SMED30019284

Overview
NameSMED30019284
Smed IDSMED30019284
Length (bp)3559
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30019284 (SMED30019284) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30019284 (SMED30019284) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30019284 (SMED30019284) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30019284 (SMED30019284) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019284

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30019284SMESG000046620.1 Contig2120GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30019284SMESG000077668.1 Contig2120GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
epidermisSMED30019284SMESG000077670.1 dd_Smed_v4_10136_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019284SMESG000077669.1 SMESG000077668.1 SMESG000077667.1 Contig49355uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019284SMESG000077669.1 SMESG000077668.1 SMESG000077667.1 Contig49355newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30019284SMESG000077670.1 dd_Smed_v6_10136_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30019284SMESG000077670.1 SMESG000077669.1 OX_Smed_1.0.11946ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30019284SMESG000077669.1 SMESG000077668.1 SMESG000077667.1 Contig49355uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30019284SMESG000077669.1 SMESG000077668.1 SMESG000077667.1 Contig49355newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30019284SMESG000077670.1 dd_Smed_v4_10136_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30019284 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.007365:10550..15813 +13686
Homology
BLAST of SMED30019284 vs. Ensembl Human
Match: LRRD1 (leucine rich repeats and death domain containing 1 [Source:HGNC Symbol;Acc:HGNC:34300])

HSP 1 Score: 228.794 bits (582), Expect = 1.419e-61
Identity = 201/658 (30.55%), Postives = 332/658 (50.46%), Query Frame = 3
Query:  195 LEGLIVNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXX-XXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFP---WLPESIIDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDIESSFVLEFQDRLESLDLSNNAISALPATAFTKFSKLRYLNLQGNPCKIPPSDVFNCGQMIPICSYLTAYNEFDATILDRIMPIISNKFPISRTRHLFRKLRIPESVIIELESTYRGKYNQKLLLSKGLEAWRKY-----LVDKATTDSLIRCFFLI 2141
            LE L +  N ++ +P  I  L +L  LN+SHN+I+++      L N+  L   NN++      +     L+  ++  NK   +P+TL SL  L   +  +N L   PK +  L +L +L L  N +S LP+ I+EL+NLE L + +N LT L   +F+L+ + EL + +N L+ +S  I   ++L +L L  N    IP  I   + L+ L+L  N K+T LP  I  + +L +L +++ N   ++D   + NN+  L+ S N IT +PI+ KNC  +  ++ S NKI   P    +L  L  L ++ N +  +PV + + + L  + LS N+   F E    +  L  +++  N I+ IP SI ++  L    L  NK ++FP      E++   DLS+N ++ I  + +  L  I+ LN S+         +  L SL+     Q +G+KLT + G LS +  LKE+++SNN +  IP  I +++NL S+    N+I  +  S +L   D L+ L+LS N ++ALP+  +  FS L+ +N   NP   PP ++    Q+  I  YL   +E D  IL++I  I++N    +    L +KL +  S   E +   +   +      + L  W+       L   A  D LIR   +I
Sbjct:  190 LEILSLQENGLSSLPSEIQLLHNLRILNVSHNHISHIPKEISQLGNIRQLFFYNNYIENFPSDLECLGNLEILSLGKNKLRHIPDTLPSLKTLRVLNLEYNQLTTFPKALCFLPKLISLDLTGNLISSLPKEIRELKNLETLLMDHNKLTFLAVEIFQLLKIKELQLADNKLEVISHKIENFRELRILILDKNLLKNIPEKISCCAMLECLSLSDN-KLTELPKYIHKLNNLRKLHVNRNNMVKITDCISHLNNICSLEFSGNIITDVPIEIKNCQKIIKIELSYNKIMYFPLGLCALDSLYYLSVNGNYISEIPVDISFSKQLLHLELSENKLLIFSEHFCSLINLKYLDLGKNQIKKIPASISNMISLHVLILCCNKFETFPRELCTLENLQVLDLSENQLQKISSD-ICNLKGIQKLNFSSNQFIHFPIELCQLQSLEQLNISQIKGRKLTRLPGELSNMTQLKELDISNNAIREIPRNIGELRNLVSLHAYNNQISYLPPS-LLSLND-LQQLNLSGNNLTALPSAIYNIFS-LKEINFDDNPLLRPPVEICKGKQLYTIARYLQRADERDEKILEKIFKIVANNITETNFEFLCQKLNLANS---ETDMPTKSTVSLSERAHQALVIWKTQSNKLSLTAAALRDQLIRALTMI 839          

HSP 2 Score: 145.591 bits (366), Expect = 8.646e-35
Identity = 143/540 (26.48%), Postives = 251/540 (46.48%), Query Frame = 3
Query:   72 TLTKEEIDNINEDFFEKEKINILNCSYSKVKKIGK-LCNCKDLEGLIVNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETL--CSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLP-GXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSI---EITANDIETIPESIMSLTRLQTFNLSGNKIQSFP---WLPESIIDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSIS 1661
            +L K ++ +I +     + + +LN  Y+++    K LC    L  L + GN I+ +P  I +LK+L  L + HN +T L    F L  +  L LA+N L V+S  I NF +L+   +  N    +PE +  C++ E LS   S N L  +PK I  L  L  L +N N++  + + I  L                        N+  L    N +  + ++I   +K+I + LS+N  +  P  +  L SL YL++ GN  I+ +P        L  L + +      S+ F    NL+ LD+  N I ++P    N +SL VL    NK    P    +L+ LQ+LDLS N+L  +   +  ++ ++K+N S+N+F +FP  L ++ +L  +   +I    +  +P  + ++T+L+  ++S N I+  P       +++     +N +  +P + ++ LN ++ LN+S                          G  LT +   +  + +LKEIN  +N L+  P +I + K L +I+
Sbjct:  263 SLGKNKLRHIPDTLPSLKTLRVLNLEYNQLTTFPKALCFLPKLISLDLTGNLISSLPKEIRELKNLETLLMDHNKLTFLAVEIFQLLKIKELQLADNKLEVISHKIENFRELRILILDKNLLKNIPEKISCCAMLECLSL--SDNKLTELPKYIHKLNNLRKLHVNRNNMVKITDCISHLN-----------------------NICSLEFSGNIITDVPIEIKNCQKIIKIELSYNKIMYFPLGLCALDSLYYLSVNGNY-ISEIPVDISFSKQLLHLELSENKLLIFSEHFCSLINLKYLDLGKNQIKKIPASISNMISLHVLILCCNKFETFPRELCTLENLQVLDLSENQLQKISSDICNLKGIQKLNFSSNQFIHFPIELCQLQSLEQLNISQIKGRKLTRLPGELSNMTQLKELDISNNAIREIPRNIGELRNLVSLHAYNNQISYLPPSLLS-LNDLQQLNLS--------------------------GNNLTALPSAIYNIFSLKEINFDDNPLLRPPVEICKGKQLYTIA 749          

HSP 3 Score: 108.612 bits (270), Expect = 3.114e-23
Identity = 103/379 (27.18%), Postives = 183/379 (48.28%), Query Frame = 3
Query:  753 VLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXX--XXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNK-----IQSFPWLPESIIDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDIESSFVLEFQDRLESLDLSNNAISALPATAFTKFSKLRYLNLQGNPCKIPPSDVFNCGQMI 1868
             +NL      E P +I ++  +KYL L  N +I    G+     + L  L + +   SSL  +    +NLRIL++S+NHI+ +P +     ++  L + NN I   P     L  L+IL L  N+L  +P  +  +++LR +NL  N+   FP+ L  +P L S+++T N I ++P+ I  L  L+T  +  NK     ++ F  L   I +  L+DN +E I      K+     L I   + + +  I   ++   + +       KLTE+   + +LNNL++++++ N ++ I + I  + N+ S+   GN I D+     ++   ++  ++LS N I   P         L YL++ GN     P D+    Q++
Sbjct:  145 TVNLEAKGLQEFPKDILKIKYVKYLYLDKN-QIKTFQGADSGDLLGLEILSLQENGLSSLPSEIQLLHNLRILNVSHNHISHIPKEISQLGNIRQLFFYNNYIENFPSDLECLGNLEILSLGKNKLRHIPDTLPSLKTLRVLNLEYNQLTTFPKALCFLPKLISLDLTGNLISSLPKEIRELKNLETLLMDHNKLTFLAVEIFQLL--KIKELQLADNKLEVISH----KIENFRELRILILDKNLLKNIPEKISCCAMLECLSLSDNKLTELPKYIHKLNNLRKLHVNRNNMVKITDCISHLNNICSLEFSGNIITDV--PIEIKNCQKIIKIELSYNKIMYFPL-GLCALDSLYYLSVNGNYISEIPVDISFSKQLL 513          
BLAST of SMED30019284 vs. Ensembl Human
Match: LRRD1 (leucine rich repeats and death domain containing 1 [Source:HGNC Symbol;Acc:HGNC:34300])

HSP 1 Score: 228.794 bits (582), Expect = 1.419e-61
Identity = 201/658 (30.55%), Postives = 332/658 (50.46%), Query Frame = 3
Query:  195 LEGLIVNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXX-XXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFP---WLPESIIDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDIESSFVLEFQDRLESLDLSNNAISALPATAFTKFSKLRYLNLQGNPCKIPPSDVFNCGQMIPICSYLTAYNEFDATILDRIMPIISNKFPISRTRHLFRKLRIPESVIIELESTYRGKYNQKLLLSKGLEAWRKY-----LVDKATTDSLIRCFFLI 2141
            LE L +  N ++ +P  I  L +L  LN+SHN+I+++      L N+  L   NN++      +     L+  ++  NK   +P+TL SL  L   +  +N L   PK +  L +L +L L  N +S LP+ I+EL+NLE L + +N LT L   +F+L+ + EL + +N L+ +S  I   ++L +L L  N    IP  I   + L+ L+L  N K+T LP  I  + +L +L +++ N   ++D   + NN+  L+ S N IT +PI+ KNC  +  ++ S NKI   P    +L  L  L ++ N +  +PV + + + L  + LS N+   F E    +  L  +++  N I+ IP SI ++  L    L  NK ++FP      E++   DLS+N ++ I  + +  L  I+ LN S+         +  L SL+     Q +G+KLT + G LS +  LKE+++SNN +  IP  I +++NL S+    N+I  +  S +L   D L+ L+LS N ++ALP+  +  FS L+ +N   NP   PP ++    Q+  I  YL   +E D  IL++I  I++N    +    L +KL +  S   E +   +   +      + L  W+       L   A  D LIR   +I
Sbjct:  190 LEILSLQENGLSSLPSEIQLLHNLRILNVSHNHISHIPKEISQLGNIRQLFFYNNYIENFPSDLECLGNLEILSLGKNKLRHIPDTLPSLKTLRVLNLEYNQLTTFPKALCFLPKLISLDLTGNLISSLPKEIRELKNLETLLMDHNKLTFLAVEIFQLLKIKELQLADNKLEVISHKIENFRELRILILDKNLLKNIPEKISCCAMLECLSLSDN-KLTELPKYIHKLNNLRKLHVNRNNMVKITDCISHLNNICSLEFSGNIITDVPIEIKNCQKIIKIELSYNKIMYFPLGLCALDSLYYLSVNGNYISEIPVDISFSKQLLHLELSENKLLIFSEHFCSLINLKYLDLGKNQIKKIPASISNMISLHVLILCCNKFETFPRELCTLENLQVLDLSENQLQKISSD-ICNLKGIQKLNFSSNQFIHFPIELCQLQSLEQLNISQIKGRKLTRLPGELSNMTQLKELDISNNAIREIPRNIGELRNLVSLHAYNNQISYLPPS-LLSLND-LQQLNLSGNNLTALPSAIYNIFS-LKEINFDDNPLLRPPVEICKGKQLYTIARYLQRADERDEKILEKIFKIVANNITETNFEFLCQKLNLANS---ETDMPTKSTVSLSERAHQALVIWKTQSNKLSLTAAALRDQLIRALTMI 839          

HSP 2 Score: 145.591 bits (366), Expect = 8.646e-35
Identity = 143/540 (26.48%), Postives = 251/540 (46.48%), Query Frame = 3
Query:   72 TLTKEEIDNINEDFFEKEKINILNCSYSKVKKIGK-LCNCKDLEGLIVNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETL--CSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLP-GXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSI---EITANDIETIPESIMSLTRLQTFNLSGNKIQSFP---WLPESIIDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSIS 1661
            +L K ++ +I +     + + +LN  Y+++    K LC    L  L + GN I+ +P  I +LK+L  L + HN +T L    F L  +  L LA+N L V+S  I NF +L+   +  N    +PE +  C++ E LS   S N L  +PK I  L  L  L +N N++  + + I  L                        N+  L    N +  + ++I   +K+I + LS+N  +  P  +  L SL YL++ GN  I+ +P        L  L + +      S+ F    NL+ LD+  N I ++P    N +SL VL    NK    P    +L+ LQ+LDLS N+L  +   +  ++ ++K+N S+N+F +FP  L ++ +L  +   +I    +  +P  + ++T+L+  ++S N I+  P       +++     +N +  +P + ++ LN ++ LN+S                          G  LT +   +  + +LKEIN  +N L+  P +I + K L +I+
Sbjct:  263 SLGKNKLRHIPDTLPSLKTLRVLNLEYNQLTTFPKALCFLPKLISLDLTGNLISSLPKEIRELKNLETLLMDHNKLTFLAVEIFQLLKIKELQLADNKLEVISHKIENFRELRILILDKNLLKNIPEKISCCAMLECLSL--SDNKLTELPKYIHKLNNLRKLHVNRNNMVKITDCISHLN-----------------------NICSLEFSGNIITDVPIEIKNCQKIIKIELSYNKIMYFPLGLCALDSLYYLSVNGNY-ISEIPVDISFSKQLLHLELSENKLLIFSEHFCSLINLKYLDLGKNQIKKIPASISNMISLHVLILCCNKFETFPRELCTLENLQVLDLSENQLQKISSDICNLKGIQKLNFSSNQFIHFPIELCQLQSLEQLNISQIKGRKLTRLPGELSNMTQLKELDISNNAIREIPRNIGELRNLVSLHAYNNQISYLPPSLLS-LNDLQQLNLS--------------------------GNNLTALPSAIYNIFSLKEINFDDNPLLRPPVEICKGKQLYTIA 749          

HSP 3 Score: 108.612 bits (270), Expect = 3.114e-23
Identity = 103/379 (27.18%), Postives = 183/379 (48.28%), Query Frame = 3
Query:  753 VLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXX--XXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNK-----IQSFPWLPESIIDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDIESSFVLEFQDRLESLDLSNNAISALPATAFTKFSKLRYLNLQGNPCKIPPSDVFNCGQMI 1868
             +NL      E P +I ++  +KYL L  N +I    G+     + L  L + +   SSL  +    +NLRIL++S+NHI+ +P +     ++  L + NN I   P     L  L+IL L  N+L  +P  +  +++LR +NL  N+   FP+ L  +P L S+++T N I ++P+ I  L  L+T  +  NK     ++ F  L   I +  L+DN +E I      K+     L I   + + +  I   ++   + +       KLTE+   + +LNNL++++++ N ++ I + I  + N+ S+   GN I D+     ++   ++  ++LS N I   P         L YL++ GN     P D+    Q++
Sbjct:  145 TVNLEAKGLQEFPKDILKIKYVKYLYLDKN-QIKTFQGADSGDLLGLEILSLQENGLSSLPSEIQLLHNLRILNVSHNHISHIPKEISQLGNIRQLFFYNNYIENFPSDLECLGNLEILSLGKNKLRHIPDTLPSLKTLRVLNLEYNQLTTFPKALCFLPKLISLDLTGNLISSLPKEIRELKNLETLLMDHNKLTFLAVEIFQLL--KIKELQLADNKLEVISH----KIENFRELRILILDKNLLKNIPEKISCCAMLECLSLSDNKLTELPKYIHKLNNLRKLHVNRNNMVKITDCISHLNNICSLEFSGNIITDV--PIEIKNCQKIIKIELSYNKIMYFPL-GLCALDSLYYLSVNGNYISEIPVDISFSKQLL 513          
BLAST of SMED30019284 vs. Ensembl Human
Match: SHOC2 (SHOC2 leucine rich repeat scaffold protein [Source:HGNC Symbol;Acc:HGNC:15454])

HSP 1 Score: 151.754 bits (382), Expect = 1.473e-37
Identity = 142/473 (30.02%), Postives = 242/473 (51.16%), Query Frame = 3
Query:   27 LKYFNASTNEDKIFKTLTKEEIDNINEDFFEKEKINILNCSYSKVKKIGKLCNC-KDLEGLIVNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMD-IGKLKKLIVLNLSFNNFIEIP-SNIGELSSLKYLNLRGNSKITNLP-GXXXXXXXXXXXXDQCN-FSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNK-IQSFPW---LPESIIDFDLSDNPVESIPQNFMA 1418
            +K  N    E+ +   L+K  I  +     E  ++  L    +K++ +     C  +L  L ++ N +T +P +++ LK L  L+L HN +  + +  + L++L  L L  N +T + + I N SKL   +I  NK   LP  +  L  L++ D +HN L  +PK IG+  Q+T L L HN+L DLP+TI  L +L  L L  N L+ +   + +   L ELN+ NN++  L    +  L KL  L L+ N F   P     + S++  LN+  N +I  +P G      +   L  + N  +SL  DFG + ++  L+++ N +T++P D    +SL VL  SNN + ++P   G+L+KL+ LDL  N+L+SLP  + Y++ L+K+ L+NN+    P  +  +  L  + +  N +  +PE I +L  L+   L+ N  + S P+   L   +    + + P+  +P   +A
Sbjct:   91 IKELNKCREENSMRLDLSKRSIHILPSSIKELTQLTELYLYSNKLQSLPAEVGCLVNLMTLALSENSLTSLPDSLDNLKKLRMLDLRHNKLREIPSVVYRLDSLTTLYLRFNRITTVEKDIKNLSKLSMLSIRENKIKQLPAEIGELCNLITLDVAHNQLEHLPKEIGNCTQITNLDLQHNELLDLPDTIGNLSSLSRLGLRYNRLSAIPRSLAKCSALEELNLENNNISTLPESLLSSLVKLNSLTLARNCFQLYPVGGPSQFSTIYSLNMEHN-RINKIPFGIFSRAKVLSKLNMKDNQLTSLPLDFGTWTSMVELNLATNQLTKIPEDVSGLVSLEVLILSNNLLKKLPHGLGNLRKLRELDLEENKLESLPNEIAYLKDLQKLVLTNNQLTTLPRGIGHLTNLTHLGLGENLLTHLPEEIGTLENLEELYLNDNPNLHSLPFELALCSKLSIMSIENCPLSHLPPQIVA 562          

HSP 2 Score: 113.62 bits (283), Expect = 3.175e-25
Identity = 121/460 (26.30%), Postives = 197/460 (42.83%), Query Frame = 3
Query:  456 CSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMS-LTRLQTFNLSGNKIQSFPWLPES----IIDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDIESSFVLEFQDRLESLDLSNNAISALPATAFTKFSKLRYLNLQGN 1820
            C     +  D S   ++ +P  I  L QLT L L  N L  LP                         V  LVNL+ L +  N L  L   +  LKKL +L+L  N   EIPS +  L SL  L LR N                         +++  D    + L +L I  N I QLP +     +L  L  ++N++  +P+  G+  ++  LDL +NEL  LP  +  + SL ++ L  NR +  P  L K   L  + +  N+I T+PES++S L +L +  L+ N  Q +P    S    I   ++  N +  IP    ++   +  LN+ +     +     +  S+       +   +LT+I   +S L +L+ + LSNN L  +P  +  ++ L  + L  NK++ + +     +   L+ L L+NN ++ LP       + L +L L  N
Sbjct:   97 CREENSMRLDLSKRSIHILPSSIKELTQLTELYLYSNKLQSLPAE-----------------------VGCLVNLMTLALSENSLTSLPDSLDNLKKLRMLDLRHNKLREIPSVVYRLDSLTTLYLRFN-----------------------RITTVEKDIKNLSKLSMLSIRENKIKQLPAEIGELCNLITLDVAHNQLEHLPKEIGNCTQITNLDLQHNELLDLPDTIGNLSSLSRLGLRYNRLSAIPRSLAKCSALEELNLENNNISTLPESLLSSLVKLNSLTLARNCFQLYPVGGPSQFSTIYSLNMEHNRINKIPFGIFSRAKVLSKLNMKDNQLTSLPLDFGTWTSMVELNLATN---QLTKIPEDVSGLVSLEVLILSNNLLKKLPHGLGNLRKLRELDLEENKLESLPNEIA--YLKDLQKLVLTNNQLTTLP-RGIGHLTNLTHLGLGEN 504          
BLAST of SMED30019284 vs. Ensembl Human
Match: LRRC1 (leucine rich repeat containing 1 [Source:HGNC Symbol;Acc:HGNC:14307])

HSP 1 Score: 132.109 bits (331), Expect = 2.182e-31
Identity = 116/384 (30.21%), Postives = 183/384 (47.66%), Query Frame = 3
Query:  189 KDLEGLIVNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSF 1340
            + LE L+++ N++ E+P    QL  L  L LS N I  L     +   L+ LD++ N +  + E I     LQ  + SGN    LPE+   L  L     +   L  +P+ IG+L  L +L L  N L+ LP+++ +L+ LE L LGNN + NL   +  L++L +L +  N L  L  +IG LK L+ L++S N    +P  I  L+SL  L +  N                          ++ D  G    L IL +  N +TQLP     C SL  L  + N++  +P+  G LKKL  L+   N+L SLP  +    SL    + +NR    P  +++   L+ +++  N +  +P S+ +L +L+   LS N+ Q  
Sbjct:   36 RSLEELLLDANQLRELPEQFFQLVKLRKLGLSDNEIQRLPPEIANFMQLVELDVSRNEIPEIPESISFCKALQVADFSGNPLTRLPESFPELQNLTCLSVNDISLQSLPENIGNLYNLASLELRENLLTYLPDSLTQLRRLEELDLGNNEIYNLPESIGALLHLKDLWLDGNQLSELPQEIGNLKNLLCLDVSENRLERLPEEISGLTSLTDLVISQNL-----------------------LETIPDGIGKLKKLSILKVDQNRLTQLPEAVGECESLTELVLTENQLLTLPKSIGKLKKLSNLNADRNKLVSLPKEIGGCCSLTVFCVRDNRLTRIPAEVSQATELHVLDVAGNRLLHLPLSLTAL-KLKALWLSDNQSQPL 395          

HSP 2 Score: 131.724 bits (330), Expect = 2.741e-31
Identity = 113/373 (30.29%), Postives = 179/373 (47.99%), Query Frame = 3
Query:   75 LTKEEIDNINEDFFEKEKINILNCSYSKVKKIG-KLCNCKDLEGLIVNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNR 1190
            L   ++  + E FF+  K+  L  S ++++++  ++ N   L  L V+ NEI EIP +I+  K+L   + S N +T L  +F +L+NL  L + +  L  L E IGN   L    +  N    LP++L  L  L   D  +N +  +P+ IG+L  L  L L+ N LS+LP+ I  L+NL  L +  N L  L   +  L +L +L I  N L+ +   IGKLKKL +L +  N   ++P  +GE  SL  L L  N  +T                       L    G    L  L+   N +  LP +   C SL V    +N++  IP       +L +LD++ N L  LP+ +  ++ L+ + LS+N+
Sbjct:   43 LDANQLRELPEQFFQLVKLRKLGLSDNEIQRLPPEIANFMQLVELDVSRNEIPEIPESISFCKALQVADFSGNPLTRLPESFPELQNLTCLSVNDISLQSLPENIGNLYNLASLELRENLLTYLPDSLTQLRRLEELDLGNNEIYNLPESIGALLHLKDLWLDGNQLSELPQEIGNLKNLLCLDVSENRLERLPEEISGLTSLTDLVISQNLLETIPDGIGKLKKLSILKVDQNRLTQLPEAVGECESLTELVLTENQLLT-----------------------LPKSIGKLKKLSNLNADRNKLVSLPKEIGGCCSLTVFCVRDNRLTRIPAEVSQATELHVLDVAGNRLLHLPLSLTALK-LKALWLSDNQ 391          

HSP 3 Score: 101.293 bits (251), Expect = 2.188e-21
Identity = 90/336 (26.79%), Postives = 164/336 (48.81%), Query Frame = 3
Query:  903 DQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFP------------W--------LPESI------IDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKI----KDIESSFVLEFQDRLESLDLSNNAISALPATAFTKFSKLRYLNLQGN 1820
            D      L + F     LR L +S+N I +LP +  N + L  L  S N+I EIPE     K LQ+ D S N L  LP     +++L  +++++    + PE +  +  L S+E+  N +  +P+S+  L RL+  +L  N+I + P            W        LP+ I      +  D+S+N +E +P+  ++ L  + +L IS    + I + +  L  L I K DQ+R   LT++   + +  +L E+ L+ N L+++P+ I ++K L++++   NK+    K+I     L          + +N ++ +PA   ++ ++L  L++ GN
Sbjct:   44 DANQLRELPEQFFQLVKLRKLGLSDNEIQRLPPEIANFMQLVELDVSRNEIPEIPESISFCKALQVADFSGNPLTRLPESFPELQNLTCLSVNDISLQSLPENIGNLYNLASLELRENLLTYLPDSLTQLRRLEELDLGNNEIYNLPESIGALLHLKDLWLDGNQLSELPQEIGNLKNLLCLDVSENRLERLPEE-ISGLTSLTDLVISQNLLETIPDGIGKLKKLSILKVDQNR---LTQLPEAVGECESLTELVLTENQLLTLPKSIGKLKKLSNLNADRNKLVSLPKEIGGCCSLTV------FCVRDNRLTRIPA-EVSQATELHVLDVAGN 368          

HSP 4 Score: 83.9593 bits (206), Expect = 6.859e-16
Identity = 77/320 (24.06%), Postives = 156/320 (48.75%), Query Frame = 3
Query:  936 FGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFPWLPESII------DFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDIESSFVLEFQDRLESLDLSNNAISALPATAFTKFSKLRYLNLQGNPCKIPPSDVFNCGQMIPIC 1877
            + Y  +L  L +  N + +LP  F   + L  L  S+N+I  +P    +  +L  LD+S NE+  +P  + + ++L+  + S N     PE   ++  L  + +    ++++PE+I +L  L +  L  N +    +LP+S+       + DL +N + ++P++  A L ++++L +       + + + +L +L      ++R ++L E    +S L +L ++ +S N L +IP+ I ++K L+ + +  N++  +  + V E +  L  L L+ N +  LP +   K  KL  LN   N     P ++  C  +   C
Sbjct:   32 YRYARSLEELLLDANQLRELPEQFFQLVKLRKLGLSDNEIQRLPPEIANFMQLVELDVSRNEIPEIPESISFCKALQVADFSGNPLTRLPESFPELQNLTCLSVNDISLQSLPENIGNLYNLASLELRENLLT---YLPDSLTQLRRLEELDLGNNEIYNLPESIGALL-HLKDLWLDGNQLSELPQEIGNLKNLLCLDVSENRLERLPE---EISGLTSLTDLVISQNLLETIPDGIGKLKKLSILKVDQNRLTQLPEA-VGECES-LTELVLTENQLLTLPKS-IGKLKKLSNLNADRNKLVSLPKEIGGCCSLTVFC 341          

