLTPEESKERLGKIVSKIDGDKDGFVTVDELKDWIKFAQKRWIYEDVERQWKGHDLNEDGLVSWEEYKNATYGYVLDDPDPDDGFNYKQMMVRDERRFKMADKDGDLIATKEEFTAFLHPEEYDYMKDIVVQETMEDIDKNADGFIDLEEYIGDMYSHDGNTDEPEWVKTEREQFVEFRDKNRDGKMDKEETKDWILPSDYDHAEAEARHLVYESDQNKDGKLTKEEIVDKYDLFVGSQATDFGEALVRHDEF 315          
BLAST of Reticulocalbin 3 vs. Ensembl Human
Match: CALU (calumenin [Source:HGNC Symbol;Acc:HGNC:1458])

HSP 1 Score: 266.159 bits (679), Expect = 1.010e-85
Identity = 147/316 (46.52%), Postives = 206/316 (65.19%), Query Frame = 3
Query:  114 MNIIYFISIIFLVTTFVTCKPPDAKRVLDHELSXXXXXXXXXXXXXXXXXXAFLGKDESSKYKNMSPEESKEKLSKIVDKIDVNSDGKIYPDELKHWITIQSQRYLREDTDKNWADYTIEKDKLT----FENXXXXXXX-------XXXXXXMVKRDERRWAKADIDGDNLLTKEEFFDFLHPEESEKMRDIVIQETIDDMDKNKDGAIDLDEYIRDMFNPEKDEEEPDWVKTERAQFKDHRDLNKDGKLDREEVGQWILPPDHNHVTSETSHLMEQTDANKDGHLTKEEILEKYDVFIGSQATDFGDALTRHSEL 1028
            M++  F+  + L T F   KP + K  + HE   +     +D    +YDHDAFLG +E+  +  ++PEESKE+L KIV KID + DG +  DELK WI    +R++ ED ++ W  + + +D L     ++N                +   M+ RDERR+  AD DGD + TKEEF  FLHPEE + M+DIV+QET++D+DKN DG IDL+EYI DM++ + + +EP+WVKTER QF + RD N+DGK+D+EE   WILP D++H  +E  HL+ ++D NKDG LTKEEI++KYD+F+GSQATDFG+AL RH E 
Sbjct:    9 MDLRQFLMCLSLCTAFALSKPTEKKDRVHHE-PQLSDKVHNDAQSFDYDHDAFLGAEEAKTFDQLTPEESKERLGKIVSKIDGDKDGFVTVDELKDWIKFAQKRWIYEDVERQWKGHDLNEDGLVSWEEYKNATYGYVLDDPDPDDGFNYKQMMVRDERRFKMADKDGDLIATKEEFTAFLHPEEYDYMKDIVVQETMEDIDKNADGFIDLEEYIGDMYSHDGNTDEPEWVKTEREQFVEFRDKNRDGKMDKEETKDWILPSDYDHAEAEARHLVYESDQNKDGKLTKEEIVDKYDLFVGSQATDFGEALVRHDEF 323          
BLAST of Reticulocalbin 3 vs. Ensembl Human
Match: CALU (calumenin [Source:HGNC Symbol;Acc:HGNC:1458])

HSP 1 Score: 261.536 bits (667), Expect = 4.221e-84
Identity = 145/316 (45.89%), Postives = 206/316 (65.19%), Query Frame = 3
Query:  114 MNIIYFISIIFLVTTFVTCKPPDAKRVLDHELSXXXXXXXXXXXXXXXXXXAFLGKDESSKYKNMSPEESKEKLSKIVDKIDVNSDGKIYPDELKHWITIQSQRYLREDTDKNWADYTIEKDKLT----FENXXXXXX-------XXXXXXXMVKRDERRWAKADIDGDNLLTKEEFFDFLHPEESEKMRDIVIQETIDDMDKNKDGAIDLDEYIRDMFNPEKDEEEPDWVKTERAQFKDHRDLNKDGKLDREEVGQWILPPDHNHVTSETSHLMEQTDANKDGHLTKEEILEKYDVFIGSQATDFGDALTRHSEL 1028
            M++  F+  + L T F   KP + K  + HE   +     +D    +YDHDAFLG +E+  +  ++PEESKE+L  IVDKID + DG +   ELK WI    ++Y+ ++ +  W ++ + +D L     + N     Y       +  +   M+ RDERR+  AD DGD + TKEEF  FLHPEE + M+DIV+QET++D+DKN DG IDL+EYI DM++ + + +EP+WVKTER QF + RD N+DGK+D+EE   WILP D++H  +E  HL+ ++D NKDG LTKEEI++KYD+F+GSQATDFG+AL RH E 
Sbjct:    1 MDLRQFLMCLSLCTAFALSKPTEKKDRVHHE-PQLSDKVHNDAQSFDYDHDAFLGAEEAKTFDQLTPEESKERLGMIVDKIDADKDGFVTEGELKSWIKHAQKKYIYDNVENQWQEFDMNQDGLISWDEYRNVTYGTYLDDPDPDDGFNYKQMMVRDERRFKMADKDGDLIATKEEFTAFLHPEEYDYMKDIVVQETMEDIDKNADGFIDLEEYIGDMYSHDGNTDEPEWVKTEREQFVEFRDKNRDGKMDKEETKDWILPSDYDHAEAEARHLVYESDQNKDGKLTKEEIVDKYDLFVGSQATDFGEALVRHDEF 315          
BLAST of Reticulocalbin 3 vs. Ensembl Human
Match: CALU (calumenin [Source:HGNC Symbol;Acc:HGNC:1458])

HSP 1 Score: 261.536 bits (667), Expect = 5.606e-84
Identity = 145/316 (45.89%), Postives = 205/316 (64.87%), Query Frame = 3
Query:  114 MNIIYFISIIFLVTTFVTCKPPDAKRVLDHELSXXXXXXXXXXXXXXXXXXAFLGKDESSKYKNMSPEESKEKLSKIVDKIDVNSDGKIYPDELKHWITIQSQRYLREDTDKNWADYTIEKDKLT----FENXXXXXXX-------XXXXXXMVKRDERRWAKADIDGDNLLTKEEFFDFLHPEESEKMRDIVIQETIDDMDKNKDGAIDLDEYIRDMFNPEKDEEEPDWVKTERAQFKDHRDLNKDGKLDREEVGQWILPPDHNHVTSETSHLMEQTDANKDGHLTKEEILEKYDVFIGSQATDFGDALTRHSEL 1028
            M++  F+  + L T F   KP + K  + HE   +     +D    +YDHDAFLG +E+  +  ++PEESKE+L  IVDKID + DG +   ELK WI    ++Y+ ++ +  W ++ + +D L     + N     Y          +   M+ RDERR+  AD DGD + TKEEF  FLHPEE + M+DIV+QET++D+DKN DG IDL+EYI DM++ + + +EP+WVKTER QF + RD N+DGK+D+EE   WILP D++H  +E  HL+ ++D NKDG LTKEEI++KYD+F+GSQATDFG+AL RH E 
Sbjct:    9 MDLRQFLMCLSLCTAFALSKPTEKKDRVHHE-PQLSDKVHNDAQSFDYDHDAFLGAEEAKTFDQLTPEESKERLGMIVDKIDADKDGFVTEGELKSWIKHAQKKYIYDNVENQWQEFDMNQDGLISWDEYRNVTYGTYLDDPDPDDGFNYKQMMVRDERRFKMADKDGDLIATKEEFTAFLHPEEYDYMKDIVVQETMEDIDKNADGFIDLEEYIGDMYSHDGNTDEPEWVKTEREQFVEFRDKNRDGKMDKEETKDWILPSDYDHAEAEARHLVYESDQNKDGKLTKEEIVDKYDLFVGSQATDFGEALVRHDEF 323          
BLAST of Reticulocalbin 3 vs. Ensembl Human
Match: RCN1 (reticulocalbin 1 [Source:HGNC Symbol;Acc:HGNC:9934])

HSP 1 Score: 231.106 bits (588), Expect = 4.969e-72
Identity = 125/270 (46.30%), Postives = 179/270 (66.30%), Query Frame = 3
Query:  267 AFLGKDESSKYKNMSPEESKEKLSKIVDKIDVNSDGKIYPDELKHWITIQSQRYLREDTDK-------------NWADYTIEKDKLTFENXXX--XXXXXXXXXXMVKRDERRWAKADIDGDNLLTKEEFFDFLHPEESEKMRDIVIQETIDDMDKNKDGAIDLDEYIRDMFNPEKDEEEPDWVKTERAQFKDHRDLNKDGKLDREEVGQWILPPDHNHVTSETSHLMEQTDANKDGHLTKEEILEKYDVFIGSQATDFGDALTR-HSEL 1028
            AFLGK++S  +  ++P+ESKE+L KIVD+ID + DG +  +ELK WI    +RY+ ++  K             +W +Y          N  +   + +      M+ RDERR+  AD++GD   T+EEF  FLHPEE E M++IV+ ET++D+DKN DG +D DEYI DMF+ E++  EPDWV +ER QF + RDLNKDGKLD++E+  WILP D++H  +E  HL+ ++D NKD  LTKEEILE +++F+GSQAT++G+ LT+ H EL
Sbjct:   62 AFLGKEDSKTFDQLTPDESKERLGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEYKQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKAADLNGDLTATREEFTAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFSHEENGPEPDWVLSEREQFNEFRDLNKDGKLDKDEIRHWILPQDYDHAQAEARHLVYESDKNKDEKLTKEEILENWNMFVGSQATNYGEDLTKNHDEL 331          
BLAST of Reticulocalbin 3 vs. Ensembl Celegans
Match: calu-1 (CALUmenin (Calcium-binding protein) homolog [Source:UniProtKB/TrEMBL;Acc:H2L0I1])

HSP 1 Score: 232.646 bits (592), Expect = 3.312e-73
Identity = 121/266 (45.49%), Postives = 175/266 (65.79%), Query Frame = 3
Query:  270 FLGKDESSKYKNMSPEESKEKLSKIVDKIDVNSDGKIYPDELKHWITIQSQRYLREDTDKNWADYTIEK---DKLTFENX---------XXXXXXXXXXXXMVKRDERRWAKADIDGDNLLTKEEFFDFLHPEESEKMRDIVIQETIDDMDKNKDGAIDLDEYIRDMFNP----EKDEEEPDWVKTERAQFKDHRDLNKDGKLDREEVGQWILPPDHNHVTSETSHLMEQTDANKDGHLTKEEILEKYDVFIGSQATDFGDALTRH 1019
            FLGKD ++++  ++PE+SKEKL+K+V K+D +SDG I  +ELK  I    +RY+  D D+ W +Y  EK    K+ +E+Y                 + A M+ RDE+RWA AD D +  L + E+  F+HPE+ + MRD+V+ ET+DD+DKNKDG++DLDEYI DM+ P    E + +EPDWV++ER  FK+HRD + DGKL++EE+  WI+P   +H  +E  HL+   D NKDG L  +EI+  YD F+GSQATD+G+ L +H
Sbjct:   44 FLGKDTAAEFDELTPEKSKEKLAKLVPKMDADSDGFIEENELKDHINFMQKRYVNNDVDRTWKNYKAEKIVDGKIKWEDYREMVYGSADGAGQELSPEYAKMIARDEKRWAVADYDSNGALDRTEYGCFMHPEDCDHMRDVVVAETVDDIDKNKDGSVDLDEYIGDMYRPDDYPELNGKEPDWVQSEREMFKEHRDKDGDGKLNQEEMRDWIMPVGFDHAEAEARHLVGIADDNKDGKLNLDEIVAHYDTFVGSQATDYGEQLQKH 309          
BLAST of Reticulocalbin 3 vs. Ensembl Celegans
Match: calu-1 (CALUmenin (Calcium-binding protein) homolog [Source:UniProtKB/TrEMBL;Acc:H2L0I1])

HSP 1 Score: 232.646 bits (592), Expect = 3.312e-73
Identity = 121/266 (45.49%), Postives = 175/266 (65.79%), Query Frame = 3
Query:  270 FLGKDESSKYKNMSPEESKEKLSKIVDKIDVNSDGKIYPDELKHWITIQSQRYLREDTDKNWADYTIEK---DKLTFENX---------XXXXXXXXXXXXMVKRDERRWAKADIDGDNLLTKEEFFDFLHPEESEKMRDIVIQETIDDMDKNKDGAIDLDEYIRDMFNP----EKDEEEPDWVKTERAQFKDHRDLNKDGKLDREEVGQWILPPDHNHVTSETSHLMEQTDANKDGHLTKEEILEKYDVFIGSQATDFGDALTRH 1019
            FLGKD ++++  ++PE+SKEKL+K+V K+D +SDG I  +ELK  I    +RY+  D D+ W +Y  EK    K+ +E+Y                 + A M+ RDE+RWA AD D +  L + E+  F+HPE+ + MRD+V+ ET+DD+DKNKDG++DLDEYI DM+ P    E + +EPDWV++ER  FK+HRD + DGKL++EE+  WI+P   +H  +E  HL+   D NKDG L  +EI+  YD F+GSQATD+G+ L +H
Sbjct:   44 FLGKDTAAEFDELTPEKSKEKLAKLVPKMDADSDGFIEENELKDHINFMQKRYVNNDVDRTWKNYKAEKIVDGKIKWEDYREMVYGSADGAGQELSPEYAKMIARDEKRWAVADYDSNGALDRTEYGCFMHPEDCDHMRDVVVAETVDDIDKNKDGSVDLDEYIGDMYRPDDYPELNGKEPDWVQSEREMFKEHRDKDGDGKLNQEEMRDWIMPVGFDHAEAEARHLVGIADDNKDGKLNLDEIVAHYDTFVGSQATDYGEQLQKH 309          
BLAST of Reticulocalbin 3 vs. Ensembl Celegans
Match: calu-2 (CALUmenin (Calcium-binding protein) homolog [Source:UniProtKB/TrEMBL;Acc:Q9TYS8])

HSP 1 Score: 88.1965 bits (217), Expect = 2.184e-19
Identity = 70/241 (29.05%), Postives = 127/241 (52.70%), Query Frame = 3
Query:  309 SPEESKEKLSKIVDKIDVNSDGKIYPDELKHWITIQSQRYL-RE------DTDKNWADYTIEKDKLTFENXXXXXXXXXXXXXMVKRDERRWAKADIDGDNLLTKEEFFDFLHPEESEKMRDIVIQETIDDMDKNKDGAIDLDEYIRDMFNPEKDEEEPDWVKTERAQFKDHRDLNKDGKLDREEVGQWILPPDHNHVTSETSHLMEQTDANKDGHLTKEEILEKYDVFIGSQATDFGDAL 1010
            S +ES EK +K    +D N+DG +   E+  W++   Q+ + RE      + D+N AD  +  ++   +++  +   + +E  ++ +D+  + +AD D D  L  EE   FL+PE    M  ++I  T+ + D+N DGAI+  E++ ++     ++   +W K E  +F+   D NKDGKL  +E+  W+L       + E   L+  +D +KDG L+ EEI++ + +F  ++A    D L
Sbjct:   45 SGQESVEKFAKA---LDTNNDGFVDKSEILAWVSESYQKTVDREAVERISELDEN-ADGFVSWEEYLADSFPDEELHNKEEESLIAQDKMYFKQADEDNDGKLNLEELASFLNPEHHPHMHPVLIAVTLLEKDQNGDGAIEEKEFLGEL----DEQRGSEWYKVEVERFRTVYDKNKDGKLAGDELTDWLLVDGTTAGSYEAESLLTNSDDDKDGQLSYEEIVKHHALFAKTEAAQEADHL 277          
BLAST of Reticulocalbin 3 vs. Ensembl Celegans
Match: C56C10.9 (pep chromosome:WBcel235:II:6591048:6592351:-1 gene:WBGene00016965.1 transcript:C56C10.9.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C56C10.9)

HSP 1 Score: 52.373 bits (124), Expect = 2.986e-7
Identity = 60/236 (25.42%), Postives = 104/236 (44.07%), Query Frame = 3
Query:  303 NMSPEESK---EKLSKIVDKIDVNSDGKIYPDELKHWITIQSQRYLRE------------DTDKN----WADYTIEKDKLTFENXXXXXXXXXXXX--XMVKRDERRWAKADIDGDNLLTKEEFFDFLHPEESEKMRDIVIQETIDDMDKNKDGAIDLDEYIR------DMFNPEKDEEEPDWVKTERAQFKDHRDLNKDGKLDREEVGQWILPPDHNHVTSETSHLMEQTDANKD 929
            N+ P +SK   E + ++  K DVN DG +   ELK  I    + +L +            DT+K+    W ++     K+  +++      D        V  ++R + ++DI  D  L + E+  FLHPE S +    ++ + +   DKN D  +  D+++       D  NPE +  E    +    +F +  D N DGK    E+  ++ P +    + E + +M  TDAN D
Sbjct:   54 NLDPSDSKQLSESIKEMFKKTDVNDDGFLTAGELKQQIRKNMEEHLEKSKNDSEIFFDIVDTNKDGSIVWEEFEPHFSKMHEKDHSDSELMDVHTEDPHRVDDEKRMFNRSDITRDGRLDRMEWHIFLHPEYSAQGLVEIVNDLMGVYDKNNDEVVSQDDFVNGIPGTVDELNPEFENMEKLEKERRLREFNEEIDENSDGKATFRELYDYVDPQNFRLASKEVNDIMMLTDANND 289          
BLAST of Reticulocalbin 3 vs. Ensembl Fly
Match: scf (gene:FBgn0025682 transcript:FBtr0089942)

HSP 1 Score: 231.876 bits (590), Expect = 1.243e-72
Identity = 128/271 (47.23%), Postives = 169/271 (62.36%), Query Frame = 3
Query:  267 AFLGKDESSKYKNMSPEESKEKLSKIVDKIDVNSDGKIYPDELKHWITIQSQRYLREDTDKNWADY------TIEKDKLT----------FENXXXXXXXXXXXXXMVKRDERRWAKADIDGDNLLTKEEFFDFLHPEESEKMRDIVIQETIDDMDKNKDGAIDLDEYIRDMFNPEKDE-EEPDWVKTERAQFKDHRDLNKDGKLDREEVGQWILPPDHNHVTSETSHLMEQTDANKDGHLTKEEILEKYDVFIGSQATDFGDALTRHSEL 1028
            AFLG DES K+ +++PEES+ +L  IVD+ID N DG +   ELK+WI    +RY+ ED  + W  +      TI  D               + K++         ++KRD  RW+ AD D D+ LTK+EF  FLHPE+   M+ +V++ETI D+DK+ DG I +DEYI DM+     E EEP+WV  ER  F  HRDL+KDG L+ EEV QWI P D +H  +E  HL+ + DA+ D  LTKEEIL+KYDVF+GSQATDFG+AL RH E 
Sbjct:   59 AFLGPDESKKFDSLTPEESRRRLGVIVDRIDENKDGSVTLAELKNWIAYTQRRYIEEDVGRVWKQHNPDNNETISWDSYMQTVYGFMDDLSPDEKEQEENGVSYKSLLKRDRYRWSVADQDLDDNLTKDEFTAFLHPEDHPSMKGVVLRETITDLDKDHDGKISVDEYIGDMYRSTGAEDEEPEWVANEREAFSTHRDLDKDGYLNEEEVKQWIAPHDFDHSEAEAKHLLFEADADHDDKLTKEEILDKYDVFVGSQATDFGEALARHDEF 329          
BLAST of Reticulocalbin 3 vs. Ensembl Fly
Match: scf (gene:FBgn0025682 transcript:FBtr0089941)