HSP 5 Score: 64.3142 bits (155), Expect = 1.022e-9
Identity = 58/215 (26.98%), Postives = 109/215 (50.70%), Query Frame = 3
Query: 1140 IMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFPWLPESII------DFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDIESSFVLEFQDRLESLDLSNNAISALP 1766
            I  Y  SL ++ L  N+    PE   ++  L  + ++ N+I+ +P  I +  +L   ++S N+I   P +PESI         D S NP+  +P++F  +L  +  L++++ +   + E + +L +L   +    R   LT +   L+QL  L+E++L NN + ++PE I  + +L  + L GN++ ++     +     L  LD+S N +  LP
Sbjct:   31 IYRYARSLEELLLDANQLRELPEQFFQLVKLRKLGLSDNEIQRLPPEIANFMQLVELDVSRNEI---PEIPESISFCKALQVADFSGNPLTRLPESF-PELQNLTCLSVNDISLQSLPENIGNLYNLASLEL---RENLLTYLPDSLTQLRRLEELDLGNNEIYNLPESIGALLHLKDLWLDGNQLSELPQE--IGNLKNLLCLDVSENRLERLP 236          
BLAST of SMED30019284 vs. Ensembl Human
Match: SHOC2 (SHOC2 leucine rich repeat scaffold protein [Source:HGNC Symbol;Acc:HGNC:15454])

HSP 1 Score: 126.716 bits (317), Expect = 1.197e-29
Identity = 121/474 (25.53%), Postives = 215/474 (45.36%), Query Frame = 3
Query:   18 CDDLKYFNASTNEDKIFKTLTKEEIDNINEDFFEKEKINILNCSYSKVKKIGKLCNC-KDLEGLIVNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQ-YLSMDIGKLKKLIVLNLSFNNFIEIPSNI-GELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNK-IQSFPW---LPESIIDFDLSDNPVESIPQNFMA 1418
             + +K  N    E+ +   L+K  I  +     E  ++  L    +K++ +     C  +L  L ++ N +T +P +++ LK L  L+L HN +  + +  + L++L  L L  N +T + + I N SKL   +I  NK   LP  + +LS L      +N L+ +P+ +     L  L L +N++S LPE++                      +  LV L  L +  N  Q Y      +   +  LN+  N   +IP  I      L  LN++ N                         +SL  DFG + ++  L+++ N +T++P D    +SL VL  SNN + ++P   G+L+KL+ LDL  N+L+SLP  + Y++ L+K+ L+NN+    P  +  +  L  + +  N +  +PE I +L  L+   L+ N  + S P+   L   +    + + P+  +P   +A
Sbjct:   88 AEVIKELNKCREENSMRLDLSKRSIHILPSSIKELTQLTELYLYSNKLQSLPAEVGCLVNLMTLALSENSLTSLPDSLDNLKKLRMLDLRHNKLREIPSVVYRLDSLTTLYLRFNRITTVEKDIKNLSKLSMLSIRENKIKQLPAEIGNLSSLSRLGLRYNRLSAIPRSLAKCSALEELNLENNNISTLPESL----------------------LSSLVKLNSLTLARNCFQLYPVGGPSQFSTIYSLNMEHNRINKIPFGIFSRAKVLSKLNMKDN-----------------------QLTSLPLDFGTWTSMVELNLATNQLTKIPEDVSGLVSLEVLILSNNLLKKLPHGLGNLRKLRELDLEENKLESLPNEIAYLKDLQKLVLTNNQLTTLPRGIGHLTNLTHLGLGENLLTHLPEEIGTLENLEELYLNDNPNLHSLPFELALCSKLSIMSIENCPLSHLPPQIVA 516          

HSP 2 Score: 85.5001 bits (210), Expect = 2.004e-16
Identity = 96/361 (26.59%), Postives = 173/361 (47.92%), Query Frame = 3
Query:  756 LNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXX-XXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMS-LTRLQTFNLSGNKIQSFPWLPES----IIDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDIESSFVLEFQDRLESLDLSNNAISALPATAFTKFSKLRYLNLQGN 1820
            L+LS  +   +PS+I EL+ L  L L  N K+ +LP  +  L++L  L + + + +SL D       LR+LD+ +N + ++P       SL  L    N+I  + +   +L KL +L +  N++  LP  +  + SL ++ L  NR +  P  L K   L  + +  N+I T+PES++S L +L +  L+ N  Q +P    S    I   ++  N +  IP    ++   +  LN+ +     +     +  S+       +   +LT+I   +S L +L+ + LSNN L  +P  +  ++ L  + L  NK++ + +     +   L+ L L+NN ++ LP       + L +L L  N
Sbjct:  105 LDLSKRSIHILPSSIKELTQLTELYLYSN-KLQSLPAEVGCLVNLMTLALSENSLTSLPDSLDNLKKLRMLDLRHNKLREIPSVVYRLDSLTTLYLRFNRITTVEKDIKNLSKLSMLSIRENKIKQLPAEIGNLSSLSRLGLRYNRLSAIPRSLAKCSALEELNLENNNISTLPESLLSSLVKLNSLTLARNCFQLYPVGGPSQFSTIYSLNMEHNRINKIPFGIFSRAKVLSKLNMKDNQLTSLPLDFGTWTSMVELNLATN---QLTKIPEDVSGLVSLEVLILSNNLLKKLPHGLGNLRKLRELDLEENKLESLPNEIA--YLKDLQKLVLTNNQLTTLP-RGIGHLTNLTHLGLGEN 458          
BLAST of SMED30019284 vs. Ensembl Celegans
Match: soc-2 (Leucine-rich repeat protein soc-2 [Source:UniProtKB/Swiss-Prot;Acc:Q22875])

HSP 1 Score: 140.584 bits (353), Expect = 1.869e-34
Identity = 133/453 (29.36%), Postives = 233/453 (51.43%), Query Frame = 3
Query:   84 EEIDNINEDFFEKEKINILNCSYSKVKKIGKLCNCKDLEGLIVNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMD-IGKLKKLIVLNLSFNNFIEIPS-NIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXD--QCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGN-KIQSFPW---LPESIIDFDLSDNPVESIPQNFMA 1418
            +E+  + E F  K K+  L        +IG+L N K L GL  + N +T +P ++  L+SL  L+L HN +T + +  + + +L  L L  N +  + E IGN SKL+  ++  NK   LP  +  L+ L+    S+NHL  VP+ IG    LT L L HNDLS+LP +I +L NL  + +  N +  +   +     L E  + +N LQ L  + +  L K+  +NLS N     P+    +  S   +N+  N +I+ +P  I   +     ++  +    SL  D G + ++  L++S N +  LP D +  ++L +L  SNN++ ++P   G+L KL+ LDL  NEL+++P  + +++ L K+ + +N+    P  +  + +L  + +  N++  IPE I  L  L++  L+ N  + + P+   L +S+    + ++P+  IP    A
Sbjct:   92 KELTQLTELFLYKNKLTCLPT------EIGQLVNLKKL-GL--SENALTSLPDSLASLESLETLDLRHNKLTEVPSVIYKIGSLETLWLRYNRIVAVDEQIGNLSKLKMLDVRENKIRELPSAIGKLTSLVVCLVSYNHLTRVPEEIGDCHSLTQLDLQHNDLSELPYSIGKLVNLVRIGIRYNKIRCIPSELESCQQLEEFIVESNHLQLLPPNLLTMLPKIHTVNLSRNELTAFPAGGPQQFVSTVTINMEHN-QISKIPIGIFSKATRLTKLNLKENELVSLPLDMGSWTSITELNLSTNQLKVLPEDIEKLVNLEILVLSNNQLKKLPNQIGNLNKLRELDLEENELETVPTEIGFLQHLTKLWVQSNKILTLPRSIGNLCSLQDLRLGENNLTAIPEEIGHLDSLKSLYLNDNSSLHNLPFELALCQSLEIMSIENSPLSQIPPEITA 534          

HSP 2 Score: 125.176 bits (313), Expect = 2.209e-29
Identity = 137/525 (26.10%), Postives = 238/525 (45.33%), Query Frame = 3
Query:  273 LNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPE-VFGSLKKLQILDLSNNELDSLPVIM-EYMESLRKINLSNNRFNNFP-EILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFPWLPESIIDFD---LSDNPVESIPQNFMAKLNYIENLNISNTNSDGI-LEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGN-KIKDIESSFVLEFQDRLESLDLSNNAISALPA--TAFTKFSKLRYLNLQG 1817
            L+LS   IT++ +   +L  L  L L  N LT L   IG    L+   +S N   +LP++L SL  L + D  HN L  VP  I  +  L TL L +N +  + E I  L  L++                       L++  N ++ L   IGKL  L+V  +S+N+   +P  IG+  SL  L+L+ N                       + S L    G   NL  + I  N I  +P + ++C  L      +N +  +P  +   L K+  ++LS NEL + P    +   S   IN+ +N+ +  P  I +K   L  + +  N++ ++P  + S T +   NLS N+++  P   E +++ +   LS+N ++ +P N +  LN +  L++     + +  EI F  +  K++     +  K+  +   +  L +L+++ L  N L +IPE+I  + +L S+ L  N  + ++   F L     LE + + N+ +S +P   TA      ++YL +QG
Sbjct:   77 LDLSSIEITSIPSPIKELTQLTELFLYKNKLTCLPTEIGQLVNLKKLGLSENALTSLPDSLASLESLETLDLRHNKLTEVPSVIYKIGSLETLWLRYNRIVAVDEQIGNLSKLKM-----------------------LDVRENKIRELPSAIGKLTSLVVCLVSYNHLTRVPEEIGDCHSLTQLDLQHN-----------------------DLSELPYSIGKLVNLVRIGIRYNKIRCIPSELESCQQLEEFIVESNHLQLLPPNLLTMLPKIHTVNLSRNELTAFPAGGPQQFVSTVTINMEHNQISKIPIGIFSKATRLTKLNLKENELVSLPLDMGSWTSITELNLSTNQLKVLPEDIEKLVNLEILVLSNNQLKKLP-NQIGNLNKLRELDLEENELETVPTEIGFLQHLTKLWV----QSNKILTLPRSIGNLCSLQDLRLGENNLTAIPEEIGHLDSLKSLYLNDNSSLHNL--PFELALCQSLEIMSIENSPLSQIPPEITAGGPSLVIQYLKMQG 548          

HSP 3 Score: 102.834 bits (255), Expect = 2.730e-22
Identity = 105/416 (25.24%), Postives = 170/416 (40.87%), Query Frame = 3
Query:  456 CSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMS-LTRLQTFNLSGNKIQSFP-WLPE---SIIDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDI 1688
            C  ++    D S   +  +P  I  L QLT L L  N L+ LP  I +L                       VNL +L +  N L  L   +  L+ L  L+L  N   E+PS I ++ SL+ L LR N  +                       ++ +  G  + L++LD+  N I +LP       SL V   S N +  +PE  G    L  LDL +N+L  LP  +  + +L +I +  N+    P  L     L    + +N ++ +P ++++ L ++ T NLS N++ +FP   P+   S +  ++  N +  IP    +K   +  LN+               N L     D      +TE+             NLS N L  +PE I ++ NL  + L  N++K +
Sbjct:   69 CKEAQDQRLDLSSIEITSIPSPIKELTQLTELFLYKNKLTCLPTEIGQL-----------------------VNLKKLGLSENALTSLPDSLASLESLETLDLRHNKLTEVPSVIYKIGSLETLWLRYNRIV-----------------------AVDEQIGNLSKLKMLDVRENKIRELPSAIGKLTSLVVCLVSYNHLTRVPEEIGDCHSLTQLDLQHNDLSELPYSIGKLVNLVRIGIRYNKIRCIPSELESCQQLEEFIVESNHLQLLPPNLLTMLPKIHTVNLSRNELTAFPAGGPQQFVSTVTINMEHNQISKIPIGIFSKATRLTKLNLKE-------------NELVSLPLDMGSWTSITEL-------------NLSTNQLKVLPEDIEKLVNLEILVLSNNQLKKL 412          

HSP 4 Score: 67.0106 bits (162), Expect = 5.098e-11
Identity = 62/247 (25.10%), Postives = 120/247 (48.58%), Query Frame = 3
Query: 1095 QILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFPWLPESIIDFD---LSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKI--FKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDIESSFVLEFQDRLESLDLSNNAISALPATAFTKFSKLRYLNLQGN 1820
            Q LDLS+ E+ S+P  ++ +  L ++ L  N+    P  + ++  L  + ++ N + ++P+S+ SL  L+T +L  NK+   P +   I   +   L  N + ++ +  +  L+ ++ L++       +   +  L SL +    Y+      LT +   +   ++L +++L +N L  +P  I ++ NL  I +R NKI+ I S   LE   +LE   + +N +  LP    T   K+  +NL  N
Sbjct:   75 QRLDLSSIEITSIPSPIKELTQLTELFLYKNKLTCLPTEIGQLVNLKKLGLSENALTSLPDSLASLESLETLDLRHNKLTEVPSVIYKIGSLETLWLRYNRIVAVDEQ-IGNLSKLKMLDVRENKIRELPSAIGKLTSLVVCLVSYNH-----LTRVPEEIGDCHSLTQLDLQHNDLSELPYSIGKLVNLVRIGIRYNKIRCIPSE--LESCQQLEEFIVESNHLQLLPPNLLTMLPKIHTVNLSRN 313          
BLAST of SMED30019284 vs. Ensembl Celegans
Match: soc-2 (Leucine-rich repeat protein soc-2 [Source:UniProtKB/Swiss-Prot;Acc:Q22875])

HSP 1 Score: 140.198 bits (352), Expect = 2.169e-34
Identity = 133/453 (29.36%), Postives = 233/453 (51.43%), Query Frame = 3
Query:   84 EEIDNINEDFFEKEKINILNCSYSKVKKIGKLCNCKDLEGLIVNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMD-IGKLKKLIVLNLSFNNFIEIPS-NIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXD--QCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGN-KIQSFPW---LPESIIDFDLSDNPVESIPQNFMA 1418
            +E+  + E F  K K+  L        +IG+L N K L GL  + N +T +P ++  L+SL  L+L HN +T + +  + + +L  L L  N +  + E IGN SKL+  ++  NK   LP  +  L+ L+    S+NHL  VP+ IG    LT L L HNDLS+LP +I +L NL  + +  N +  +   +     L E  + +N LQ L  + +  L K+  +NLS N     P+    +  S   +N+  N +I+ +P  I   +     ++  +    SL  D G + ++  L++S N +  LP D +  ++L +L  SNN++ ++P   G+L KL+ LDL  NEL+++P  + +++ L K+ + +N+    P  +  + +L  + +  N++  IPE I  L  L++  L+ N  + + P+   L +S+    + ++P+  IP    A
Sbjct:   83 KELTQLTELFLYKNKLTCLPT------EIGQLVNLKKL-GL--SENALTSLPDSLASLESLETLDLRHNKLTEVPSVIYKIGSLETLWLRYNRIVAVDEQIGNLSKLKMLDVRENKIRELPSAIGKLTSLVVCLVSYNHLTRVPEEIGDCHSLTQLDLQHNDLSELPYSIGKLVNLVRIGIRYNKIRCIPSELESCQQLEEFIVESNHLQLLPPNLLTMLPKIHTVNLSRNELTAFPAGGPQQFVSTVTINMEHN-QISKIPIGIFSKATRLTKLNLKENELVSLPLDMGSWTSITELNLSTNQLKVLPEDIEKLVNLEILVLSNNQLKKLPNQIGNLNKLRELDLEENELETVPTEIGFLQHLTKLWVQSNKILTLPRSIGNLCSLQDLRLGENNLTAIPEEIGHLDSLKSLYLNDNSSLHNLPFELALCQSLEIMSIENSPLSQIPPEITA 525          

HSP 2 Score: 124.405 bits (311), Expect = 3.075e-29
Identity = 137/525 (26.10%), Postives = 238/525 (45.33%), Query Frame = 3
Query:  273 LNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPE-VFGSLKKLQILDLSNNELDSLPVIM-EYMESLRKINLSNNRFNNFP-EILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFPWLPESIIDFD---LSDNPVESIPQNFMAKLNYIENLNISNTNSDGI-LEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGN-KIKDIESSFVLEFQDRLESLDLSNNAISALPA--TAFTKFSKLRYLNLQG 1817
            L+LS   IT++ +   +L  L  L L  N LT L   IG    L+   +S N   +LP++L SL  L + D  HN L  VP  I  +  L TL L +N +  + E I  L  L++                       L++  N ++ L   IGKL  L+V  +S+N+   +P  IG+  SL  L+L+ N                       + S L    G   NL  + I  N I  +P + ++C  L      +N +  +P  +   L K+  ++LS NEL + P    +   S   IN+ +N+ +  P  I +K   L  + +  N++ ++P  + S T +   NLS N+++  P   E +++ +   LS+N ++ +P N +  LN +  L++     + +  EI F  +  K++     +  K+  +   +  L +L+++ L  N L +IPE+I  + +L S+ L  N  + ++   F L     LE + + N+ +S +P   TA      ++YL +QG
Sbjct:   68 LDLSSIEITSIPSPIKELTQLTELFLYKNKLTCLPTEIGQLVNLKKLGLSENALTSLPDSLASLESLETLDLRHNKLTEVPSVIYKIGSLETLWLRYNRIVAVDEQIGNLSKLKM-----------------------LDVRENKIRELPSAIGKLTSLVVCLVSYNHLTRVPEEIGDCHSLTQLDLQHN-----------------------DLSELPYSIGKLVNLVRIGIRYNKIRCIPSELESCQQLEEFIVESNHLQLLPPNLLTMLPKIHTVNLSRNELTAFPAGGPQQFVSTVTINMEHNQISKIPIGIFSKATRLTKLNLKENELVSLPLDMGSWTSITELNLSTNQLKVLPEDIEKLVNLEILVLSNNQLKKLP-NQIGNLNKLRELDLEENELETVPTEIGFLQHLTKLWV----QSNKILTLPRSIGNLCSLQDLRLGENNLTAIPEEIGHLDSLKSLYLNDNSSLHNL--PFELALCQSLEIMSIENSPLSQIPPEITAGGPSLVIQYLKMQG 539          

HSP 3 Score: 102.449 bits (254), Expect = 4.036e-22
Identity = 105/416 (25.24%), Postives = 170/416 (40.87%), Query Frame = 3
Query:  456 CSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMS-LTRLQTFNLSGNKIQSFP-WLPE---SIIDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDI 1688
            C  ++    D S   +  +P  I  L QLT L L  N L+ LP  I +L                       VNL +L +  N L  L   +  L+ L  L+L  N   E+PS I ++ SL+ L LR N  +                       ++ +  G  + L++LD+  N I +LP       SL V   S N +  +PE  G    L  LDL +N+L  LP  +  + +L +I +  N+    P  L     L    + +N ++ +P ++++ L ++ T NLS N++ +FP   P+   S +  ++  N +  IP    +K   +  LN+               N L     D      +TE+             NLS N L  +PE I ++ NL  + L  N++K +
Sbjct:   60 CKEAQDQRLDLSSIEITSIPSPIKELTQLTELFLYKNKLTCLPTEIGQL-----------------------VNLKKLGLSENALTSLPDSLASLESLETLDLRHNKLTEVPSVIYKIGSLETLWLRYNRIV-----------------------AVDEQIGNLSKLKMLDVRENKIRELPSAIGKLTSLVVCLVSYNHLTRVPEEIGDCHSLTQLDLQHNDLSELPYSIGKLVNLVRIGIRYNKIRCIPSELESCQQLEEFIVESNHLQLLPPNLLTMLPKIHTVNLSRNELTAFPAGGPQQFVSTVTINMEHNQISKIPIGIFSKATRLTKLNLKE-------------NELVSLPLDMGSWTSITEL-------------NLSTNQLKVLPEDIEKLVNLEILVLSNNQLKKL 403          

HSP 4 Score: 66.2402 bits (160), Expect = 8.341e-11
Identity = 62/247 (25.10%), Postives = 120/247 (48.58%), Query Frame = 3
Query: 1095 QILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFPWLPESIIDFD---LSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKI--FKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDIESSFVLEFQDRLESLDLSNNAISALPATAFTKFSKLRYLNLQGN 1820
            Q LDLS+ E+ S+P  ++ +  L ++ L  N+    P  + ++  L  + ++ N + ++P+S+ SL  L+T +L  NK+   P +   I   +   L  N + ++ +  +  L+ ++ L++       +   +  L SL +    Y+      LT +   +   ++L +++L +N L  +P  I ++ NL  I +R NKI+ I S   LE   +LE   + +N +  LP    T   K+  +NL  N
Sbjct:   66 QRLDLSSIEITSIPSPIKELTQLTELFLYKNKLTCLPTEIGQLVNLKKLGLSENALTSLPDSLASLESLETLDLRHNKLTEVPSVIYKIGSLETLWLRYNRIVAVDEQ-IGNLSKLKMLDVRENKIRELPSAIGKLTSLVVCLVSYNH-----LTRVPEEIGDCHSLTQLDLQHNDLSELPYSIGKLVNLVRIGIRYNKIRCIPSE--LESCQQLEEFIVESNHLQLLPPNLLTMLPKIHTVNLSRN 304          
BLAST of SMED30019284 vs. Ensembl Celegans
Match: soc-2 (Leucine-rich repeat protein soc-2 [Source:UniProtKB/Swiss-Prot;Acc:Q22875])

HSP 1 Score: 140.198 bits (352), Expect = 2.187e-34
Identity = 133/453 (29.36%), Postives = 233/453 (51.43%), Query Frame = 3
Query:   84 EEIDNINEDFFEKEKINILNCSYSKVKKIGKLCNCKDLEGLIVNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMD-IGKLKKLIVLNLSFNNFIEIPS-NIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXD--QCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGN-KIQSFPW---LPESIIDFDLSDNPVESIPQNFMA 1418
            +E+  + E F  K K+  L        +IG+L N K L GL  + N +T +P ++  L+SL  L+L HN +T + +  + + +L  L L  N +  + E IGN SKL+  ++  NK   LP  +  L+ L+    S+NHL  VP+ IG    LT L L HNDLS+LP +I +L NL  + +  N +  +   +     L E  + +N LQ L  + +  L K+  +NLS N     P+    +  S   +N+  N +I+ +P  I   +     ++  +    SL  D G + ++  L++S N +  LP D +  ++L +L  SNN++ ++P   G+L KL+ LDL  NEL+++P  + +++ L K+ + +N+    P  +  + +L  + +  N++  IPE I  L  L++  L+ N  + + P+   L +S+    + ++P+  IP    A
Sbjct:   93 KELTQLTELFLYKNKLTCLPT------EIGQLVNLKKL-GL--SENALTSLPDSLASLESLETLDLRHNKLTEVPSVIYKIGSLETLWLRYNRIVAVDEQIGNLSKLKMLDVRENKIRELPSAIGKLTSLVVCLVSYNHLTRVPEEIGDCHSLTQLDLQHNDLSELPYSIGKLVNLVRIGIRYNKIRCIPSELESCQQLEEFIVESNHLQLLPPNLLTMLPKIHTVNLSRNELTAFPAGGPQQFVSTVTINMEHN-QISKIPIGIFSKATRLTKLNLKENELVSLPLDMGSWTSITELNLSTNQLKVLPEDIEKLVNLEILVLSNNQLKKLPNQIGNLNKLRELDLEENELETVPTEIGFLQHLTKLWVQSNKILTLPRSIGNLCSLQDLRLGENNLTAIPEEIGHLDSLKSLYLNDNSSLHNLPFELALCQSLEIMSIENSPLSQIPPEITA 535          

HSP 2 Score: 124.79 bits (312), Expect = 3.081e-29
Identity = 137/525 (26.10%), Postives = 238/525 (45.33%), Query Frame = 3
Query:  273 LNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPE-VFGSLKKLQILDLSNNELDSLPVIM-EYMESLRKINLSNNRFNNFP-EILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFPWLPESIIDFD---LSDNPVESIPQNFMAKLNYIENLNISNTNSDGI-LEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGN-KIKDIESSFVLEFQDRLESLDLSNNAISALPA--TAFTKFSKLRYLNLQG 1817
            L+LS   IT++ +   +L  L  L L  N LT L   IG    L+   +S N   +LP++L SL  L + D  HN L  VP  I  +  L TL L +N +  + E I  L  L++                       L++  N ++ L   IGKL  L+V  +S+N+   +P  IG+  SL  L+L+ N                       + S L    G   NL  + I  N I  +P + ++C  L      +N +  +P  +   L K+  ++LS NEL + P    +   S   IN+ +N+ +  P  I +K   L  + +  N++ ++P  + S T +   NLS N+++  P   E +++ +   LS+N ++ +P N +  LN +  L++     + +  EI F  +  K++     +  K+  +   +  L +L+++ L  N L +IPE+I  + +L S+ L  N  + ++   F L     LE + + N+ +S +P   TA      ++YL +QG
Sbjct:   78 LDLSSIEITSIPSPIKELTQLTELFLYKNKLTCLPTEIGQLVNLKKLGLSENALTSLPDSLASLESLETLDLRHNKLTEVPSVIYKIGSLETLWLRYNRIVAVDEQIGNLSKLKM-----------------------LDVRENKIRELPSAIGKLTSLVVCLVSYNHLTRVPEEIGDCHSLTQLDLQHN-----------------------DLSELPYSIGKLVNLVRIGIRYNKIRCIPSELESCQQLEEFIVESNHLQLLPPNLLTMLPKIHTVNLSRNELTAFPAGGPQQFVSTVTINMEHNQISKIPIGIFSKATRLTKLNLKENELVSLPLDMGSWTSITELNLSTNQLKVLPEDIEKLVNLEILVLSNNQLKKLP-NQIGNLNKLRELDLEENELETVPTEIGFLQHLTKLWV----QSNKILTLPRSIGNLCSLQDLRLGENNLTAIPEEIGHLDSLKSLYLNDNSSLHNL--PFELALCQSLEIMSIENSPLSQIPPEITAGGPSLVIQYLKMQG 549          

HSP 3 Score: 102.449 bits (254), Expect = 3.641e-22
Identity = 105/416 (25.24%), Postives = 170/416 (40.87%), Query Frame = 3
Query:  456 CSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMS-LTRLQTFNLSGNKIQSFP-WLPE---SIIDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDI 1688
            C  ++    D S   +  +P  I  L QLT L L  N L+ LP  I +L                       VNL +L +  N L  L   +  L+ L  L+L  N   E+PS I ++ SL+ L LR N  +                       ++ +  G  + L++LD+  N I +LP       SL V   S N +  +PE  G    L  LDL +N+L  LP  +  + +L +I +  N+    P  L     L    + +N ++ +P ++++ L ++ T NLS N++ +FP   P+   S +  ++  N +  IP    +K   +  LN+               N L     D      +TE+             NLS N L  +PE I ++ NL  + L  N++K +
Sbjct:   70 CKEAQDQRLDLSSIEITSIPSPIKELTQLTELFLYKNKLTCLPTEIGQL-----------------------VNLKKLGLSENALTSLPDSLASLESLETLDLRHNKLTEVPSVIYKIGSLETLWLRYNRIV-----------------------AVDEQIGNLSKLKMLDVRENKIRELPSAIGKLTSLVVCLVSYNHLTRVPEEIGDCHSLTQLDLQHNDLSELPYSIGKLVNLVRIGIRYNKIRCIPSELESCQQLEEFIVESNHLQLLPPNLLTMLPKIHTVNLSRNELTAFPAGGPQQFVSTVTINMEHNQISKIPIGIFSKATRLTKLNLKE-------------NELVSLPLDMGSWTSITEL-------------NLSTNQLKVLPEDIEKLVNLEILVLSNNQLKKL 413          

HSP 4 Score: 66.6254 bits (161), Expect = 6.443e-11
Identity = 62/247 (25.10%), Postives = 120/247 (48.58%), Query Frame = 3
Query: 1095 QILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFPWLPESIIDFD---LSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKI--FKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDIESSFVLEFQDRLESLDLSNNAISALPATAFTKFSKLRYLNLQGN 1820
            Q LDLS+ E+ S+P  ++ +  L ++ L  N+    P  + ++  L  + ++ N + ++P+S+ SL  L+T +L  NK+   P +   I   +   L  N + ++ +  +  L+ ++ L++       +   +  L SL +    Y+      LT +   +   ++L +++L +N L  +P  I ++ NL  I +R NKI+ I S   LE   +LE   + +N +  LP    T   K+  +NL  N
Sbjct:   76 QRLDLSSIEITSIPSPIKELTQLTELFLYKNKLTCLPTEIGQLVNLKKLGLSENALTSLPDSLASLESLETLDLRHNKLTEVPSVIYKIGSLETLWLRYNRIVAVDEQ-IGNLSKLKMLDVRENKIRELPSAIGKLTSLVVCLVSYNH-----LTRVPEEIGDCHSLTQLDLQHNDLSELPYSIGKLVNLVRIGIRYNKIRCIPSE--LESCQQLEEFIVESNHLQLLPPNLLTMLPKIHTVNLSRN 314          
BLAST of SMED30019284 vs. Ensembl Celegans
Match: soc-2 (Leucine-rich repeat protein soc-2 [Source:UniProtKB/Swiss-Prot;Acc:Q22875])

HSP 1 Score: 140.198 bits (352), Expect = 2.187e-34
Identity = 133/453 (29.36%), Postives = 233/453 (51.43%), Query Frame = 3
Query:   84 EEIDNINEDFFEKEKINILNCSYSKVKKIGKLCNCKDLEGLIVNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMD-IGKLKKLIVLNLSFNNFIEIPS-NIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXD--QCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGN-KIQSFPW---LPESIIDFDLSDNPVESIPQNFMA 1418
            +E+  + E F  K K+  L        +IG+L N K L GL  + N +T +P ++  L+SL  L+L HN +T + +  + + +L  L L  N +  + E IGN SKL+  ++  NK   LP  +  L+ L+    S+NHL  VP+ IG    LT L L HNDLS+LP +I +L NL  + +  N +  +   +     L E  + +N LQ L  + +  L K+  +NLS N     P+    +  S   +N+  N +I+ +P  I   +     ++  +    SL  D G + ++  L++S N +  LP D +  ++L +L  SNN++ ++P   G+L KL+ LDL  NEL+++P  + +++ L K+ + +N+    P  +  + +L  + +  N++  IPE I  L  L++  L+ N  + + P+   L +S+    + ++P+  IP    A
Sbjct:   93 KELTQLTELFLYKNKLTCLPT------EIGQLVNLKKL-GL--SENALTSLPDSLASLESLETLDLRHNKLTEVPSVIYKIGSLETLWLRYNRIVAVDEQIGNLSKLKMLDVRENKIRELPSAIGKLTSLVVCLVSYNHLTRVPEEIGDCHSLTQLDLQHNDLSELPYSIGKLVNLVRIGIRYNKIRCIPSELESCQQLEEFIVESNHLQLLPPNLLTMLPKIHTVNLSRNELTAFPAGGPQQFVSTVTINMEHN-QISKIPIGIFSKATRLTKLNLKENELVSLPLDMGSWTSITELNLSTNQLKVLPEDIEKLVNLEILVLSNNQLKKLPNQIGNLNKLRELDLEENELETVPTEIGFLQHLTKLWVQSNKILTLPRSIGNLCSLQDLRLGENNLTAIPEEIGHLDSLKSLYLNDNSSLHNLPFELALCQSLEIMSIENSPLSQIPPEITA 535          

HSP 2 Score: 124.79 bits (312), Expect = 3.081e-29
Identity = 137/525 (26.10%), Postives = 238/525 (45.33%), Query Frame = 3
Query:  273 LNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPE-VFGSLKKLQILDLSNNELDSLPVIM-EYMESLRKINLSNNRFNNFP-EILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFPWLPESIIDFD---LSDNPVESIPQNFMAKLNYIENLNISNTNSDGI-LEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGN-KIKDIESSFVLEFQDRLESLDLSNNAISALPA--TAFTKFSKLRYLNLQG 1817
            L+LS   IT++ +   +L  L  L L  N LT L   IG    L+   +S N   +LP++L SL  L + D  HN L  VP  I  +  L TL L +N +  + E I  L  L++                       L++  N ++ L   IGKL  L+V  +S+N+   +P  IG+  SL  L+L+ N                       + S L    G   NL  + I  N I  +P + ++C  L      +N +  +P  +   L K+  ++LS NEL + P    +   S   IN+ +N+ +  P  I +K   L  + +  N++ ++P  + S T +   NLS N+++  P   E +++ +   LS+N ++ +P N +  LN +  L++     + +  EI F  +  K++     +  K+  +   +  L +L+++ L  N L +IPE+I  + +L S+ L  N  + ++   F L     LE + + N+ +S +P   TA      ++YL +QG
Sbjct:   78 LDLSSIEITSIPSPIKELTQLTELFLYKNKLTCLPTEIGQLVNLKKLGLSENALTSLPDSLASLESLETLDLRHNKLTEVPSVIYKIGSLETLWLRYNRIVAVDEQIGNLSKLKM-----------------------LDVRENKIRELPSAIGKLTSLVVCLVSYNHLTRVPEEIGDCHSLTQLDLQHN-----------------------DLSELPYSIGKLVNLVRIGIRYNKIRCIPSELESCQQLEEFIVESNHLQLLPPNLLTMLPKIHTVNLSRNELTAFPAGGPQQFVSTVTINMEHNQISKIPIGIFSKATRLTKLNLKENELVSLPLDMGSWTSITELNLSTNQLKVLPEDIEKLVNLEILVLSNNQLKKLP-NQIGNLNKLRELDLEENELETVPTEIGFLQHLTKLWV----QSNKILTLPRSIGNLCSLQDLRLGENNLTAIPEEIGHLDSLKSLYLNDNSSLHNL--PFELALCQSLEIMSIENSPLSQIPPEITAGGPSLVIQYLKMQG 549          

HSP 3 Score: 102.449 bits (254), Expect = 3.641e-22
Identity = 105/416 (25.24%), Postives = 170/416 (40.87%), Query Frame = 3
Query:  456 CSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMS-LTRLQTFNLSGNKIQSFP-WLPE---SIIDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDI 1688
            C  ++    D S   +  +P  I  L QLT L L  N L+ LP  I +L                       VNL +L +  N L  L   +  L+ L  L+L  N   E+PS I ++ SL+ L LR N  +                       ++ +  G  + L++LD+  N I +LP       SL V   S N +  +PE  G    L  LDL +N+L  LP  +  + +L +I +  N+    P  L     L    + +N ++ +P ++++ L ++ T NLS N++ +FP   P+   S +  ++  N +  IP    +K   +  LN+               N L     D      +TE+             NLS N L  +PE I ++ NL  + L  N++K +
Sbjct:   70 CKEAQDQRLDLSSIEITSIPSPIKELTQLTELFLYKNKLTCLPTEIGQL-----------------------VNLKKLGLSENALTSLPDSLASLESLETLDLRHNKLTEVPSVIYKIGSLETLWLRYNRIV-----------------------AVDEQIGNLSKLKMLDVRENKIRELPSAIGKLTSLVVCLVSYNHLTRVPEEIGDCHSLTQLDLQHNDLSELPYSIGKLVNLVRIGIRYNKIRCIPSELESCQQLEEFIVESNHLQLLPPNLLTMLPKIHTVNLSRNELTAFPAGGPQQFVSTVTINMEHNQISKIPIGIFSKATRLTKLNLKE-------------NELVSLPLDMGSWTSITEL-------------NLSTNQLKVLPEDIEKLVNLEILVLSNNQLKKL 413          

HSP 4 Score: 66.6254 bits (161), Expect = 6.443e-11
Identity = 62/247 (25.10%), Postives = 120/247 (48.58%), Query Frame = 3
Query: 1095 QILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFPWLPESIIDFD---LSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKI--FKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDIESSFVLEFQDRLESLDLSNNAISALPATAFTKFSKLRYLNLQGN 1820
            Q LDLS+ E+ S+P  ++ +  L ++ L  N+    P  + ++  L  + ++ N + ++P+S+ SL  L+T +L  NK+   P +   I   +   L  N + ++ +  +  L+ ++ L++       +   +  L SL +    Y+      LT +   +   ++L +++L +N L  +P  I ++ NL  I +R NKI+ I S   LE   +LE   + +N +  LP    T   K+  +NL  N
Sbjct:   76 QRLDLSSIEITSIPSPIKELTQLTELFLYKNKLTCLPTEIGQLVNLKKLGLSENALTSLPDSLASLESLETLDLRHNKLTEVPSVIYKIGSLETLWLRYNRIVAVDEQ-IGNLSKLKMLDVRENKIRELPSAIGKLTSLVVCLVSYNH-----LTRVPEEIGDCHSLTQLDLQHNDLSELPYSIGKLVNLVRIGIRYNKIRCIPSE--LESCQQLEEFIVESNHLQLLPPNLLTMLPKIHTVNLSRN 314          
BLAST of SMED30019284 vs. Ensembl Celegans
Match: soc-2 (Leucine-rich repeat protein soc-2 [Source:UniProtKB/Swiss-Prot;Acc:Q22875])

HSP 1 Score: 140.584 bits (353), Expect = 3.415e-34
Identity = 133/453 (29.36%), Postives = 233/453 (51.43%), Query Frame = 3
Query:   84 EEIDNINEDFFEKEKINILNCSYSKVKKIGKLCNCKDLEGLIVNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMD-IGKLKKLIVLNLSFNNFIEIPS-NIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXD--QCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGN-KIQSFPW---LPESIIDFDLSDNPVESIPQNFMA 1418
            +E+  + E F  K K+  L        +IG+L N K L GL  + N +T +P ++  L+SL  L+L HN +T + +  + + +L  L L  N +  + E IGN SKL+  ++  NK   LP  +  L+ L+    S+NHL  VP+ IG    LT L L HNDLS+LP +I +L NL  + +  N +  +   +     L E  + +N LQ L  + +  L K+  +NLS N     P+    +  S   +N+  N +I+ +P  I   +     ++  +    SL  D G + ++  L++S N +  LP D +  ++L +L  SNN++ ++P   G+L KL+ LDL  NEL+++P  + +++ L K+ + +N+    P  +  + +L  + +  N++  IPE I  L  L++  L+ N  + + P+   L +S+    + ++P+  IP    A
Sbjct:  165 KELTQLTELFLYKNKLTCLPT------EIGQLVNLKKL-GL--SENALTSLPDSLASLESLETLDLRHNKLTEVPSVIYKIGSLETLWLRYNRIVAVDEQIGNLSKLKMLDVRENKIRELPSAIGKLTSLVVCLVSYNHLTRVPEEIGDCHSLTQLDLQHNDLSELPYSIGKLVNLVRIGIRYNKIRCIPSELESCQQLEEFIVESNHLQLLPPNLLTMLPKIHTVNLSRNELTAFPAGGPQQFVSTVTINMEHN-QISKIPIGIFSKATRLTKLNLKENELVSLPLDMGSWTSITELNLSTNQLKVLPEDIEKLVNLEILVLSNNQLKKLPNQIGNLNKLRELDLEENELETVPTEIGFLQHLTKLWVQSNKILTLPRSIGNLCSLQDLRLGENNLTAIPEEIGHLDSLKSLYLNDNSSLHNLPFELALCQSLEIMSIENSPLSQIPPEITA 607          

HSP 2 Score: 124.405 bits (311), Expect = 5.814e-29
Identity = 137/525 (26.10%), Postives = 238/525 (45.33%), Query Frame = 3
Query:  273 LNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPE-VFGSLKKLQILDLSNNELDSLPVIM-EYMESLRKINLSNNRFNNFP-EILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFPWLPESIIDFD---LSDNPVESIPQNFMAKLNYIENLNISNTNSDGI-LEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGN-KIKDIESSFVLEFQDRLESLDLSNNAISALPA--TAFTKFSKLRYLNLQG 1817
            L+LS   IT++ +   +L  L  L L  N LT L   IG    L+   +S N   +LP++L SL  L + D  HN L  VP  I  +  L TL L +N +  + E I  L  L++                       L++  N ++ L   IGKL  L+V  +S+N+   +P  IG+  SL  L+L+ N                       + S L    G   NL  + I  N I  +P + ++C  L      +N +  +P  +   L K+  ++LS NEL + P    +   S   IN+ +N+ +  P  I +K   L  + +  N++ ++P  + S T +   NLS N+++  P   E +++ +   LS+N ++ +P N +  LN +  L++     + +  EI F  +  K++     +  K+  +   +  L +L+++ L  N L +IPE+I  + +L S+ L  N  + ++   F L     LE + + N+ +S +P   TA      ++YL +QG
Sbjct:  150 LDLSSIEITSIPSPIKELTQLTELFLYKNKLTCLPTEIGQLVNLKKLGLSENALTSLPDSLASLESLETLDLRHNKLTEVPSVIYKIGSLETLWLRYNRIVAVDEQIGNLSKLKM-----------------------LDVRENKIRELPSAIGKLTSLVVCLVSYNHLTRVPEEIGDCHSLTQLDLQHN-----------------------DLSELPYSIGKLVNLVRIGIRYNKIRCIPSELESCQQLEEFIVESNHLQLLPPNLLTMLPKIHTVNLSRNELTAFPAGGPQQFVSTVTINMEHNQISKIPIGIFSKATRLTKLNLKENELVSLPLDMGSWTSITELNLSTNQLKVLPEDIEKLVNLEILVLSNNQLKKLP-NQIGNLNKLRELDLEENELETVPTEIGFLQHLTKLWV----QSNKILTLPRSIGNLCSLQDLRLGENNLTAIPEEIGHLDSLKSLYLNDNSSLHNL--PFELALCQSLEIMSIENSPLSQIPPEITAGGPSLVIQYLKMQG 621          

HSP 3 Score: 102.834 bits (255), Expect = 4.060e-22
Identity = 104/416 (25.00%), Postives = 171/416 (41.11%), Query Frame = 3
Query:  456 CSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMS-LTRLQTFNLSGNKIQSFP-WLPE---SIIDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDI 1688
            C  ++    D S   +  +P  I  L QLT L L  N L+ LP  I +L                       VNL +L +  N L  L   +  L+ L  L+L  N   E+PS I ++ SL+ L LR N  +                       ++ +  G  + L++LD+  N I +LP       SL V   S N +  +PE  G    L  LDL +N+L  LP  +  + +L +I +  N+    P  L     L    + +N ++ +P ++++ L ++ T NLS N++ +FP   P+   S +  ++  N +  IP    +K   +  LN+               N L     D             +    ++ E+NLS N L  +PE I ++ NL  + L  N++K +
Sbjct:  142 CKEAQDQRLDLSSIEITSIPSPIKELTQLTELFLYKNKLTCLPTEIGQL-----------------------VNLKKLGLSENALTSLPDSLASLESLETLDLRHNKLTEVPSVIYKIGSLETLWLRYNRIV-----------------------AVDEQIGNLSKLKMLDVRENKIRELPSAIGKLTSLVVCLVSYNHLTRVPEEIGDCHSLTQLDLQHNDLSELPYSIGKLVNLVRIGIRYNKIRCIPSELESCQQLEEFIVESNHLQLLPPNLLTMLPKIHTVNLSRNELTAFPAGGPQQFVSTVTINMEHNQISKIPIGIFSKATRLTKLNLKE-------------NELVSLPLD-------------MGSWTSITELNLSTNQLKVLPEDIEKLVNLEILVLSNNQLKKL 485          

HSP 4 Score: 66.2402 bits (160), Expect = 9.646e-11
Identity = 62/247 (25.10%), Postives = 120/247 (48.58%), Query Frame = 3
Query: 1095 QILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFPWLPESIIDFD---LSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKI--FKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDIESSFVLEFQDRLESLDLSNNAISALPATAFTKFSKLRYLNLQGN 1820
            Q LDLS+ E+ S+P  ++ +  L ++ L  N+    P  + ++  L  + ++ N + ++P+S+ SL  L+T +L  NK+   P +   I   +   L  N + ++ +  +  L+ ++ L++       +   +  L SL +    Y+      LT +   +   ++L +++L +N L  +P  I ++ NL  I +R NKI+ I S   LE   +LE   + +N +  LP    T   K+  +NL  N
Sbjct:  148 QRLDLSSIEITSIPSPIKELTQLTELFLYKNKLTCLPTEIGQLVNLKKLGLSENALTSLPDSLASLESLETLDLRHNKLTEVPSVIYKIGSLETLWLRYNRIVAVDEQ-IGNLSKLKMLDVRENKIRELPSAIGKLTSLVVCLVSYNH-----LTRVPEEIGDCHSLTQLDLQHNDLSELPYSIGKLVNLVRIGIRYNKIRCIPSE--LESCQQLEEFIVESNHLQLLPPNLLTMLPKIHTVNLSRN 386          
BLAST of SMED30019284 vs. Ensembl Fly
Match: Sur-8 (gene:FBgn0038504 transcript:FBtr0339532)

HSP 1 Score: 138.272 bits (347), Expect = 3.142e-33
Identity = 118/422 (27.96%), Postives = 200/422 (47.39%), Query Frame = 3
Query:  177 LCNCKDLEGLIVNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMD-IGKLKKLIVLNLSFNNFIEIPS-NIGELSSLKYLNLRGNSKITNLP-GXXXXXXXXXXXXDQCN-FSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNK-IQSFPW---LPESIIDFDLSDNPVESIPQNFMA 1418
            L NC  L+ L +  N++ EIP  I +L+SLT L L  N IT +      L NL  L L  N +  L   IG    L   ++S N    LPE + +   L + D  HN L  +P  IG+LK L  L + +N LS +P T+K  ++++                       E N+  N +  L    +  L  L  + LS N F   P+    + +++  +NL  N +I  +P G          L  + N  ++L  D G + N+  L+++ N + +LP D  N  +L +L  SNN + +IP   G+L+KL+ILDL  N ++ LP  +  +  L+++ L  N+    P  +  +  L  + ++ N+++ +PE I SL  L+   ++ N  ++  P+   L +++   ++   P+ +IP    A
Sbjct:  225 LQNCSQLKVLDLRHNKLAEIPPVIYRLRSLTTLYLRFNRITAVADDLRQLVNLTMLSLRENKIRELGSAIGALVNLTTLDVSHNHLEHLPEDIGNCVNLSALDLQHNELLDIPDSIGNLKSLVRLGMRYNRLSSVPATLKNCKSMD-----------------------EFNVEGNGITQLPDGMLASLSGLTTITLSRNQFASYPTGGPAQFTNVYSINLEHN-RIDKIPYGIFSRAKGLTKLNMKENMLTALPLDIGTWVNMVELNLATNALQKLPDDIMNLQNLEILILSNNMLKKIPNTIGNLRKLRILDLEENRIEVLPHEIGLLHELQRLILQTNQITMLPRSIGHLGNLTHLSVSENNLQFLPEEIGSLESLENLYINQNPGLEKLPFELALCQNLKYLNIDKCPLSTIPPEIQA 622          

HSP 2 Score: 114.005 bits (284), Expect = 1.500e-25
Identity = 133/512 (25.98%), Postives = 228/512 (44.53%), Query Frame = 3
Query:  123 EKINILNCSYSKVKKI-GKLCNCKDLEGLIVNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHI----TQLPIDFKNCLSLAVLKWSNNKINEIP-EVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFP---WLPESIIDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQI 1631
            E I  L+ S S +  I   +  C  L  L +  N+I ++P  I  L SL  L L+ N +T+L  +  +   L  LDL +N L  +  +I     L    +  N+   + + L  L  L       N +  +   IG+L  LTTL ++HN L  LPE I                          VNL  L++ +N+L  +   IG LK L+ L + +N    +P+ +    S+   N+ GN  IT LP  +               +SLS        L  + +S N      T  P  F N  S+ +    +N+I++IP  +F   K L  L++  N L +LP+ +    ++ ++NL+ N     P+ +  +  L  + ++ N ++ IP +I +L +L+  +L  N+I+  P    L   +    L  N +  +P++ +  L  + +L++S  N   + E + SL SL+    +Q+ G  L ++   L+   NLK +N+    L +IP +I
Sbjct:  160 EGIKRLDLSKSSITVIPSTVKECVHLTELYLYSNKIGQLPPEIGCLVSLRNLALNENSLTSLPESLQNCSQLKVLDLRHNKLAEIPPVIYRLRSLTTLYLRFNRITAVADDLRQLVNLTMLSLRENKIRELGSAIGALVNLTTLDVSHNHLEHLPEDIG-----------------------NCVNLSALDLQHNELLDIPDSIGNLKSLVRLGMRYNRLSSVPATLKNCKSMDEFNVEGNG-ITQLPDGM--------------LASLS-------GLTTITLSRNQFASYPTGGPAQFTNVYSINL---EHNRIDKIPYGIFSRAKGLTKLNMKENMLTALPLDIGTWVNMVELNLATNALQKLPDDIMNLQNLEILILSNNMLKKIPNTIGNLRKLRILDLEENRIEVLPHEIGLLHELQRLILQTNQITMLPRS-IGHLGNLTHLSVSENNLQFLPEEIGSLESLENLYINQNPG--LEKLPFELALCQNLKYLNIDKCPLSTIPPEI 620          

HSP 3 Score: 95.9005 bits (237), Expect = 9.190e-20
Identity = 76/310 (24.52%), Postives = 152/310 (49.03%), Query Frame = 3
Query:  951 NLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFPWLPESIID---FDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQIL-QMKNLTSISLRGNKIKDIESSFVLEFQDRLESLDLSNNAISALPATAFTKFSKLRYLNLQGNPCKIPPSDVFNCGQMI 1868
             ++ LD+S + IT +P   K C+ L  L   +NKI ++P   G L  L+ L L+ N L SLP  ++    L+ ++L +N+    P ++ ++ +L ++ +  N I  + + +  L  L   +L  NKI+       ++++    D+S N +E +P++    +    NL+  +   + +L+I  S+ +LK       R  +L+ +   L    ++ E N+  N +  +P+ +L  +  LT+I+L  N+     +    +F + + S++L +N I  +P   F++   L  LN++ N     P D+     M+
Sbjct:  161 GIKRLDLSKSSITVIPSTVKECVHLTELYLYSNKIGQLPPEIGCLVSLRNLALNENSLTSLPESLQNCSQLKVLDLRHNKLAEIPPVIYRLRSLTTLYLRFNRITAVADDLRQLVNLTMLSLRENKIRELGSAIGALVNLTTLDVSHNHLEHLPED----IGNCVNLSALDLQHNELLDIPDSIGNLKSLVRLGMRYNRLSSVPATLKNCKSMDEFNVEGNGITQLPDGMLASLSGLTTITLSRNQFASYPTGGPAQFTN-VYSINLEHNRIDKIPYGIFSRAKGLTKLNMKENMLTALPLDIGTWVNMV 465          

HSP 4 Score: 87.4261 bits (215), Expect = 3.431e-17
Identity = 103/419 (24.58%), Postives = 182/419 (43.44%), Query Frame = 3
Query:  756 LNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKK-----------------------LQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFPWL---PESIIDFDLSDNPVESIPQNFMAKLNYIENLNISN-------TNSDGILEIVFSLNSLKIFKYDQ------DRGKKLTEIDGRLSQLN----------NLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDIESSFVLEFQDRLESLDLSNNAISALPATAFTKFSKLRYLNLQGNPCKIPPSDVFNCGQM 1865
            L+LS ++   IPS + E   L  L L  N KI  LP                       + G   +LR L ++ N +T LP   +NC  L VL   +NK+ EIP V   L+                        L +L L  N++  L   +  + +L  +++S+N   + PE +     L+++++  N++  IP+SI +L  L    +  N++ S P      +S+ +F++  N +  +P   +A L+ +  + +S        T        V+S+N L+  + D+       R K LT+++ + + L           N+ E+NL+ N L  +P+ I+ ++NL  + L  N +K I ++  +    +L  LDL  N I  LP        +L+ L LQ N   + P  + + G +
Sbjct:  165 LDLSKSSITVIPSTVKECVHLTELYLYSN-KIGQLP----------------------PEIGCLVSLRNLALNENSLTSLPESLQNCSQLKVLDLRHNKLAEIPPVIYRLRSLTTLYLRFNRITAVADDLRQLVNLTMLSLRENKIRELGSAIGALVNLTTLDVSHNHLEHLPEDIGNCVNLSALDLQHNELLDIPDSIGNLKSLVRLGMRYNRLSSVPATLKNCKSMDEFNVEGNGITQLPDGMLASLSGLTTITLSRNQFASYPTGGPAQFTNVYSIN-LEHNRIDKIPYGIFSRAKGLTKLNMKENMLTALPLDIGTWVNMVELNLATNALQKLPDDIMNLQNLEILILSNNMLKKIPNT--IGNLRKLRILDLEENRIEVLPH-EIGLLHELQRLILQTNQITMLPRSIGHLGNL 556          
BLAST of SMED30019284 vs. Ensembl Fly
Match: Sur-8 (gene:FBgn0038504 transcript:FBtr0083448)