HSP 1 Score: 183.726 bits (465), Expect = 8.256e-56
Identity = 93/165 (56.36%), Postives = 118/165 (71.52%), Query Frame = 3
Query:  537 MVKRDERRWAKADIDGDNLLTKEEFFDFLHPEESEKMRDIVIQETIDDMDKNKDGAIDLDEYIRDMFNPEKDE-EEPDWVKTERAQFKDHRDLNKDGKLDREEVGQWILPPDHNHVTSETSHLMEQTDANKDGHLTKEEILEKYDVFIGSQATDFGDALTRHSEL 1028
            ++KRD  RW+ AD D D+ LTK+EF  FLHPE+   M+ +V++ETI D+DK+ DG I +DEYI DM+     E EEP+WV  ER  F  HRDL+KDG L+ EEV QWI P D +H  +E  HL+ + DA+ D  LTKEEIL+KYDVF+GSQATDFG+AL RH E 
Sbjct:   28 LLKRDRYRWSVADQDLDDNLTKDEFTAFLHPEDHPSMKGVVLRETITDLDKDHDGKISVDEYIGDMYRSTGAEDEEPEWVANEREAFSTHRDLDKDGYLNEEEVKQWIAPHDFDHSEAEAKHLLFEADADHDDKLTKEEILDKYDVFVGSQATDFGEALARHDEF 192          
BLAST of Reticulocalbin 3 vs. Ensembl Fly
Match: CG31650 (gene:FBgn0031673 transcript:FBtr0333539)

HSP 1 Score: 122.479 bits (306), Expect = 4.406e-31
Identity = 86/255 (33.73%), Postives = 133/255 (52.16%), Query Frame = 3
Query:  285 ESSKYKNMSPEESKEKLSKIVDKIDVNSDGKIYPDELKHWITIQ------SQRYLREDTDKN----WADY---TIEKDKLTFENXXXXXXXXXXXXXMVKRDERRWAKADIDGDNLLTKEEFFDFLHPEESEKMRDIVIQETIDDMDKNKDGAIDLDEYIRDMFNPEKDEEEPDWVKTERAQFKDHRDLNKDGKLDREEVGQWILPPDHNHVTSETSHLMEQTDANKDGHLTKEEILEKYDVFIGSQATDFGDAL 1010
            E+ ++ ++SP+ESK +L  ++  +D+N D  I   ELK WI  +      + R+   D D +    W +Y   T   +   F+         +DE  M+K+D+  +  AD + D +LT EEF  F +PEE  +M  I+++ T+ D D + DG I+  E++ D  +    E    W+ TE+ +F    D N DG L  +EV  WI+P +      E  HL   TD + D  L+  EIL  YD F+GS+ATD+GD L
Sbjct:   79 EAQEFDSLSPDESKRRLLILIKMMDLNKDEFIDRHELKAWILRKLSEEEAADRFEEIDQDADERITWKEYLQDTYAMEDEDFKKETIDYDSYEDEQKMIKQDKEMFNAADTNKDGVLTLEEFVLFQNPEEHPQMLPILLEHTMQDKDADHDGKINFQEFVGDAASHHDKE----WLITEKERFDKDHDSNGDGVLTGDEVLSWIVPSNTAIANDEVDHLFVSTDEDHDDRLSYLEILNNYDTFVGSEATDYGDHL 329          
BLAST of Reticulocalbin 3 vs. Ensembl Fly
Match: CG31650 (gene:FBgn0031673 transcript:FBtr0301907)

HSP 1 Score: 121.709 bits (304), Expect = 7.781e-31
Identity = 88/259 (33.98%), Postives = 135/259 (52.12%), Query Frame = 3
Query:  285 ESSKYKNMSPEESKEKLSKIVDKIDVNSDGKIYPDELKHWITIQSQRYLRE------------DTDK--NWADY---TIEKDKLTFENXXXXXXXXXXXXXMVKRDERRWAKADIDGDNLLTKEEFFDFLHPEESEKMRDIVIQETIDDMDKNKDGAIDLDEYIRDMFNPEKDEEEPDWVKTERAQFKDHRDLNKDGKLDREEVGQWILPPDHNHVTSETSHLMEQTDANKDGHLTKEEILEKYDVFIGSQATDFGDAL 1010
            E+ ++ ++SP+ESK +L  ++  +D+N D  I   ELK WI ++S + L E            D D+   W +Y   T   +   F+         +DE  M+K+D+  +  AD + D +LT EEF  F +PEE  +M  I+++ T+ D D + DG I+  E++ D  +    E    W+ TE+ +F    D N DG L  +EV  WI+P +      E  HL   TD + D  L+  EIL  YD F+GS+ATD+GD L
Sbjct:   79 EAQEFDSLSPDESKRRLLILIKMMDLNKDEFIDRHELKAWI-LRSFKKLSEEEAADRFEEIDQDADERITWKEYLQDTYAMEDEDFKKETIDYDSYEDEQKMIKQDKEMFNAADTNKDGVLTLEEFVLFQNPEEHPQMLPILLEHTMQDKDADHDGKINFQEFVGDAASHHDKE----WLITEKERFDKDHDSNGDGVLTGDEVLSWIVPSNTAIANDEVDHLFVSTDEDHDDRLSYLEILNNYDTFVGSEATDYGDHL 332          
BLAST of Reticulocalbin 3 vs. Ensembl Fly
Match: CG31650 (gene:FBgn0031673 transcript:FBtr0301905)

HSP 1 Score: 121.709 bits (304), Expect = 7.781e-31
Identity = 88/259 (33.98%), Postives = 135/259 (52.12%), Query Frame = 3
Query:  285 ESSKYKNMSPEESKEKLSKIVDKIDVNSDGKIYPDELKHWITIQSQRYLRE------------DTDK--NWADY---TIEKDKLTFENXXXXXXXXXXXXXMVKRDERRWAKADIDGDNLLTKEEFFDFLHPEESEKMRDIVIQETIDDMDKNKDGAIDLDEYIRDMFNPEKDEEEPDWVKTERAQFKDHRDLNKDGKLDREEVGQWILPPDHNHVTSETSHLMEQTDANKDGHLTKEEILEKYDVFIGSQATDFGDAL 1010
            E+ ++ ++SP+ESK +L  ++  +D+N D  I   ELK WI ++S + L E            D D+   W +Y   T   +   F+         +DE  M+K+D+  +  AD + D +LT EEF  F +PEE  +M  I+++ T+ D D + DG I+  E++ D  +    E    W+ TE+ +F    D N DG L  +EV  WI+P +      E  HL   TD + D  L+  EIL  YD F+GS+ATD+GD L
Sbjct:   79 EAQEFDSLSPDESKRRLLILIKMMDLNKDEFIDRHELKAWI-LRSFKKLSEEEAADRFEEIDQDADERITWKEYLQDTYAMEDEDFKKETIDYDSYEDEQKMIKQDKEMFNAADTNKDGVLTLEEFVLFQNPEEHPQMLPILLEHTMQDKDADHDGKINFQEFVGDAASHHDKE----WLITEKERFDKDHDSNGDGVLTGDEVLSWIVPSNTAIANDEVDHLFVSTDEDHDDRLSYLEILNNYDTFVGSEATDYGDHL 332          
BLAST of Reticulocalbin 3 vs. Ensembl Zebrafish
Match: calua (calumenin a [Source:NCBI gene;Acc:415241])

HSP 1 Score: 261.922 bits (668), Expect = 2.380e-84
Identity = 146/317 (46.06%), Postives = 207/317 (65.30%), Query Frame = 3
Query:  111 KMNIIYFISIIFLVTTFVTCKPPDAKRVLDHELSXXXXXXXXXXXXXXXXXXAFLGKDESSKYKNMSPEESKEKLSKIVDKIDVNSDGKIYPDELKHWITIQSQRYLREDTDKNWADYTIEKDKLT----FENXXXXXX-------XXXXXXXMVKRDERRWAKADIDGDNLLTKEEFFDFLHPEESEKMRDIVIQETIDDMDKNKDGAIDLDEYIRDMFNPEKDEEEPDWVKTERAQFKDHRDLNKDGKLDREEVGQWILPPDHNHVTSETSHLMEQTDANKDGHLTKEEILEKYDVFIGSQATDFGDALTRHSEL 1028
            KM I   +    L   + T KP + K  + H+ + +   + DD  +  YDHDAFLG++E+  + +++PEESK +L KIV+KID + DG +   ELK WI    ++Y+ ++ ++ W D+ +  D++     ++N     Y       +  +   M+ RDERR+  AD +GD++  KEEF  FLHPEE E M+DIV+ ET++D+DKN DG IDL+EYI DM+N E + +EP+WV TER QF + RD NKDGK+DREE   WILP D++H  +E  HL+ ++D NKDG LTKEEIL KYD+F+GSQATDFG+AL RH E 
Sbjct:    2 KMEIRPLLMCFALCVVYATSKPTEKKDRVHHD-APLSSKEHDDGTNFEYDHDAFLGEEEAKTFDDLTPEESKNRLGKIVEKIDADEDGFVTEAELKAWIKKAQKKYIYDNVERQWKDFDLNNDRMISWEEYKNVTYGTYLDDPEPDDGYNYKQMMARDERRFKMADGNGDHIADKEEFTAFLHPEEYEHMKDIVVLETMEDIDKNGDGFIDLEEYIGDMYNHEDEMDEPEWVATEREQFSEFRDKNKDGKMDREETMDWILPADYDHAEAEAKHLVYESDTNKDGKLTKEEILNKYDLFVGSQATDFGEALVRHDEF 317          
BLAST of Reticulocalbin 3 vs. Ensembl Zebrafish
Match: calua (calumenin a [Source:NCBI gene;Acc:415241])

HSP 1 Score: 261.922 bits (668), Expect = 2.380e-84
Identity = 146/317 (46.06%), Postives = 207/317 (65.30%), Query Frame = 3
Query:  111 KMNIIYFISIIFLVTTFVTCKPPDAKRVLDHELSXXXXXXXXXXXXXXXXXXAFLGKDESSKYKNMSPEESKEKLSKIVDKIDVNSDGKIYPDELKHWITIQSQRYLREDTDKNWADYTIEKDKLT----FENXXXXXX-------XXXXXXXMVKRDERRWAKADIDGDNLLTKEEFFDFLHPEESEKMRDIVIQETIDDMDKNKDGAIDLDEYIRDMFNPEKDEEEPDWVKTERAQFKDHRDLNKDGKLDREEVGQWILPPDHNHVTSETSHLMEQTDANKDGHLTKEEILEKYDVFIGSQATDFGDALTRHSEL 1028
            KM I   +    L   + T KP + K  + H+ + +   + DD  +  YDHDAFLG++E+  + +++PEESK +L KIV+KID + DG +   ELK WI    ++Y+ ++ ++ W D+ +  D++     ++N     Y       +  +   M+ RDERR+  AD +GD++  KEEF  FLHPEE E M+DIV+ ET++D+DKN DG IDL+EYI DM+N E + +EP+WV TER QF + RD NKDGK+DREE   WILP D++H  +E  HL+ ++D NKDG LTKEEIL KYD+F+GSQATDFG+AL RH E 
Sbjct:    2 KMEIRPLLMCFALCVVYATSKPTEKKDRVHHD-APLSSKEHDDGTNFEYDHDAFLGEEEAKTFDDLTPEESKNRLGKIVEKIDADEDGFVTEAELKAWIKKAQKKYIYDNVERQWKDFDLNNDRMISWEEYKNVTYGTYLDDPEPDDGYNYKQMMARDERRFKMADGNGDHIADKEEFTAFLHPEEYEHMKDIVVLETMEDIDKNGDGFIDLEEYIGDMYNHEDEMDEPEWVATEREQFSEFRDKNKDGKMDREETMDWILPADYDHAEAEAKHLVYESDTNKDGKLTKEEILNKYDLFVGSQATDFGEALVRHDEF 317          
BLAST of Reticulocalbin 3 vs. Ensembl Zebrafish
Match: rcn3 (reticulocalbin 3, EF-hand calcium binding domain [Source:ZFIN;Acc:ZDB-GENE-040625-175])

HSP 1 Score: 254.988 bits (650), Expect = 1.118e-81
Identity = 150/316 (47.47%), Postives = 200/316 (63.29%), Query Frame = 3
Query:  123 IYFISIIFLVTTFVTCKPPDAKRVLDHELSXXXXXXXXXXXXXXXXXXAFLGKDESSKYKNMSPEESKEKLSKIVDKIDVNSDGKIYPDELKHWITIQSQRYLREDTDKNWADYTIEKDK----LTFENXXXXXX---------XXXXXXXMVKRDERRWAKADIDGDNLLTKEEFFDFLHPEESEKMRDIVIQETIDDMDKNKDGAIDLDEYIRDMFNPEKDEEEPDWVKTERAQFKDHRDLNKDGKLDREEVGQWILPPDHNHVTSETSHLMEQTDANKDGHLTKEEILEKYDVFIGSQATDFGDALT-RHSEL 1028
            + F+  + L        P   KR+  H   D+  H  DD H   +DH+AFLGK+ES  +  +SPEESK++L KIVDKID + DG +   EL HWI  + +RY+ E+ DK+W +Y   KD     + ++N     Y         +      M+ RDERR+  AD DGD + T+EEF  FLHPEE + MRDIVIQETI+D+DKN DG IDL EYI DM+NPE  E EPDWV TE+ QF + RD+NKDG LD  EV  WILP + +H  +E  HL+ +TD + D  +TK+EILE +++F+GSQAT++G+ LT RH EL
Sbjct:    3 LLFLGTLALFAGLSVAVPAQEKRI--HHKLDLSDHPHDDAHGFQFDHEAFLGKEESKTFDQLSPEESKDRLGKIVDKIDTDKDGFVSHAELHHWIKHRQRRYIEENVDKHWNEYDQNKDGKIGWIEYKNTTYGYYIDTEFDDVDDKATYKSMLNRDERRFKSADRDGDGVATREEFTAFLHPEEFDFMRDIVIQETIEDIDKNGDGKIDLQEYIGDMYNPEDGETEPDWVTTEKKQFSEFRDMNKDGFLDATEVSHWILPTEVDHADNEARHLIHETDKDNDDKITKKEILENWNMFVGSQATNYGEDLTKRHDEL 316          
BLAST of Reticulocalbin 3 vs. Ensembl Zebrafish
Match: rcn3 (reticulocalbin 3, EF-hand calcium binding domain [Source:ZFIN;Acc:ZDB-GENE-040625-175])

HSP 1 Score: 254.988 bits (650), Expect = 1.118e-81
Identity = 150/316 (47.47%), Postives = 200/316 (63.29%), Query Frame = 3
Query:  123 IYFISIIFLVTTFVTCKPPDAKRVLDHELSXXXXXXXXXXXXXXXXXXAFLGKDESSKYKNMSPEESKEKLSKIVDKIDVNSDGKIYPDELKHWITIQSQRYLREDTDKNWADYTIEKDK----LTFENXXXXXX---------XXXXXXXMVKRDERRWAKADIDGDNLLTKEEFFDFLHPEESEKMRDIVIQETIDDMDKNKDGAIDLDEYIRDMFNPEKDEEEPDWVKTERAQFKDHRDLNKDGKLDREEVGQWILPPDHNHVTSETSHLMEQTDANKDGHLTKEEILEKYDVFIGSQATDFGDALT-RHSEL 1028
            + F+  + L        P   KR+  H   D+  H  DD H   +DH+AFLGK+ES  +  +SPEESK++L KIVDKID + DG +   EL HWI  + +RY+ E+ DK+W +Y   KD     + ++N     Y         +      M+ RDERR+  AD DGD + T+EEF  FLHPEE + MRDIVIQETI+D+DKN DG IDL EYI DM+NPE  E EPDWV TE+ QF + RD+NKDG LD  EV  WILP + +H  +E  HL+ +TD + D  +TK+EILE +++F+GSQAT++G+ LT RH EL
Sbjct:    3 LLFLGTLALFAGLSVAVPAQEKRI--HHKLDLSDHPHDDAHGFQFDHEAFLGKEESKTFDQLSPEESKDRLGKIVDKIDTDKDGFVSHAELHHWIKHRQRRYIEENVDKHWNEYDQNKDGKIGWIEYKNTTYGYYIDTEFDDVDDKATYKSMLNRDERRFKSADRDGDGVATREEFTAFLHPEEFDFMRDIVIQETIEDIDKNGDGKIDLQEYIGDMYNPEDGETEPDWVTTEKKQFSEFRDMNKDGFLDATEVSHWILPTEVDHADNEARHLIHETDKDNDDKITKKEILENWNMFVGSQATNYGEDLTKRHDEL 316          
BLAST of Reticulocalbin 3 vs. Ensembl Zebrafish
Match: calub (calumenin b [Source:NCBI gene;Acc:394057])