HSP 1 Score: 138.272 bits (347), Expect = 3.142e-33
Identity = 118/422 (27.96%), Postives = 200/422 (47.39%), Query Frame = 3
Query:  177 LCNCKDLEGLIVNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMD-IGKLKKLIVLNLSFNNFIEIPS-NIGELSSLKYLNLRGNSKITNLP-GXXXXXXXXXXXXDQCN-FSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNK-IQSFPW---LPESIIDFDLSDNPVESIPQNFMA 1418
            L NC  L+ L +  N++ EIP  I +L+SLT L L  N IT +      L NL  L L  N +  L   IG    L   ++S N    LPE + +   L + D  HN L  +P  IG+LK L  L + +N LS +P T+K  ++++                       E N+  N +  L    +  L  L  + LS N F   P+    + +++  +NL  N +I  +P G          L  + N  ++L  D G + N+  L+++ N + +LP D  N  +L +L  SNN + +IP   G+L+KL+ILDL  N ++ LP  +  +  L+++ L  N+    P  +  +  L  + ++ N+++ +PE I SL  L+   ++ N  ++  P+   L +++   ++   P+ +IP    A
Sbjct:  225 LQNCSQLKVLDLRHNKLAEIPPVIYRLRSLTTLYLRFNRITAVADDLRQLVNLTMLSLRENKIRELGSAIGALVNLTTLDVSHNHLEHLPEDIGNCVNLSALDLQHNELLDIPDSIGNLKSLVRLGMRYNRLSSVPATLKNCKSMD-----------------------EFNVEGNGITQLPDGMLASLSGLTTITLSRNQFASYPTGGPAQFTNVYSINLEHN-RIDKIPYGIFSRAKGLTKLNMKENMLTALPLDIGTWVNMVELNLATNALQKLPDDIMNLQNLEILILSNNMLKKIPNTIGNLRKLRILDLEENRIEVLPHEIGLLHELQRLILQTNQITMLPRSIGHLGNLTHLSVSENNLQFLPEEIGSLESLENLYINQNPGLEKLPFELALCQNLKYLNIDKCPLSTIPPEIQA 622          

HSP 2 Score: 114.005 bits (284), Expect = 1.500e-25
Identity = 133/512 (25.98%), Postives = 228/512 (44.53%), Query Frame = 3
Query:  123 EKINILNCSYSKVKKI-GKLCNCKDLEGLIVNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHI----TQLPIDFKNCLSLAVLKWSNNKINEIP-EVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFP---WLPESIIDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQI 1631
            E I  L+ S S +  I   +  C  L  L +  N+I ++P  I  L SL  L L+ N +T+L  +  +   L  LDL +N L  +  +I     L    +  N+   + + L  L  L       N +  +   IG+L  LTTL ++HN L  LPE I                          VNL  L++ +N+L  +   IG LK L+ L + +N    +P+ +    S+   N+ GN  IT LP  +               +SLS        L  + +S N      T  P  F N  S+ +    +N+I++IP  +F   K L  L++  N L +LP+ +    ++ ++NL+ N     P+ +  +  L  + ++ N ++ IP +I +L +L+  +L  N+I+  P    L   +    L  N +  +P++ +  L  + +L++S  N   + E + SL SL+    +Q+ G  L ++   L+   NLK +N+    L +IP +I
Sbjct:  160 EGIKRLDLSKSSITVIPSTVKECVHLTELYLYSNKIGQLPPEIGCLVSLRNLALNENSLTSLPESLQNCSQLKVLDLRHNKLAEIPPVIYRLRSLTTLYLRFNRITAVADDLRQLVNLTMLSLRENKIRELGSAIGALVNLTTLDVSHNHLEHLPEDIG-----------------------NCVNLSALDLQHNELLDIPDSIGNLKSLVRLGMRYNRLSSVPATLKNCKSMDEFNVEGNG-ITQLPDGM--------------LASLS-------GLTTITLSRNQFASYPTGGPAQFTNVYSINL---EHNRIDKIPYGIFSRAKGLTKLNMKENMLTALPLDIGTWVNMVELNLATNALQKLPDDIMNLQNLEILILSNNMLKKIPNTIGNLRKLRILDLEENRIEVLPHEIGLLHELQRLILQTNQITMLPRS-IGHLGNLTHLSVSENNLQFLPEEIGSLESLENLYINQNPG--LEKLPFELALCQNLKYLNIDKCPLSTIPPEI 620          

HSP 3 Score: 95.9005 bits (237), Expect = 9.190e-20
Identity = 76/310 (24.52%), Postives = 152/310 (49.03%), Query Frame = 3
Query:  951 NLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFPWLPESIID---FDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQIL-QMKNLTSISLRGNKIKDIESSFVLEFQDRLESLDLSNNAISALPATAFTKFSKLRYLNLQGNPCKIPPSDVFNCGQMI 1868
             ++ LD+S + IT +P   K C+ L  L   +NKI ++P   G L  L+ L L+ N L SLP  ++    L+ ++L +N+    P ++ ++ +L ++ +  N I  + + +  L  L   +L  NKI+       ++++    D+S N +E +P++    +    NL+  +   + +L+I  S+ +LK       R  +L+ +   L    ++ E N+  N +  +P+ +L  +  LT+I+L  N+     +    +F + + S++L +N I  +P   F++   L  LN++ N     P D+     M+
Sbjct:  161 GIKRLDLSKSSITVIPSTVKECVHLTELYLYSNKIGQLPPEIGCLVSLRNLALNENSLTSLPESLQNCSQLKVLDLRHNKLAEIPPVIYRLRSLTTLYLRFNRITAVADDLRQLVNLTMLSLRENKIRELGSAIGALVNLTTLDVSHNHLEHLPED----IGNCVNLSALDLQHNELLDIPDSIGNLKSLVRLGMRYNRLSSVPATLKNCKSMDEFNVEGNGITQLPDGMLASLSGLTTITLSRNQFASYPTGGPAQFTN-VYSINLEHNRIDKIPYGIFSRAKGLTKLNMKENMLTALPLDIGTWVNMV 465          

HSP 4 Score: 87.4261 bits (215), Expect = 3.431e-17
Identity = 103/419 (24.58%), Postives = 182/419 (43.44%), Query Frame = 3
Query:  756 LNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKK-----------------------LQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFPWL---PESIIDFDLSDNPVESIPQNFMAKLNYIENLNISN-------TNSDGILEIVFSLNSLKIFKYDQ------DRGKKLTEIDGRLSQLN----------NLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDIESSFVLEFQDRLESLDLSNNAISALPATAFTKFSKLRYLNLQGNPCKIPPSDVFNCGQM 1865
            L+LS ++   IPS + E   L  L L  N KI  LP                       + G   +LR L ++ N +T LP   +NC  L VL   +NK+ EIP V   L+                        L +L L  N++  L   +  + +L  +++S+N   + PE +     L+++++  N++  IP+SI +L  L    +  N++ S P      +S+ +F++  N +  +P   +A L+ +  + +S        T        V+S+N L+  + D+       R K LT+++ + + L           N+ E+NL+ N L  +P+ I+ ++NL  + L  N +K I ++  +    +L  LDL  N I  LP        +L+ L LQ N   + P  + + G +
Sbjct:  165 LDLSKSSITVIPSTVKECVHLTELYLYSN-KIGQLP----------------------PEIGCLVSLRNLALNENSLTSLPESLQNCSQLKVLDLRHNKLAEIPPVIYRLRSLTTLYLRFNRITAVADDLRQLVNLTMLSLRENKIRELGSAIGALVNLTTLDVSHNHLEHLPEDIGNCVNLSALDLQHNELLDIPDSIGNLKSLVRLGMRYNRLSSVPATLKNCKSMDEFNVEGNGITQLPDGMLASLSGLTTITLSRNQFASYPTGGPAQFTNVYSIN-LEHNRIDKIPYGIFSRAKGLTKLNMKENMLTALPLDIGTWVNMVELNLATNALQKLPDDIMNLQNLEILILSNNMLKKIPNT--IGNLRKLRILDLEENRIEVLPH-EIGLLHELQRLILQTNQITMLPRSIGHLGNL 556          
BLAST of SMED30019284 vs. Ensembl Fly
Match: Sur-8 (gene:FBgn0038504 transcript:FBtr0083447)

HSP 1 Score: 138.272 bits (347), Expect = 3.142e-33
Identity = 118/422 (27.96%), Postives = 200/422 (47.39%), Query Frame = 3
Query:  177 LCNCKDLEGLIVNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMD-IGKLKKLIVLNLSFNNFIEIPS-NIGELSSLKYLNLRGNSKITNLP-GXXXXXXXXXXXXDQCN-FSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNK-IQSFPW---LPESIIDFDLSDNPVESIPQNFMA 1418
            L NC  L+ L +  N++ EIP  I +L+SLT L L  N IT +      L NL  L L  N +  L   IG    L   ++S N    LPE + +   L + D  HN L  +P  IG+LK L  L + +N LS +P T+K  ++++                       E N+  N +  L    +  L  L  + LS N F   P+    + +++  +NL  N +I  +P G          L  + N  ++L  D G + N+  L+++ N + +LP D  N  +L +L  SNN + +IP   G+L+KL+ILDL  N ++ LP  +  +  L+++ L  N+    P  +  +  L  + ++ N+++ +PE I SL  L+   ++ N  ++  P+   L +++   ++   P+ +IP    A
Sbjct:  225 LQNCSQLKVLDLRHNKLAEIPPVIYRLRSLTTLYLRFNRITAVADDLRQLVNLTMLSLRENKIRELGSAIGALVNLTTLDVSHNHLEHLPEDIGNCVNLSALDLQHNELLDIPDSIGNLKSLVRLGMRYNRLSSVPATLKNCKSMD-----------------------EFNVEGNGITQLPDGMLASLSGLTTITLSRNQFASYPTGGPAQFTNVYSINLEHN-RIDKIPYGIFSRAKGLTKLNMKENMLTALPLDIGTWVNMVELNLATNALQKLPDDIMNLQNLEILILSNNMLKKIPNTIGNLRKLRILDLEENRIEVLPHEIGLLHELQRLILQTNQITMLPRSIGHLGNLTHLSVSENNLQFLPEEIGSLESLENLYINQNPGLEKLPFELALCQNLKYLNIDKCPLSTIPPEIQA 622          

HSP 2 Score: 114.005 bits (284), Expect = 1.500e-25
Identity = 133/512 (25.98%), Postives = 228/512 (44.53%), Query Frame = 3
Query:  123 EKINILNCSYSKVKKI-GKLCNCKDLEGLIVNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHI----TQLPIDFKNCLSLAVLKWSNNKINEIP-EVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFP---WLPESIIDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQI 1631
            E I  L+ S S +  I   +  C  L  L +  N+I ++P  I  L SL  L L+ N +T+L  +  +   L  LDL +N L  +  +I     L    +  N+   + + L  L  L       N +  +   IG+L  LTTL ++HN L  LPE I                          VNL  L++ +N+L  +   IG LK L+ L + +N    +P+ +    S+   N+ GN  IT LP  +               +SLS        L  + +S N      T  P  F N  S+ +    +N+I++IP  +F   K L  L++  N L +LP+ +    ++ ++NL+ N     P+ +  +  L  + ++ N ++ IP +I +L +L+  +L  N+I+  P    L   +    L  N +  +P++ +  L  + +L++S  N   + E + SL SL+    +Q+ G  L ++   L+   NLK +N+    L +IP +I
Sbjct:  160 EGIKRLDLSKSSITVIPSTVKECVHLTELYLYSNKIGQLPPEIGCLVSLRNLALNENSLTSLPESLQNCSQLKVLDLRHNKLAEIPPVIYRLRSLTTLYLRFNRITAVADDLRQLVNLTMLSLRENKIRELGSAIGALVNLTTLDVSHNHLEHLPEDIG-----------------------NCVNLSALDLQHNELLDIPDSIGNLKSLVRLGMRYNRLSSVPATLKNCKSMDEFNVEGNG-ITQLPDGM--------------LASLS-------GLTTITLSRNQFASYPTGGPAQFTNVYSINL---EHNRIDKIPYGIFSRAKGLTKLNMKENMLTALPLDIGTWVNMVELNLATNALQKLPDDIMNLQNLEILILSNNMLKKIPNTIGNLRKLRILDLEENRIEVLPHEIGLLHELQRLILQTNQITMLPRS-IGHLGNLTHLSVSENNLQFLPEEIGSLESLENLYINQNPG--LEKLPFELALCQNLKYLNIDKCPLSTIPPEI 620          

HSP 3 Score: 95.9005 bits (237), Expect = 9.190e-20
Identity = 76/310 (24.52%), Postives = 152/310 (49.03%), Query Frame = 3
Query:  951 NLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFPWLPESIID---FDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQIL-QMKNLTSISLRGNKIKDIESSFVLEFQDRLESLDLSNNAISALPATAFTKFSKLRYLNLQGNPCKIPPSDVFNCGQMI 1868
             ++ LD+S + IT +P   K C+ L  L   +NKI ++P   G L  L+ L L+ N L SLP  ++    L+ ++L +N+    P ++ ++ +L ++ +  N I  + + +  L  L   +L  NKI+       ++++    D+S N +E +P++    +    NL+  +   + +L+I  S+ +LK       R  +L+ +   L    ++ E N+  N +  +P+ +L  +  LT+I+L  N+     +    +F + + S++L +N I  +P   F++   L  LN++ N     P D+     M+
Sbjct:  161 GIKRLDLSKSSITVIPSTVKECVHLTELYLYSNKIGQLPPEIGCLVSLRNLALNENSLTSLPESLQNCSQLKVLDLRHNKLAEIPPVIYRLRSLTTLYLRFNRITAVADDLRQLVNLTMLSLRENKIRELGSAIGALVNLTTLDVSHNHLEHLPED----IGNCVNLSALDLQHNELLDIPDSIGNLKSLVRLGMRYNRLSSVPATLKNCKSMDEFNVEGNGITQLPDGMLASLSGLTTITLSRNQFASYPTGGPAQFTN-VYSINLEHNRIDKIPYGIFSRAKGLTKLNMKENMLTALPLDIGTWVNMV 465          

HSP 4 Score: 87.4261 bits (215), Expect = 3.431e-17
Identity = 103/419 (24.58%), Postives = 182/419 (43.44%), Query Frame = 3
Query:  756 LNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKK-----------------------LQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFPWL---PESIIDFDLSDNPVESIPQNFMAKLNYIENLNISN-------TNSDGILEIVFSLNSLKIFKYDQ------DRGKKLTEIDGRLSQLN----------NLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDIESSFVLEFQDRLESLDLSNNAISALPATAFTKFSKLRYLNLQGNPCKIPPSDVFNCGQM 1865
            L+LS ++   IPS + E   L  L L  N KI  LP                       + G   +LR L ++ N +T LP   +NC  L VL   +NK+ EIP V   L+                        L +L L  N++  L   +  + +L  +++S+N   + PE +     L+++++  N++  IP+SI +L  L    +  N++ S P      +S+ +F++  N +  +P   +A L+ +  + +S        T        V+S+N L+  + D+       R K LT+++ + + L           N+ E+NL+ N L  +P+ I+ ++NL  + L  N +K I ++  +    +L  LDL  N I  LP        +L+ L LQ N   + P  + + G +
Sbjct:  165 LDLSKSSITVIPSTVKECVHLTELYLYSN-KIGQLP----------------------PEIGCLVSLRNLALNENSLTSLPESLQNCSQLKVLDLRHNKLAEIPPVIYRLRSLTTLYLRFNRITAVADDLRQLVNLTMLSLRENKIRELGSAIGALVNLTTLDVSHNHLEHLPEDIGNCVNLSALDLQHNELLDIPDSIGNLKSLVRLGMRYNRLSSVPATLKNCKSMDEFNVEGNGITQLPDGMLASLSGLTTITLSRNQFASYPTGGPAQFTNVYSIN-LEHNRIDKIPYGIFSRAKGLTKLNMKENMLTALPLDIGTWVNMVELNLATNALQKLPDDIMNLQNLEILILSNNMLKKIPNT--IGNLRKLRILDLEENRIEVLPH-EIGLLHELQRLILQTNQITMLPRSIGHLGNL 556          
BLAST of SMED30019284 vs. Ensembl Fly
Match: Sur-8 (gene:FBgn0038504 transcript:FBtr0339531)

HSP 1 Score: 138.658 bits (348), Expect = 3.432e-33
Identity = 118/422 (27.96%), Postives = 200/422 (47.39%), Query Frame = 3
Query:  177 LCNCKDLEGLIVNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMD-IGKLKKLIVLNLSFNNFIEIPS-NIGELSSLKYLNLRGNSKITNLP-GXXXXXXXXXXXXDQCN-FSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGN-KIQSFPW---LPESIIDFDLSDNPVESIPQNFMA 1418
            L NC  L+ L +  N++ EIP  I +L+SLT L L  N IT +      L NL  L L  N +  L   IG    L   ++S N    LPE + +   L + D  HN L  +P  IG+LK L  L + +N LS +P T+K  ++++                       E N+  N +  L    +  L  L  + LS N F   P+    + +++  +NL  N +I  +P G          L  + N  ++L  D G + N+  L+++ N + +LP D  N  +L +L  SNN + +IP   G+L+KL+ILDL  N ++ LP  +  +  L+++ L  N+    P  +  +  L  + ++ N+++ +PE I SL  L+   ++ N  ++  P+   L +++   ++   P+ +IP    A
Sbjct:  225 LQNCSQLKVLDLRHNKLAEIPPVIYRLRSLTTLYLRFNRITAVADDLRQLVNLTMLSLRENKIRELGSAIGALVNLTTLDVSHNHLEHLPEDIGNCVNLSALDLQHNELLDIPDSIGNLKSLVRLGMRYNRLSSVPATLKNCKSMD-----------------------EFNVEGNGITQLPDGMLASLSGLTTITLSRNQFASYPTGGPAQFTNVYSINLEHN-RIDKIPYGIFSRAKGLTKLNMKENMLTALPLDIGTWVNMVELNLATNALQKLPDDIMNLQNLEILILSNNMLKKIPNTIGNLRKLRILDLEENRIEVLPHEIGLLHELQRLILQTNQITMLPRSIGHLGNLTHLSVSENNLQFLPEEIGSLESLENLYINQNPGLEKLPFELALCQNLKYLNIDKCPLSTIPPEIQA 622          

HSP 2 Score: 115.161 bits (287), Expect = 8.692e-26
Identity = 133/512 (25.98%), Postives = 228/512 (44.53%), Query Frame = 3
Query:  123 EKINILNCSYSKVKKI-GKLCNCKDLEGLIVNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHI----TQLPIDFKNCLSLAVLKWSNNKINEIP-EVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFP---WLPESIIDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQI 1631
            E I  L+ S S +  I   +  C  L  L +  N+I ++P  I  L SL  L L+ N +T+L  +  +   L  LDL +N L  +  +I     L    +  N+   + + L  L  L       N +  +   IG+L  LTTL ++HN L  LPE I                          VNL  L++ +N+L  +   IG LK L+ L + +N    +P+ +    S+   N+ GN  IT LP  +               +SLS        L  + +S N      T  P  F N  S+ +    +N+I++IP  +F   K L  L++  N L +LP+ +    ++ ++NL+ N     P+ +  +  L  + ++ N ++ IP +I +L +L+  +L  N+I+  P    L   +    L  N +  +P++ +  L  + +L++S  N   + E + SL SL+    +Q+ G  L ++   L+   NLK +N+    L +IP +I
Sbjct:  160 EGIKRLDLSKSSITVIPSTVKECVHLTELYLYSNKIGQLPPEIGCLVSLRNLALNENSLTSLPESLQNCSQLKVLDLRHNKLAEIPPVIYRLRSLTTLYLRFNRITAVADDLRQLVNLTMLSLRENKIRELGSAIGALVNLTTLDVSHNHLEHLPEDIG-----------------------NCVNLSALDLQHNELLDIPDSIGNLKSLVRLGMRYNRLSSVPATLKNCKSMDEFNVEGNG-ITQLPDGM--------------LASLS-------GLTTITLSRNQFASYPTGGPAQFTNVYSINL---EHNRIDKIPYGIFSRAKGLTKLNMKENMLTALPLDIGTWVNMVELNLATNALQKLPDDIMNLQNLEILILSNNMLKKIPNTIGNLRKLRILDLEENRIEVLPHEIGLLHELQRLILQTNQITMLPRS-IGHLGNLTHLSVSENNLQFLPEEIGSLESLENLYINQNPG--LEKLPFELALCQNLKYLNIDKCPLSTIPPEI 620          

HSP 3 Score: 96.2857 bits (238), Expect = 6.778e-20
Identity = 76/310 (24.52%), Postives = 152/310 (49.03%), Query Frame = 3
Query:  951 NLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFPWLPESIID---FDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQIL-QMKNLTSISLRGNKIKDIESSFVLEFQDRLESLDLSNNAISALPATAFTKFSKLRYLNLQGNPCKIPPSDVFNCGQMI 1868
             ++ LD+S + IT +P   K C+ L  L   +NKI ++P   G L  L+ L L+ N L SLP  ++    L+ ++L +N+    P ++ ++ +L ++ +  N I  + + +  L  L   +L  NKI+       ++++    D+S N +E +P++    +    NL+  +   + +L+I  S+ +LK       R  +L+ +   L    ++ E N+  N +  +P+ +L  +  LT+I+L  N+     +    +F + + S++L +N I  +P   F++   L  LN++ N     P D+     M+
Sbjct:  161 GIKRLDLSKSSITVIPSTVKECVHLTELYLYSNKIGQLPPEIGCLVSLRNLALNENSLTSLPESLQNCSQLKVLDLRHNKLAEIPPVIYRLRSLTTLYLRFNRITAVADDLRQLVNLTMLSLRENKIRELGSAIGALVNLTTLDVSHNHLEHLPED----IGNCVNLSALDLQHNELLDIPDSIGNLKSLVRLGMRYNRLSSVPATLKNCKSMDEFNVEGNGITQLPDGMLASLSGLTTITLSRNQFASYPTGGPAQFTN-VYSINLEHNRIDKIPYGIFSRAKGLTKLNMKENMLTALPLDIGTWVNMV 465          

HSP 4 Score: 87.8113 bits (216), Expect = 3.450e-17
Identity = 103/419 (24.58%), Postives = 182/419 (43.44%), Query Frame = 3
Query:  756 LNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKK-----------------------LQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFPWL---PESIIDFDLSDNPVESIPQNFMAKLNYIENLNISN-------TNSDGILEIVFSLNSLKIFKYDQ------DRGKKLTEIDGRLSQLN----------NLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDIESSFVLEFQDRLESLDLSNNAISALPATAFTKFSKLRYLNLQGNPCKIPPSDVFNCGQM 1865
            L+LS ++   IPS + E   L  L L  N KI  LP                       + G   +LR L ++ N +T LP   +NC  L VL   +NK+ EIP V   L+                        L +L L  N++  L   +  + +L  +++S+N   + PE +     L+++++  N++  IP+SI +L  L    +  N++ S P      +S+ +F++  N +  +P   +A L+ +  + +S        T        V+S+N L+  + D+       R K LT+++ + + L           N+ E+NL+ N L  +P+ I+ ++NL  + L  N +K I ++  +    +L  LDL  N I  LP        +L+ L LQ N   + P  + + G +
Sbjct:  165 LDLSKSSITVIPSTVKECVHLTELYLYSN-KIGQLP----------------------PEIGCLVSLRNLALNENSLTSLPESLQNCSQLKVLDLRHNKLAEIPPVIYRLRSLTTLYLRFNRITAVADDLRQLVNLTMLSLRENKIRELGSAIGALVNLTTLDVSHNHLEHLPEDIGNCVNLSALDLQHNELLDIPDSIGNLKSLVRLGMRYNRLSSVPATLKNCKSMDEFNVEGNGITQLPDGMLASLSGLTTITLSRNQFASYPTGGPAQFTNVYSIN-LEHNRIDKIPYGIFSRAKGLTKLNMKENMLTALPLDIGTWVNMVELNLATNALQKLPDDIMNLQNLEILILSNNMLKKIPNT--IGNLRKLRILDLEENRIEVLPH-EIGLLHELQRLILQTNQITMLPRSIGHLGNL 556          
BLAST of SMED30019284 vs. Ensembl Fly
Match: scrib (gene:FBgn0263289 transcript:FBtr0308633)

HSP 1 Score: 130.954 bits (328), Expect = 3.762e-30
Identity = 105/373 (28.15%), Postives = 175/373 (46.92%), Query Frame = 3
Query:   75 LTKEEIDNINEDFFEKEKINILNCSYSKVKKIG-KLCNCKDLEGLIVNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNR 1190
            L    I ++ ++FF   ++  L  S +++ ++   + N ++L  L V+ N+I +IP  I  L+SL   + S N I  L + F  L+NL  L L +  LT L    G+ ++L+   +  N    LPET+  L++L   D   N +  +P  +G L  L  L L+HN L  LP  +  L  L  L +  N L  L + +  LV+L +L++  N L+ L   I KL +L +L L  N    +   +G   +++ L L  N                         S L    G    L  L++  N +  LP++   C +L VL   +NK+ ++P   G+   L +LD+S N+L  LP  +  ++ L+ + LS N+
Sbjct:   44 LDANHIRDLPKNFFRLHRLRKLGLSDNEIGRLPPDIQNFENLVELDVSRNDIPDIPDDIKHLQSLQVADFSSNPIPKLPSGFSQLKNLTVLGLNDMSLTTLPADFGSLTQLESLELRENLLKHLPETISQLTKLKRLDLGDNEIEDLPPYLGYLPGLHELWLDHNQLQRLPPELGLLTKLTYLDVSENRLEELPNEISGLVSLTDLDLAQNLLEALPDGIAKLSRLTILKLDQNRLQRLNDTLGNCENMQELILTENF-----------------------LSELPASIGQMTKLNNLNVDRNALEYLPLEIGQCANLGVLSLRDNKLKKLPPELGNCTVLHVLDVSGNQLLYLPYSLVNLQ-LKAVWLSENQ 392          

HSP 2 Score: 128.257 bits (321), Expect = 2.552e-29
Identity = 115/429 (26.81%), Postives = 189/429 (44.06%), Query Frame = 3
Query:  483 DCSHNHLNFVPKGIGSL-KQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFPWLPESIIDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDIESSFVLEFQDRLESLDLSNNAISALP 1766
            D  H  L  VP+ I    + L  L L+ N + DLP+                         F L  L +L + +N++  L  DI   + L+ L++S N+  +IP +I  L SL+  +   N  I  LP                 FS L        NL +L +++  +T LP DF +   L  L+   N +  +PE    L KL+ LDL +NE++ LP  + Y+  L ++ L +N+    P  L  +  L  ++++ N +E +P  I  L  L   +L+ N +++   LP+ I    LS   +  + QN + +LN  + L     N + + E++ + N              L+E+   + Q+  L  +N+  N L  +P +I Q  NL  +SLR NK+K +     L     L  LD+S N +  LP
Sbjct:   19 DKRHCSLPQVPEEILRYSRTLEELFLDANHIRDLPKNF-----------------------FRLHRLRKLGLSDNEIGRLPPDIQNFENLVELDVSRNDIPDIPDDIKHLQSLQVADFSSNP-IPKLPS---------------GFSQL-------KNLTVLGLNDMSLTTLPADFGSLTQLESLELRENLLKHLPETISQLTKLKRLDLGDNEIEDLPPYLGYLPGLHELWLDHNQLQRLPPELGLLTKLTYLDVSENRLEELPNEISGLVSLTDLDLAQNLLEA---LPDGIA--KLSRLTILKLDQNRLQRLN--DTLG----NCENMQELILTENF-------------LSELPASIGQMTKLNNLNVDRNALEYLPLEIGQCANLGVLSLRDNKLKKLPPE--LGNCTVLHVLDVSGNQLLYLP 375          