HSP 1 Score: 254.988 bits (650), Expect = 1.131e-81
Identity = 137/314 (43.63%), Postives = 202/314 (64.33%), Query Frame = 3
Query:  120 IIYFISIIFLVTTFVTCKPPDAKRVLDHELSXXXXXXXXXXXXXXXXXXAFLGKDESSKYKNMSPEESKEKLSKIVDKIDVNSDGKIYPDELKHWITIQSQRYLREDTDKNWADYTIEKDKLT----FENXXXXX-------XXXXXXXXMVKRDERRWAKADIDGDNLLTKEEFFDFLHPEESEKMRDIVIQETIDDMDKNKDGAIDLDEYIRDMFNPEKDEEEPDWVKTERAQFKDHRDLNKDGKLDREEVGQWILPPDHNHVTSETSHLMEQTDANKDGHLTKEEILEKYDVFIGSQATDFGDALTRHSEL 1028
            +++F+++  L ++    KP + K  + H++       DD+++       AFLG++E+  +  ++PEESKE+L KIV+KID + DG +  DE+K WI    +R++ ED D+ W  + +  D       ++N             +  +   M+ RDERR+  AD DGD    KEEF  FLHPEE + M+DIV+ ET++D+DKN DG IDL+EYI DM++   D  EP+WVKTER QF + RD NKDG++D++E   WILP D++H  +E  HL+ ++DA+KDG LTK+EI++KYD+F+GSQATDFGDAL RH E 
Sbjct:    6 LLFFVALCILQSS---SKPMEKKDRVHHDVPLSNKDHDDEENFDYDHE-AFLGQEEAKTFDQLTPEESKERLGKIVEKIDEDHDGFVTADEMKRWIKHAQRRWIYEDVDRQWQAHDLNSDSFVSWEEYKNATYGYILDEADPEDGFNYRQMMTRDERRFKMADQDGDLRANKEEFTAFLHPEEFDYMKDIVVLETMEDIDKNGDGLIDLNEYIGDMYSQNGDSSEPEWVKTEREQFTEFRDKNKDGRMDKDETRDWILPADYDHAEAEAKHLLYESDADKDGRLTKQEIVDKYDLFVGSQATDFGDALVRHDEF 315          
BLAST of Reticulocalbin 3 vs. Ensembl Xenopus
Match: calu (calumenin [Source:NCBI gene;Acc:407965])

HSP 1 Score: 250.751 bits (639), Expect = 6.372e-80
Identity = 127/265 (47.92%), Postives = 178/265 (67.17%), Query Frame = 3
Query:  267 AFLGKDESSKYKNMSPEESKEKLSKIVDKIDVNSDGKIYPDELKHWITIQSQRYLREDTDKNWADYTIEKDKLT----FENXXXXX-------XXXXXXXXMVKRDERRWAKADIDGDNLLTKEEFFDFLHPEESEKMRDIVIQETIDDMDKNKDGAIDLDEYIRDMFNPEKDEEEPDWVKTERAQFKDHRDLNKDGKLDREEVGQWILPPDHNHVTSETSHLMEQTDANKDGHLTKEEILEKYDVFIGSQATDFGDALTRHSEL 1028
            AFLG +E+  +  ++PEESKE+L +IV KID + DG +  +EL+ WI    +R++ ED ++ W  + +  D +     ++N                +   M+ RDERR+  AD DGD + TKEEF  FLHPEE + M+DIV+ ET++D+DKN DG IDL+EYI DM+N + D  EP+WVKTER QF + RD N DGK+D+EE   WILP D++H  +E+ HL+ ++D NKD  LT+EEI++KYD+F+GSQATDFG+AL RH E 
Sbjct:   51 AFLGAEEAKTFDQLTPEESKERLGRIVGKIDADKDGYVTVNELRDWIIFAQKRWIYEDVERQWKGHDLNGDSMVSWEEYKNATYGYILDDPDPDNSFNYKQMMVRDERRFKMADQDGDLIATKEEFTAFLHPEEFDYMKDIVVLETMEDIDKNGDGLIDLEEYIGDMYNHDGDANEPEWVKTEREQFVEFRDKNHDGKMDKEETKDWILPSDYDHAEAESRHLVYESDQNKDSKLTREEIVDKYDLFVGSQATDFGEALVRHDEF 315          
BLAST of Reticulocalbin 3 vs. Ensembl Xenopus
Match: rcn3 (reticulocalbin 3 [Source:NCBI gene;Acc:395023])

HSP 1 Score: 250.751 bits (639), Expect = 9.625e-80
Identity = 144/316 (45.57%), Postives = 201/316 (63.61%), Query Frame = 3
Query:  114 MNIIYFISIIFLVTTFVTCKPPDAKRVLDHELSXXXXXXXXXXXXXXXXXXAFLGKDESSKYKNMSPEESKEKLSKIVDKIDVNSDGKIYPDELKHWITIQSQRYLREDTDKNWADYTIEKDKLT----FENXXX-----------XXXXXXXXXXMVKRDERRWAKADIDGDNLLTKEEFFDFLHPEESEKMRDIVIQETIDDMDKNKDGAIDLDEYIRDMFNPEKDEEEPDWVKTERAQFKDHRDLNKDGKLDREEVGQWILPPDHNHVTSETSHLMEQTDANKDGHLTKEEILEKYDVFIGSQATDFGDALTR 1016
            M  +    ++ L  ++V   P   K+   H   D+  H+ DD     YDH+AFLGK+E+  +  ++PEES+ +L KIVDKID + DG +   ELK W+     RY+ E+ +K+WADY   KD +     ++N                 + +    M+ RDERR+  AD DGD + T+EEF  FLHPEE   M+DIVI ETI+D+DKN DG +D+ EYI DM+ P +DE EPDWVKTER QF D RD+NKDGK+DR E+ QWILP D++H   E  HL+ ++D +KDG LTK+EIL+ +++F+GSQAT++G+ LTR
Sbjct:    1 MRSLPVFLLVTLCVSWVMGVPTKEKKDRVHHSKDLSDHEHDDQKGFQYDHEAFLGKEEARTFDQLTPEESQHRLGKIVDKIDKDKDGFVTDIELKEWMKHSQNRYIYENVNKHWADYDKNKDDMISWEEYKNTTYGYLPGEEFYDVADKDKERYRKMMMRDERRFKVADKDGDLIATREEFTAFLHPEEYGYMQDIVITETIEDIDKNDDGIVDVHEYIADMYTPNEDEPEPDWVKTERQQFTDFRDINKDGKMDRTEISQWILPHDYDHADLEAKHLVYESDKDKDGKLTKKEILDNWNMFVGSQATNYGEDLTR 316          
BLAST of Reticulocalbin 3 vs. Ensembl Xenopus
Match: calu (calumenin [Source:NCBI gene;Acc:407965])

HSP 1 Score: 248.054 bits (632), Expect = 8.933e-79
Identity = 127/265 (47.92%), Postives = 179/265 (67.55%), Query Frame = 3
Query:  267 AFLGKDESSKYKNMSPEESKEKLSKIVDKIDVNSDGKIYPDELKHWITIQSQRYLREDTDKNWADYTIEKDKLT----FENXXXXXX-------XXXXXXXMVKRDERRWAKADIDGDNLLTKEEFFDFLHPEESEKMRDIVIQETIDDMDKNKDGAIDLDEYIRDMFNPEKDEEEPDWVKTERAQFKDHRDLNKDGKLDREEVGQWILPPDHNHVTSETSHLMEQTDANKDGHLTKEEILEKYDVFIGSQATDFGDALTRHSEL 1028
            AFLG +E+  +  ++PEESKE+L  IV KID+++DG +   EL  WI    ++Y+ ++ ++ W ++ + +D L     + N     Y          +   M+ RDERR+  AD DGD + TKEEF  FLHPEE + M+DIV+ ET++D+DKN DG IDL+EYI DM+N + D  EP+WVKTER QF + RD N DGK+D+EE   WILP D++H  +E+ HL+ ++D NKD  LT+EEI++KYD+F+GSQATDFG+AL RH E 
Sbjct:   51 AFLGAEEAKTFDQLTPEESKERLGMIVSKIDLDNDGYVTEGELTAWIKKAQKKYVYDNVERQWQEFDLNQDGLVSWDEYRNVTYGTYLDDPDPDNSFNYKQMMVRDERRFKMADQDGDLIATKEEFTAFLHPEEFDYMKDIVVLETMEDIDKNGDGLIDLEEYIGDMYNHDGDANEPEWVKTEREQFVEFRDKNHDGKMDKEETKDWILPSDYDHAEAESRHLVYESDQNKDSKLTREEIVDKYDLFVGSQATDFGEALVRHDEF 315          
BLAST of Reticulocalbin 3 vs. Ensembl Xenopus
Match: fgf11 (fibroblast growth factor 11 [Source:Xenbase;Acc:XB-GENE-479522])

HSP 1 Score: 244.588 bits (623), Expect = 1.787e-77
Identity = 129/270 (47.78%), Postives = 181/270 (67.04%), Query Frame = 3
Query:  267 AFLGKDESSKYKNMSPEESKEKLSKIVDKIDVNSDGKIYPDELKHWITIQSQRYLREDTDKNWADYTIEKDK---------------LTFENXXXXXXXXXXXXXMVKRDERRWAKADIDGDNLLTKEEFFDFLHPEESEKMRDIVIQETIDDMDKNKDGAIDLDEYIRDMFNPEKDEEEPDWVKTERAQFKDHRDLNKDGKLDREEVGQWILPPDHNHVTSETSHLMEQTDANKDGHLTKEEILEKYDVFIGSQATDFGDALTR-HSEL 1028
            AFLGKD++  +  ++PEESK++L KI+++ID +SDG I  +EL  WI    +RY+ E+  + W DY + KD                L      + A E      M+ RDERR+ +AD++GD    +EEF  FLHPEE E M+DIVI ET++D+DKN DG +D DEYI DMF+ E+ + EPDWV TER QF D RD+NKDGK+D+EE+  WILP D++H  +E  HL+ ++D +KD  LTKEE+L+ +++F+GSQAT++G+ LTR H EL
Sbjct:   52 AFLGKDDAKTFDQLTPEESKDRLGKIINRIDSDSDGLITTEELTAWIKRVQKRYVYENVARVWKDYDVNKDNTISWEEYKQATYGYYLANPEEFQDAAEQFSFKKMLPRDERRFKQADLNGDLEANREEFTSFLHPEEFEHMKDIVILETLEDIDKNGDGFVDQDEYIADMFSHEEGQPEPDWVATEREQFADFRDINKDGKMDKEEIRHWILPQDYDHAQAEARHLIYESDLDKDKVLTKEEVLQNWNMFVGSQATNYGEDLTRNHDEL 321          
BLAST of Reticulocalbin 3 vs. Ensembl Xenopus
Match: rcn3 (reticulocalbin 3 [Source:NCBI gene;Acc:395023])

HSP 1 Score: 234.958 bits (598), Expect = 1.081e-73
Identity = 140/318 (44.03%), Postives = 197/318 (61.95%), Query Frame = 3
Query:  114 MNIIYFISIIFLVTTFVTCKPPDAKRVLDHELSXXXXXXXXXXXXXXXXXXAFLGKDESSKYKNMSPEESKEKLSKIVDKIDVNSDGKIYPDELKHWITIQSQRYLREDTDKNWADYTIEKDKLTF-----------------ENXXXXXXXXXXXXXMVKRDERRWAKADIDGDNLLTKEEFFDFLHPEESEKMRDIVIQETIDDMDKNKDGAIDLDEYIRDMFNPEKDEEEPDWVKTERAQFKDHRDLNKDGKLDREEVGQWILPPDHNHVTSETSHLMEQTDANKDGHLTKEEILEKYDVFIGSQATDFGDALTR 1016
            M  +    ++ L  ++V   P   K+   H   D+  H+ DD     YDH+AFLGK+E+  +  ++PEES+ +L KI+D++D ++D  I   EL  WI   S+R+  ED++K    Y   KD +                   E Y     + +    M+ RDERR+  AD DGD + T+EEF  FLHPEE   M+DIVI ETI+D+DKN DG +D+ EYI DM+ P +DE EPDWVKTER QF D RD+NKDGK+DR E+ QWILP D++H   E  HL+ ++D +KDG LTK+EIL+ +++F+GSQAT++G+ LTR
Sbjct:    1 MRSLPVFLLVTLCVSWVMGVPTKEKKDRVHHSKDLSDHEHDDQKGFQYDHEAFLGKEEARTFDQLTPEESQHRLGKIIDQMDKDNDKYITSGELFAWIKHVSRRWNLEDSEKQGKKYDTNKDGMISWDEYAKGVYGHLLGKGEEFYDVADKDKERYRKMMMRDERRFKVADKDGDLIATREEFTAFLHPEEYGYMQDIVITETIEDIDKNDDGIVDVHEYIADMYTPNEDEPEPDWVKTERQQFTDFRDINKDGKMDRTEISQWILPHDYDHADLEAKHLVYESDKDKDGKLTKKEILDNWNMFVGSQATNYGEDLTR 318          
BLAST of Reticulocalbin 3 vs. Ensembl Mouse
Match: Calu (calumenin [Source:MGI Symbol;Acc:MGI:1097158])

HSP 1 Score: 266.544 bits (680), Expect = 3.771e-86
Identity = 147/316 (46.52%), Postives = 208/316 (65.82%), Query Frame = 3
Query:  114 MNIIYFISIIFLVTTFVTCKPPDAKRVLDHELSXXXXXXXXXXXXXXXXXXAFLGKDESSKYKNMSPEESKEKLSKIVDKIDVNSDGKIYPDELKHWITIQSQRYLREDTDKNWADYTIEKDKLT----FENXXXXXX-------XXXXXXXMVKRDERRWAKADIDGDNLLTKEEFFDFLHPEESEKMRDIVIQETIDDMDKNKDGAIDLDEYIRDMFNPEKDEEEPDWVKTERAQFKDHRDLNKDGKLDREEVGQWILPPDHNHVTSETSHLMEQTDANKDGHLTKEEILEKYDVFIGSQATDFGDALTRHSEL 1028
            M++  F+  + L T F   KP + K  + HE   +     +D  + +YDHDAFLG +E+  +  ++PEESKE+L KIV KID + DG +  DELK WI    +R++ ED ++ W  + + +D L     ++N             +  +   M+ RDERR+  AD DGD + TKEEF  FLHPEE + M+DIV+QET++D+DKN DG IDL+EYI DM++ + + +EP+WVKTER QF + RD N+DGK+D+EE   WILP D++H  +E  HL+ ++D NKDG LTKEEI++KYD+F+GSQATDFG+AL RH E 
Sbjct:    1 MDLRQFLMCLSLCTAFALSKPTEKKDRVHHE-PQLSDKVHNDAQNFDYDHDAFLGAEEAKSFDQLTPEESKERLGKIVSKIDDDKDGFVTVDELKGWIKFAQKRWIHEDVERQWKGHDLNEDGLVSWEEYKNATYGYVLDDPDPDDGFNYKQMMVRDERRFKMADKDGDLIATKEEFTAFLHPEEYDYMKDIVVQETMEDIDKNADGFIDLEEYIGDMYSHDGNADEPEWVKTEREQFVEFRDKNRDGKMDKEETKDWILPSDYDHAEAEARHLVYESDQNKDGKLTKEEIVDKYDLFVGSQATDFGEALVRHDEF 315          
BLAST of Reticulocalbin 3 vs. Ensembl Mouse
Match: Calu (calumenin [Source:MGI Symbol;Acc:MGI:1097158])

HSP 1 Score: 262.307 bits (669), Expect = 1.841e-84
Identity = 145/316 (45.89%), Postives = 207/316 (65.51%), Query Frame = 3
Query:  114 MNIIYFISIIFLVTTFVTCKPPDAKRVLDHELSXXXXXXXXXXXXXXXXXXAFLGKDESSKYKNMSPEESKEKLSKIVDKIDVNSDGKIYPDELKHWITIQSQRYLREDTDKNWADYTIEKDKLT----FENXXXXXX-------XXXXXXXMVKRDERRWAKADIDGDNLLTKEEFFDFLHPEESEKMRDIVIQETIDDMDKNKDGAIDLDEYIRDMFNPEKDEEEPDWVKTERAQFKDHRDLNKDGKLDREEVGQWILPPDHNHVTSETSHLMEQTDANKDGHLTKEEILEKYDVFIGSQATDFGDALTRHSEL 1028
            M++  F+  + L T F   KP + K  + HE   +     +D  + +YDHDAFLG +E+  +  ++PEESKE+L  IVDKID + DG +   ELK WI    ++Y+ ++ +  W ++ + +D L     + N     Y       +  +   M+ RDERR+  AD DGD + TKEEF  FLHPEE + M+DIV+QET++D+DKN DG IDL+EYI DM++ + + +EP+WVKTER QF + RD N+DGK+D+EE   WILP D++H  +E  HL+ ++D NKDG LTKEEI++KYD+F+GSQATDFG+AL RH E 
Sbjct:    1 MDLRQFLMCLSLCTAFALSKPTEKKDRVHHE-PQLSDKVHNDAQNFDYDHDAFLGAEEAKSFDQLTPEESKERLGMIVDKIDADKDGFVTEGELKSWIKHAQKKYIYDNVENQWQEFDMNQDGLISWDEYRNVTYGTYLDDPDPDDGFNYKQMMVRDERRFKMADKDGDLIATKEEFTAFLHPEEYDYMKDIVVQETMEDIDKNADGFIDLEEYIGDMYSHDGNADEPEWVKTEREQFVEFRDKNRDGKMDKEETKDWILPSDYDHAEAEARHLVYESDQNKDGKLTKEEIVDKYDLFVGSQATDFGEALVRHDEF 315          
BLAST of Reticulocalbin 3 vs. Ensembl Mouse
Match: Rcn1 (reticulocalbin 1 [Source:MGI Symbol;Acc:MGI:104559])

HSP 1 Score: 241.891 bits (616), Expect = 1.981e-76
Identity = 132/270 (48.89%), Postives = 186/270 (68.89%), Query Frame = 3
Query:  267 AFLGKDESSKYKNMSPEESKEKLSKIVDKIDVNSDGKIYPDELKHWITIQSQRYLREDTDKNWADYTIEKD-KLTFENXXXX--------------XXXXXXXXXMVKRDERRWAKADIDGDNLLTKEEFFDFLHPEESEKMRDIVIQETIDDMDKNKDGAIDLDEYIRDMFNPEKDEEEPDWVKTERAQFKDHRDLNKDGKLDREEVGQWILPPDHNHVTSETSHLMEQTDANKDGHLTKEEILEKYDVFIGSQATDFGDALTR-HSEL 1028
            AFLGK++S  +  +SP+ESKE+L KIVD+ID + DG +  +ELK WI    +RY+ ++  K W DY  +KD K+++E YK+               + +      M+ RDERR+  +D+DGD   T+EEF  FLHPEE E M++IV+ ET++D+DKN DG +D DEYI DMF+ E +  EPDWV +ER QF D RDLNKDGKLD++E+  WILP D++H  +E  HL+ ++D NKD  LTKEEIL+ +++F+GSQAT++G+ LT+ H EL
Sbjct:   56 AFLGKEDSKTFDQLSPDESKERLGKIVDRIDSDGDGLVTTEELKLWIKRVQKRYIYDNVAKVWKDYDRDKDEKISWEEYKQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKASDLDGDLTATREEFTAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFSHEDNGPEPDWVLSEREQFNDFRDLNKDGKLDKDEIRHWILPQDYDHAQAEARHLVYESDKNKDEMLTKEEILDNWNMFVGSQATNYGEDLTKNHDEL 325          
BLAST of Reticulocalbin 3 vs. Ensembl Mouse
Match: Rcn3 (reticulocalbin 3, EF-hand calcium binding domain [Source:MGI Symbol;Acc:MGI:1277122])

HSP 1 Score: 235.343 bits (599), Expect = 6.750e-74
Identity = 119/267 (44.57%), Postives = 177/267 (66.29%), Query Frame = 3
Query:  267 AFLGKDESSKYKNMSPEESKEKLSKIVDKIDV--NSDGKIYPDELKHWITIQSQRYLREDTDKNWADYTIEKD-KLTFENXXXXXXX-------------XXXXXXMVKRDERRWAKADIDGDNLLTKEEFFDFLHPEESEKMRDIVIQETIDDMDKNKDGAIDLDEYIRDMFNPEKDEEEPDWVKTERAQFKDHRDLNKDGKLDREEVGQWILPPDHNHVTSETSHLMEQTDANKDGHLTKEEILEKYDVFIGSQATDFGDALTRH 1019
            AFLG+D + ++  +SPEES+ +L +IVD++D+  +SDG +   EL+ WI    QR++R+     W  Y  ++D ++ +E  +   Y               +    M+ RDERR+  AD DGD++ T+EE   FLHPEE   MRDIV+ ET++D+DKNKDG + ++EYI D+++ E  EEEP WV+TER QF++ RDLNKDG+LD  EVG W+LPP  +    E +HL+ ++D +KDG L+K EIL  +++F+GSQAT++G+ LTRH
Sbjct:   58 AFLGRDVAKEFDKLSPEESQARLGRIVDRMDLAGDSDGWVSLAELRAWIAHTQQRHIRDSVSAAWHTYDTDRDGRVGWEELRNATYGHYEPGEEFHDVEDAETYKKMLARDERRFRVADQDGDSMATREELTAFLHPEEFPHMRDIVVAETLEDLDKNKDGYVQVEEYIADLYSEEPGEEEPAWVQTERQQFREFRDLNKDGRLDGSEVGYWVLPPSQDQPLVEANHLLHESDTDKDGRLSKAEILSNWNMFVGSQATNYGEDLTRH 324          
BLAST of Reticulocalbin 3 vs. Ensembl Mouse
Match: Rcn3 (reticulocalbin 3, EF-hand calcium binding domain [Source:MGI Symbol;Acc:MGI:1277122])

HSP 1 Score: 235.343 bits (599), Expect = 6.750e-74
Identity = 119/267 (44.57%), Postives = 177/267 (66.29%), Query Frame = 3
Query:  267 AFLGKDESSKYKNMSPEESKEKLSKIVDKIDV--NSDGKIYPDELKHWITIQSQRYLREDTDKNWADYTIEKD-KLTFENXXXXXXX-------------XXXXXXMVKRDERRWAKADIDGDNLLTKEEFFDFLHPEESEKMRDIVIQETIDDMDKNKDGAIDLDEYIRDMFNPEKDEEEPDWVKTERAQFKDHRDLNKDGKLDREEVGQWILPPDHNHVTSETSHLMEQTDANKDGHLTKEEILEKYDVFIGSQATDFGDALTRH 1019
            AFLG+D + ++  +SPEES+ +L +IVD++D+  +SDG +   EL+ WI    QR++R+     W  Y  ++D ++ +E  +   Y               +    M+ RDERR+  AD DGD++ T+EE   FLHPEE   MRDIV+ ET++D+DKNKDG + ++EYI D+++ E  EEEP WV+TER QF++ RDLNKDG+LD  EVG W+LPP  +    E +HL+ ++D +KDG L+K EIL  +++F+GSQAT++G+ LTRH
Sbjct:   58 AFLGRDVAKEFDKLSPEESQARLGRIVDRMDLAGDSDGWVSLAELRAWIAHTQQRHIRDSVSAAWHTYDTDRDGRVGWEELRNATYGHYEPGEEFHDVEDAETYKKMLARDERRFRVADQDGDSMATREELTAFLHPEEFPHMRDIVVAETLEDLDKNKDGYVQVEEYIADLYSEEPGEEEPAWVQTERQQFREFRDLNKDGRLDGSEVGYWVLPPSQDQPLVEANHLLHESDTDKDGRLSKAEILSNWNMFVGSQATNYGEDLTRH 324          
BLAST of Reticulocalbin 3 vs. UniProt/SwissProt
Match: sp|Q6XLQ7|CALU_RABIT (Calumenin OS=Oryctolagus cuniculus OX=9986 GN=CALU PE=1 SV=2)

HSP 1 Score: 267.314 bits (682), Expect = 1.456e-85
Identity = 148/316 (46.84%), Postives = 207/316 (65.51%), Query Frame = 3
Query:  114 MNIIYFISIIFLVTTFVTCKPPDAKRVLDHELSXXXXXXXXXXXXXXXXXXAFLGKDESSKYKNMSPEESKEKLSKIVDKIDVNSDGKIYPDELKHWITIQSQRYLREDTDKNWADYTIEKDKLT----FENXXXXXX-------XXXXXXXMVKRDERRWAKADIDGDNLLTKEEFFDFLHPEESEKMRDIVIQETIDDMDKNKDGAIDLDEYIRDMFNPEKDEEEPDWVKTERAQFKDHRDLNKDGKLDREEVGQWILPPDHNHVTSETSHLMEQTDANKDGHLTKEEILEKYDVFIGSQATDFGDALTRHSEL 1028
            M++  F+  + L T F   KP + K  + HE   +     DD    +YDHDAFLG +E+  +  ++PEESKE+L KIV KID + DG +  DELK WI    +R++ ED ++ W  + + +D L     ++N             +  +   M+ RDERR+  AD DGD + TKEEF  FLHPEE + M+DIV+QET++D+DKN DG IDL+EYI DM++ + + +EP+WVKTER QF + RD N+DGK+D+EE   WILP D++H  +E  HL+ ++D NKDG LTKEEI++KYD+F+GSQATDFG+AL RH E 
Sbjct:    1 MDLRQFLMCLSLCTAFALSKPTEKKDRVHHE-PQLSDKVHDDAQSFDYDHDAFLGAEEAKTFDQLTPEESKERLGKIVSKIDADKDGFVTVDELKDWIKFAQKRWIYEDVERQWKGHDLNEDGLVSWEEYKNATYGYVLDDPDPDDGFNYKQMMVRDERRFKMADKDGDLIATKEEFTAFLHPEEYDYMKDIVVQETMEDIDKNGDGFIDLEEYIGDMYSHDGNADEPEWVKTEREQFVEFRDKNRDGKMDKEETKDWILPSDYDHAEAEARHLVYESDQNKDGKLTKEEIVDKYDLFVGSQATDFGEALVRHDEF 315          
BLAST of Reticulocalbin 3 vs. UniProt/SwissProt
Match: sp|O35887|CALU_MOUSE (Calumenin OS=Mus musculus OX=10090 GN=Calu PE=1 SV=1)

HSP 1 Score: 266.544 bits (680), Expect = 2.637e-85
Identity = 147/316 (46.52%), Postives = 208/316 (65.82%), Query Frame = 3
Query:  114 MNIIYFISIIFLVTTFVTCKPPDAKRVLDHELSXXXXXXXXXXXXXXXXXXAFLGKDESSKYKNMSPEESKEKLSKIVDKIDVNSDGKIYPDELKHWITIQSQRYLREDTDKNWADYTIEKDKLT----FENXXXXXX-------XXXXXXXMVKRDERRWAKADIDGDNLLTKEEFFDFLHPEESEKMRDIVIQETIDDMDKNKDGAIDLDEYIRDMFNPEKDEEEPDWVKTERAQFKDHRDLNKDGKLDREEVGQWILPPDHNHVTSETSHLMEQTDANKDGHLTKEEILEKYDVFIGSQATDFGDALTRHSEL 1028
            M++  F+  + L T F   KP + K  + HE   +     +D  + +YDHDAFLG +E+  +  ++PEESKE+L KIV KID + DG +  DELK WI    +R++ ED ++ W  + + +D L     ++N             +  +   M+ RDERR+  AD DGD + TKEEF  FLHPEE + M+DIV+QET++D+DKN DG IDL+EYI DM++ + + +EP+WVKTER QF + RD N+DGK+D+EE   WILP D++H  +E  HL+ ++D NKDG LTKEEI++KYD+F+GSQATDFG+AL RH E 
Sbjct:    1 MDLRQFLMCLSLCTAFALSKPTEKKDRVHHE-PQLSDKVHNDAQNFDYDHDAFLGAEEAKSFDQLTPEESKERLGKIVSKIDDDKDGFVTVDELKGWIKFAQKRWIHEDVERQWKGHDLNEDGLVSWEEYKNATYGYVLDDPDPDDGFNYKQMMVRDERRFKMADKDGDLIATKEEFTAFLHPEEYDYMKDIVVQETMEDIDKNADGFIDLEEYIGDMYSHDGNADEPEWVKTEREQFVEFRDKNRDGKMDKEETKDWILPSDYDHAEAEARHLVYESDQNKDGKLTKEEIVDKYDLFVGSQATDFGEALVRHDEF 315          
BLAST of Reticulocalbin 3 vs. UniProt/SwissProt
Match: sp|O43852|CALU_HUMAN (Calumenin OS=Homo sapiens OX=9606 GN=CALU PE=1 SV=2)

HSP 1 Score: 266.544 bits (680), Expect = 2.907e-85
Identity = 147/316 (46.52%), Postives = 207/316 (65.51%), Query Frame = 3
Query:  114 MNIIYFISIIFLVTTFVTCKPPDAKRVLDHELSXXXXXXXXXXXXXXXXXXAFLGKDESSKYKNMSPEESKEKLSKIVDKIDVNSDGKIYPDELKHWITIQSQRYLREDTDKNWADYTIEKDKLT----FENXXXXXX-------XXXXXXXMVKRDERRWAKADIDGDNLLTKEEFFDFLHPEESEKMRDIVIQETIDDMDKNKDGAIDLDEYIRDMFNPEKDEEEPDWVKTERAQFKDHRDLNKDGKLDREEVGQWILPPDHNHVTSETSHLMEQTDANKDGHLTKEEILEKYDVFIGSQATDFGDALTRHSEL 1028
            M++  F+  + L T F   KP + K  + HE   +     +D    +YDHDAFLG +E+  +  ++PEESKE+L KIV KID + DG +  DELK WI    +R++ ED ++ W  + + +D L     ++N             +  +   M+ RDERR+  AD DGD + TKEEF  FLHPEE + M+DIV+QET++D+DKN DG IDL+EYI DM++ + + +EP+WVKTER QF + RD N+DGK+D+EE   WILP D++H  +E  HL+ ++D NKDG LTKEEI++KYD+F+GSQATDFG+AL RH E 
Sbjct:    1 MDLRQFLMCLSLCTAFALSKPTEKKDRVHHE-PQLSDKVHNDAQSFDYDHDAFLGAEEAKTFDQLTPEESKERLGKIVSKIDGDKDGFVTVDELKDWIKFAQKRWIYEDVERQWKGHDLNEDGLVSWEEYKNATYGYVLDDPDPDDGFNYKQMMVRDERRFKMADKDGDLIATKEEFTAFLHPEEYDYMKDIVVQETMEDIDKNADGFIDLEEYIGDMYSHDGNTDEPEWVKTEREQFVEFRDKNRDGKMDKEETKDWILPSDYDHAEAEARHLVYESDQNKDGKLTKEEIVDKYDLFVGSQATDFGEALVRHDEF 315          
BLAST of Reticulocalbin 3 vs. UniProt/SwissProt
Match: sp|Q5RDD8|CALU_PONAB (Calumenin OS=Pongo abelii OX=9601 GN=CALU PE=2 SV=1)

HSP 1 Score: 265.774 bits (678), Expect = 5.439e-85
Identity = 147/316 (46.52%), Postives = 207/316 (65.51%), Query Frame = 3
Query:  114 MNIIYFISIIFLVTTFVTCKPPDAKRVLDHELSXXXXXXXXXXXXXXXXXXAFLGKDESSKYKNMSPEESKEKLSKIVDKIDVNSDGKIYPDELKHWITIQSQRYLREDTDKNWADYTIEKDKLT----FENXXXXXX-------XXXXXXXMVKRDERRWAKADIDGDNLLTKEEFFDFLHPEESEKMRDIVIQETIDDMDKNKDGAIDLDEYIRDMFNPEKDEEEPDWVKTERAQFKDHRDLNKDGKLDREEVGQWILPPDHNHVTSETSHLMEQTDANKDGHLTKEEILEKYDVFIGSQATDFGDALTRHSEL 1028
            M++  F+  + L T F   KP + K  + HE   +     +D    +YDHDAFLG +E+  +  ++PEESKE+L KIV KID + DG +  DELK WI    +R++ ED ++ W  + + +D L     ++N             +  +   M+ RDERR+  AD DGD + TKEEF  FLHPEE + M+DIV+QET++D+DKN DG IDL+EYI DM++ + + +EP+WVKTER QF + RD N+DGK+D+EE   WILP D++H  +E  HL+ ++D NKDG LTKEEI++KYD+F+GSQATDFG+AL RH E 
Sbjct:    1 MDLRQFLMCLSLCTAFALSKPTEKKDRVHHE-PQLSDKVHNDAQSFDYDHDAFLGAEEAKTFDQLTPEESKERLGKIVSKIDDDKDGFVTVDELKDWIKFAQKRWIYEDVERQWKGHDLNEDGLVSWEEYKNATYGYVLDDPDPDDGFNYKQMMVRDERRFKMADKDGDLIATKEEFTAFLHPEEYDYMKDIVVQETMEDIDKNADGFIDLEEYIGDMYSHDGNTDEPEWVKTEREQFVEFRDKNRDGKMDKEETKDWILPSDYDHAEAEARHLVYESDQNKDGKLTKEEIVDKYDLFVGSQATDFGEALVRHDEF 315          
BLAST of Reticulocalbin 3 vs. UniProt/SwissProt
Match: sp|Q4U471|CALU_MESAU (Calumenin OS=Mesocricetus auratus OX=10036 GN=CALU PE=2 SV=1)

HSP 1 Score: 260.766 bits (665), Expect = 5.414e-83
Identity = 144/316 (45.57%), Postives = 207/316 (65.51%), Query Frame = 3
Query:  114 MNIIYFISIIFLVTTFVTCKPPDAKRVLDHELSXXXXXXXXXXXXXXXXXXAFLGKDESSKYKNMSPEESKEKLSKIVDKIDVNSDGKIYPDELKHWITIQSQRYLREDTDKNWADYTIEKDKLT----FENXXXXXX-------XXXXXXXMVKRDERRWAKADIDGDNLLTKEEFFDFLHPEESEKMRDIVIQETIDDMDKNKDGAIDLDEYIRDMFNPEKDEEEPDWVKTERAQFKDHRDLNKDGKLDREEVGQWILPPDHNHVTSETSHLMEQTDANKDGHLTKEEILEKYDVFIGSQATDFGDALTRHSEL 1028
            M++  F+  + L T F   KP + K  + HE   +     +D  + +YDHDAFLG +E+  +  ++PEESKE+L KIV KID + DG +  DELK WI    +R++ ED ++ W  + + +D L     ++N             +  +   M+ RDERR+  AD DGD + TKEEF  F HP+E + M+DIV+QET++D+DKN DG IDL+EYI DM++ + + +EP+WVKTER QF + RD N+DG++D+EE   WILP D++H  +E  HL+ ++D NKDG LTKEEI++KYD+F+GSQATDFG+AL RH E 
Sbjct:    1 MDLRQFLLCLSLCTAFALSKPTEKKDRVHHE-PQLSDKVHNDAQNFDYDHDAFLGAEEAKSFDQLTPEESKERLGKIVSKIDDDKDGFVTVDELKGWIKFAQKRWIHEDVERQWKGHDLNEDGLVSWEEYKNATYGYVLDDPDPDDGFNYKQMMVRDERRFKMADKDGDLIATKEEFTAFPHPDEYDYMKDIVVQETMEDIDKNADGFIDLEEYIGDMYSHDGNADEPEWVKTEREQFVEFRDKNRDGRMDKEETKDWILPSDYDHAEAEARHLVYESDQNKDGKLTKEEIVDKYDLFVGSQATDFGEALVRHDEF 315          
BLAST of Reticulocalbin 3 vs. TrEMBL
Match: A0A1I8IEK6 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000851g2 PE=4 SV=1)

HSP 1 Score: 280.411 bits (716), Expect = 4.412e-88
Identity = 152/284 (53.52%), Postives = 205/284 (72.18%), Query Frame = 3
Query:  189 RVLDHELSXXXXXXXXXXXXXXXXXXAFLGKDESSKYKNMSPEESKEKLSKIVDKIDVNSDGKIYPDELKHWITIQSQRYLREDTDKNWADY-TIEKDKL---TFENXXXXXXXXXXXXXMVKRDERRWAKADIDGDNLLTKEEFFDFLHPEESEKMRDIVIQETIDDMDKNKDGAIDLDEYIRDMFNPEKDEEEPDWVKTERAQFKDHRDLNKDGKLDREEVGQWILPPDHNHVTSETSHLMEQTDANKDGHLTKEEILEKYDVFIGSQATDFGDALTRHSEL 1028
            RV  H+LSD++H +D+D+ D  YDH+AFLGK++SSK+  MSPEESK  L KIVDKID ++DG +   EL  WI   S+RY+ ED+ K + DY +   DKL   T++        D+  +  + RD+RRW +AD DGD +L+  EF DF HPEE+  MR++V  ET++DMDK+KDG +D++EYI DM+ P   E+EPDWVKTER  F + RD NKDG+LD+ E+  WI+P D+NHV +ET HLM Q D +KDG L+++EI++KYDVF+GSQATDFG+AL RH EL
Sbjct:   47 RVYQHDLSDLDHDEDEDEDDHKYDHEAFLGKEDSSKFDKMSPEESKANLGKIVDKIDKDNDGMVTEKELSDWIDYISKRYVTEDSRKQFLDYASSPADKLSWDTYKARNFGKDTDEATSKSMSRDQRRWQRADRDGDGMLSLAEFTDFTHPEEAPHMRELVGLETLEDMDKDKDGGVDINEYIADMWTPSAGEQEPDWVKTERETFSNVRDKNKDGRLDQAEIASWIVPEDYNHVEAETRHLMSQADTDKDGRLSRQEIMDKYDVFVGSQATDFGEALGRHEEL 330          
BLAST of Reticulocalbin 3 vs. TrEMBL
Match: A0A1I8GA22 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000851g1 PE=4 SV=1)