HSP 3 Score: 128.257 bits (321), Expect = 2.801e-29
Identity = 109/396 (27.53%), Postives = 174/396 (43.94%), Query Frame = 3
Query:  189 KDLEGLIVNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFPWLPESIIDFDL 1376
            + LE L ++ N I ++P    +L  L  L LS N I  L     + ENL+ LD++ N +  + + I +   LQ  + S N    LP     L  L     +   L  +P   GSL QL +L L  N L  LPETI +L  L+ L LG+N + +L  Y+  L  L EL + +N LQ L  ++G L KL  L++S N   E+P+ I  L SL                                    +D          LD++ N +  LP        L +LK   N++  + +  G+ + +Q L L+ N L  LP  +  M  L  +N+  N     P  + +   L  + +  N ++ +P  + + T L   ++SGN++    +LP S+++  L
Sbjct:   37 RTLEELFLDANHIRDLPKNFFRLHRLRKLGLSDNEIGRLPPDIQNFENLVELDVSRNDIPDIPDDIKHLQSLQVADFSSNPIPKLPSGFSQLKNLTVLGLNDMSLTTLPADFGSLTQLESLELRENLLKHLPETISQLTKLKRLDLGDNEIEDLPPYLGYLPGLHELWLDHNQLQRLPPELGLLTKLTYLDVSENRLEELPNEISGLVSL------------------------------------TD----------LDLAQNLLEALPDGIAKLSRLTILKLDQNRLQRLNDTLGNCENMQELILTENFLSELPASIGQMTKLNNLNVDRNALEYLPLEIGQCANLGVLSLRDNKLKKLPPELGNCTVLHVLDVSGNQLL---YLPYSLVNLQL 383          

HSP 4 Score: 126.331 bits (316), Expect = 1.041e-28
Identity = 108/360 (30.00%), Postives = 180/360 (50.00%), Query Frame = 3
Query:  258 KSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXX-XXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQ 1334
            ++L  L L  N+I +L   FF L  L  L L++N +  L   I NF  L   ++S N    +P+ +  L  L   D S N +  +P G   LK LT L LN   L+ LP     L  LE L+L  N L +L   + +L  L  L++ +N+++ L   +G L  L  L L  N    +P  +G L+ L YL++  N ++  LP  I  L+SL++L + Q    +L D     + L IL +  N + +L     NC ++  L  + N ++E+P   G + KL  L++  N L+ LP+ +    +L  ++L +N+    P  L     L+ ++++ N +  +P S+++L +L+   LS N+ Q
Sbjct:   37 RTLEELFLDANHIRDLPKNFFRLHRLRKLGLSDNEIGRLPPDIQNFENLVELDVSRNDIPDIPDDIKHLQSLQVADFSSNPIPKLPSGFSQLKNLTVLGLNDMSLTTLPADFGSLTQLESLELRENLLKHLPETISQLTKLKRLDLGDNEIEDLPPYLGYLPGLHELWLDHNQLQRLPPELGLLTKLTYLDVSEN-RLEELPNEISGLVSLTDLDLAQNLLEALPDGIAKLSRLTILKLDQNRLQRLNDTLGNCENMQELILTENFLSELPASIGQMTKLNNLNVDRNALEYLPLEIGQCANLGVLSLRDNKLKKLPPELGNCTVLHVLDVSGNQLLYLPYSLVNL-QLKAVWLSENQSQ 394          
BLAST of SMED30019284 vs. Ensembl Zebrafish
Match: shoc2 (SHOC2 leucine rich repeat scaffold protein [Source:NCBI gene;Acc:555476])

HSP 1 Score: 150.599 bits (379), Expect = 1.843e-37
Identity = 136/497 (27.36%), Postives = 230/497 (46.28%), Query Frame = 3
Query:   27 LKYFNASTNEDKIFKTLTKEEIDNINEDFFEKEKINILNCSYSKVKKIGKLCNCKDLEGLI---VNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFE------------------------LVNLLELNICNNDLQ-YLSMDIGKLKKLIVLNLSFNNFIEIPSNI-GELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNK-IQSFPW---LPESIIDFDLSDNPVESIPQNFMA 1418
            +K  N    E+ +   L+K  I  +     E  ++  L    +K++ +     C  L GL+   ++ N +T +P +++ LK L  L+L HN +  +    + + +L  L L  N +T + + I N SKL   +I  NK   LP  +  L  L++ D +HN L  +PK IG+  Q+T L L HNDL DLPETI  L ++  L L  N L+ +   + +                        LVNL  L +  N  Q Y      +   +  LN+  N   +IP  I      L  LN++ N                         +SL  DFG + ++  L+++ N +T++P D    +SL +L  SNN + ++P   G+L+KL+ LDL  N+L+SLP  + Y++ L+K+ L+NN+    P  +  +  L  + +  N ++ +PE I +L  L+   L+ N  + S P+   L   +    + + P+  +P   +A
Sbjct:   70 IKELNKCREENSMRLDLSKRSIHLLPSSIKELTQLTELYLYSNKLQSLPPEVGC--LSGLVTLALSENSLTSLPDSLDNLKKLRMLDLRHNKLREIPAVVYRVSSLTTLYLRFNRITTVEKDIKNLSKLTMLSIRENKIKQLPAEIGELCNLITLDVAHNQLEHLPKEIGNCTQITNLDLQHNDLLDLPETIGNLASINRLGLRYNRLSAIPRSLAKCRELEELNLENNNISVLPEGLLSSLVNLTSLTLARNCFQSYPVGGPSQFSTIYSLNMEHNRINKIPFGIFSRAKVLSKLNMKDN-----------------------QLTSLPLDFGTWTSMVELNLATNQLTKIPEDICGLVSLEMLTLSNNLLKKLPYGIGNLRKLRELDLEENKLESLPNEIAYLKDLQKLVLTNNQLTTLPRGIGHLTNLTYLGLGENLLQHLPEEIGTLENLEDLYLNDNPNLHSLPFELALCSKLSIMSIENCPLSHLPPQIVA 541          

HSP 2 Score: 100.523 bits (249), Expect = 2.607e-21
Identity = 132/520 (25.38%), Postives = 223/520 (42.88%), Query Frame = 3
Query:  456 CSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLP--------------------VIMEYMES----LRKINLSNNRFNNFP-EILTKIPTLNSIEITANDIETIPESIMSLTR-LQTFNLSGNKIQSFP-----WLPESIIDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDI-ESSFVLEFQDRLESLDLSNNA-ISALPATAFTKFSKLRYLNLQGNPCKIPPSDVFNCGQMIPICSYLTAYNEFDATI 1916
            C     +  D S   ++ +P  I  L QLT L L  N L  LP  +  L  L                       + L +  N L  L   +  LKKL +L+L  N   EIP+ +  +SSL  L LR N   T       L  L+ L I +     L  + G   NL  LD+++N +  LP +  NC  +  L   +N + ++PE  G+L  +  L L  N L ++P                    V+ E + S    L  + L+ N F ++P    ++  T+ S+ +  N I  IP  I S  + L   N+  N++ S P     W   S+++ +L+ N +  IP++    L  +E L +SN   + + ++ + + +L+  +       KL  +   ++ L +L+++ L+NN L ++P  I  + NLT + L  N ++ + E    LE    LE L L++N  + +LP       SKL  ++++  P    P  +   G    I  +L     + A +
Sbjct:   76 CREENSMRLDLSKRSIHLLPSSIKELTQLTELYLYSNKLQSLPPEVGCLSGL-----------------------VTLALSENSLTSLPDSLDNLKKLRMLDLRHNKLREIPAVVYRVSSLTTLYLRFNRITTVEKDIKNLSKLTMLSIRENKIKQLPAEIGELCNLITLDVAHNQLEHLPKEIGNCTQITNLDLQHNDLLDLPETIGNLASINRLGLRYNRLSAIPRSLAKCRELEELNLENNNISVLPEGLLSSLVNLTSLTLARNCFQSYPVGGPSQFSTIYSLNMEHNRINKIPFGIFSRAKVLSKLNMKDNQLTSLPLDFGTW--TSMVELNLATNQLTKIPEDICG-LVSLEMLTLSN---NLLKKLPYGIGNLRKLRELDLEENKLESLPNEIAYLKDLQKLVLTNNQLTTLPRGIGHLTNLTYLGLGENLLQHLPEEIGTLE---NLEDLYLNDNPNLHSLPF-ELALCSKLSIMSIENCPLSHLPPQIVAGGPSF-IIQFLKMQGPYRAMV 561          
BLAST of SMED30019284 vs. Ensembl Zebrafish
Match: shoc2 (SHOC2 leucine rich repeat scaffold protein [Source:NCBI gene;Acc:555476])

HSP 1 Score: 150.599 bits (379), Expect = 1.843e-37
Identity = 136/497 (27.36%), Postives = 230/497 (46.28%), Query Frame = 3
Query:   27 LKYFNASTNEDKIFKTLTKEEIDNINEDFFEKEKINILNCSYSKVKKIGKLCNCKDLEGLI---VNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFE------------------------LVNLLELNICNNDLQ-YLSMDIGKLKKLIVLNLSFNNFIEIPSNI-GELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNK-IQSFPW---LPESIIDFDLSDNPVESIPQNFMA 1418
            +K  N    E+ +   L+K  I  +     E  ++  L    +K++ +     C  L GL+   ++ N +T +P +++ LK L  L+L HN +  +    + + +L  L L  N +T + + I N SKL   +I  NK   LP  +  L  L++ D +HN L  +PK IG+  Q+T L L HNDL DLPETI  L ++  L L  N L+ +   + +                        LVNL  L +  N  Q Y      +   +  LN+  N   +IP  I      L  LN++ N                         +SL  DFG + ++  L+++ N +T++P D    +SL +L  SNN + ++P   G+L+KL+ LDL  N+L+SLP  + Y++ L+K+ L+NN+    P  +  +  L  + +  N ++ +PE I +L  L+   L+ N  + S P+   L   +    + + P+  +P   +A
Sbjct:   70 IKELNKCREENSMRLDLSKRSIHLLPSSIKELTQLTELYLYSNKLQSLPPEVGC--LSGLVTLALSENSLTSLPDSLDNLKKLRMLDLRHNKLREIPAVVYRVSSLTTLYLRFNRITTVEKDIKNLSKLTMLSIRENKIKQLPAEIGELCNLITLDVAHNQLEHLPKEIGNCTQITNLDLQHNDLLDLPETIGNLASINRLGLRYNRLSAIPRSLAKCRELEELNLENNNISVLPEGLLSSLVNLTSLTLARNCFQSYPVGGPSQFSTIYSLNMEHNRINKIPFGIFSRAKVLSKLNMKDN-----------------------QLTSLPLDFGTWTSMVELNLATNQLTKIPEDICGLVSLEMLTLSNNLLKKLPYGIGNLRKLRELDLEENKLESLPNEIAYLKDLQKLVLTNNQLTTLPRGIGHLTNLTYLGLGENLLQHLPEEIGTLENLEDLYLNDNPNLHSLPFELALCSKLSIMSIENCPLSHLPPQIVA 541          

HSP 2 Score: 100.523 bits (249), Expect = 2.607e-21
Identity = 132/520 (25.38%), Postives = 223/520 (42.88%), Query Frame = 3
Query:  456 CSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLP--------------------VIMEYMES----LRKINLSNNRFNNFP-EILTKIPTLNSIEITANDIETIPESIMSLTR-LQTFNLSGNKIQSFP-----WLPESIIDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDI-ESSFVLEFQDRLESLDLSNNA-ISALPATAFTKFSKLRYLNLQGNPCKIPPSDVFNCGQMIPICSYLTAYNEFDATI 1916
            C     +  D S   ++ +P  I  L QLT L L  N L  LP  +  L  L                       + L +  N L  L   +  LKKL +L+L  N   EIP+ +  +SSL  L LR N   T       L  L+ L I +     L  + G   NL  LD+++N +  LP +  NC  +  L   +N + ++PE  G+L  +  L L  N L ++P                    V+ E + S    L  + L+ N F ++P    ++  T+ S+ +  N I  IP  I S  + L   N+  N++ S P     W   S+++ +L+ N +  IP++    L  +E L +SN   + + ++ + + +L+  +       KL  +   ++ L +L+++ L+NN L ++P  I  + NLT + L  N ++ + E    LE    LE L L++N  + +LP       SKL  ++++  P    P  +   G    I  +L     + A +
Sbjct:   76 CREENSMRLDLSKRSIHLLPSSIKELTQLTELYLYSNKLQSLPPEVGCLSGL-----------------------VTLALSENSLTSLPDSLDNLKKLRMLDLRHNKLREIPAVVYRVSSLTTLYLRFNRITTVEKDIKNLSKLTMLSIRENKIKQLPAEIGELCNLITLDVAHNQLEHLPKEIGNCTQITNLDLQHNDLLDLPETIGNLASINRLGLRYNRLSAIPRSLAKCRELEELNLENNNISVLPEGLLSSLVNLTSLTLARNCFQSYPVGGPSQFSTIYSLNMEHNRINKIPFGIFSRAKVLSKLNMKDNQLTSLPLDFGTW--TSMVELNLATNQLTKIPEDICG-LVSLEMLTLSN---NLLKKLPYGIGNLRKLRELDLEENKLESLPNEIAYLKDLQKLVLTNNQLTTLPRGIGHLTNLTYLGLGENLLQHLPEEIGTLE---NLEDLYLNDNPNLHSLPF-ELALCSKLSIMSIENCPLSHLPPQIVAGGPSF-IIQFLKMQGPYRAMV 561          
BLAST of SMED30019284 vs. Ensembl Zebrafish
Match: shoc2 (SHOC2 leucine rich repeat scaffold protein [Source:NCBI gene;Acc:555476])

HSP 1 Score: 150.599 bits (379), Expect = 1.843e-37
Identity = 136/497 (27.36%), Postives = 230/497 (46.28%), Query Frame = 3
Query:   27 LKYFNASTNEDKIFKTLTKEEIDNINEDFFEKEKINILNCSYSKVKKIGKLCNCKDLEGLI---VNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFE------------------------LVNLLELNICNNDLQ-YLSMDIGKLKKLIVLNLSFNNFIEIPSNI-GELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNK-IQSFPW---LPESIIDFDLSDNPVESIPQNFMA 1418
            +K  N    E+ +   L+K  I  +     E  ++  L    +K++ +     C  L GL+   ++ N +T +P +++ LK L  L+L HN +  +    + + +L  L L  N +T + + I N SKL   +I  NK   LP  +  L  L++ D +HN L  +PK IG+  Q+T L L HNDL DLPETI  L ++  L L  N L+ +   + +                        LVNL  L +  N  Q Y      +   +  LN+  N   +IP  I      L  LN++ N                         +SL  DFG + ++  L+++ N +T++P D    +SL +L  SNN + ++P   G+L+KL+ LDL  N+L+SLP  + Y++ L+K+ L+NN+    P  +  +  L  + +  N ++ +PE I +L  L+   L+ N  + S P+   L   +    + + P+  +P   +A
Sbjct:   70 IKELNKCREENSMRLDLSKRSIHLLPSSIKELTQLTELYLYSNKLQSLPPEVGC--LSGLVTLALSENSLTSLPDSLDNLKKLRMLDLRHNKLREIPAVVYRVSSLTTLYLRFNRITTVEKDIKNLSKLTMLSIRENKIKQLPAEIGELCNLITLDVAHNQLEHLPKEIGNCTQITNLDLQHNDLLDLPETIGNLASINRLGLRYNRLSAIPRSLAKCRELEELNLENNNISVLPEGLLSSLVNLTSLTLARNCFQSYPVGGPSQFSTIYSLNMEHNRINKIPFGIFSRAKVLSKLNMKDN-----------------------QLTSLPLDFGTWTSMVELNLATNQLTKIPEDICGLVSLEMLTLSNNLLKKLPYGIGNLRKLRELDLEENKLESLPNEIAYLKDLQKLVLTNNQLTTLPRGIGHLTNLTYLGLGENLLQHLPEEIGTLENLEDLYLNDNPNLHSLPFELALCSKLSIMSIENCPLSHLPPQIVA 541          

HSP 2 Score: 100.523 bits (249), Expect = 2.607e-21
Identity = 132/520 (25.38%), Postives = 223/520 (42.88%), Query Frame = 3
Query:  456 CSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLP--------------------VIMEYMES----LRKINLSNNRFNNFP-EILTKIPTLNSIEITANDIETIPESIMSLTR-LQTFNLSGNKIQSFP-----WLPESIIDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDI-ESSFVLEFQDRLESLDLSNNA-ISALPATAFTKFSKLRYLNLQGNPCKIPPSDVFNCGQMIPICSYLTAYNEFDATI 1916
            C     +  D S   ++ +P  I  L QLT L L  N L  LP  +  L  L                       + L +  N L  L   +  LKKL +L+L  N   EIP+ +  +SSL  L LR N   T       L  L+ L I +     L  + G   NL  LD+++N +  LP +  NC  +  L   +N + ++PE  G+L  +  L L  N L ++P                    V+ E + S    L  + L+ N F ++P    ++  T+ S+ +  N I  IP  I S  + L   N+  N++ S P     W   S+++ +L+ N +  IP++    L  +E L +SN   + + ++ + + +L+  +       KL  +   ++ L +L+++ L+NN L ++P  I  + NLT + L  N ++ + E    LE    LE L L++N  + +LP       SKL  ++++  P    P  +   G    I  +L     + A +
Sbjct:   76 CREENSMRLDLSKRSIHLLPSSIKELTQLTELYLYSNKLQSLPPEVGCLSGL-----------------------VTLALSENSLTSLPDSLDNLKKLRMLDLRHNKLREIPAVVYRVSSLTTLYLRFNRITTVEKDIKNLSKLTMLSIRENKIKQLPAEIGELCNLITLDVAHNQLEHLPKEIGNCTQITNLDLQHNDLLDLPETIGNLASINRLGLRYNRLSAIPRSLAKCRELEELNLENNNISVLPEGLLSSLVNLTSLTLARNCFQSYPVGGPSQFSTIYSLNMEHNRINKIPFGIFSRAKVLSKLNMKDNQLTSLPLDFGTW--TSMVELNLATNQLTKIPEDICG-LVSLEMLTLSN---NLLKKLPYGIGNLRKLRELDLEENKLESLPNEIAYLKDLQKLVLTNNQLTTLPRGIGHLTNLTYLGLGENLLQHLPEEIGTLE---NLEDLYLNDNPNLHSLPF-ELALCSKLSIMSIENCPLSHLPPQIVAGGPSF-IIQFLKMQGPYRAMV 561          
BLAST of SMED30019284 vs. Ensembl Zebrafish
Match: lrrc40 (leucine rich repeat containing 40 [Source:NCBI gene;Acc:334130])

HSP 1 Score: 148.288 bits (373), Expect = 1.317e-36
Identity = 132/436 (30.28%), Postives = 204/436 (46.79%), Query Frame = 3
Query:  189 KDLEGLIVNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPE--TIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGN----------------------SKITNLP--GXXXXXXXXXXXXDQCNF------------------SSLSDD-FGYYNNLRILDI--SNNHITQLP---IDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIM-SLTRLQTFNLSGNKIQSFP 1343
            + L+ LI++ N++TE+P  + +L +L  L+L  N I  +      L NL  LDL+NNHL  + E + N   L   ++S NK  +LP  +  +  L   DCS N +  +P  +  ++ L  L L HN L  LPE    K L+ L         L          ++LLEL   +N ++ L  +I  L+ L  L+L+ N+   +P  +G L  LK L+L GN                      S++   P  G       +     Q                     +S+ DD F   +   + ++  S N +T +P   +D K+  +LA +    NK+  IP  F  LK+L  +DL NN L SLP+ +E +  LR + LS NRF +FPE+L +IP+L +I I++N +  I    M +L+RL T +LS N I   P
Sbjct:  126 EQLQKLILSHNKLTELPSGVWRLTNLRCLHLQQNLIEQIPRDLGQLVNLDDLDLSNNHLIDIPESLANLQNLVKLDLSCNKLKSLPPAISQMKNLRMLDCSRNQMESIPPVLAQMESLEQLYLRHNKLRFLPELPCCKTLKELHCGNNQIEVLEAEHLKHLNALSLLELR--DNKVKSLPEEITLLQGLERLDLTNNDISSLPCGLGTLPKLKSLSLEGNPLRAIRRDLLTKGTGELLKYLRSRVQEPPNGGLKEEPKTAMTFPSQAKINVHAIKTLKTLDYSEKQDASIPDDVFDAVDGNPVANVNFSKNQLTAVPHRIVDLKD--TLADINLGFNKLTTIPADFCHLKQLMHIDLRNNLLISLPMELEGLIKLRSVILSFNRFKSFPEVLYRIPSLETILISSNQVGGIDAVQMKTLSRLSTLDLSNNDIMQVP 557          

HSP 2 Score: 125.561 bits (314), Expect = 3.746e-29
Identity = 151/582 (25.95%), Postives = 260/582 (44.67%), Query Frame = 3
Query:  210 VNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPID-FKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNF-PEILTK-----IPTLNSI--EITANDIETIPESIMSLTRLQTFNLSGNKIQSFPWLPESIIDFDLSDNPVESIPQNFMAKL--NYIENLNISNTN-----------SDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGR----------LSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDIESSFVLEFQDRLESLDLSNNAISALPATAFTKFSKLRYLNLQGNPCKIPPSDVFNCG 1859
            ++G  +TE+P ++ +L   T      N     E  +++  +L  L L++N L  + + +     L   +I  N+ ++LP+++  L +L     SHN L  +P G+  L  L  L L  N +  +P  + +L NL+ L L NN+L ++   +  L NL++L++  N L+ L   I ++K L +L+ S N    IP  + ++ SL+ L LR N K+  LP                       +      L+ L   NN I  L  +  K+  +L++L+  +NK+  +PE    L+ L+ LDL+NN++ SLP  +  +  L+ ++L  N       ++LTK     +  L S   E     ++  P++ M+       N+   K         ++   D S+    SIP +    +  N + N+N S               D + +I    N L     D    K+L  ID R          L  L  L+ + LS N   S PE + ++ +L +I +  N++  I+ +  ++   RL +LDLSNN I  +P       + LR L L GNP + P + +   G
Sbjct:   41 LSGRGLTEVPASVWRLNLDTPQEAKQNVSFGAEDRWWEQTDLTKLLLSSNKLQSIPDDVKLLPALVVLDIHDNQLSSLPDSIGDLEQLQKLILSHNKLTELPSGVWRLTNLRCLHLQQNLIEQIPRDLGQLVNLDDLDLSNNHLIDIPESLANLQNLVKLDLSCNKLKSLPPAISQMKNLRMLDCSRNQMESIPPVLAQMESLEQLYLRHN-KLRFLP-----------------------ELPCCKTLKELHCGNNQIEVLEAEHLKHLNALSLLELRDNKVKSLPEEITLLQGLERLDLTNNDISSLPCGLGTLPKLKSLSLEGNPLRAIRRDLLTKGTGELLKYLRSRVQEPPNGGLKEEPKTAMTFPSQAKINVHAIK---------TLKTLDYSEKQDASIPDDVFDAVDGNPVANVNFSKNQLTAVPHRIVDLKDTLADINLGFNKLTTIPADFCHLKQLMHIDLRNNLLISLPMELEGLIKLRSVILSFNRFKSFPEVLYRIPSLETILISSNQVGGID-AVQMKTLSRLSTLDLSNNDIMQVPP-ELGNCTSLRALMLDGNPFRNPRAAILIKG 587          

HSP 3 Score: 101.293 bits (251), Expect = 1.965e-21
Identity = 102/350 (29.14%), Postives = 172/350 (49.14%), Query Frame = 3
Query:  825 LNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGY-YNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFPWLPESIID---FDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSI-PEQILQMKNLTSISLRGNKIKDIESSFVLEFQDRLESLDLSNNAISALPATAFTKFSKLRYLNLQGNPCKIPPSDVFNCG 1859
            LNL G   +T +P S+  ++L      + N S  ++D  +   +L  L +S+N +  +P D K   +L VL   +N+++ +P+  G L++LQ L LS+N+L  LP  +  + +LR ++L  N     P  L ++  L+ ++++ N +  IPES+ +L  L   +LS NK++S P     + +    D S N +ESIP   +A++  +E L + +             N L+                  L     LKE++  NN +  +  E +  +  L+ + LR NK+K +     L  Q  LE LDL+NN IS+LP    T   KL+ L+L+GNP +    D+   G
Sbjct:   39 LNLSGRG-LTEVPASVWRLNLDTPQEAKQNVSFGAEDRWWEQTDLTKLLLSSNKLQSIPDDVKLLPALVVLDIHDNQLSSLPDSIGDLEQLQKLILSHNKLTELPSGVWRLTNLRCLHLQQNLIEQIPRDLGQLVNLDDLDLSNNHLIDIPESLANLQNLVKLDLSCNKLKSLPPAISQMKNLRMLDCSRNQMESIPP-VLAQMESLEQLYLRH-------------NKLRFLP--------------ELPCCKTLKELHCGNNQIEVLEAEHLKHLNALSLLELRDNKVKSLPEEITL-LQG-LERLDLTNNDISSLPCGLGT-LPKLKSLSLEGNPLRAIRRDLLTKG 356          

HSP 4 Score: 91.6633 bits (226), Expect = 1.971e-18
Identity = 84/352 (23.86%), Postives = 151/352 (42.90%), Query Frame = 3
Query:  912 NFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFPWLP--ESIIDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDIESSFVLEFQD------RLESLDLSNNAISALPATAFT----------KFSKLRYLNLQGNPCKIPPSDVFNCGQMIPICSYLTAYNEFDAT 1913
              SSL D  G    L+ L +S+N +T+LP       +L  L    N I +IP   G L  L  LDLSNN L  +P  +  +++L K++LS N+  + P  ++++  L  ++ + N +E+IP  +  +  L+   L  NK++  P LP  +++ +    +N +E +    +  LN +            +LE+               R  K+  +   ++ L  L+ ++L+NN + S+P  +  +  L S+SL GN ++ I    + +         R    +  N  +   P TA T              L+ L+         P DVF+     P+ +   + N+  A 
Sbjct:  114 QLSSLPDSIGDLEQLQKLILSHNKLTELPSGVWRLTNLRCLHLQQNLIEQIPRDLGQLVNLDDLDLSNNHLIDIPESLANLQNLVKLDLSCNKLKSLPPAISQMKNLRMLDCSRNQMESIPPVLAQMESLEQLYLRHNKLRFLPELPCCKTLKELHCGNNQIEVLEAEHLKHLNAL-----------SLLEL---------------RDNKVKSLPEEITLLQGLERLDLTNNDISSLPCGLGTLPKLKSLSLEGNPLRAIRRDLLTKGTGELLKYLRSRVQEPPNGGLKEEPKTAMTFPSQAKINVHAIKTLKTLDYSEKQDASIPDDVFDAVDGNPVANVNFSKNQLTAV 439          
BLAST of SMED30019284 vs. Ensembl Zebrafish
Match: BX511222.1 (malignant fibrous histiocytoma amplified sequence 1 [Source:NCBI gene;Acc:797005])

HSP 1 Score: 132.494 bits (332), Expect = 8.579e-31
Identity = 102/342 (29.82%), Postives = 164/342 (47.95%), Query Frame = 3
Query:  321 DLENLIYLDLANNHLTVLSELIGN-FSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFP 1343
            D++ +  L+L NN L  L E +G+  +KL+   +  NKF T+P  +  LS+L+  D SHN LN   + I  LK L  L  +HN +  LP  I  LQ+LE                       EL+I  N+L        +L+KL  L++  N     PS I  LS L+ L+  GN K+  LPG                      +     +++IL +S+ H+  LP  F    +L  L   NN +  +P+ FG ++KL++L+LS+N  +  P ++  +  L ++ LS N+    PE + ++  L ++ +  N I  +P+SI+ L +L+   L GN+I   P
Sbjct:   45 DIKEIEVLNLGNNSLQELPEGLGSTLTKLRILILRRNKFATVPSAVFQLSQLVELDISHNCLNHFSEDIDLLKGLKKLCFSHNRIQYLPSQIGTLQSLE-----------------------ELDISFNELHDFPRSFSQLRKLRTLDVDHNKLQRFPSEILALSDLEELDCSGN-KLEGLPG----------------------NIMMLQSIKILWLSSTHLLSLPETFCELQNLESLMLDNNFLTRLPQSFGKMQKLKMLNLSSNSFEDFPQVIIKLTKLEELYLSRNKLTFLPEEVGQLCNLANLWLDNNSITFLPDSIVELGKLEELVLQGNQIAILP 340          

HSP 2 Score: 107.842 bits (268), Expect = 4.074e-23
Identity = 107/427 (25.06%), Postives = 192/427 (44.96%), Query Frame = 3
Query:  675 NLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGE-LSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFPWLPESIIDFD------LSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDIESSFVLEFQDRLESLDLSNNAISALPATAFTKFSKLRYLNLQGNPCKIPPSDVFNCGQMIPICSYLTAYNEFDATILDRIMP 1934
            NL +L +   + Q +++    +K++ VLNL  N+  E+P  +G  L+ L+ L LR N                        F+++       + L  LDIS+N +     D      L  L +S+N+I  +P   G+L+ L+ LD+S NEL   P     +  LR +++ +N+   FP  +  +  L  ++ + N +E +P +IM L  ++   LS   + S   LPE+  +        L +N +  +PQ+F  K+  ++ LN+S+ + +   +++  L  L+     ++   KLT +   + QL NL  + L NN +  +P+ I+++  L  + L+GN+I                          A+    F K +K+    ++ NP   PP +V  C + IP   Y+ AY +  A     I P
Sbjct:   26 NLRQLTLSTKNSQKITLP-EDIKEIEVLNLGNNSLQELPEGLGSTLTKLRILILRRN-----------------------KFATVPSAVFQLSQLVELDISHNCLNHFSEDIDLLKGLKKLCFSHNRIQYLPSQIGTLQSLEELDISFNELHDFPRSFSQLRKLRTLDVDHNKLQRFPSEILALSDLEELDCSGNKLEGLPGNIMMLQSIKILWLSSTHLLS---LPETFCELQNLESLMLDNNFLTRLPQSF-GKMQKLKMLNLSSNSFEDFPQVIIKLTKLEELYLSRN---KLTFLPEEVGQLCNLANLWLDNNSITFLPDSIVELGKLEELVLQGNQI--------------------------AILPDNFGKLAKVNIWKVKDNPLIQPPYEV--CMKGIP---YIAAYQKELAHSQPAIKP 390          

HSP 3 Score: 98.9821 bits (245), Expect = 1.845e-20
Identity = 111/388 (28.61%), Postives = 157/388 (40.46%), Query Frame = 3
Query:   96 NINEDFFEKEKINILNCSYSKVKKIGKLCNCKDLEGLIVNGNEITEIPLAINQL-----------------------KSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNEL---------DSLPVIMEYMESL 1163
             + ED  E E +N+ N S  ++ + G       L  LI+  N+   +P A+ QL                       K L  L  SHN I  L +    L++L  LD++ N L           KL+  ++  NK    P  + +LS+L   DCS N L  +P  I  L+ +  L L+   L  LPET  ELQNLE                        L + NN L  L    GK++KL +LNLS N+F + P  I +L+ L+ L L  N K+T LP                      ++ G   NL  L + NN IT LP        L  L    N+I  +P+ FG L K+ I  + +N L           +P I  Y + L
Sbjct:   41 TLPEDIKEIEVLNLGNNSLQELPE-GLGSTLTKLRILILRRNKFATVPSAVFQLSQLVELDISHNCLNHFSEDIDLLKGLKKLCFSHNRIQYLPSQIGTLQSLEELDISFNELHDFPRSFSQLRKLRTLDVDHNKLQRFPSEILALSDLEELDCSGNKLEGLPGNIMMLQSIKILWLSSTHLLSLPETFCELQNLE-----------------------SLMLDNNFLTRLPQSFGKMQKLKMLNLSSNSFEDFPQVIIKLTKLEELYLSRN-KLTFLP----------------------EEVGQLCNLANLWLDNNSITFLPDSIVELGKLEELVLQGNQIAILPDNFGKLAKVNIWKVKDNPLIQPPYEVCMKGIPYIAAYQKEL 381          
BLAST of SMED30019284 vs. Ensembl Xenopus
Match: LRRD1 (leucine-rich repeats and death domain containing 1 [Source:NCBI gene;Acc:100490254])

HSP 1 Score: 239.195 bits (609), Expect = 1.241e-65
Identity = 192/612 (31.37%), Postives = 318/612 (51.96%), Query Frame = 3
Query:  177 LCNCKDLEGLIVNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCN-FSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFP---WLPESIIDFDLSDNPVESIPQ--NFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDIESSFVLEFQDRLESLDLSNNAISALPATAFTKFSKLRYLNLQGNPCKIPPSDVFNCGQMIPICSYLTAYNEFDATILDRIMPIISNKFPISRTRHLFRKLRI 1994
            LC+   LE L + GN +  +P  I  L  LT LN++HN I  L      L+N+  L   NN L+ L   +G+ + LQ   ISGN   TLP++  SL  L   +   N ++ +PK +  L QL  L L+ N +  LP+ I +L+NL  L L +N LT L   ++ L +L EL + +N L  +S  +  LK+L VL+++ N   +I   +    +++ L L GN ++  LP  I  +   + L  + N    L D   + NNL ++  +NN++  +PI+ KNC  +  L  S NK++E+P+   S+  L  L+L+ NE+  +   + +   L  + LS N+   F      +  L  ++++ N+I ++P +I +L  L    L  NK + FP      +S+   DLS N +E++P   + +  L Y+   N+SN +       +FS++SL+  K  Q  G+KL  +   LS+L NLKE+ +S+N + ++P  I +MKNL  ++   N++  + +S  +     L+ L L  N +++LP+   +   KLR +NL  NP   PPS + +  ++ PI  YL + +  D  IL +   +ISN  P        +KLRI
Sbjct:   81 LCHLSKLEILSLEGNALVSLPPEICSLSQLTALNVNHNQIAVLPHEISGLKNIKQLFANNNKLSQLPPCLGDLTTLQVLCISGNSMKTLPDSTASLKNLHVLNLDGNQISALPKAVFRLSQLVKLCLSGNQIKSLPKEIGDLKNLRELSLSSNQLTFLPVQLYNLTSLEELTLDDNKLTAISDKLQNLKQLKVLSIANNLLTDITEKVCWCPAIECLKLNGN-QMYRLPTKIHNLRNLKELHIERNALEMLPDQLAHLNNLSVIVCANNNLLWIPIELKNCNQITKLDLSGNKLSEVPQALSSMTSLLYLNLNQNEIHEIANSIIHNRKLEHLELSGNKLTVFSVHFCGLHNLAYLDLSRNEINSVPSAISNLESLSELLLHSNKFRRFPIELCALKSLQKIDLSGNQIETVPSGISLLEGLRYV---NLSNNSFKVFPRELFSVSSLETLKISQKDGRKLISLPDELSKLKNLKELEISDNNIKTLPGSIGEMKNLVQLTATSNQLYHLPAS--ISSLAALQQLSLKGNQLTSLPSD-ISGLQKLREINLDSNPMLRPPSLLCDGKRLYPIGRYLQSADLRDEKILQKTFKLISNNIPAEDFSFFCKKLRI 685          

HSP 2 Score: 145.976 bits (367), Expect = 4.469e-35
Identity = 153/546 (28.02%), Postives = 249/546 (45.60%), Query Frame = 3
Query:  261 SLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCN-FSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFPWLP------ESIIDFDLSDNPVESIPQNF--MAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDIESSFVLEF--QDRLESLDLSNNAISALPATAFTKFSKLRYLNLQGNPCKIPPSDVFNCGQM 1865
            S+T +NL+   +T +    F   NL  L L+NN +T L   + + SKL+  ++ GN   +LP  +CSLS                       QLT L +NHN ++ LP  I  L+N++                       +L   NN L  L   +G L  L VL +S N+   +P +   L +L  LNL GN +I+ LP ++  +S    L    N   SL  + G   NLR L +S+N +T LP+   N  SL  L   +NK+  I +   +LK+L++L ++NN L  +   + +  ++  + L+ N+    P  +  +  L  + I  N +E +P+ +  L  L     + N +    W+P        I   DLS N +  +PQ    M  L Y+      N N + I EI  S+   +  ++ +  G KLT        L+NL  ++LS N + S+P  I  +++L+ + L  NK +     F +E      L+ +DLS N I  +P +  +    LRY+NL  N  K+ P ++F+   +
Sbjct:   40 SITSINLNSKELTEIPPDVFRCTNLQCLLLSNNFMTHLPTSLCHLSKLEILSLEGNALVSLPPEICSLS-----------------------QLTALNVNHNQIAVLPHEISGLKNIK-----------------------QLFANNNKLSQLPPCLGDLTTLQVLCISGNSMKTLPDSTASLKNLHVLNLDGN-QISALPKAVFRLSQLVKLCLSGNQIKSLPKEIGDLKNLRELSLSSNQLTFLPVQLYNLTSLEELTLDDNKLTAISDKLQNLKQLKVLSIANNLLTDITEKVCWCPAIECLKLNGNQMYRLPTKIHNLRNLKELHIERNALEMLPDQLAHLNNLSVIVCANNNLL---WIPIELKNCNQITKLDLSGNKLSEVPQALSSMTSLLYL------NLNQNEIHEIANSIIHNRKLEHLELSGNKLTVFSVHFCGLHNLAYLDLSRNEINSVPSAISNLESLSELLLHSNKFR----RFPIELCALKSLQKIDLSGNQIETVP-SGISLLEGLRYVNLSNNSFKVFPRELFSVSSL 524          
BLAST of SMED30019284 vs. Ensembl Xenopus
Match: shoc2 (SHOC2 leucine-rich repeat scaffold protein [Source:NCBI gene;Acc:100495610])

HSP 1 Score: 158.688 bits (400), Expect = 4.939e-40
Identity = 140/475 (29.47%), Postives = 239/475 (50.32%), Query Frame = 3
Query:   60 KIFKTLTKEEIDNINEDFFEKEKINILNCSYSKVKKIGKL-------------CNC-KDLEGLIVNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMD-IGKLKKLIVLNLSFNNFIEIP-SNIGELSSLKYLNLRGNSKITNLP-GXXXXXXXXXXXXDQCN-FSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNK-IQSFPW---LPESIIDFDLSDNPVESIPQNFMA 1418
            ++ K L+K   +N       K+ I++L  S   + +I +L               C  +L  L ++ N +T +P +++ LK L  L+L HN +  +    + L +L  L L  N +T + + I   SKL   +I  NK   LP  +  L  L++ D +HN L  +PK IG+  Q+T L L HN+L DLP+TI  L +L  L L  N L+ +   + +   L ELN+ NN++  L    +  L K+  L L+ N F   P     + S++  LN+  N +I  +P G      +   L  + N  +SL  DFG + ++  L+++ N +T++P D    +S+ VL  SNN + ++P   G+L+KL+ LDL  N+L+SLP  + Y++ L+K+ L+NN+    P  +  +  L  + +  N +  +PE I +L  L+   L+ N  + S P+   L   +    + + P+  +P   +A
Sbjct:   69 EVIKELSKCREENATRLDLAKKSIHMLPVSIKDLTQITELYLYGNKLQSLPAEVGCLVNLVKLALSENSLTSLPDSLDNLKKLCMLDLRHNKLREIPAVVYRLSSLTTLFLRFNRITAVEKDIKTLSKLTMLSIRENKIKHLPAEIGELCNLITLDVAHNQLEHLPKEIGNCTQITNLDLQHNELLDLPDTIGNLCSLSRLGLRYNRLSAVPRSLAKCSELDELNLENNNISTLPEGLLSSLVKVNSLTLARNCFQSYPVGGPSQFSTIYSLNMEHN-RINKIPFGIFSRAKVLSKLNMKDNQLTSLPLDFGTWTSMVELNLATNQLTKIPEDVSGLVSIEVLILSNNLLKKLPHGIGNLRKLRELDLEENKLESLPNEIAYLKDLQKLVLTNNQLTTLPRGIGHLTNLTHLGLGENLLTHLPEEIGTLENLEELYLNDNPNLHSLPFELALCSKLSIMSIENCPLSHLPPQIVA 542          

HSP 2 Score: 116.701 bits (291), Expect = 2.614e-26
Identity = 117/460 (25.43%), Postives = 198/460 (43.04%), Query Frame = 3
Query:  456 CSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMS-LTRLQTFNLSGNKIQSFPWLPES----IIDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDIESSFVLEFQDRLESLDLSNNAISALPATAFTKFSKLRYLNLQGN 1820
            C        D +   ++ +P  I  L Q+T L L  N L  LP                         V  LVNL++L +  N L  L   +  LKKL +L+L  N   EIP+ +  LSSL  L LR N                         +++  D    + L +L I  N I  LP +     +L  L  ++N++  +P+  G+  ++  LDL +NEL  LP  +  + SL ++ L  NR +  P  L K   L+ + +  N+I T+PE ++S L ++ +  L+ N  QS+P    S    I   ++  N +  IP    ++   +  LN+ +     +     +  S+       +   +LT+I   +S L +++ + LSNN L  +P  I  ++ L  + L  NK++ + +     +   L+ L L+NN ++ LP       + L +L L  N
Sbjct:   77 CREENATRLDLAKKSIHMLPVSIKDLTQITELYLYGNKLQSLPAE-----------------------VGCLVNLVKLALSENSLTSLPDSLDNLKKLCMLDLRHNKLREIPAVVYRLSSLTTLFLRFN-----------------------RITAVEKDIKTLSKLTMLSIRENKIKHLPAEIGELCNLITLDVAHNQLEHLPKEIGNCTQITNLDLQHNELLDLPDTIGNLCSLSRLGLRYNRLSAVPRSLAKCSELDELNLENNNISTLPEGLLSSLVKVNSLTLARNCFQSYPVGGPSQFSTIYSLNMEHNRINKIPFGIFSRAKVLSKLNMKDNQLTSLPLDFGTWTSMVELNLATN---QLTKIPEDVSGLVSIEVLILSNNLLKKLPHGIGNLRKLRELDLEENKLESLPNEIA--YLKDLQKLVLTNNQLTTLP-RGIGHLTNLTHLGLGEN 484          
BLAST of SMED30019284 vs. Ensembl Xenopus
Match: shoc2 (SHOC2 leucine-rich repeat scaffold protein [Source:NCBI gene;Acc:100495610])

HSP 1 Score: 158.303 bits (399), Expect = 8.028e-40
Identity = 140/475 (29.47%), Postives = 239/475 (50.32%), Query Frame = 3
Query:   60 KIFKTLTKEEIDNINEDFFEKEKINILNCSYSKVKKIGKL-------------CNC-KDLEGLIVNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMD-IGKLKKLIVLNLSFNNFIEIP-SNIGELSSLKYLNLRGNSKITNLP-GXXXXXXXXXXXXDQCN-FSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNK-IQSFPW---LPESIIDFDLSDNPVESIPQNFMA 1418
            ++ K L+K   +N       K+ I++L  S   + +I +L               C  +L  L ++ N +T +P +++ LK L  L+L HN +  +    + L +L  L L  N +T + + I   SKL   +I  NK   LP  +  L  L++ D +HN L  +PK IG+  Q+T L L HN+L DLP+TI  L +L  L L  N L+ +   + +   L ELN+ NN++  L    +  L K+  L L+ N F   P     + S++  LN+  N +I  +P G      +   L  + N  +SL  DFG + ++  L+++ N +T++P D    +S+ VL  SNN + ++P   G+L+KL+ LDL  N+L+SLP  + Y++ L+K+ L+NN+    P  +  +  L  + +  N +  +PE I +L  L+   L+ N  + S P+   L   +    + + P+  +P   +A
Sbjct:   89 EVIKELSKCREENATRLDLAKKSIHMLPVSIKDLTQITELYLYGNKLQSLPAEVGCLVNLVKLALSENSLTSLPDSLDNLKKLCMLDLRHNKLREIPAVVYRLSSLTTLFLRFNRITAVEKDIKTLSKLTMLSIRENKIKHLPAEIGELCNLITLDVAHNQLEHLPKEIGNCTQITNLDLQHNELLDLPDTIGNLCSLSRLGLRYNRLSAVPRSLAKCSELDELNLENNNISTLPEGLLSSLVKVNSLTLARNCFQSYPVGGPSQFSTIYSLNMEHN-RINKIPFGIFSRAKVLSKLNMKDNQLTSLPLDFGTWTSMVELNLATNQLTKIPEDVSGLVSIEVLILSNNLLKKLPHGIGNLRKLRELDLEENKLESLPNEIAYLKDLQKLVLTNNQLTTLPRGIGHLTNLTHLGLGENLLTHLPEEIGTLENLEELYLNDNPNLHSLPFELALCSKLSIMSIENCPLSHLPPQIVA 562          

HSP 2 Score: 116.701 bits (291), Expect = 3.388e-26
Identity = 117/460 (25.43%), Postives = 198/460 (43.04%), Query Frame = 3
Query:  456 CSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMS-LTRLQTFNLSGNKIQSFPWLPES----IIDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDIESSFVLEFQDRLESLDLSNNAISALPATAFTKFSKLRYLNLQGN 1820
            C        D +   ++ +P  I  L Q+T L L  N L  LP                         V  LVNL++L +  N L  L   +  LKKL +L+L  N   EIP+ +  LSSL  L LR N                         +++  D    + L +L I  N I  LP +     +L  L  ++N++  +P+  G+  ++  LDL +NEL  LP  +  + SL ++ L  NR +  P  L K   L+ + +  N+I T+PE ++S L ++ +  L+ N  QS+P    S    I   ++  N +  IP    ++   +  LN+ +     +     +  S+       +   +LT+I   +S L +++ + LSNN L  +P  I  ++ L  + L  NK++ + +     +   L+ L L+NN ++ LP       + L +L L  N
Sbjct:   97 CREENATRLDLAKKSIHMLPVSIKDLTQITELYLYGNKLQSLPAE-----------------------VGCLVNLVKLALSENSLTSLPDSLDNLKKLCMLDLRHNKLREIPAVVYRLSSLTTLFLRFN-----------------------RITAVEKDIKTLSKLTMLSIRENKIKHLPAEIGELCNLITLDVAHNQLEHLPKEIGNCTQITNLDLQHNELLDLPDTIGNLCSLSRLGLRYNRLSAVPRSLAKCSELDELNLENNNISTLPEGLLSSLVKVNSLTLARNCFQSYPVGGPSQFSTIYSLNMEHNRINKIPFGIFSRAKVLSKLNMKDNQLTSLPLDFGTWTSMVELNLATN---QLTKIPEDVSGLVSIEVLILSNNLLKKLPHGIGNLRKLRELDLEENKLESLPNEIA--YLKDLQKLVLTNNQLTTLP-RGIGHLTNLTHLGLGEN 504          
BLAST of SMED30019284 vs. Ensembl Xenopus
Match: pparg (peroxisome proliferator activated receptor gamma [Source:Xenbase;Acc:XB-GENE-483136])

HSP 1 Score: 141.739 bits (356), Expect = 2.346e-34
Identity = 156/589 (26.49%), Postives = 267/589 (45.33%), Query Frame = 3
Query:  210 VNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQL-PIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNF-PEILTK--------------IPTLNSI--EITANDIETIPESIMSLTR---LQTFNLSGNKIQSFPW----LPESIIDFDLSDNPVESIPQNF--MAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDIESSFVLEFQDRLESLDLSNNAISAL-PATAFTKFSKLRYLNLQGNPCKIPPSDVFNCGQMIPICSYLTA 1892
            ++   +T++P+++ ++   T      N        +++  +L  L LA+N L +LSE I     L   +I  N+  +LP  +  L+ L   + SHN +  +PK +  L+ L +L+L HN L +LP++I  L  LE L + NN L +++  V +L  L++ N+ +N L  L  +IGK+K L  L+ + N    +P+++  + SL+ L LR N K+T LP                       +  +   L+ L + NN I  L P   +N  SL+VL+   NK+  +PE    L  L+ LDLSNN+L SLP  +  + +L+ + L  N       +IL K              +P    I  +I       IPE++ + T    + T N S N++   P     + +S+ D +L  N + SI  N   + KL +I+                              R   LT +   +  +  L+ + LS N     P+ + ++  L +I +  N+I  I+   +     +L +LDL NN +  + PA    +   LR L+L+GNP + P + +   G  + +  YL +
Sbjct:   43 LSARGLTDVPVSVWRINVDTPPEAHQNVDFGGSDRWWEQTDLTKLILASNKLQLLSEDISLLPALVVLDIHDNQIVSLPCAIKELTNLQKLNISHNKIKQLPKELQHLQNLKSLLLQHNQLEELPDSIGHLSILEELDVSNNCLRSISSSVGQLTGLVKFNLSSNKLTALPTEIGKMKNLKQLDCTSNLLENVPASVAGMESLEQLYLRQN-KLTYLP-----------------------ELPFLTKLKELHVGNNQIQTLGPEHLQNLSSLSVLELRYNKLKVLPEEISLLNGLERLDLSNNDLGSLPCTLGSLPNLKSLQLEGNPLRGIRRDILNKGTQELLKYLKGRVQVPGKLFIHPKILEKQASLIPEAVFNATGSSFITTVNFSKNQLTEVPARIVEMKDSVCDVNLGFNKISSISLNLCMLLKLTHIDM-----------------------------RNNVLTSLPSEMEAMTRLQSVILSFNRFKHFPDVLYRIPTLETILISSNQIGSIDPIKM----TKLSTLDLQNNDLLQIPPALGNCESQSLRALHLEGNPFRNPRAAILAKG-TVAVLEYLRS 573          

HSP 2 Score: 130.183 bits (326), Expect = 1.182e-30
Identity = 130/450 (28.89%), Postives = 207/450 (46.00%), Query Frame = 3
Query:  180 CNCKDL---EGLIVNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGN---------------------SKITNLPGX----XXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLP---IDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFPWL-----PESIIDFDLSDNPVESIPQNFMAK 1421
            C  K+L   + L ++ N+I ++P  +  L++L  L L HN +  L  +   L  L  LD++NN L  +S  +G  + L  FN+S NK   LP  +  +  L   DC+ N L  VP  +  ++ L  L L  N L+ LPE     +  E+    N   T    ++  L +L  L +  N L+ L  +I  L  L  L+LS N+   +P  +G L +LK L L GN                          +PG       ++     LI +  F++    F     +  ++ S N +T++P   ++ K+  S+  +    NKI+ I      L KL  +D+ NN L SLP  ME M  L+ + LS NRF +FP++L +IPTL +I I++N I +I    + +T+L T +L  N +   P        +S+    L  NP  +     +AK
Sbjct:  122 CAIKELTNLQKLNISHNKIKQLPKELQHLQNLKSLLLQHNQLEELPDSIGHLSILEELDVSNNCLRSISSSVGQLTGLVKFNLSSNKLTALPTEIGKMKNLKQLDCTSNLLENVPASVAGMESLEQLYLRQNKLTYLPELPFLTKLKELHVGNNQIQTLGPEHLQNLSSLSVLELRYNKLKVLPEEISLLNGLERLDLSNNDLGSLPCTLGSLPNLKSLQLEGNPLRGIRRDILNKGTQELLKYLKGRVQVPGKLFIHPKILEKQASLIPEAVFNATGSSF-----ITTVNFSKNQLTEVPARIVEMKD--SVCDVNLGFNKISSISLNLCMLLKLTHIDMRNNVLTSLPSEMEAMTRLQSVILSFNRFKHFPDVLYRIPTLETILISSNQIGSI--DPIKMTKLSTLDLQNNDLLQIPPALGNCESQSLRALHLEGNPFRNPRAAILAK 562          
BLAST of SMED30019284 vs. Ensembl Xenopus
Match: pparg (peroxisome proliferator activated receptor gamma [Source:Xenbase;Acc:XB-GENE-483136])