HSP 1 Score: 280.026 bits (715), Expect = 6.442e-88
Identity = 152/284 (53.52%), Postives = 205/284 (72.18%), Query Frame = 3
Query:  189 RVLDHELSXXXXXXXXXXXXXXXXXXAFLGKDESSKYKNMSPEESKEKLSKIVDKIDVNSDGKIYPDELKHWITIQSQRYLREDTDKNWADY-TIEKDKL---TFENXXXXXXXXXXXXXMVKRDERRWAKADIDGDNLLTKEEFFDFLHPEESEKMRDIVIQETIDDMDKNKDGAIDLDEYIRDMFNPEKDEEEPDWVKTERAQFKDHRDLNKDGKLDREEVGQWILPPDHNHVTSETSHLMEQTDANKDGHLTKEEILEKYDVFIGSQATDFGDALTRHSEL 1028
            RV  H+LSD++H +D+D+ D  YDH+AFLGK++SSK+  MSPEESK  L KIVDKID ++DG +   EL  WI   S+RY+ ED+ K + DY +   DKL   T++        D+  +  + RDERRW +AD DGD +L+  EF DF HPEE+  MR++V  ET++DMDK+KDG +D++EYI DM+ P   E+EPDWVKTER  F + RD NKDG+LD+ E+  WI+P D+NHV +ET HLM Q D +KDG L+++EI++KYDVF+GSQATDFG+AL +H EL
Sbjct:   47 RVYQHDLSDLDHDEDEDEDDHKYDHEAFLGKEDSSKFDKMSPEESKANLGKIVDKIDKDNDGMVTEKELSDWIDYISKRYVTEDSRKQFLDYASSPADKLSWDTYKARNFGKDTDEATSKSMSRDERRWQRADRDGDGMLSLAEFTDFTHPEEAPHMRELVGLETLEDMDKDKDGGVDINEYIADMWTPSAGEQEPDWVKTERETFSNVRDKNKDGRLDQAEIASWIVPEDYNHVEAETRHLMSQADTDKDGRLSRQEIMDKYDVFVGSQATDFGEALGKHEEL 330          
BLAST of Reticulocalbin 3 vs. TrEMBL
Match: A0A1I8FV93 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000851g3 PE=4 SV=1)

HSP 1 Score: 279.641 bits (714), Expect = 9.406e-88
Identity = 152/284 (53.52%), Postives = 204/284 (71.83%), Query Frame = 3
Query:  189 RVLDHELSXXXXXXXXXXXXXXXXXXAFLGKDESSKYKNMSPEESKEKLSKIVDKIDVNSDGKIYPDELKHWITIQSQRYLREDTDKNWADY-TIEKDKL---TFENXXXXXXXXXXXXXMVKRDERRWAKADIDGDNLLTKEEFFDFLHPEESEKMRDIVIQETIDDMDKNKDGAIDLDEYIRDMFNPEKDEEEPDWVKTERAQFKDHRDLNKDGKLDREEVGQWILPPDHNHVTSETSHLMEQTDANKDGHLTKEEILEKYDVFIGSQATDFGDALTRHSEL 1028
            RV  H+LSD++H +D+D+ D  YDH+AFLGK++SSK+  MSPEESK  L KIVDKID ++DG +   EL  WI   S+RY+ ED+ K + DY +   DKL   T++        D+  +  + RD+RRW +AD DGD +L   EF DF HPEE+  MR++V  ET++DMDK+KDG +D++EYI DM+ P   E+EPDWVKTER  F + RD NKDG+LD+ E+  WI+P D+NHV +ET HLM Q D +KDG L+++EI++KYDVF+GSQATDFG+AL RH EL
Sbjct:   47 RVYQHDLSDLDHDEDEDEDDHKYDHEAFLGKEDSSKFDKMSPEESKANLGKIVDKIDKDNDGMVTEKELSDWIDYISKRYVTEDSRKQFLDYASSPADKLSWDTYKARNFGKDTDEATSKSMSRDQRRWQRADRDGDGMLNLAEFTDFTHPEEAPHMRELVGLETLEDMDKDKDGGVDINEYIADMWTPSAGEQEPDWVKTERETFSNVRDKNKDGRLDQAEIASWIVPEDYNHVEAETRHLMSQADTDKDGRLSRQEIMDKYDVFVGSQATDFGEALGRHEEL 330          
BLAST of Reticulocalbin 3 vs. TrEMBL
Match: A0A183W6T8 (Uncharacterized protein OS=Trichobilharzia regenti OX=157069 GN=TRE_LOCUS7948 PE=4 SV=1)

HSP 1 Score: 277.715 bits (709), Expect = 2.741e-87
Identity = 147/317 (46.37%), Postives = 212/317 (66.88%), Query Frame = 3
Query:  114 MNIIYFISIIFLVTTF-VTCKPPDAKRVLDHELSXXXXXXXXXXXXXXXXXXAFLGKDESSKYKNMSPEESKEKLSKIVDKIDVNSDGKIYPDELKHWITIQSQRYLREDTDKNWADYTI-EKDKLTFENXXXX---------XXXXXXXXXMVKRDERRWAKADIDGDNLLTKEEFFDFLHPEESEKMRDIVIQETIDDMDKNKDGAIDLDEYIRDMFNPEK-DEEEPDWVKTERAQFKDHRDLNKDGKLDREEVGQWILPPDHNHVTSETSHLMEQTDANKDGHLTKEEILEKYDVFIGSQATDFGDALTRHSEL 1028
            M ++Y + +  L  +F +     DA  V D E S +  H+            AFLGKDE+ ++ +++PEESKEKL +IV+KID N DG+I  DE+  WI+  S R L EDTD+ W +Y + + DK+++E +  +           +D+ +  +++RDERRW  AD DGD  L+KEEF  FLHPE   KMRD++++ET++++DKN DG +DLDEYI+D++ P   +E EP+WVKTER +F   RDLN DGKLD EEV +W++P D NHV +E +HL  ++DA++DG L+K EIL +YD+F+GSQAT+FG+ LT H EL
Sbjct:    1 MKLLYIVLVTTLCISFKLEVDLSDAPHVHDGEHSSVYDHE------------AFLGKDEAQRFDDLTPEESKEKLGQIVNKIDQNGDGQITTDEMAAWISKVSNRMLLEDTDRTWREYGLSDGDKMSWEKHVNELVGEDGEYEDEDDETKKTLLQRDERRWKTADTDGDGKLSKEEFLAFLHPEHEPKMRDVIVKETMEEVDKNHDGYVDLDEYIKDLWTPNSPNEAEPEWVKTEREEFSKRRDLNGDGKLDAEEVKKWVVPEDFNHVQAEVTHLFSESDADQDGKLSKNEILNRYDLFVGSQATNFGEILTSHDEL 305          
BLAST of Reticulocalbin 3 vs. TrEMBL
Match: A0A2R2MS28 (calumenin-A-like OS=Lingula unguis OX=7574 GN=LOC106177426 PE=4 SV=1)

HSP 1 Score: 280.796 bits (717), Expect = 3.136e-86
Identity = 157/324 (48.46%), Postives = 215/324 (66.36%), Query Frame = 3
Query:  114 MNIIYFISIIFLVTTFVTCKPPDAK-----RVLDHELSXXXXXXXXXXXXXXXXXXAFLGKDESSKYKNMSPEESKEKLSKIVDKIDVNSDGKIYPDELKHWITIQSQRYLREDTDKNWA-DYTIEKDKLTFE-------------NXXXXXXXXXXXXXMVKRDERRWAKADIDGDNLLTKEEFFDFLHPEESEKMRDIVIQETIDDMDKNKDGAIDLDEYIRDMFNPEKDEEEPDWVKTERAQFKDHRDLNKDGKLDREEVGQWILPPDHNHVTSETSHLMEQTDANKDGHLTKEEILEKYDVFIGSQATDFGDALTRHSEL 1028
            M     + ++ LV T  +   P        R LD +LSD +H++ ++ +       AFLG++E+  +  ++PEESKE+LSKI+DKID N DG++  +ELK WI    +RY+ +DT++ W  D  +E DKLT+E                K      D  DM+ RDERR+ KAD DGD  LTK+EF +FLHPEE+E MR+IV+ ET++D+DK+KDG I L EYI DM+  + DEEEPDWVK ER QF  +RD NKDG +D++EV  WI+PPD++H  +E  HL+ ++D +KDG LTKEEIL+KYD+F+GSQATDFG+ALTRH E 
Sbjct:  158 MRSCACMVVLALVATSRSSAIPTKSEDHKSRSLDKDLSDEQHYEGEEHNAEYDHE-AFLGQEEAKTFDQLTPEESKERLSKIIDKIDRNQDGQVSEEELKEWIQHVQKRYVYQDTERQWVQDQKVEGDKLTWEAYKDRTYGFLKDGRDTKAGDSGYDYKDMMDRDERRFKKADADGDGALTKDEFANFLHPEEAEHMREIVVLETMEDIDKDKDGKISLQEYIGDMWPNKDDEEEPDWVKNEREQFGAYRDKNKDGYMDKDEVKDWIIPPDYDHSEAEAKHLIHESDRDKDGQLTKEEILDKYDLFVGSQATDFGEALTRHDEF 480          

HSP 2 Score: 82.4185 bits (202), Expect = 3.743e-13
Identity = 51/133 (38.35%), Postives = 80/133 (60.15%), Query Frame = 3
Query:  114 MNIIYFISIIFLVTTFVTCKPPDAK-----RVLDHELSXXXXXXXXXXXXXXXXXXAFLGKDESSKYKNMSPEESKEKLSKIVDKIDVNSDGKIYPDELKHWITIQSQRYLREDTDKNWA-DYTIEKDKLTFE 494
            M     + ++ LV T  +   P        R LD +LSD +H++ ++ +       AFLG++E+  +  ++PEESKE+LSKI+DKID N DG++  +ELK WI    +RY+ +DT++ W  D  +E DKLT+E
Sbjct:    7 MRSCACMVVLALVATSRSSAIPTKSDDHKSRSLDKDLSDEQHYEGEEHNAEYDHE-AFLGQEEAKTFDQLTPEESKERLSKIIDKIDRNQDGQVSEEELKEWIQHVQKRYVYQDTERQWVQDQKVEGDKLTWE 138          
BLAST of Reticulocalbin 3 vs. Ensembl Cavefish
Match: calua (calumenin [Source:NCBI gene;Acc:103043492])

HSP 1 Score: 253.062 bits (645), Expect = 5.102e-81
Identity = 140/316 (44.30%), Postives = 207/316 (65.51%), Query Frame = 3
Query:  114 MNIIYFISIIFLVTTFVTCKPPDAKRVLDHELSXXXXXXXXXXXXXXXXXXAFLGKDESSKYKNMSPEESKEKLSKIVDKIDVNSDGKIYPDELKHWITIQSQRYLREDTDKNWADYTIEKDKLT----FENXXXXXX-------XXXXXXXMVKRDERRWAKADIDGDNLLTKEEFFDFLHPEESEKMRDIVIQETIDDMDKNKDGAIDLDEYIRDMFNPEKDEEEPDWVKTERAQFKDHRDLNKDGKLDREEVGQWILPPDHNHVTSETSHLMEQTDANKDGHLTKEEILEKYDVFIGSQATDFGDALTRHSEL 1028
            M +   +    L   + T KP + K  + H+ + +   + +D  + +YDHDAFLG++ +  + +++PEESK++L KIV+KID + DG +   ELK WI    ++Y+ ++ D+ W D+ +  D +     ++N     Y       +  +   M+ RDERR+  AD +GD++  KEEF  FLHPEE E M++IV+ ET++D+DKN DG IDL+EYI DM+N E + +EP+WV TER QF + RD NKDGK+D+EE   WILP D++H  +E  HL+ ++D+NKDG L+KEEIL KYD+F+GSQATDFG+AL RH E 
Sbjct:    1 MEVRPLLMCFALCVVYATSKPTEKKDRVHHD-APLSSKEHNDGENFDYDHDAFLGEEVAKSFDDLTPEESKDRLGKIVEKIDDDQDGFVTEAELKEWIKKAQKKYIYDNVDRQWKDFDMNNDGMISWDEYKNVTYGTYLDDPEPDDGYNYKQMMARDERRFKMADRNGDSIADKEEFTAFLHPEEYEHMKEIVVLETMEDIDKNGDGFIDLEEYIGDMYNHEDEMDEPEWVATEREQFSEFRDKNKDGKMDKEETMDWILPADYDHAEAEAKHLVYESDSNKDGKLSKEEILNKYDLFVGSQATDFGEALVRHDEF 315          
BLAST of Reticulocalbin 3 vs. Ensembl Cavefish
Match: calub (calumenin-B [Source:NCBI gene;Acc:103027690])

HSP 1 Score: 250.366 bits (638), Expect = 6.290e-80
Identity = 139/316 (43.99%), Postives = 197/316 (62.34%), Query Frame = 3
Query:  114 MNIIYFISIIFLVTTFVTCKPPDAKRVLDHELSXXXXXXXXXXXXXXXXXXAFLGKDESSKYKNMSPEESKEKLSKIVDKIDVNSDGKIYPDELKHWITIQSQRYLREDTDKNWADYTIEKDKLT----FENXXXXXXXXXX-------XXXMVKRDERRWAKADIDGDNLLTKEEFFDFLHPEESEKMRDIVIQETIDDMDKNKDGAIDLDEYIRDMFNPEKDEEEPDWVKTERAQFKDHRDLNKDGKLDREEVGQWILPPDHNHVTSETSHLMEQTDANKDGHLTKEEILEKYDVFIGSQATDFGDALTRHSEL 1028
            M +   +  I L    ++ KP D K  + H+ S      +DD++       AFLG++E+  +  ++PEESKE+L  IVDKID + D  +  +ELK WI    +R++ ED D+ W  + +  D       ++N       DD           M+ RDERR+  AD DG+    KEEF  FLHPEE + M+DIV+ ET++D+DKN DG IDLDEYI DM++ + D  EP+WV+TER QF + RD NKDG++D+EE   WILP D++H  +E  HL+ ++D +KDG LTK+EI++KYD+F+GSQATDFG+AL RH E 
Sbjct:    1 MELWPLLLCIVLCVVHISSKPMDKKDRVHHDASLSNKEHEDDENFDYDHE-AFLGQEEAKTFDQLTPEESKERLGLIVDKIDEDHDAHVTVEELKKWIKHAQKRWIYEDVDRQWQSHDLNADGYVSWEEYKNATYGYILDDSDPDDGFNYRQMMARDERRFKMADTDGNLQADKEEFTAFLHPEEYDYMKDIVVLETMEDIDKNGDGFIDLDEYIGDMYSQDGDPTEPEWVRTEREQFTEFRDKNKDGRMDKEETRDWILPSDYDHAEAEAKHLLYESDTDKDGMLTKQEIVDKYDLFVGSQATDFGEALVRHDEF 315          
BLAST of Reticulocalbin 3 vs. Ensembl Cavefish
Match: rcn3 (reticulocalbin 3 [Source:NCBI gene;Acc:103045651])

HSP 1 Score: 248.054 bits (632), Expect = 4.248e-79
Identity = 145/316 (45.89%), Postives = 199/316 (62.97%), Query Frame = 3
Query:  123 IYFISIIFLVTTFVTCKPPDAKRVLDHELSXXXXXXXXXXXXXXXXXXAFLGKDESSKYKNMSPEESKEKLSKIVDKIDVNSDGKIYPDELKHWITIQSQRYLREDTDKNWADYTIEKDK-------------LTFENXXXXXXXXXXXXXMVKRDERRWAKADIDGDNLLTKEEFFDFLHPEESEKMRDIVIQETIDDMDKNKDGAIDLDEYIRDMFNPEKDEEEPDWVKTERAQFKDHRDLNKDGKLDREEVGQWILPPDHNHVTSETSHLMEQTDANKDGHLTKEEILEKYDVFIGSQATDFGDALTR-HSEL 1028
            +  +S+I  VT  V   PP  KRV  H   D+  H  DD H   YDH+AFLGK+E+  +  ++PEESK KL KIVD+ID + DG +   EL HWI  + +RY+ E+ DK+W +Y  +KD                 ++        +    M+ RDERR+  AD DGD + ++EEF  FLHPEE   M+D+V+QET++D+DKN DG I+L+EYI DM+  E  E EP+WV TE+ QF + RD+NKDG LD  EV QWILP D +H   E  HL+ +TD + D  +TK+EILE +++F+GSQAT++G+ LTR H EL
Sbjct:    3 LLLLSLIVGVTVAV---PPQEKRV--HHQRDLSDHAHDDAHSFQYDHEAFLGKEEAKTFDQLTPEESKAKLGKIVDRIDTDKDGFVSHAELHHWIKHRQRRYIEENVDKHWKEYDQDKDGKIAWTEYKNTTYGFYLDDEFSDVENRESYKAMLMRDERRFKVADKDGDGIASREEFTAFLHPEEFSYMKDLVVQETVEDIDKNGDGKINLEEYIGDMYTSEDGENEPEWVNTEKKQFSEFRDVNKDGFLDASEVAQWILPGDVDHADIEAKHLIHETDRDNDDKMTKKEILENWNMFVGSQATNYGEDLTRKHDEL 313          
BLAST of Reticulocalbin 3 vs. Ensembl Cavefish
Match: rcn1 (reticulocalbin 1 [Source:NCBI gene;Acc:103039743])

HSP 1 Score: 242.276 bits (617), Expect = 1.147e-76
Identity = 132/270 (48.89%), Postives = 183/270 (67.78%), Query Frame = 3
Query:  267 AFLGKDESSKYKNMSPEESKEKLSKIVDKIDVNSDGKIYPDELKHWITIQSQRYLREDTDKNWADYTIEKD-KLTFENXXXXXXXXXXX--------------XXMVKRDERRWAKADIDGDNLLTKEEFFDFLHPEESEKMRDIVIQETIDDMDKNKDGAIDLDEYIRDMFNPEKDEEEPDWVKTERAQFKDHRDLNKDGKLDREEVGQWILPPDHNHVTSETSHLMEQTDANKDGHLTKEEILEKYDVFIGSQATDFGDALTR-HSEL 1028
            AFLGK+++  +  +SP ES+++L KIVD+ID + +G I  +ELK WI    +RY+ E+  K W+DY + KD K++++ YK+  Y                     M+ RDERR+  AD+DGD    +EEF  FLHPEE + M++IV+ ET++D+DKN DG +D DEYI DMF  E+   EPDWVKTER QF D RDLNKDGK+D EE+  WILP D++H  +E  HL+ ++D +KD  LTKEEILE +++F+GSQAT++G+ LTR H EL
Sbjct:   52 AFLGKEDAKTFDQLSPAESRDRLGKIVDRIDADGNGYITTEELKAWIKRVQKRYVYENVAKVWSDYDLNKDNKISWDEYKQATYGYYLANPEEFEDATDQFSFKKMLPRDERRFKLADLDGDLAAEREEFTAFLHPEEFDHMKEIVVLETMEDIDKNGDGHVDEDEYIADMFAHEEGGPEPDWVKTERDQFSDFRDLNKDGKMDLEEIRHWILPQDYDHAQAEARHLLLESDTDKDQMLTKEEILENWNMFVGSQATNYGEDLTRNHDEL 321          
BLAST of Reticulocalbin 3 vs. Ensembl Cavefish
Match: rcn2 (reticulocalbin 2 [Source:NCBI gene;Acc:103045530])

HSP 1 Score: 139.043 bits (349), Expect = 1.517e-37
Identity = 90/271 (33.21%), Postives = 141/271 (52.03%), Query Frame = 3
Query:  267 AFLGKDESSKYKNMSPEESKEKLSKIVDKIDVNSDGKIYPDELKHWITIQSQRYLREDTDKNWADYTIEKDKLTF----------------ENXXXXXXXXXXXXXMVKRDERRWAKADIDGDNLLTKEEFFDFLHPEESEKMRDIVIQETIDDMDKNKDGAIDLDEYIRDMFNPEKDEEEPDWVKTERAQFKDHRDLNKDGKLDREEVGQWILPPDHNHVTSETSHLMEQTDANKDGHLTKEEILEKYDVFIGSQATDFGDAL-TRHSEL 1028
            AFL  ++  + K +SP E + K+ +IV +ID +SD  + P+E+  WI    +RY  +D  + +  + I  D L                  EN   +  E++    +  +++RR+  AD DG + L   EF  F HP E + M D  I++ + + D +KDG I L E+I D+   E DE    W   E  +FKD  D NKDGKL+R+E  +W+ P  +     E  HL+++ D + D  L++ EIL+  D+F+ S+ TD+G  L   H EL
Sbjct:   32 AFLDDEDKDEIKKLSPSEQRGKMVEIVKRIDTDSDKFLTPEEITVWIQRVYKRYAMDDAQERFPGFDINSDGLVTWDEYNMVMHGHTVEVDENAVLEDPEEESLRFLHLKEKRRFDFADTDGTSGLNVTEFLAFTHPSEVDHMSDFAIEDVLSEYDLDKDGFISLSEFIGDLRASESDEP-SQWEAEETVRFKDLYDQNKDGKLNRDEQLRWVAPNSYGSAREEAVHLIKEMDQDGDERLSETEILKNQDIFMNSEVTDYGRQLHVPHDEL 301          
BLAST of Reticulocalbin 3 vs. Ensembl Sea Lamprey
Match: CALU (calumenin [Source:HGNC Symbol;Acc:HGNC:1458])

HSP 1 Score: 262.692 bits (670), Expect = 2.385e-85
Identity = 141/310 (45.48%), Postives = 198/310 (63.87%), Query Frame = 3
Query:  132 ISIIFLVTTFVTCKPPDAKRVLDHELSXXXXXXXXXXXXXXXXXXAFLGKDESSKYKNMSPEESKEKLSKIVDKIDVNSDGKIYPDELKHWITIQSQRYLREDTDKNWADYTIEKDK-----------LTFENXXXXXXXXXXXXXMVKRDERRWAKADIDGDNLLTKEEFFDFLHPEESEKMRDIVIQETIDDMDKNKDGAIDLDEYIRDMFNPEKDEEEPDWVKTERAQFKDHRDLNKDGKLDREEVGQWILPPDHNHVTSETSHLMEQTDANKDGHLTKEEILEKYDVFIGSQATDFGDALTRHSEL 1028
            ++ + L       KP   K+   H    +   + DD+   +YDH+AFLG + +  +  +SPEESKE+L KIV+KID + DG +  DE+  WI    +R++ ED D+ W  + I+ D              F        +  +   M+ RDERR+  AD+DGD   +KEEF  FLHPEE E M+DI++ ET++D+DKN DG IDL+EYI DM+N   + EEP+WVKTER QF D RD NKDGK+D+EE   WILP D++H  +E  HL+ ++D++KDG L+KEEIL+K+D+F+GSQAT+FG+ALTRH E 
Sbjct:    8 VAFVALCAWLALAKPTAEKKNRVHPDEPLSEKKHDDEQSFDYDHEAFLGAETAKTFDQLSPEESKERLGKIVEKIDSDGDGLVTQDEMTMWIKHTQRRWVYEDVDRQWTGHDIDGDGSVSWEEYRNATYGFLAVSPIEEDGFNYKQMLGRDERRFKAADVDGDGQASKEEFTAFLHPEEFEHMKDIIVTETMEDIDKNGDGFIDLNEYIGDMYNQAGESEEPEWVKTERQQFTDFRDTNKDGKMDKEETMAWILPSDYDHAEAEARHLIYESDSDKDGKLSKEEILDKHDLFVGSQATNFGEALTRHDEF 317          
BLAST of Reticulocalbin 3 vs. Ensembl Sea Lamprey
Match: CALU (calumenin [Source:HGNC Symbol;Acc:HGNC:1458])

HSP 1 Score: 196.438 bits (498), Expect = 8.451e-61
Identity = 102/239 (42.68%), Postives = 155/239 (64.85%), Query Frame = 3
Query:  342 IVDKIDVNSDGKIYPDELKHWITIQSQRYLREDTDKNWADYTIEKDKLT----FENXXXXXXXXX------XXXXMVKRDERRWAKADIDGDNLLTKEEFFDFLHPEESEKMRDIVIQETIDDMDKNKDGAIDLDEYIRDMFNPEKDEEEPDWVKTERAQFKDHRDLNKDGKLDREEVGQWILPPDHNHVTSETSHLMEQTDANKDGHLTKEEILEKYDVFIGSQATDFGDALTRHSEL 1028
            IV +ID N DG +   EL  WI    +R++ E+ ++ W+ + ++ D       ++N       ++          MV RDERR+  AD+DGD   ++ E+  FLHPEE   MR++V+ ETI+D+DKN DG I++DEYI DM++ E +E + +WV++ER QF + RD + DG +  +EV  WILP D++   +E+ HL+ + D ++DG+LT+EEI+ KYD+F+GSQATDFG+AL RH EL
Sbjct:    2 IVTRIDENGDGLVTETELTEWIRHAQRRWVLEEAERQWSSHDLDGDGYVNWAEYKNATYSYLAEEDPEDPDGYRAMVLRDERRFQAADVDGDGRASRNEYAAFLHPEEHPHMRNLVVTETIEDIDKNGDGFINVDEYIGDMYSEESEEGDSEWVESERKQFAELRDTDGDGLMGHDEVAAWILPDDYDQAEAESKHLIHECDDDQDGNLTREEIIAKYDLFVGSQATDFGEALMRHDEL 240          
BLAST of Reticulocalbin 3 vs. Ensembl Sea Lamprey
Match: rcn2 (reticulocalbin 2 [Source:ZFIN;Acc:ZDB-GENE-050706-62])

HSP 1 Score: 110.923 bits (276), Expect = 2.491e-28
Identity = 60/169 (35.50%), Postives = 100/169 (59.17%), Query Frame = 3
Query:  537 MVKRDERRWAKADIDGDNLLTKEEFFDFLHPEESEKMRDIVIQETIDDMDKNKDGAIDLDEYIRDMF-NPEKDEEEPDWVKTERAQFKDHRDLNKDGKLDREEVGQWILPPDHNHVTSETSHLMEQTDANKDGHLTKEEILEKYDVFIGSQATDFGDAL----TRHSEL 1028
            +  R+++++ KAD DG   L   EF  F HPEE + M+D V++E + + DK+ DG +DL E++ D   +P   + +P+WV TE  +F    D++ DGKL+  E+  W++P +      ET HL+E  D + DG L+ +E+++  ++F+ S+ TD+G  L      H EL
Sbjct:   76 LYAREKKKFGKADSDGVQGLNITEFLAFEHPEEFDYMQDSVLEEALLEHDKDGDGFVDLAEFLGDYHRDPSTPQSDPEWVITETDKFTSEFDIDHDGKLNPSELLSWLMPNNLEVAEDETEHLLEHMDTDGDGQLSHDEVVQNKELFLTSEVTDYGRQLGEQYAHHEEL 244          
BLAST of Reticulocalbin 3 vs. Ensembl Sea Lamprey
Match: rcn2 (reticulocalbin 2 [Source:ZFIN;Acc:ZDB-GENE-050706-62])

HSP 1 Score: 110.153 bits (274), Expect = 2.769e-28
Identity = 60/169 (35.50%), Postives = 100/169 (59.17%), Query Frame = 3
Query:  537 MVKRDERRWAKADIDGDNLLTKEEFFDFLHPEESEKMRDIVIQETIDDMDKNKDGAIDLDEYIRDMF-NPEKDEEEPDWVKTERAQFKDHRDLNKDGKLDREEVGQWILPPDHNHVTSETSHLMEQTDANKDGHLTKEEILEKYDVFIGSQATDFGDAL----TRHSEL 1028
            +  R+++++ KAD DG   L   EF  F HPEE + M+D V++E + + DK+ DG +DL E++ D   +P   + +P+WV TE  +F    D++ DGKL+  E+  W++P +      ET HL+E  D + DG L+ +E+++  ++F+ S+ TD+G  L      H EL
Sbjct:   61 LYAREKKKFGKADSDGVQGLNITEFLAFEHPEEFDYMQDSVLEEALLEHDKDGDGFVDLAEFLGDYHRDPSTPQSDPEWVITETDKFTSEFDIDHDGKLNPSELLSWLMPNNLEVAEDETEHLLEHMDTDGDGQLSHDEVVQNKELFLTSEVTDYGRQLGEQYAHHEEL 229          
BLAST of Reticulocalbin 3 vs. Ensembl Sea Lamprey
Match: sdf4 (stromal cell derived factor 4 [Source:NCBI gene;Acc:406360])

HSP 1 Score: 85.1149 bits (209), Expect = 4.399e-19
Identity = 66/254 (25.98%), Postives = 124/254 (48.82%), Query Frame = 3
Query:  330 KLSKIVDKIDVNSDGKIYPDELKHWITIQSQRYLREDTDKN----------------WADYTI---------EKDKLTFENXXXXXXXXXXXXXMVKRDERRWAKAD-IDGDNLLTKEEFFDFLHPEESEKMRDIVIQETIDDMDKNKDGAIDLDEYIRDMFNPEKDEEEPD----WVKTERAQFKDHRDLNKDGKLDREEVGQWILPPDHNHVTSETSHLMEQTDANKDGHLTKEEILEKYDVFIGSQATDFG 1001
            +L   + ++D + D +I   EL+ WI  +++ +L++  D+N                W +Y +         EKD       K++   D++  +++   + RW +AD    D  L ++EF  F HPE S  M   ++QE I D+D++KD  + L E+        ++++E D    WV+  R +F +  D NKDG + R E+ +++ P   ++  SE   ++   D ++D  L+ +E+L   + F GS+  D+ 
Sbjct:    1 RLCASLVRVDKDRDKRISAVELQEWIVEKTREHLQQALDENKPHFRTLDPDGDGLVTWDEYRLRYLVSKGFDEKDIAERIRDKQELKIDEETEELMDNLKERWNQADDAPQDQKLNEKEFLSFQHPEHSRSMLSYMVQEIIHDLDQDKDQRLSLSEFASLPLGTVENQKEQDIDDDWVRERRKEFIEVIDSNKDGFITRSELEEYMDPTSSHNALSEAKQMISVADEDEDAQLSLDEVLRYSEYFTGSKLVDYA 254          
BLAST of Reticulocalbin 3 vs. Ensembl Nematostella
Match: EDO32638 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUH8])

HSP 1 Score: 263.462 bits (672), Expect = 3.442e-85
Identity = 154/329 (46.81%), Postives = 215/329 (65.35%), Query Frame = 3
Query:  132 ISIIFLVTTFVTCKPPDAK--RVLDHELSXXXX-XXXXXXXXXXXXXXAFLGKDESSKYKNMSPEESKEKLSKIVDKIDVNSDGKIYPDELKHWITIQSQRYLREDTDKNWADY-TIEKDKL-------------------------TFENXXXXXXXXXXXXXMVKRDERRWAKADIDGDNLLTKEEFFDFLHPEESEKMRDIVIQETIDDMDKNKDGAIDLDEYIRDMF-NPEKDEEEPDWVKTERAQFKDHRDLNKDGKLDREEVGQWILPPDHNHVTSETSHLMEQTDANKDGHLTKEEILEKYDVFIGSQATDFGDALTRHSEL 1028
            I ++  +      +P D K  RV D ++S+ EH    + +H+  YDH+AFLG DE   +  +SPEESKE+L K+VDKIDV+ DGK+  +ELK WI   ++RY+ ED D+ W     IE  K+                         T+   K+    + +  +M+KRD RRW KADI+ D+ L+KEE+  FLHPEE E M+D+V++ET+DD+DKNKDG + L+EY+ D++   EK++EEPDWVKTER QF   RD N+DGK+D++EV  WI+P D +HV +E +HL+ + D NKDG+LTK EI++K++VF GSQATDFGDALTRH E 
Sbjct:    5 IIVLLCICAVALARPQDKKKTRVFDGKVSEEEHFRGTEQEHNTEYDHEAFLG-DEKKTFDQLSPEESKERLGKLVDKIDVDHDGKVTEEELKQWIKKSAKRYVYEDVDRQWDHLKKIEHAKIKMDDLVDGKRVDMAAPIGWEEYKNNTYGFIKEDDKSEYNYDNMIKRDRRRWEKADINRDDKLSKEEYTAFLHPEEYEYMKDVVVEETLDDIDKNKDGYVSLEEYLGDLYPESEKEDEEPDWVKTEREQFLTVRDKNRDGKMDKDEVRDWIVPADFDHVGAEVTHLINEADVNKDGYLTKSEIIDKHEVFAGSQATDFGDALTRHDEF 332          
BLAST of Reticulocalbin 3 vs. Ensembl Nematostella
Match: EDO35844 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKE6])

HSP 1 Score: 163.696 bits (413), Expect = 3.913e-47
Identity = 104/264 (39.39%), Postives = 154/264 (58.33%), Query Frame = 3
Query:  267 AFLGKDESSKYKNMSPEESKEKLSKIVDKIDVNSDGKIYPDELKHWI-TIQSQRYLR------------EDTDKNWADYTIEKDKLTFENXXXXXXXXXXXXXMVKRDERRWAKADIDGDNLLTKEEFFDFLHPEESEKMRDIVIQETIDDMDKNKDGAIDLDEYIRDMFNPEKDEEEPDWVKTERAQFKDHRDLNKDGKLDREEVGQWILP-PDHNHVTSETSHLMEQTDANKDGHLTKEEILEKYDVFIGSQATDFGDALTR 1016
            AFLG  E  ++ ++ PEE+K++L  ++ ++D N DG +  +EL  W+  +  +R +             ED   +W +Y+    K T+ +  +   E  +    ++RD+RR+  AD + D  LT+EE   FLHPE S +M ++ I ETI+D+D++KDG I L E++ +    E+  E PDWVK E  +F +  D NKDGKLD+EEV  WILP  DH     E  HL+   D N DG LT EEI + Y VF+GS+ATD+G AL +
Sbjct:   52 AFLGT-EKEEFDHLPPEEAKKRLRALIREVDNNKDGAVTTEELTDWVKGVFKKRSMEGVDNDLKEKDANEDGKVDWNEYS----KGTYGDQTEDDEEMKE---FLRRDKRRFDAADTNKDGFLTREEMAIFLHPESSPEMSEVHILETIEDIDRDKDGLISLKEFLGEY--EEEPGEVPDWVKDETNRFNEEYDKNKDGKLDKEEVRLWILPETDHLMAAEEAKHLVSSADDNSDGKLTIEEIEKNYAVFVGSEATDYGRALPK 305          
BLAST of Reticulocalbin 3 vs. Ensembl Nematostella
Match: EDO47673 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLD6])

HSP 1 Score: 163.31 bits (412), Expect = 4.027e-47
Identity = 94/271 (34.69%), Postives = 154/271 (56.83%), Query Frame = 3
Query:  267 AFLGKDESSKYKNMSPEESKEKLSKIVDKIDVNSDGKIYPDELKHWITIQSQRYLREDTDKNWADYTIEKDKLT-----------------FENXXXXXXXXXXXXXMVKRDERRWAKADIDGDNLLTKEEFFDFLHPEESEKMRDIVIQETIDDMDKNKDGAIDLDEYIRDMFNPEKDEEEPDWVKTERAQFKDHRDLNKDGKLDREEVGQWILPPDHNHVTSETSHLMEQTDANKDGHLTKEEILEKYDVFIGSQATDFGDALTRHSEL 1028
            AFLG+D+  ++ +++P+ESK +L  IVD+ID + DG+I   E+K WI     RY  +D D+ W      ++++                  ++         D      +RD ++W  AD + D  L+KEEF    HP   + M+D+V+ E++ D+D N+DG I  +E++      +  EEE + +   R +F +HRD NKDG+LDR E+  ++ P  ++HV +E  HL+ + D N+DG LTK+EI++ ++ F+GS+A +FG AL RH E 
Sbjct:   29 AFLGQDKK-EFDSLTPQESKRRLGLIVDRIDKDQDGRITYTEMKEWINYAGNRYAFDDGDRLWKAIKKREEQIAKKENKSFNPDAPIDWDLYKEDAFGKTITDANEKRYQRDRKQWEVADRNKDTKLSKEEFPALFHPSVFDYMQDLVLDESMLDIDTNRDGYISQEEFLGKATEEKGTEEEKEMIARRRQEFLEHRDTNKDGRLDRRELKDYLFPA-YDHVGAEAQHLINEVDKNEDGMLTKDEIMDNFEKFVGSRAAEFGQALNRHEEF 297          
BLAST of Reticulocalbin 3 vs. Ensembl Nematostella
Match: EDO31169 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYP9])