HSP 1 Score: 140.584 bits (353), Expect = 5.087e-34
Identity = 152/582 (26.12%), Postives = 263/582 (45.19%), Query Frame = 3
Query:  210 VNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQL-PIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILT----------KIPTLNSIEITANDIETIPESIMSLTR---LQTFNLSGNKIQSFPW----LPESIIDFDLSDNPVESIPQNF--MAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDIESSFVLEFQDRLESLDLSNNAISAL-PATAFTKFSKLRYLNLQGNPCKIPPSDVFNCGQMIPICSYLTA 1892
            ++   +T++P+++ ++   T      N        +++  +L  L LA+N L +LSE I     L   +I  N+  +LP  +  L+ L   + SHN +  +PK +  L+ L +L+L HN L +LP++I  L  LE L + NN L +++  V +L  L++ N+ +N L  L  +IGK+K L  L+ + N    +P+++  + SL+ L LR N K+T LP                       +  +   L+ L + NN I  L P   +N  SL+VL+   NK+  +PE    L  L+ LDLSNN+L   P   +    L +  ++    N+    +T           I TL ++E        IPE++ + T    + T N S N++   P     + +S+ D +L  N + SI  N   + KL +I+                              R   LT +   +  +  L+ + LS N     P+ + ++  L +I +  N+I  I+   +     +L +LDL NN +  + PA    +   LR L+L+GNP + P + +   G  + +  YL +
Sbjct:   43 LSARGLTDVPVSVWRINVDTPPEAHQNVDFGGSDRWWEQTDLTKLILASNKLQLLSEDISLLPALVVLDIHDNQIVSLPCAIKELTNLQKLNISHNKIKQLPKELQHLQNLKSLLLQHNQLEELPDSIGHLSILEELDVSNNCLRSISSSVGQLTGLVKFNLSSNKLTALPTEIGKMKNLKQLDCTSNLLENVPASVAGMESLEQLYLRQN-KLTYLP-----------------------ELPFLTKLKELHVGNNQIQTLGPEHLQNLSSLSVLELRYNKLKVLPEEISLLNGLERLDLSNNDLGRYPG-QKQQRKLFRCKMTQEDENSTATAMTLPSESVVNTHAIVTLKTLEYCEKQASLIPEAVFNATGSSFITTVNFSKNQLTEVPARIVEMKDSVCDVNLGFNKISSISLNLCMLLKLTHIDM-----------------------------RNNVLTSLPSEMEAMTRLQSVILSFNRFKHFPDVLYRIPTLETILISSNQIGSIDPIKM----TKLSTLDLQNNDLLQIPPALGNCESQSLRALHLEGNPFRNPRAAILAKG-TVAVLEYLRS 565          

HSP 2 Score: 131.724 bits (330), Expect = 3.782e-31
Identity = 130/449 (28.95%), Postives = 209/449 (46.55%), Query Frame = 3
Query:  204 LIVNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMD-IGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYN----------NLRILDISNNHITQLPIDFKNCLS---LAVLKWSNNKINEIPEVFGSLK------------------------KLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFPWL-----PESIIDFDLSDNPVESIPQNFMAK 1421
            L ++ N+I  +P AI +L +L  LN+SHN I  L      L+NL  L L +N L  L + IG+ S L+  ++S N   ++  ++  L+ L+ F+ S N L  +P  IG +K L  L    N L ++P ++  +++LE L L  N LT L    F L  L EL++ NN +Q L  + +  L  L VL L +N    +P  I  L+ L+ L+L  N+ +   PG      L    + Q + +S +      +           L+ L+      + +P    N      +  + +S N++ E+P     +K                        KL  +D+ NN L SLP  ME M  L+ + LS NRF +FP++L +IPTL +I I++N I +I    + +T+L T +L  N +   P        +S+    L  NP  +     +AK
Sbjct:  110 LDIHDNQIVSLPCAIKELTNLQKLNISHNKIKQLPKELQHLQNLKSLLLQHNQLEELPDSIGHLSILEELDVSNNCLRSISSSVGQLTGLVKFNLSSNKLTALPTEIGKMKNLKQLDCTSNLLENVPASVAGMESLEQLYLRQNKLTYLPELPF-LTKLKELHVGNNQIQTLGPEHLQNLSSLSVLELRYNKLKVLPEEISLLNGLERLDL-SNNDLGRYPGQKQQRKLFRCKMTQEDENSTATAMTLPSESVVNTHAIVTLKTLEYCEKQASLIPEAVFNATGSSFITTVNFSKNQLTEVPARIVEMKDSVCDVNLGFNKISSISLNLCMLLKLTHIDMRNNVLTSLPSEMEAMTRLQSVILSFNRFKHFPDVLYRIPTLETILISSNQIGSI--DPIKMTKLSTLDLQNNDLLQIPPALGNCESQSLRALHLEGNPFRNPRAAILAK 554          
BLAST of SMED30019284 vs. Ensembl Mouse
Match: Lrrd1 (leucine rich repeats and death domain containing 1 [Source:MGI Symbol;Acc:MGI:3045299])

HSP 1 Score: 177.178 bits (448), Expect = 6.004e-45
Identity = 172/628 (27.39%), Postives = 296/628 (47.13%), Query Frame = 3
Query:  129 INILNCSYSKVKKIGK-LCNCKDLEGLIVNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLP-GXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFPWLPESIIDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDIESSFVLEFQDRLESLDLSNNAISALPATAFTKFSKLRYLNLQGNPCKIPPSDVFNCGQMIPICSYLTAYNEFDATILDRIMPIISNKFPISRTRHLFRKLRIPESV 2006
            + ILN SY+++ +I K L   +++  L++N N I  +P  +  L+ L  L+L  N +T +  +   L+NL  L+L  N LT+ S+ +    KL   N++GN   +LP+ +  L  L S    HN L F+   I  L ++  L L  N L  +   I+  + L +L L  N L ++   +   VNL  L++ +N+++ L   I KLK L  L+++ N  I +   I  LS++  L   GN +IT++P        ++ + ++  N            +L  L  + N+I+++P+D      L  L+ + NK+    +   SL  L+ LDL+ N++ ++P  +  M SL  + LS+N+F +FP+ L  +  L  ++I+ N ++ IP  I  L R+Q  NLS N   +F               PVE      + +L  +E LNIS T+   +  +   ++ +   K        + +I   + +L +L     SNN + S+P   L ++ L S+ LRGN +                         +ALP+  + K S L+ +N   NP   PP ++    +M  I  YL   +E D  IL++I  I++N    +    L +KL +  S 
Sbjct:  207 LKILNASYNEISQIPKELLQLENMRQLLLNSNHIDTLPSGLEHLRYLETLSLGKNMLTYIPDSLSSLKNLRILNLEYNQLTIFSKSLCFLPKLNSLNLTGNMIGSLPKEVRELKNLESLLMDHNKLTFLAVEIFQLPKIKELHLADNKLEAISPKIENFKELRLLNLDKNLLQSIPKKISHCVNLESLSLSDNNIEELPKKIRKLKNLRQLHVNRNKMITMTEEISHLSNIHILEFSGN-QITHVPIEIKNCRKITRVELNYNNIMYFPVGLCALQSLDYLSFNGNYISEIPVDMSFSKQLLHLELNRNKLTVFSKHLCSLTNLEYLDLAKNQIMTIPSCISAMVSLHVLILSDNKFESFPKELCSLKNLRVLDISENKLQKIPLEISKLKRIQKLNLSNNIFTNF---------------PVE------LCQLQTLEELNISQTSGKKLTRLPEEVSHMTQLKILNISNNAIKDIPKNIGELRSLVSFYASNNQISSLPSSFLSLEVLQSLDLRGNNM-------------------------TALPSGIY-KLSSLKEINFDDNPLMRPPMEICKGKEMHMITCYLQRADERDEKILEKIFNIVANSITETNFEFLQQKLNMASSA 786          
BLAST of SMED30019284 vs. Ensembl Mouse
Match: Shoc2 (Shoc2, leucine rich repeat scaffold protein [Source:MGI Symbol;Acc:MGI:1927197])

HSP 1 Score: 151.369 bits (381), Expect = 1.118e-37
Identity = 142/473 (30.02%), Postives = 242/473 (51.16%), Query Frame = 3
Query:   27 LKYFNASTNEDKIFKTLTKEEIDNINEDFFEKEKINILNCSYSKVKKIGKLCNC-KDLEGLIVNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMD-IGKLKKLIVLNLSFNNFIEIP-SNIGELSSLKYLNLRGNSKITNLP-GXXXXXXXXXXXXDQCN-FSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNK-IQSFPW---LPESIIDFDLSDNPVESIPQNFMA 1418
            +K  N    E+ +   L+K  I  +     E  ++  L    +K++ +     C  +L  L ++ N +T +P +++ LK L  L+L HN +  + +  + L++L  L L  N +T + + I N  KL   +I  NK   LP  +  L  L++ D +HN L  +PK IG+  Q+T L L HNDL DLP+TI  L +L  L L  N L+ +   + +   L ELN+ NN++  L    +  L KL  L L+ N F   P     + S++  LN+  N +I  +P G      +   L  + N  +SL  DFG + ++  L+++ N +T++P D    +SL VL  SNN + ++P   G+L+KL+ LDL  N+L+SLP  + Y++ L+K+ L+NN+ +  P  +  +  L  + +  N +  +PE I +L  L+   L+ N  + S P+   L   +    + + P+  +P   +A
Sbjct:   91 IKELNKCREENSMRLDLSKRSIHILPPSVKELTQLTELYLYSNKLQSLPAEVGCLVNLMTLALSENSLTSLPDSLDNLKKLRMLDLRHNKLREIPSVVYRLDSLTTLYLRFNRITTVEKDIKNLPKLSMLSIRENKIKQLPAEIGELCNLITLDVAHNQLEHLPKEIGNCTQITNLDLQHNDLLDLPDTIGNLSSLNRLGLRYNRLSAIPRSLAKCSALEELNLENNNISTLPESLLSSLVKLNSLTLARNCFQLYPVGGPSQFSTIYSLNMEHN-RINKIPFGIFSRAKVLSKLNMKDNQLTSLPLDFGTWTSMVELNLATNQLTKIPEDVSGLVSLEVLILSNNLLKKLPHGLGNLRKLRELDLEENKLESLPNEIAYLKDLQKLVLTNNQLSTLPRGIGHLTNLTHLGLGENLLTHLPEEIGTLENLEELYLNDNPNLHSLPFELALCSKLSIMSIENCPLSHLPPQIVA 562          

HSP 2 Score: 111.694 bits (278), Expect = 9.073e-25
Identity = 120/460 (26.09%), Postives = 196/460 (42.61%), Query Frame = 3
Query:  456 CSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMS-LTRLQTFNLSGNKIQSFPWLPES----IIDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDIESSFVLEFQDRLESLDLSNNAISALPATAFTKFSKLRYLNLQGN 1820
            C     +  D S   ++ +P  +  L QLT L L  N L  LP                         V  LVNL+ L +  N L  L   +  LKKL +L+L  N   EIPS +  L SL  L LR N                         +++  D      L +L I  N I QLP +     +L  L  ++N++  +P+  G+  ++  LDL +N+L  LP  +  + SL ++ L  NR +  P  L K   L  + +  N+I T+PES++S L +L +  L+ N  Q +P    S    I   ++  N +  IP    ++   +  LN+ +     +     +  S+       +   +LT+I   +S L +L+ + LSNN L  +P  +  ++ L  + L  NK++ + +     +   L+ L L+NN +S LP       + L +L L  N
Sbjct:   97 CREENSMRLDLSKRSIHILPPSVKELTQLTELYLYSNKLQSLPAE-----------------------VGCLVNLMTLALSENSLTSLPDSLDNLKKLRMLDLRHNKLREIPSVVYRLDSLTTLYLRFN-----------------------RITTVEKDIKNLPKLSMLSIRENKIKQLPAEIGELCNLITLDVAHNQLEHLPKEIGNCTQITNLDLQHNDLLDLPDTIGNLSSLNRLGLRYNRLSAIPRSLAKCSALEELNLENNNISTLPESLLSSLVKLNSLTLARNCFQLYPVGGPSQFSTIYSLNMEHNRINKIPFGIFSRAKVLSKLNMKDNQLTSLPLDFGTWTSMVELNLATN---QLTKIPEDVSGLVSLEVLILSNNLLKKLPHGLGNLRKLRELDLEENKLESLPNEIA--YLKDLQKLVLTNNQLSTLP-RGIGHLTNLTHLGLGEN 504          
BLAST of SMED30019284 vs. Ensembl Mouse
Match: Shoc2 (Shoc2, leucine rich repeat scaffold protein [Source:MGI Symbol;Acc:MGI:1927197])

HSP 1 Score: 151.369 bits (381), Expect = 1.118e-37
Identity = 142/473 (30.02%), Postives = 242/473 (51.16%), Query Frame = 3
Query:   27 LKYFNASTNEDKIFKTLTKEEIDNINEDFFEKEKINILNCSYSKVKKIGKLCNC-KDLEGLIVNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMD-IGKLKKLIVLNLSFNNFIEIP-SNIGELSSLKYLNLRGNSKITNLP-GXXXXXXXXXXXXDQCN-FSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNK-IQSFPW---LPESIIDFDLSDNPVESIPQNFMA 1418
            +K  N    E+ +   L+K  I  +     E  ++  L    +K++ +     C  +L  L ++ N +T +P +++ LK L  L+L HN +  + +  + L++L  L L  N +T + + I N  KL   +I  NK   LP  +  L  L++ D +HN L  +PK IG+  Q+T L L HNDL DLP+TI  L +L  L L  N L+ +   + +   L ELN+ NN++  L    +  L KL  L L+ N F   P     + S++  LN+  N +I  +P G      +   L  + N  +SL  DFG + ++  L+++ N +T++P D    +SL VL  SNN + ++P   G+L+KL+ LDL  N+L+SLP  + Y++ L+K+ L+NN+ +  P  +  +  L  + +  N +  +PE I +L  L+   L+ N  + S P+   L   +    + + P+  +P   +A
Sbjct:   91 IKELNKCREENSMRLDLSKRSIHILPPSVKELTQLTELYLYSNKLQSLPAEVGCLVNLMTLALSENSLTSLPDSLDNLKKLRMLDLRHNKLREIPSVVYRLDSLTTLYLRFNRITTVEKDIKNLPKLSMLSIRENKIKQLPAEIGELCNLITLDVAHNQLEHLPKEIGNCTQITNLDLQHNDLLDLPDTIGNLSSLNRLGLRYNRLSAIPRSLAKCSALEELNLENNNISTLPESLLSSLVKLNSLTLARNCFQLYPVGGPSQFSTIYSLNMEHN-RINKIPFGIFSRAKVLSKLNMKDNQLTSLPLDFGTWTSMVELNLATNQLTKIPEDVSGLVSLEVLILSNNLLKKLPHGLGNLRKLRELDLEENKLESLPNEIAYLKDLQKLVLTNNQLSTLPRGIGHLTNLTHLGLGENLLTHLPEEIGTLENLEELYLNDNPNLHSLPFELALCSKLSIMSIENCPLSHLPPQIVA 562          

HSP 2 Score: 111.694 bits (278), Expect = 9.073e-25
Identity = 120/460 (26.09%), Postives = 196/460 (42.61%), Query Frame = 3
Query:  456 CSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMS-LTRLQTFNLSGNKIQSFPWLPES----IIDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDIESSFVLEFQDRLESLDLSNNAISALPATAFTKFSKLRYLNLQGN 1820
            C     +  D S   ++ +P  +  L QLT L L  N L  LP                         V  LVNL+ L +  N L  L   +  LKKL +L+L  N   EIPS +  L SL  L LR N                         +++  D      L +L I  N I QLP +     +L  L  ++N++  +P+  G+  ++  LDL +N+L  LP  +  + SL ++ L  NR +  P  L K   L  + +  N+I T+PES++S L +L +  L+ N  Q +P    S    I   ++  N +  IP    ++   +  LN+ +     +     +  S+       +   +LT+I   +S L +L+ + LSNN L  +P  +  ++ L  + L  NK++ + +     +   L+ L L+NN +S LP       + L +L L  N
Sbjct:   97 CREENSMRLDLSKRSIHILPPSVKELTQLTELYLYSNKLQSLPAE-----------------------VGCLVNLMTLALSENSLTSLPDSLDNLKKLRMLDLRHNKLREIPSVVYRLDSLTTLYLRFN-----------------------RITTVEKDIKNLPKLSMLSIRENKIKQLPAEIGELCNLITLDVAHNQLEHLPKEIGNCTQITNLDLQHNDLLDLPDTIGNLSSLNRLGLRYNRLSAIPRSLAKCSALEELNLENNNISTLPESLLSSLVKLNSLTLARNCFQLYPVGGPSQFSTIYSLNMEHNRINKIPFGIFSRAKVLSKLNMKDNQLTSLPLDFGTWTSMVELNLATN---QLTKIPEDVSGLVSLEVLILSNNLLKKLPHGLGNLRKLRELDLEENKLESLPNEIA--YLKDLQKLVLTNNQLSTLP-RGIGHLTNLTHLGLGEN 504          
BLAST of SMED30019284 vs. Ensembl Mouse
Match: Lrrc1 (leucine rich repeat containing 1 [Source:MGI Symbol;Acc:MGI:2442313])

HSP 1 Score: 127.872 bits (320), Expect = 3.658e-30
Identity = 115/384 (29.95%), Postives = 185/384 (48.18%), Query Frame = 3
Query:  189 KDLEGLIVNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSF 1340
            + LE L+++ N++ E+P    QL  L  L LS N I  L     +   L+ LD++ N +  + E I     LQ  + SGN    LPE+   L  L     +   L  +P+ IG+L  L +L L  N L+ LP+++ +L+ LE L LGNN + NL   +  L++L +L +  N L  L  +IG LK L+ L++S N    +P  I  L+SL YL +  N                          ++ +  G    L IL +  N +TQLP    +C +L  L  + N++  +P+  G LKKL  L+   N+L SLP  +    SL    + +NR    P  +++   L+ +++  N +  +P S+ +L +L+   LS N+ Q  
Sbjct:   36 RSLEELLLDANQLRELPEQFFQLVKLRKLGLSDNEIQRLPPEIANFMQLVELDVSRNDIPEIPESIAFCKALQVADFSGNPLTRLPESFPELQNLTCLSVNDISLQSLPENIGNLYNLASLELRENLLTYLPDSLTQLRRLEELDLGNNEIYNLPESIGALLHLKDLWLDGNQLSELPQEIGNLKNLLCLDVSENRLERLPEEISGLTSLTYLVISQNL-----------------------LETIPEGIGKLKKLSILKLDQNRLTQLPEAIGDCENLTELVLTENRLLTLPKSIGKLKKLSNLNADRNKLVSLPKEIGGCCSLTMFCIRDNRLTRLPAEVSQAVELHVLDVAGNRLHHLPLSLTTL-KLKALWLSDNQSQPL 395          

HSP 2 Score: 111.309 bits (277), Expect = 7.379e-25
Identity = 113/350 (32.29%), Postives = 178/350 (50.86%), Query Frame = 3
Query:   75 LTKEEIDNINEDFFEKEKINILNCSYSKVKKIG-KLCNCKDLEGLIVNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNE 1121
            L   ++  + E FF+  K+  L  S ++++++  ++ N   L  L V+ N+I EIP +I   K+L   + S N +T L  +F +L+NL  L + +  L  L E IGN   L    +  N    LP++L  L  L   D  +N +  +P+ IG+L  L  L L+ N LS+LP+ I  L+NL  L +  N L  L   +  L +L  L I  N L+ +   IGKLKKL +L L  N   ++P  IG+  +L  L L  N  +T       L  LS L  D+    SL  + G   +L +  I +N +T+LP +    + L VL  + N+++ +P    +L KL+ L LS+N+
Sbjct:   43 LDANQLRELPEQFFQLVKLRKLGLSDNEIQRLPPEIANFMQLVELDVSRNDIPEIPESIAFCKALQVADFSGNPLTRLPESFPELQNLTCLSVNDISLQSLPENIGNLYNLASLELRENLLTYLPDSLTQLRRLEELDLGNNEIYNLPESIGALLHLKDLWLDGNQLSELPQEIGNLKNLLCLDVSENRLERLPEEISGLTSLTYLVISQNLLETIPEGIGKLKKLSILKLDQNRLTQLPEAIGDCENLTELVLTENRLLTLPKSIGKLKKLSNLNADRNKLVSLPKEIGGCCSLTMFCIRDNRLTRLPAEVSQAVELHVLDVAGNRLHHLPLSLTTL-KLKALWLSDNQ 391          

HSP 3 Score: 110.538 bits (275), Expect = 1.345e-24
Identity = 104/355 (29.30%), Postives = 160/355 (45.07%), Query Frame = 3
Query:  348 LANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFPWLPESIID---FDLSDNPVESIP 1403
            L  N L  L E      KL+   +S N+   LP  + +  +L+  D S N +  +P+ I   K L     + N L+ LPE+  ELQNL  L + + +L +L   +  L NL  L +  N L YL   + +L++L  L+L  N    +P +IG L  LK L L GN                         S L  + G   NL  LD+S N + +LP +     SL  L  S N +  IPE  G LKKL IL L  N L  LP  +   E+L ++ L+ NR    P+ + K+  L+++    N + ++P+ I     L  F +  N++   P      ++    D++ N +  +P
Sbjct:   43 LDANQLRELPEQFFQLVKLRKLGLSDNEIQRLPPEIANFMQLVELDVSRNDIPEIPESIAFCKALQVADFSGNPLTRLPESFPELQNLTCLSVNDISLQSLPENIGNLYNLASLELRENLLTYLPDSLTQLRRLEELDLGNNEIYNLPESIGALLHLKDLWLDGN-----------------------QLSELPQEIGNLKNLLCLDVSENRLERLPEEISGLTSLTYLVISQNLLETIPEGIGKLKKLSILKLDQNRLTQLPEAIGDCENLTELVLTENRLLTLPKSIGKLKKLSNLNADRNKLVSLPKEIGGCCSLTMFCIRDNRLTRLPAEVSQAVELHVLDVAGNRLHHLP 374          

HSP 4 Score: 73.559 bits (179), Expect = 8.322e-13
Identity = 76/320 (23.75%), Postives = 154/320 (48.12%), Query Frame = 3
Query:  936 FGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFPWLPESII------DFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDIESSFVLEFQDRLESLDLSNNAISALPATAFTKFSKLRYLNLQGNPCKIPPSDVFNCGQMIPIC 1877
            + Y  +L  L +  N + +LP  F   + L  L  S+N+I  +P    +  +L  LD+S N++  +P  + + ++L+  + S N     PE   ++  L  + +    ++++PE+I +L  L +  L  N +    +LP+S+       + DL +N + ++P++  A L ++++L +       + + + +L +L      ++R ++L E    +S L +L  + +S N L +IPE I ++K L+ + L  N++  +  +  +   + L  L L+ N +  LP +   K  KL  LN   N     P ++  C  +   C
Sbjct:   32 YRYARSLEELLLDANQLRELPEQFFQLVKLRKLGLSDNEIQRLPPEIANFMQLVELDVSRNDIPEIPESIAFCKALQVADFSGNPLTRLPESFPELQNLTCLSVNDISLQSLPENIGNLYNLASLELRENLLT---YLPDSLTQLRRLEELDLGNNEIYNLPESIGALL-HLKDLWLDGNQLSELPQEIGNLKNLLCLDVSENRLERLPE---EISGLTSLTYLVISQNLLETIPEGIGKLKKLSILKLDQNRLTQLPEA--IGDCENLTELVLTENRLLTLPKS-IGKLKKLSNLNADRNKLVSLPKEIGGCCSLTMFC 341          

HSP 5 Score: 72.0182 bits (175), Expect = 2.335e-12
Identity = 72/255 (28.24%), Postives = 122/255 (47.84%), Query Frame = 3
Query: 1068 EVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKI----QSFPWLPESIIDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDIESSFVLEFQDRLESLDLSNNAISALPATAFTKFSKLRYLNLQGN 1820
            E++   + L+ L L  N+L  LP     +  LRK+ LS+N     P  +     L  ++++ NDI  IPESI     LQ  + SGN +    +SFP L +++    ++D  ++S+P+N       I NL              ++L SL++      R   LT +   L+QL  L+E++L NN + ++PE I  + +L  + L GN++ ++     +     L  LD+S N +  LP    +  + L YL +  N
Sbjct:   30 EIYRYARSLEELLLDANQLRELPEQFFQLVKLRKLGLSDNEIQRLPPEIANFMQLVELDVSRNDIPEIPESIAFCKALQVADFSGNPLTRLPESFPEL-QNLTCLSVNDISLQSLPEN-------IGNL--------------YNLASLEL------RENLLTYLPDSLTQLRRLEELDLGNNEIYNLPESIGALLHLKDLWLDGNQLSELPQE--IGNLKNLLCLDVSENRLERLPE-EISGLTSLTYLVISQN 253          
BLAST of SMED30019284 vs. Ensembl Mouse
Match: Lrriq4 (leucine-rich repeats and IQ motif containing 4 [Source:MGI Symbol;Acc:MGI:1915557])

HSP 1 Score: 124.405 bits (311), Expect = 7.071e-29
Identity = 131/492 (26.63%), Postives = 212/492 (43.09%), Query Frame = 3
Query:  408 FFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDL-PETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGK-LKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFPWLPESIIDFD---LSDNPVESIPQNFMAKLNYIENLNISNTNSDGIL---EIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDIESSFVLEFQDRLESLDLSNNAISALPATAFTKFSKLRYLNLQGNPCKIPPSDVFNCG 1859
            F + S     T+P  + +L EL      +N +  +P+GI  L+    L L++N L DL PE         +   GN  + +  H V  L  L EL +    L  +   I K L  L +  LS N    +P  I   + L+ + L+ N                       +F     D     NL ++D+  N +  +P D  + + L     ++N +  +PE      KL +LDL++N + SLP  +E +  L ++ LS NR    P +L    +L+ + +    +  + +S   L  L+  +LS N I+ FP    ++ + +   L DN V  +P      ++ + NL I     + +L   E +FSL SL+     QD+G KL+ +   + +L NLKE+ + NN L  +P  +  M NL  +  R N +K +  +        L  L L +N +  LP         L+ L L  NP   PP  V N G
Sbjct:   50 FIDGSNQGLKTIPSEILALKELEEVHLENNQIAEIPQGIQQLQNTKVLYLHNNSLQDLCPELGALSSLESLDLSGNPLVISSLHVVSRLRTLRELRLYRTGLTEIPTGICKSLHHLELFGLSENFLESLPEEIVNQTKLREIYLKQN-----------------------HFEVFPCDLCVLYNLEVIDLDENKLKSIPGDIGHLVRLQKFYVASNHLMSLPESLSQCSKLSVLDLTHNSIHSLPSSLELLTELTEVGLSGNRLEKVPRLLCSWVSLHLLYLRNTSLHGLRDSFKRLINLRFLDLSQNHIEHFPVQICALKNLEILALDDNKVRQLP----PSISLLSNLKILGLTGNDLLSFPEEIFSLISLEKLYIGQDQGSKLSSLPENIKRLMNLKELYIENNRLEQLPASLGLMPNLEVLDCRHNLLKQLPDAIC--RTRNLRELLLEDNLLCCLPEN-LDHLVNLKVLTLMNNPMVDPPIYVCNQG 511          