HSP 1 Score: 155.221 bits (391), Expect = 2.223e-44
Identity = 97/272 (35.66%), Postives = 159/272 (58.46%), Query Frame = 3
Query:  267 AFLGKDESSKYKNMSPEESKEKLSKIVDKIDVNSDGKIYPDELKHWITIQSQRYLR-------EDTDKN------WADYT-IEKD-----KLTFENXXXXXXXXXXXXXMVKRDERRWAKADIDGDNLLTKEEFFDFLHPEESEKMRDIVIQETIDDMDKNKDGAIDLDEY---IRDMFNPEKDEEEPDWVKTERAQFKDHRDLNKDGKLDREEVGQWILPPDHNHVTSETSHLMEQTDANKDGHLTKEEILEKYDVFIGSQATDFGDALTR 1016
            AFLG+D+++++  ++P+++K++L ++  KIDV+ D KI   EL  WI +  +++ R       E  DKN      W +Y  +E D      ++ EN             M KRDE+RW  AD+D DNLLT +E   F+HPEE+ +M  +++QE ++ +D +KDG I   EY   +  M+   +D +  D +K+ +  F +  D +KDG L++EE+  WI P   +  + E  HLM + D NKD  LT +EI+E+Y++F GS+AT++G+ L +
Sbjct:    6 AFLGEDQAAEFDELTPKQTKQRLRELFPKIDVDQDQKISLKELVEWIDVNMKKHTRKSSESRMEQMDKNKDGKVSWEEYVNVEYDPKNEKGMSNENKDHLKE-------MKKRDEKRWKHADMDNDNLLTIDELQMFIHPEETPRMTSVLVQENMEMLDSDKDGKISFAEYAGKLSVMWRMREDNQ--DSLKSLKDDFNNDLDKDKDGSLNKEELKSWIFPS-GSPSSGEAEHLMTEVDKNKDNFLTVDEIMERYELFAGSRATNYGNMLKK 267          
BLAST of Reticulocalbin 3 vs. Ensembl Nematostella
Match: EDO42789 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0S7])

HSP 1 Score: 133.65 bits (335), Expect = 3.235e-36
Identity = 88/262 (33.59%), Postives = 143/262 (54.58%), Query Frame = 3
Query:  267 AFLGKDESSKYKNMSPEESKEKLSKIVDKIDVNSDGKIYPDELKHWITIQSQRY-LREDTDK-------------NWADYTIEKDKLTFENXXXXXXXXXXXXXMVKRDERRWAKADIDGDNLLTKEEFFDFLHPEESEKMRDIVIQETIDDMDKNKDGAIDLDEYIRDMFNPEKDEEEPDWVKTERAQFKDHRDLNKDGKLDREEVGQWILPPDHNHVTSETSHLMEQTDANKDGHLTKEEILEKYDVFIGSQATDFGDAL 1010
            AFLG++ + +++N+SPEE++ +L  +V +ID+N DG +   EL+ WI  + +++ + ED D               W ++ +     T E+  KK   ++ +   ++ D R+W  AD D D+ LT+EE+  F HP+E E M   +  + + + DK+KDG + L EY+  +       E PD+   ++  F++  D NKDGKLD +EV  W  P + N    E  HL+E  D N DG L+ +EI+  ++ F GS AT FG   
Sbjct:   10 AFLGEEMAKEFENLSPEEARRRLRMLVPRIDINKDGFVEEAELEIWIRHKMKKWEVEEDVDAIFRDMDFNNDNHATWKEFMMRTYGFTDEDINKKWERNNLKD-YIEDDRRKWKYADQDKDSRLTREEYEYFHHPKEHEVMIPYIAMKVMLEGDKDKDGFLSLQEYLDWL-------EMPDFHIMDKRDFEEKHDQNKDGKLDLKEVEDWRRPKNFNKALEEAQHLIEHADLNGDGKLSADEIVTSHEFFAGSYATQFGQTF 263          
BLAST of Reticulocalbin 3 vs. Ensembl Medaka
Match: calub (calumenin [Source:NCBI gene;Acc:101165303])

HSP 1 Score: 254.218 bits (648), Expect = 1.873e-81
Identity = 140/318 (44.03%), Postives = 202/318 (63.52%), Query Frame = 3
Query:  108 SKMNIIYFISIIFLVTTFVTCKPPDAKRVLDHELSXXXXXXXXXXXXXXXXXXAFLGKDESSKYKNMSPEESKEKLSKIVDKIDVNSDGKIYPDELKHWITIQSQRYLREDTDKNWADYTIEKDKLT----FENXXXXXX-------XXXXXXXMVKRDERRWAKADIDGDNLLTKEEFFDFLHPEESEKMRDIVIQETIDDMDKNKDGAIDLDEYIRDMFNPEKDEEEPDWVKTERAQFKDHRDLNKDGKLDREEVGQWILPPDHNHVTSETSHLMEQTDANKDGHLTKEEILEKYDVFIGSQATDFGDALTRHSEL 1028
            S+M +   +    L   + T KP + K  + H+   + + + DD  + +YDH+AFLG++E+  +  ++PEESKE+L  +VD+ID + DG +  +E+K WI    +R++ +D D+ W  + +  D       ++N             +      M+ RDERR+  AD D D    KEEF  FLHPEE E M+DIV+ ET++D+DKN DG IDLDEYI DM+N + +  EP+WVKTER QF + RD NKDGK+D+EE   WILP D++H  +E  HL+ ++D +KDG LTK EI++KYD+F+GSQATDFG+ALTRH E 
Sbjct:    2 SRMELRPLVMCFALCVVYATSKPTEKKDRVHHD-EPLSNLEHDDADNFDYDHEAFLGQEEAKSFDQLTPEESKERLGMLVDRIDEDKDGYVTAEEMKRWIKDAQKRWIYDDVDRQWKSHDLNGDGFVSWEEYKNATYGYVLDDQDPDDGFSYKQMMARDERRFKMADQDNDMKANKEEFTAFLHPEEYEHMKDIVVLETMEDIDKNGDGFIDLDEYIGDMYNQDGETTEPEWVKTEREQFTEFRDKNKDGKMDKEETKDWILPSDYDHAEAEAKHLVYESDVDKDGRLTKAEIVDKYDLFVGSQATDFGEALTRHDEF 318          
BLAST of Reticulocalbin 3 vs. Ensembl Medaka
Match: rcn1 (reticulocalbin 1 [Source:NCBI gene;Acc:101175141])

HSP 1 Score: 248.44 bits (633), Expect = 9.933e-79
Identity = 130/270 (48.15%), Postives = 179/270 (66.30%), Query Frame = 3
Query:  267 AFLGKDESSKYKNMSPEESKEKLSKIVDKIDVNSDGKIYPDELKHWITIQSQRYLREDTDKNWADYTIEKDK---------------LTFENXXXXXXXXXXXXXMVKRDERRWAKADIDGDNLLTKEEFFDFLHPEESEKMRDIVIQETIDDMDKNKDGAIDLDEYIRDMFNPEKDEEEPDWVKTERAQFKDHRDLNKDGKLDREEVGQWILPPDHNHVTSETSHLMEQTDANKDGHLTKEEILEKYDVFIGSQATDFGDALTR-HSEL 1028
            AFLGK+E+  +  ++PEES+++L KIV++ID + DG I   ELK WI    +RY+ E+  K W DY + KD                L      +   +      M+ RDERR+  AD++GDN   KEEF  FLHPEE + M+DIV+QET++D+DKN DG +D DEYI DMF+ E    EPDWVKTER QF D RDLNKDGK+D++E+  WI+P D++H  +E  HL+ ++D +KD  LTK+EILE +++F+GSQAT++G+ LTR H EL
Sbjct:   83 AFLGKEEAKTFDQLTPEESRDRLGKIVERIDGDGDGYITTAELKDWIKRVQKRYVYENVAKVWTDYDLNKDNRISWDEYKQATYGYYLANPEEFQDDKDQFSFKKMLPRDERRFKAADLNGDNTADKEEFTSFLHPEEFDHMKDIVVQETLEDIDKNGDGYVDEDEYIADMFSHEDGGPEPDWVKTEREQFSDFRDLNKDGKMDKDEIRHWIMPQDYDHAQAEARHLVYESDQDKDQKLTKDEILENWNMFVGSQATNYGEDLTRSHDEL 352          
BLAST of Reticulocalbin 3 vs. Ensembl Medaka
Match: rcn3 (reticulocalbin-1 [Source:NCBI gene;Acc:101175408])

HSP 1 Score: 245.743 bits (626), Expect = 3.774e-78
Identity = 142/319 (44.51%), Postives = 203/319 (63.64%), Query Frame = 3
Query:  114 MNIIYFISIIFLVTTFVTCKPPDAKRVLDHELSXXXXXXXXXXXXXXXXXXAFLGKDESSKYKNMSPEESKEKLSKIVDKIDVNSDGKIYPDELKHWITIQSQRYLREDTDKNWADYTIEKD-KLTFENXXXXXXX------------XXXXXXMVKRDERRWAKADIDGDNLLTKEEFFDFLHPEESEKMRDIVIQETIDDMDKNKDGAIDLDEYIRDMFNPEKDEEEPDWVKTERAQFKDHRDLNKDGKLDREEVGQWILPPDHNHVTSETSHLMEQTDANKDGHLTKEEILEKYDVFIGSQATDFGDALT-RHSEL 1028
            M ++  ++ + ++       PP  KRV  H   D+  H  DD H   YDH+AFLGK+E+  +  ++PEESK +L+KIV++ID + DG I   EL HWI  + +RY+ ++ +K+W DY   +D ++ +E YK   Y                   M+ RDERR+  AD D D + T+ EF  FLHPEE + M+D+V+QET++D+DKNKDG ID++EYI DMF PE  E EPDWV TE+  F + RD NKDG LD  EV  WILP + +H  +E  HL+ +TD +KDG +TK+EIL  +++F+GSQAT++G+ LT +H EL
Sbjct:    2 MMLLGPLAFLCILAATAVSVPPQEKRV--HHQPDLSSHVHDDAHGYQYDHEAFLGKEEAKTFDQLTPEESKARLAKIVERIDTDKDGFISHAELHHWIKHRQRRYIEDNVNKHWKDYDKNRDDQIAWEEYKNTTYGYYLGEDFDDVEDKATYKSMLARDERRFRAADRDADGIATRSEFTAFLHPEEFDHMKDVVVQETLEDIDKNKDGKIDINEYIGDMFTPEDGETEPDWVHTEKKHFSEFRDSNKDGYLDAGEVAHWILPGEVDHADNEAKHLIHETDTDKDGKVTKKEILANWNMFVGSQATNYGEDLTKKHDEL 318          
BLAST of Reticulocalbin 3 vs. Ensembl Medaka
Match: pstpip1a (proline-serine-threonine phosphatase-interacting protein 1 [Source:NCBI gene;Acc:101156493])

HSP 1 Score: 126.716 bits (317), Expect = 8.403e-33
Identity = 86/271 (31.73%), Postives = 140/271 (51.66%), Query Frame = 3
Query:  267 AFLGKDESSKYKNMSPEESKEKLSKIVDKIDVNSDGKIYPDELKHWITIQSQRYLREDTDKNWADYTIEKDKL---------------TF-ENXXXXXXXXXXXXXMVKRDERRWAKADIDGDNLLTKEEFFDFLHPEESEKMRDIVIQETIDDMDKNKDGAIDLDEYIRDMFNPEKDEEEPDWVKTERAQFKDHRDLNKDGKLDREEVGQWILPPDHNHVTSETSHLMEQTDANKDGHLTKEEILEKYDVFIGSQATDFGDAL-TRHSEL 1028
              LG + + + K ++PEE +EKL +IV KID N D  +  +E+  WI    ++Y  ED ++ + ++ + KD +               TF E+   +  E D    +  ++++R+  ADID    L+  EF  F HP E ++M D  IQ+ + + D +KDG I L E+I D+    +D     W   E  +FK+  D +KDG L+R+E  +WI P  +     E  HL+ + D + D  ++  E+L+  D F+ S+ TD+G  L   H EL
Sbjct:   42 VLLGDETTEEIKKLTPEEQREKLLEIVKKIDTNGDNLLGAEEITLWIQHVYRKYALEDAEERFPEFDLNKDGVLTWEEYNTVAHDQLFTFDESTVLEDPEQDSLRQLHLKEKKRFDFADIDDTPGLSVSEFLAFTHPSEVDRMADFTIQDVLTEYDTDKDGFISLSEFIGDVRG--EDNSPSKWEIEETVRFKELYDQDKDGNLNRDEQLRWIAPNSYGSAREEALHLINEMDQDGDEQISVAEVLKNQDTFMNSEVTDYGRQLHGSHDEL 310          
BLAST of Reticulocalbin 3 vs. Ensembl Medaka
Match: pstpip1a (proline-serine-threonine phosphatase-interacting protein 1 [Source:NCBI gene;Acc:101156493])

HSP 1 Score: 100.908 bits (250), Expect = 1.787e-22
Identity = 70/229 (30.57%), Postives = 115/229 (50.22%), Query Frame = 3
Query:  267 AFLGKDESSKYKNMSPEESKEKLSKIVDKIDVNSDGKIYPDELKHWITIQSQRYLREDTDKNWADYTIEKDKL---------------TF-ENXXXXXXXXXXXXXMVKRDERRWAKADIDGDNLLTKEEFFDFLHPEESEKMRDIVIQETIDDMDKNKDGAIDLDEYIRDMFNPEKDEEEPDWVKTERAQFKDHRDLNKDGKLDREEVGQWILPPDHNHVTSETSHLM 905
              LG + + + K ++PEE +EKL +IV KID N D  +  +E+  WI    ++Y  ED ++ + ++ + KD +               TF E+   +  E D    +  ++++R+  ADID    L+  EF  F HP E ++M D  IQ+ + + D +KDG I L E+I D+    +D     W   E  +FK+  D +KDG L+R+E  +WI P  +     E    +
Sbjct:   42 VLLGDETTEEIKKLTPEEQREKLLEIVKKIDTNGDNLLGAEEITLWIQHVYRKYALEDAEERFPEFDLNKDGVLTWEEYNTVAHDQLFTFDESTVLEDPEQDSLRQLHLKEKKRFDFADIDDTPGLSVSEFLAFTHPSEVDRMADFTIQDVLTEYDTDKDGFISLSEFIGDVRG--EDNSPSKWEIEETVRFKELYDQDKDGNLNRDEQLRWIAPNSYGSAREEGKEFI 268          
BLAST of Reticulocalbin 3 vs. Planmine SMEST
Match: SMESG000012033.1 (SMESG000012033.1)

HSP 1 Score: 538.495 bits (1386), Expect = 0.000e+0
Identity = 303/305 (99.34%), Postives = 303/305 (99.34%), Query Frame = 3
Query:  114 MNIIYFISIIFLVTTFVTCKPPDAKRVLDHELSXXXXXXXXXXXXXXXXXXAFLGKDESSKYKNMSPEESKEKLSKIVDKIDVNSDGKIYPDELKHWITIQSQRYLREDTDKNWADYTIEKDKLTFENXXXXXXXXXXXXXMVKRDERRWAKADIDGDNLLTKEEFFDFLHPEESEKMRDIVIQETIDDMDKNKDGAIDLDEYIRDMFNPEKDEEEPDWVKTERAQFKDHRDLNKDGKLDREEVGQWILPPDHNHVTSETSHLMEQTDANKDGHLTKEEILEKYDVFIGSQATDFGDALTRHSEL 1028
            MNIIYFISIIFLVT FVTCKPPDAKRVLDHELSDIEHHQDDDDHDVNYDHDAFLGKDESSKYKNMSPEESKEKLSKIVDKIDVNSDGKIYPDELKHWITIQSQRYLREDTDKNWADYTIEKDKLTFENYKKKAYEDDDEADMVKRDERRWAKADIDGDNLLTKEEFFDFLHPEESEKMRDIVIQETIDDMDKNKDGAIDLDEYIRDMFNPEKDEEEPDWVKTERAQFKDHRDLNKDGKLDREEVGQWILPPDHNHVTSETSHLMEQTD NKDGHLTKEEILEKYDVFIGSQATDFGDALTRHSEL
Sbjct:    1 MNIIYFISIIFLVT-FVTCKPPDAKRVLDHELSDIEHHQDDDDHDVNYDHDAFLGKDESSKYKNMSPEESKEKLSKIVDKIDVNSDGKIYPDELKHWITIQSQRYLREDTDKNWADYTIEKDKLTFENYKKKAYEDDDEADMVKRDERRWAKADIDGDNLLTKEEFFDFLHPEESEKMRDIVIQETIDDMDKNKDGAIDLDEYIRDMFNPEKDEEEPDWVKTERAQFKDHRDLNKDGKLDREEVGQWILPPDHNHVTSETSHLMEQTDVNKDGHLTKEEILEKYDVFIGSQATDFGDALTRHSEL 304          
BLAST of Reticulocalbin 3 vs. Planmine SMEST
Match: SMESG000077404.1 (SMESG000077404.1)

HSP 1 Score: 208.764 bits (530), Expect = 4.358e-64
Identity = 111/259 (42.86%), Postives = 165/259 (63.71%), Query Frame = 3
Query:  267 AFLGKDESSKYKNMSPEESKEKLSKIVDKIDVNSDGKIYPDELKHWITIQSQRYLREDTDKNWADYTIEKD-KLTFE---NXXXXXXXXXXXXXMVKRDERRWAKADIDGDNLLTKEEFFDFLHPEESEKMRDIVIQETIDDMDKNKDGAIDLDEYIRDMFNPEKDEEEPDWVKTERAQFKDHRDLNKDGKLDREEVGQWILPPDHNHVTSETSHLMEQTDANKDGHLTKEEILEKYDVFIGS-QATDFGDALTRHSEL 1028
            + L  +E+ K+ +MSP ESK+K S+I+DK+D+N DG +   ELK+WIT      L +D D  W  +  + D K+ F+   +    +    D   ++ +++ RW +AD+D D LL K EFF FLHPEE + ++ ++ QET+D+MD NKD  ID++EY+ DMF P+  E + +W++ ER  F   RDLNKDG LDR+E+  W+LP  +N V SE  HLME  D NKD  L+K E+L+KY VF+GS ++ ++G     H +L
Sbjct:   50 SILKSEEARKFYSMSPSESKKKFSEIIDKMDINHDGSVEMIELKNWITNVYNSILSDDVDGQWKTFGQKNDDKINFDYYVSKTFGSKRTADHLKLINKEQHRWIEADLDNDKLLNKTEFFRFLHPEEFKDLKPLLAQETLDEMDTNKDSVIDINEYLEDMF-PQGREAKEEWIRNERQNFGIDRDLNKDGVLDRDEIQNWLLPDSYNRVESEAQHLMELADTNKDRILSKSEMLDKYQVFVGSRESVNYGGPDQSHDDL 307          
BLAST of Reticulocalbin 3 vs. Planmine SMEST
Match: SMESG000077404.1 (SMESG000077404.1)

HSP 1 Score: 207.994 bits (528), Expect = 5.754e-64
Identity = 111/259 (42.86%), Postives = 165/259 (63.71%), Query Frame = 3
Query:  267 AFLGKDESSKYKNMSPEESKEKLSKIVDKIDVNSDGKIYPDELKHWITIQSQRYLREDTDKNWADYTIEKD-KLTFE---NXXXXXXXXXXXXXMVKRDERRWAKADIDGDNLLTKEEFFDFLHPEESEKMRDIVIQETIDDMDKNKDGAIDLDEYIRDMFNPEKDEEEPDWVKTERAQFKDHRDLNKDGKLDREEVGQWILPPDHNHVTSETSHLMEQTDANKDGHLTKEEILEKYDVFIGS-QATDFGDALTRHSEL 1028
            + L  +E+ K+ +MSP ESK+K S+I+DK+D+N DG +   ELK+WIT      L +D D  W  +  + D K+ F+   +    +    D   ++ +++ RW +AD+D D LL K EFF FLHPEE + ++ ++ QET+D+MD NKD  ID++EY+ DMF P+  E + +W++ ER  F   RDLNKDG LDR+E+  W+LP  +N V SE  HLME  D NKD  L+K E+L+KY VF+GS ++ ++G     H +L
Sbjct:   38 SILKSEEARKFYSMSPSESKKKFSEIIDKMDINHDGSVEMIELKNWITNVYNSILSDDVDGQWKTFGQKNDDKINFDYYVSKTFGSKRTADHLKLINKEQHRWIEADLDNDKLLNKTEFFRFLHPEEFKDLKPLLAQETLDEMDTNKDSVIDINEYLEDMF-PQGREAKEEWIRNERQNFGIDRDLNKDGVLDRDEIQNWLLPDSYNRVESEAQHLMELADTNKDRILSKSEMLDKYQVFVGSRESVNYGGPDQSHDDL 295          
BLAST of Reticulocalbin 3 vs. Planmine SMEST
Match: SMESG000007225.1 (SMESG000007225.1)

HSP 1 Score: 180.644 bits (457), Expect = 3.652e-53
Identity = 105/272 (38.60%), Postives = 166/272 (61.03%), Query Frame = 3
Query:  267 AFLGKDESSKYKNMSPEESKEKLSKIV-DKIDVNSDGKIYPDELKHWITIQSQRYLREDTDKNWADYTIE-KDKLTFENXXXXXXXXXXXXXM----VKR-------DERRWAKADIDGDNLLTKEEFFDFLHPEESEKMRDIVIQETIDDMDKNKDGAIDLDEYIRDMFNPEKD-----EEEPDWVKTERAQFKDHRDLNKDGKLDREEVGQWILPPDHNHVTSETSHLMEQTDANKDGHLTKEEILEKYDVFIGSQATDFGDALTRHSEL 1028
            AFLGK+E+ KY  ++ EESK +L +++ +++D N DGK+   ELK WI   S++++ ++ D+ W DY  + K +L F  Y +  + D  E       +KR       D ++W  AD + D LL +EEFF F+ PEE  +MR  +I E +D  DKN D  IDL+EY  ++++ E +     + EP+W++ E   F  +RD N D ++DR+E+G+WI+P +++ + SE  HLM   D NKD  L+ +EI+E+ ++F GSQAT++G  L    EL
Sbjct:   44 AFLGKEEAEKYSELTLEESKIRLRRLIENRVDTNKDGKVTKSELKDWIKFISKKWMLDERDRVWNDYNPKNKTQLDFNGYSEINFGDKIEERYPADELKRVLKDRELDWQKWQLADDNKDGLLDREEFFAFVRPEEVPRMRPFLIDEMLDRADKNHDSYIDLEEYTDELYSREPNLVRNKDPEPEWIQYELKHFTVYRDTNNDKRMDRKEIGEWIMPSNYDGIESEVHHLMAHADINKDDELSIDEIVEQSELFAGSQATNYGSTLKNKEEL 315          
BLAST of Reticulocalbin 3 vs. Planmine SMEST
Match: SMESG000076911.1 (SMESG000076911.1)

HSP 1 Score: 163.31 bits (412), Expect = 1.082e-46
Identity = 95/258 (36.82%), Postives = 147/258 (56.98%), Query Frame = 3
Query:  267 AFLGKDESSKYKNMSPEESKEKLSKIV-DKIDVNSDGKIYPDELKHWITIQSQRYLREDTDKNWADYTIEKDKLT------------FENXXXXXXXXXXXXXMVKRDERRWAKADIDGDNLLTKEEFFDFLHPEESEKMRDIVIQETIDDMDKNKDGAIDLDEYIRDMFNPEKDEEEPDWVKTERAQFKDHRDLNKDGKLDREEVGQWILPPDHNHVTSETSHLMEQTDANKDGHLTKEEILEKYDVFIGSQATDFG 1001
            +FLG +ES  +  + PEESK +L K++ +K+D + DG +   EL+ W+   ++     + DK +  ++   D L              +          +   M ++D+R+W  AD + D  L + EF  F HPE+  KM+ IVIQET++  DKN+DG +DL+EYI D++   + EE    +K E   F +HRD N+D KLD  EVG+W++P  ++ + +ET HLM   D N+D  L+ EEI+  YD F+GSQ TD+G
Sbjct:   49 SFLGTEESKTFDKLLPEESKSRLKKLISEKVDTDKDGFVTVQELELWMITVAKLSKERERDKLFPFFSNSIDALMDYEEYSQGIYGGLQADLLDDVSKANLMIMKQQDDRKWKLADENQDGKLDRNEFLMFQHPEDYPKMKSIVIQETMEVSDKNQDGFLDLNEYISDIWPNNRPEES--LLKQEEDTFYNHRDKNQDKKLDETEVGEWLMPTGYDPIDAETKHLMHIADTNEDDQLSMEEIITHYDTFVGSQVTDYG 304          
The following BLAST results are available for this feature:
BLAST of Reticulocalbin 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CALU6.053e-8646.52calumenin [Source:HGNC Symbol;Acc:HGNC:1458][more]
CALU1.010e-8546.52calumenin [Source:HGNC Symbol;Acc:HGNC:1458][more]
CALU4.221e-8445.89calumenin [Source:HGNC Symbol;Acc:HGNC:1458][more]
CALU5.606e-8445.89calumenin [Source:HGNC Symbol;Acc:HGNC:1458][more]
RCN14.969e-7246.30reticulocalbin 1 [Source:HGNC Symbol;Acc:HGNC:9934... [more]
back to top
BLAST of Reticulocalbin 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
calu-13.312e-7345.49CALUmenin (Calcium-binding protein) homolog [Sour... [more]
calu-13.312e-7345.49CALUmenin (Calcium-binding protein) homolog [Sour... [more]
calu-22.184e-1929.05CALUmenin (Calcium-binding protein) homolog [Sour... [more]
C56C10.92.986e-725.42pep chromosome:WBcel235:II:6591048:6592351:-1 gene... [more]
back to top
BLAST of Reticulocalbin 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scf1.243e-7247.23gene:FBgn0025682 transcript:FBtr0089942[more]
scf8.256e-5656.36gene:FBgn0025682 transcript:FBtr0089941[more]
CG316504.406e-3133.73gene:FBgn0031673 transcript:FBtr0333539[more]
CG316507.781e-3133.98gene:FBgn0031673 transcript:FBtr0301907[more]
CG316507.781e-3133.98gene:FBgn0031673 transcript:FBtr0301905[more]
back to top
BLAST of Reticulocalbin 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
calua2.380e-8446.06calumenin a [Source:NCBI gene;Acc:415241][more]
calua2.380e-8446.06calumenin a [Source:NCBI gene;Acc:415241][more]
rcn31.118e-8147.47reticulocalbin 3, EF-hand calcium binding domain [... [more]
rcn31.118e-8147.47reticulocalbin 3, EF-hand calcium binding domain [... [more]
calub1.131e-8143.63calumenin b [Source:NCBI gene;Acc:394057][more]
back to top
BLAST of Reticulocalbin 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
calu6.372e-8047.92calumenin [Source:NCBI gene;Acc:407965][more]
rcn39.625e-8045.57reticulocalbin 3 [Source:NCBI gene;Acc:395023][more]
calu8.933e-7947.92calumenin [Source:NCBI gene;Acc:407965][more]
fgf111.787e-7747.78fibroblast growth factor 11 [Source:Xenbase;Acc:XB... [more]
rcn31.081e-7344.03reticulocalbin 3 [Source:NCBI gene;Acc:395023][more]
back to top
BLAST of Reticulocalbin 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Calu3.771e-8646.52calumenin [Source:MGI Symbol;Acc:MGI:1097158][more]
Calu1.841e-8445.89calumenin [Source:MGI Symbol;Acc:MGI:1097158][more]
Rcn11.981e-7648.89reticulocalbin 1 [Source:MGI Symbol;Acc:MGI:104559... [more]
Rcn36.750e-7444.57reticulocalbin 3, EF-hand calcium binding domain [... [more]
Rcn36.750e-7444.57reticulocalbin 3, EF-hand calcium binding domain [... [more]
back to top
BLAST of Reticulocalbin 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6XLQ7|CALU_RABIT1.456e-8546.84Calumenin OS=Oryctolagus cuniculus OX=9986 GN=CALU... [more]
sp|O35887|CALU_MOUSE2.637e-8546.52Calumenin OS=Mus musculus OX=10090 GN=Calu PE=1 SV... [more]
sp|O43852|CALU_HUMAN2.907e-8546.52Calumenin OS=Homo sapiens OX=9606 GN=CALU PE=1 SV=... [more]
sp|Q5RDD8|CALU_PONAB5.439e-8546.52Calumenin OS=Pongo abelii OX=9601 GN=CALU PE=2 SV=... [more]
sp|Q4U471|CALU_MESAU5.414e-8345.57Calumenin OS=Mesocricetus auratus OX=10036 GN=CALU... [more]
back to top
BLAST of Reticulocalbin 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8IEK64.412e-8853.52Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8GA226.442e-8853.52Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8FV939.406e-8853.52Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A183W6T82.741e-8746.37Uncharacterized protein OS=Trichobilharzia regenti... [more]
A0A2R2MS283.136e-8648.46calumenin-A-like OS=Lingula unguis OX=7574 GN=LOC1... [more]
back to top
BLAST of Reticulocalbin 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
calua5.102e-8144.30calumenin [Source:NCBI gene;Acc:103043492][more]
calub6.290e-8043.99calumenin-B [Source:NCBI gene;Acc:103027690][more]
rcn34.248e-7945.89reticulocalbin 3 [Source:NCBI gene;Acc:103045651][more]
rcn11.147e-7648.89reticulocalbin 1 [Source:NCBI gene;Acc:103039743][more]
rcn21.517e-3733.21reticulocalbin 2 [Source:NCBI gene;Acc:103045530][more]
back to top
BLAST of Reticulocalbin 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CALU2.385e-8545.48calumenin [Source:HGNC Symbol;Acc:HGNC:1458][more]
CALU8.451e-6142.68calumenin [Source:HGNC Symbol;Acc:HGNC:1458][more]
rcn22.491e-2835.50reticulocalbin 2 [Source:ZFIN;Acc:ZDB-GENE-050706-... [more]
rcn22.769e-2835.50reticulocalbin 2 [Source:ZFIN;Acc:ZDB-GENE-050706-... [more]
sdf44.399e-1925.98stromal cell derived factor 4 [Source:NCBI gene;Ac... [more]
back to top
BLAST of Reticulocalbin 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Reticulocalbin 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO326383.442e-8546.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO358443.913e-4739.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO476734.027e-4734.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO311692.223e-4435.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO427893.235e-3633.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Reticulocalbin 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
calub1.873e-8144.03calumenin [Source:NCBI gene;Acc:101165303][more]
rcn19.933e-7948.15reticulocalbin 1 [Source:NCBI gene;Acc:101175141][more]
rcn33.774e-7844.51reticulocalbin-1 [Source:NCBI gene;Acc:101175408][more]
pstpip1a8.403e-3331.73proline-serine-threonine phosphatase-interacting p... [more]
pstpip1a1.787e-2230.57proline-serine-threonine phosphatase-interacting p... [more]
back to top
BLAST of Reticulocalbin 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000012033.10.000e+099.34SMESG000012033.1[more]
SMESG000077404.14.358e-6442.86SMESG000077404.1[more]
SMESG000077404.15.754e-6442.86SMESG000077404.1[more]
SMESG000007225.13.652e-5338.60SMESG000007225.1[more]
SMESG000076911.11.082e-4636.82SMESG000076911.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019288 ID=SMED30019288|Name=Reticulocalbin 3|organism=Schmidtea mediterranea sexual|type=transcript|length=1292bp
AACAATAGGTTACTCAACGTCATATATACTCACAGTCAGTATTTAAATCA
TTTTTAAATTTATTATTTGTTATTAAATTCATTATTAATAATTTGGATCA
TATTCAATCGAAAATGAATATTATATATTTTATTTCTATTATTTTTCTTG
TAACAACTTTTGTCACATGTAAACCTCCAGATGCCAAACGTGTTTTAGAT
CATGAATTAAGTGATATAGAACACCATCAAGATGACGATGATCACGATGT
TAATTATGATCACGACGCATTTTTAGGCAAAGATGAATCATCTAAATATA
AAAACATGTCTCCAGAAGAAAGTAAGGAAAAATTAAGTAAAATAGTCGAT
AAAATTGATGTTAATTCTGATGGAAAAATTTATCCAGACGAATTAAAACA
TTGGATTACGATACAATCTCAAAGATATCTGAGAGAAGATACTGATAAAA
ATTGGGCAGATTATACAATTGAAAAGGATAAATTAACTTTTGAAAATTAC
AAAAAGAAAGCTTATGAAGATGATGACGAAGCTGATATGGTAAAAAGAGA
TGAAAGAAGATGGGCAAAAGCCGATATAGATGGAGATAATTTGCTCACTA
AAGAAGAATTTTTTGATTTTCTTCATCCCGAGGAGTCAGAAAAGATGAGA
GATATTGTAATCCAGGAAACGATCGATGACATGGACAAGAACAAAGATGG
GGCAATCGATCTTGATGAATATATTCGGGACATGTTCAATCCGGAAAAGG
ACGAGGAGGAACCCGATTGGGTGAAAACAGAACGCGCTCAGTTCAAGGAT
CACCGAGACCTGAATAAGGATGGTAAATTGGATCGCGAAGAAGTGGGCCA
GTGGATCCTGCCGCCCGATCACAATCACGTGACATCGGAAACGAGTCACC
TGATGGAGCAAACCGACGCTAATAAGGACGGGCATCTCACAAAAGAGGAA
ATCCTAGAGAAATACGATGTTTTTATCGGTAGTCAAGCGACGGATTTCGG
GGATGCTCTCACGAGGCACTCAGAGCTGTAGATGGGATGCCCAATATTGG
CAGTCAGTGACTCGCGCAACCACCGATACTAGTCTCCCGGTTGTGGTTTC
AATCCCGCCGTTTTTATACTATTATTAAATTTTTTTGCTTTAGTTGTTGA
TTACGTTTGATTATTGAAATAAATGTTTTTTACTGTCTTCTTTTTACCGC
ATTTATGCACTTTGGATTCATCGATTGATAAAACATGAATTGTTTTTATG
TTTTGTTAAATTATAATGTTCTTTGATTTTTGTTTAAGTAAG
back to top

protein sequence of SMED30019288-orf-1

>SMED30019288-orf-1 ID=SMED30019288-orf-1|Name=SMED30019288-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=306bp
MNIIYFISIIFLVTTFVTCKPPDAKRVLDHELSDIEHHQDDDDHDVNYDH
DAFLGKDESSKYKNMSPEESKEKLSKIVDKIDVNSDGKIYPDELKHWITI
QSQRYLREDTDKNWADYTIEKDKLTFENYKKKAYEDDDEADMVKRDERRW
AKADIDGDNLLTKEEFFDFLHPEESEKMRDIVIQETIDDMDKNKDGAIDL
DEYIRDMFNPEKDEEEPDWVKTERAQFKDHRDLNKDGKLDREEVGQWILP
PDHNHVTSETSHLMEQTDANKDGHLTKEEILEKYDVFIGSQATDFGDALT
RHSEL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000110pharynx progenitor cell
PLANA:0000120progenitor cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR002048EF_hand_dom
IPR011992EF-hand-dom_pair
IPR018247EF_Hand_1_Ca_BS
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
GO:0005783endoplasmic reticulum
GO:0005789endoplasmic reticulum membrane
GO:0005794Golgi apparatus
GO:0016020membrane
GO:0016529sarcoplasmic reticulum
GO:0033018sarcoplasmic reticulum lumen
GO:0042470melanosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002048EF-hand domainSMARTSM00054efh_1coord: 181..209
e-value: 0.037
score: 23.2
coord: 258..286
e-value: 25.0
score: 6.5
coord: 144..172
e-value: 17.0
score: 7.9
coord: 72..100
e-value: 3.5
score: 13.4
IPR002048EF-hand domainPFAMPF13202EF-hand_5coord: 231..242
e-value: 0.022
score: 14.3
coord: 264..279
e-value: 0.068
score: 12.7
coord: 78..94
e-value: 0.14
score: 11.7
IPR002048EF-hand domainPFAMPF13499EF-hand_7coord: 147..204
e-value: 4.1E-8
score: 33.6
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 254..289
score: 7.177
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 231..253
score: 7.093
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 68..103
score: 10.413
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 140..175
score: 9.52
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 177..212
score: 9.715
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 62..103
e-value: 3.2E-6
score: 28.4
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 206..296
e-value: 2.8E-8
score: 35.9
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 134..204
e-value: 1.4E-8
score: 36.7
NoneNo IPR availablePANTHERPTHR10827RETICULOCALBINcoord: 7..304
NoneNo IPR availablePANTHERPTHR10827:SF52IP16409Pcoord: 7..304
NoneNo IPR availableCDDcd16226EFh_CREC_Calumenin_likecoord: 51..288
e-value: 9.21848E-106
score: 307.203
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..18
score: 0.807
IPR018247EF-Hand 1, calcium-binding sitePROSITEPS00018EF_HAND_1coord: 190..202
IPR018247EF-Hand 1, calcium-binding sitePROSITEPS00018EF_HAND_1coord: 153..165
IPR018247EF-Hand 1, calcium-binding sitePROSITEPS00018EF_HAND_1coord: 231..243
IPR018247EF-Hand 1, calcium-binding sitePROSITEPS00018EF_HAND_1coord: 267..279
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 142..298
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 60..125