HSP 2 Score: 105.531 bits (262), Expect = 9.050e-23
Identity = 130/479 (27.14%), Postives = 232/479 (48.43%), Query Frame = 3
Query:   66 FKTLTKEEI--DNINEDFFEKEKINI------LNCSYSKVKKI-GKLCNCKDLEGLIVNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLS-ELIGNFSKLQFFNISGNKFNTLPETLC-SLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXX-XXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNN---RFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFP---WLPESIIDFDLSDNPVESIPQNFMAKLNYIENLNI 1448
            FKTLTKE +  +++ +   +KE   +      ++ S   +K I  ++   K+LE + +  N+I EIP  I QL++   L L +N + +L      L +L  LDL+ N L + S  ++     L+   +       +P  +C SL  L  F  S N L  +P+ I +  +L  + L  N     P  +  L NLE++ L  N L ++   +  LV L +  + +N L  L   + +  KL VL+L+ N+   +PS++  L+ L  + L GN ++  +P  +   +SL  L +   +   L D F    NLR LD+S NHI   P+      +L +L   +NK+ ++P     L  L+IL L+ N+L S P  +  + SL K+ +  +   + ++ PE + ++  L  + I  N +E +P S+  +  L+  +   N ++  P       ++ +  L DN +  +P+N    L+++ NL +
Sbjct:   19 FKTLTKELLRQEHLPKVLQKKEPHQLTDRTFFIDGSNQGLKTIPSEILALKELEEVHLENNQIAEIPQGIQQLQNTKVLYLHNNSLQDLCPELGALSSLESLDLSGNPLVISSLHVVSRLRTLRELRLYRTGLTEIPTGICKSLHHLELFGLSENFLESLPEEIVNQTKLREIYLKQNHFEVFPCDLCVLYNLEVIDLDENKLKSIPGDIGHLVRLQKFYVASNHLMSLPESLSQCSKLSVLDLTHNSIHSLPSSLELLTELTEVGLSGN-RLEKVPRLLCSWVSLHLLYLRNTSLHGLRDSFKRLINLRFLDLSQNHIEHFPVQICALKNLEILALDDNKVRQLPPSISLLSNLKILGLTGNDLLSFPEEIFSLISLEKLYIGQDQGSKLSSLPENIKRLMNLKELYIENNRLEQLPASLGLMPNLEVLDCRHNLLKQLPDAICRTRNLRELLLEDNLLCCLPEN----LDHLVNLKV 492          

HSP 3 Score: 87.0409 bits (214), Expect = 5.671e-17
Identity = 102/385 (26.49%), Postives = 174/385 (45.19%), Query Frame = 3
Query:   63 IFKTLTKEEIDNINEDFFEKEKINILNCSYSKVKKIGKLCNCKDLEGLIVNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPG---XXXXXXXXXXXXDQ-CNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFP 1205
            I K+L   E+  ++E+F E     I+N   +K+++I             +  N     P  +  L +L  ++L  N + ++      L  L    +A+NHL  L E +   SKL   +++ N  ++LP +L  L+EL     S N L  VP+ + S   L  L L +  L  L ++ K                        L+NL  L++  N +++  + I  LK L +L L  N   ++P +I  LS+LK L L GN  + + P    S++ +    +  DQ    SSL ++     NL+ L I NN + QLP       +L VL   +N + ++P+     + L+ L L +N L  LP  ++++ +L+ + L NN   + P
Sbjct:  158 ICKSLHHLELFGLSENFLESLPEEIVN--QTKLREI------------YLKQNHFEVFPCDLCVLYNLEVIDLDENKLKSIPGDIGHLVRLQKFYVASNHLMSLPESLSQCSKLSVLDLTHNSIHSLPSSLELLTELTEVGLSGNRLEKVPRLLCSWVSLHLLYLRNTSLHGLRDSFK-----------------------RLINLRFLDLSQNHIEHFPVQICALKNLEILALDDNKVRQLPPSISLLSNLKILGLTGND-LLSFPEEIFSLISLEKLYIGQDQGSKLSSLPENIKRLMNLKELYIENNRLEQLPASLGLMPNLEVLDCRHNLLKQLPDAICRTRNLRELLLEDNLLCCLPENLDHLVNLKVLTLMNNPMVDPP 504          

HSP 4 Score: 66.6254 bits (161), Expect = 1.214e-10
Identity = 88/345 (25.51%), Postives = 146/345 (42.32%), Query Frame = 3
Query:  129 INILNCSYSKVKKI-GKLCNCKDLEGLIVNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHL--------------------TVLSELIGNFSKL---QFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLE---IXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGS 1082
            + +++   +K+K I G + +   L+   V  N +  +P +++Q   L+ L+L+HN I +L ++   L  L  + L+ N L                    T L  L  +F +L   +F ++S N     P  +C+L  L       N +  +P  I  L  L  L L  NDL   PE I  L +LE   I Q   + L++L   +  L+NL EL I NN L+ L   +G +  L VL+   N   ++P  I    +L+ L L  N                           L ++  +  NL++L + NN +   PI   N  + A+  W + K N I ++  +
Sbjct:  211 LEVIDLDENKLKSIPGDIGHLVRLQKFYVASNHLMSLPESLSQCSKLSVLDLTHNSIHSLPSSLELLTELTEVGLSGNRLEKVPRLLCSWVSLHLLYLRNTSLHGLRDSFKRLINLRFLDLSQNHIEHFPVQICALKNLEILALDDNKVRQLPPSISLLSNLKILGLTGNDLLSFPEEIFSLISLEKLYIGQDQGSKLSSLPENIKRLMNLKELYIENNRLEQLPASLGLMPNLEVLDCRHNLLKQLPDAICRTRNLRELLLEDNL-----------------------LCCLPENLDHLVNLKVLTLMNNPMVDPPIYVCNQGNEAI--WKHLKENRIRKMMAT 530          
BLAST of SMED30019284 vs. UniProt/SwissProt
Match: sp|A4D1F6|LRRD1_HUMAN (Leucine-rich repeat and death domain-containing protein 1 OS=Homo sapiens OX=9606 GN=LRRD1 PE=2 SV=2)

HSP 1 Score: 228.794 bits (582), Expect = 6.816e-61
Identity = 201/658 (30.55%), Postives = 332/658 (50.46%), Query Frame = 3
Query:  195 LEGLIVNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXX-XXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFP---WLPESIIDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDIESSFVLEFQDRLESLDLSNNAISALPATAFTKFSKLRYLNLQGNPCKIPPSDVFNCGQMIPICSYLTAYNEFDATILDRIMPIISNKFPISRTRHLFRKLRIPESVIIELESTYRGKYNQKLLLSKGLEAWRKY-----LVDKATTDSLIRCFFLI 2141
            LE L +  N ++ +P  I  L +L  LN+SHN+I+++      L N+  L   NN++      +     L+  ++  NK   +P+TL SL  L   +  +N L   PK +  L +L +L L  N +S LP+ I+EL+NLE L + +N LT L   +F+L+ + EL + +N L+ +S  I   ++L +L L  N    IP  I   + L+ L+L  N K+T LP  I  + +L +L +++ N   ++D   + NN+  L+ S N IT +PI+ KNC  +  ++ S NKI   P    +L  L  L ++ N +  +PV + + + L  + LS N+   F E    +  L  +++  N I+ IP SI ++  L    L  NK ++FP      E++   DLS+N ++ I  + +  L  I+ LN S+         +  L SL+     Q +G+KLT + G LS +  LKE+++SNN +  IP  I +++NL S+    N+I  +  S +L   D L+ L+LS N ++ALP+  +  FS L+ +N   NP   PP ++    Q+  I  YL   +E D  IL++I  I++N    +    L +KL +  S   E +   +   +      + L  W+       L   A  D LIR   +I
Sbjct:  190 LEILSLQENGLSSLPSEIQLLHNLRILNVSHNHISHIPKEISQLGNIRQLFFYNNYIENFPSDLECLGNLEILSLGKNKLRHIPDTLPSLKTLRVLNLEYNQLTTFPKALCFLPKLISLDLTGNLISSLPKEIRELKNLETLLMDHNKLTFLAVEIFQLLKIKELQLADNKLEVISHKIENFRELRILILDKNLLKNIPEKISCCAMLECLSLSDN-KLTELPKYIHKLNNLRKLHVNRNNMVKITDCISHLNNICSLEFSGNIITDVPIEIKNCQKIIKIELSYNKIMYFPLGLCALDSLYYLSVNGNYISEIPVDISFSKQLLHLELSENKLLIFSEHFCSLINLKYLDLGKNQIKKIPASISNMISLHVLILCCNKFETFPRELCTLENLQVLDLSENQLQKISSD-ICNLKGIQKLNFSSNQFIHFPIELCQLQSLEQLNISQIKGRKLTRLPGELSNMTQLKELDISNNAIREIPRNIGELRNLVSLHAYNNQISYLPPS-LLSLND-LQQLNLSGNNLTALPSAIYNIFS-LKEINFDDNPLLRPPVEICKGKQLYTIARYLQRADERDEKILEKIFKIVANNITETNFEFLCQKLNLANS---ETDMPTKSTVSLSERAHQALVIWKTQSNKLSLTAAALRDQLIRALTMI 839          

HSP 2 Score: 145.591 bits (366), Expect = 4.152e-34
Identity = 143/540 (26.48%), Postives = 251/540 (46.48%), Query Frame = 3
Query:   72 TLTKEEIDNINEDFFEKEKINILNCSYSKVKKIGK-LCNCKDLEGLIVNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETL--CSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLP-GXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSI---EITANDIETIPESIMSLTRLQTFNLSGNKIQSFP---WLPESIIDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSIS 1661
            +L K ++ +I +     + + +LN  Y+++    K LC    L  L + GN I+ +P  I +LK+L  L + HN +T L    F L  +  L LA+N L V+S  I NF +L+   +  N    +PE +  C++ E LS   S N L  +PK I  L  L  L +N N++  + + I  L                        N+  L    N +  + ++I   +K+I + LS+N  +  P  +  L SL YL++ GN  I+ +P        L  L + +      S+ F    NL+ LD+  N I ++P    N +SL VL    NK    P    +L+ LQ+LDLS N+L  +   +  ++ ++K+N S+N+F +FP  L ++ +L  +   +I    +  +P  + ++T+L+  ++S N I+  P       +++     +N +  +P + ++ LN ++ LN+S                          G  LT +   +  + +LKEIN  +N L+  P +I + K L +I+
Sbjct:  263 SLGKNKLRHIPDTLPSLKTLRVLNLEYNQLTTFPKALCFLPKLISLDLTGNLISSLPKEIRELKNLETLLMDHNKLTFLAVEIFQLLKIKELQLADNKLEVISHKIENFRELRILILDKNLLKNIPEKISCCAMLECLSL--SDNKLTELPKYIHKLNNLRKLHVNRNNMVKITDCISHLN-----------------------NICSLEFSGNIITDVPIEIKNCQKIIKIELSYNKIMYFPLGLCALDSLYYLSVNGNY-ISEIPVDISFSKQLLHLELSENKLLIFSEHFCSLINLKYLDLGKNQIKKIPASISNMISLHVLILCCNKFETFPRELCTLENLQVLDLSENQLQKISSDICNLKGIQKLNFSSNQFIHFPIELCQLQSLEQLNISQIKGRKLTRLPGELSNMTQLKELDISNNAIREIPRNIGELRNLVSLHAYNNQISYLPPSLLS-LNDLQQLNLS--------------------------GNNLTALPSAIYNIFSLKEINFDDNPLLRPPVEICKGKQLYTIA 749          

HSP 3 Score: 108.612 bits (270), Expect = 1.496e-22
Identity = 103/379 (27.18%), Postives = 183/379 (48.28%), Query Frame = 3
Query:  753 VLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXX--XXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNK-----IQSFPWLPESIIDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDIESSFVLEFQDRLESLDLSNNAISALPATAFTKFSKLRYLNLQGNPCKIPPSDVFNCGQMI 1868
             +NL      E P +I ++  +KYL L  N +I    G+     + L  L + +   SSL  +    +NLRIL++S+NHI+ +P +     ++  L + NN I   P     L  L+IL L  N+L  +P  +  +++LR +NL  N+   FP+ L  +P L S+++T N I ++P+ I  L  L+T  +  NK     ++ F  L   I +  L+DN +E I      K+     L I   + + +  I   ++   + +       KLTE+   + +LNNL++++++ N ++ I + I  + N+ S+   GN I D+     ++   ++  ++LS N I   P         L YL++ GN     P D+    Q++
Sbjct:  145 TVNLEAKGLQEFPKDILKIKYVKYLYLDKN-QIKTFQGADSGDLLGLEILSLQENGLSSLPSEIQLLHNLRILNVSHNHISHIPKEISQLGNIRQLFFYNNYIENFPSDLECLGNLEILSLGKNKLRHIPDTLPSLKTLRVLNLEYNQLTTFPKALCFLPKLISLDLTGNLISSLPKEIRELKNLETLLMDHNKLTFLAVEIFQLL--KIKELQLADNKLEVISH----KIENFRELRILILDKNLLKNIPEKISCCAMLECLSLSDNKLTELPKYIHKLNNLRKLHVNRNNMVKITDCISHLNNICSLEFSGNIITDV--PIEIKNCQKIIKIELSYNKIMYFPL-GLCALDSLYYLSVNGNYISEIPVDISFSKQLL 513          
BLAST of SMED30019284 vs. UniProt/SwissProt
Match: sp|Q4R6F0|LRRD1_MACFA (Leucine-rich repeat and death domain-containing protein 1 OS=Macaca fascicularis OX=9541 GN=LRRD1 PE=2 SV=1)

HSP 1 Score: 225.713 bits (574), Expect = 8.669e-60
Identity = 200/658 (30.40%), Postives = 328/658 (49.85%), Query Frame = 3
Query:  195 LEGLIVNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLP-GXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFP---WLPESIIDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDIESSFVLEFQDRLESLDLSNNAISALPATAFTKFSKLRYLNLQGNPCKIPPSDVFNCGQMIPICSYLTAYNEFDATILDRIMPIISNKFPISRTRHLFRKLRIPESVIIELESTYRGKYNQKLLLSKGLEAWRKY-----LVDKATTDSLIRCFFLI 2141
            LE L +  N ++ +P  I  L +L  LN+SHN+I+++      L N+  L   NN++      +     L+  ++  NK   +P+TL SL  L   +  +N L   PK +  L +L +L L  N +S LP+ I+EL+NLE L L +N LT L   +F+L+ + EL + +N L+ +S  I   ++L +L L  N    IP  I   + L+ L L  N K+T LP     L +L +L +++ N   ++D   + NN+  L+ S N I  +PI+ KNC  +  ++ + NKI   P    +L  L  L ++ N +  +P  + + + L  + LS N+   F E    +  L  +++  N I+ IP SI ++  L    L  NK ++FP      E++   DLS+N ++ I  + +  L  I+ LN S+         +  L SL+     Q +G+KLT + G LS +  LKE+++SNN +  IP  I +++NL S+    N+I  I  S +L   D L+ L+LS N ++ALP+  +  FS L+ +N   NP   PP ++    Q+  I  YL   +E D  IL++I  I++N    +    L +KL +  S   E +   +   +      + L  W+       L   A  D LIR   +I
Sbjct:  193 LEILSLQENGLSSLPSEIQLLHNLRILNVSHNHISHIPKEISQLGNIRQLFFYNNYIENFPSDLECLGNLEILSLGKNKLRHIPDTLPSLKYLRVLNLEYNQLTIFPKALCFLPKLISLDLTGNLISSLPKEIRELKNLETLLLDHNKLTFLAVEIFQLLKIKELQLADNKLEVISHKIENFRELRILILDKNLLKNIPEKICCCAMLECLTLSDN-KLTELPKNIHKLNNLRKLHVNRNNMVKITDSISHLNNICSLEFSGNIIAGIPIEIKNCQKIIKIELNYNKIMYFPLGLCALDSLYYLSVNGNYISEIPADISFSKQLLHLELSENKLLIFSEHFCSLINLKYLDLGKNQIKKIPASISNMISLHVLILCCNKFETFPRELCTLENLRVLDLSENQLQKISSD-ICNLKRIQKLNFSSNQFIHFPIELCQLQSLEQLNISQIKGRKLTRLPGELSNMTQLKELDISNNAIREIPRNIGELRNLVSLHAYNNQISYIPPS-LLSLND-LQQLNLSGNNLTALPSAIYNLFS-LKEINFDDNPLLRPPMEICKGKQLYTIARYLQRADERDEKILEKIFKIVANNITETNFEFLCQKLNLANS---ETDMPTKSTVSLSERAHQALVIWKTQSNKLSLTAAALRDQLIRALTMI 842          

HSP 2 Score: 149.443 bits (376), Expect = 2.460e-35
Identity = 143/538 (26.58%), Postives = 250/538 (46.47%), Query Frame = 3
Query:   72 TLTKEEIDNINEDFFEKEKINILNCSYSKVKKIGK-LCNCKDLEGLIVNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXX-XXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSI---EITANDIETIPESIMSLTRLQTFNLSGNKIQSFP---WLPESIIDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSIS 1661
            +L K ++ +I +     + + +LN  Y+++    K LC    L  L + GN I+ +P  I +LK+L  L L HN +T L    F L  +  L LA+N L V+S  I NF +L+   +  N    +PE +C  + L     S N L  +PK I  L  L  L +N N++  + ++I  L                        N+  L    N +  + ++I   +K+I + L++N  +  P  +  L SL YL++ GN  I+ +P  I     L  L + +      S+ F    NL+ LD+  N I ++P    N +SL VL    NK    P    +L+ L++LDLS N+L  +   +  ++ ++K+N S+N+F +FP  L ++ +L  +   +I    +  +P  + ++T+L+  ++S N I+  P       +++     +N +  IP + ++ LN ++ LN+S                          G  LT +   +  L +LKEIN  +N L+  P +I + K L +I+
Sbjct:  266 SLGKNKLRHIPDTLPSLKYLRVLNLEYNQLTIFPKALCFLPKLISLDLTGNLISSLPKEIRELKNLETLLLDHNKLTFLAVEIFQLLKIKELQLADNKLEVISHKIENFRELRILILDKNLLKNIPEKICCCAMLECLTLSDNKLTELPKNIHKLNNLRKLHVNRNNMVKITDSISHLN-----------------------NICSLEFSGNIIAGIPIEIKNCQKIIKIELNYNKIMYFPLGLCALDSLYYLSVNGNY-ISEIPADISFSKQLLHLELSENKLLIFSEHFCSLINLKYLDLGKNQIKKIPASISNMISLHVLILCCNKFETFPRELCTLENLRVLDLSENQLQKISSDICNLKRIQKLNFSSNQFIHFPIELCQLQSLEQLNISQIKGRKLTRLPGELSNMTQLKELDISNNAIREIPRNIGELRNLVSLHAYNNQISYIPPSLLS-LNDLQQLNLS--------------------------GNNLTALPSAIYNLFSLKEINFDDNPLLRPPMEICKGKQLYTIA 752          

HSP 3 Score: 102.834 bits (255), Expect = 9.986e-21
Identity = 103/379 (27.18%), Postives = 182/379 (48.02%), Query Frame = 3
Query:  753 VLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXX--XXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNK-----IQSFPWLPESIIDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDIESSFVLEFQDRLESLDLSNNAISALPATAFTKFSKLRYLNLQGNPCKIPPSDVFNCGQMI 1868
             +NL      E P +I ++  +K+L L  N +I    G+    L+ L  L + +   SSL  +    +NLRIL++S+NHI+ +P +     ++  L + NN I   P     L  L+IL L  N+L  +P  +  ++ LR +NL  N+   FP+ L  +P L S+++T N I ++P+ I  L  L+T  L  NK     ++ F  L   I +  L+DN +E I      K+     L I   + + +  I   +    + +       KLTE+   + +LNNL++++++ N ++ I + I  + N+ S+   GN I  I     ++   ++  ++L+ N I   P         L YL++ GN     P+D+    Q++
Sbjct:  148 TVNLEAKGLQEFPKDILKIKYVKHLYLDKN-QIKTFQGADSGDLLGLEILSLQENGLSSLPSEIQLLHNLRILNVSHNHISHIPKEISQLGNIRQLFFYNNYIENFPSDLECLGNLEILSLGKNKLRHIPDTLPSLKYLRVLNLEYNQLTIFPKALCFLPKLISLDLTGNLISSLPKEIRELKNLETLLLDHNKLTFLAVEIFQLL--KIKELQLADNKLEVISH----KIENFRELRILILDKNLLKNIPEKICCCAMLECLTLSDNKLTELPKNIHKLNNLRKLHVNRNNMVKITDSISHLNNICSLEFSGNIIAGI--PIEIKNCQKIIKIELNYNKIMYFP-LGLCALDSLYYLSVNGNYISEIPADISFSKQLL 516          
BLAST of SMED30019284 vs. UniProt/SwissProt
Match: sp|Q8C0R9|LRRD1_MOUSE (Leucine-rich repeat and death domain-containing protein 1 OS=Mus musculus OX=10090 GN=Lrrd1 PE=2 SV=2)

HSP 1 Score: 177.178 bits (448), Expect = 4.200e-44
Identity = 172/628 (27.39%), Postives = 296/628 (47.13%), Query Frame = 3
Query:  129 INILNCSYSKVKKIGK-LCNCKDLEGLIVNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLP-GXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFPWLPESIIDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDIESSFVLEFQDRLESLDLSNNAISALPATAFTKFSKLRYLNLQGNPCKIPPSDVFNCGQMIPICSYLTAYNEFDATILDRIMPIISNKFPISRTRHLFRKLRIPESV 2006
            + ILN SY+++ +I K L   +++  L++N N I  +P  +  L+ L  L+L  N +T +  +   L+NL  L+L  N LT+ S+ +    KL   N++GN   +LP+ +  L  L S    HN L F+   I  L ++  L L  N L  +   I+  + L +L L  N L ++   +   VNL  L++ +N+++ L   I KLK L  L+++ N  I +   I  LS++  L   GN +IT++P        ++ + ++  N            +L  L  + N+I+++P+D      L  L+ + NK+    +   SL  L+ LDL+ N++ ++P  +  M SL  + LS+N+F +FP+ L  +  L  ++I+ N ++ IP  I  L R+Q  NLS N   +F               PVE      + +L  +E LNIS T+   +  +   ++ +   K        + +I   + +L +L     SNN + S+P   L ++ L S+ LRGN +                         +ALP+  + K S L+ +N   NP   PP ++    +M  I  YL   +E D  IL++I  I++N    +    L +KL +  S 
Sbjct:  207 LKILNASYNEISQIPKELLQLENMRQLLLNSNHIDTLPSGLEHLRYLETLSLGKNMLTYIPDSLSSLKNLRILNLEYNQLTIFSKSLCFLPKLNSLNLTGNMIGSLPKEVRELKNLESLLMDHNKLTFLAVEIFQLPKIKELHLADNKLEAISPKIENFKELRLLNLDKNLLQSIPKKISHCVNLESLSLSDNNIEELPKKIRKLKNLRQLHVNRNKMITMTEEISHLSNIHILEFSGN-QITHVPIEIKNCRKITRVELNYNNIMYFPVGLCALQSLDYLSFNGNYISEIPVDMSFSKQLLHLELNRNKLTVFSKHLCSLTNLEYLDLAKNQIMTIPSCISAMVSLHVLILSDNKFESFPKELCSLKNLRVLDISENKLQKIPLEISKLKRIQKLNLSNNIFTNF---------------PVE------LCQLQTLEELNISQTSGKKLTRLPEEVSHMTQLKILNISNNAIKDIPKNIGELRSLVSFYASNNQISSLPSSFLSLEVLQSLDLRGNNM-------------------------TALPSGIY-KLSSLKEINFDDNPLMRPPMEICKGKEMHMITCYLQRADERDEKILEKIFNIVANSITETNFEFLQQKLNMASSA 786          
BLAST of SMED30019284 vs. UniProt/SwissProt
Match: sp|Q5F4C4|SHOC2_CHICK (Leucine-rich repeat protein SHOC-2 OS=Gallus gallus OX=9031 GN=SHOC2 PE=2 SV=1)

HSP 1 Score: 159.073 bits (401), Expect = 1.025e-39
Identity = 132/424 (31.13%), Postives = 218/424 (51.42%), Query Frame = 3
Query:   27 LKYFNASTNEDKIFKTLTKEEIDNINEDFFEKEKINILNCSYSKVKKIGKLCNC-KDLEGLIVNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMD-IGKLKKLIVLNLSFNNFIEIP-SNIGELSSLKYLNLRGNSKITNLP-GXXXXXXXXXXXXDQCN-FSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESI 1283
            +K  N    E+ +   L K  I  +     E  ++  L    +K++ +     C  +L  L ++ N +T +P +++ LK L  L+L HN +  + +  + L +L  L L  N +T + + I   SKL   +I  NK   LP  +  L  L++ D +HN L  +P+ IGS  Q+T L L HN+L DLPETI  L +L  L L  N L+ +   + +   L ELN+ NN++  L    +  L KL  L L+ N F   P     + S++  LN+  N +I  +P G      +   L  + N  +SL  DFG + ++  L+++ N +T++P D    +SL VL  SNN + ++P   G+L+KL+ LDL  N+L+SLP  + Y++ L+K+ L+NN+    P  +  +  L  + +  N +  +PE I
Sbjct:   91 IKELNKCREENSMRLDLAKRSIHMLPSAVKELTQLTELYLYSNKLQSLPAEVGCLVNLVTLALSENSLTSLPDSLDNLKKLRMLDLRHNKLREIPSVVYRLTSLATLYLRFNRITTVEKDIKTLSKLTMLSIRENKIKQLPAEIGELCNLITLDVAHNQLEHLPEEIGSCTQITNLDLQHNELLDLPETIGNLSSLSRLGLRYNRLSAIPKSLAKCSELDELNLENNNISTLPEGLLSSLVKLTSLTLARNCFQSYPVGGPSQFSTIYSLNMEHN-RINKIPFGIFSRAKVLSKLNMKDNQLTSLPLDFGTWTSMVELNLATNQLTKIPEDVSGLVSLEVLILSNNLLKKLPHGIGNLRKLRELDLEENKLESLPNEIAYLKDLQKLVLTNNQLTTLPRGIGHLTNLTHLGLGENLLTHLPEEI 513          

HSP 2 Score: 117.472 bits (293), Expect = 6.094e-26
Identity = 121/455 (26.59%), Postives = 191/455 (41.98%), Query Frame = 3
Query:  456 CSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMS-LTRLQTFNLSGNKIQSFPW---------------------LPESIID-------FDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIF--------KYDQDRG--KKLTEID----------GRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGN 1673
            C     +  D +   ++ +P  +  L QLT L L  N L  LP                         V  LVNL+ L +  N L  L   +  LKKL +L+L  N   EIPS +  L+SL  L LR N                         +++  D    + L +L I  N I QLP +     +L  L  ++N++  +PE  GS  ++  LDL +NEL  LP  +  + SL ++ L  NR +  P+ L K   L+ + +  N+I T+PE ++S L +L +  L+ N  QS+P                      +P  I          ++ DN + S+P +F    + +E LN++      I E V  L SL++         K     G  +KL E+D            ++ L +L+++ L+NN L ++P  I  + NLT + L  N
Sbjct:   97 CREENSMRLDLAKRSIHMLPSAVKELTQLTELYLYSNKLQSLPAE-----------------------VGCLVNLVTLALSENSLTSLPDSLDNLKKLRMLDLRHNKLREIPSVVYRLTSLATLYLRFN-----------------------RITTVEKDIKTLSKLTMLSIRENKIKQLPAEIGELCNLITLDVAHNQLEHLPEEIGSCTQITNLDLQHNELLDLPETIGNLSSLSRLGLRYNRLSAIPKSLAKCSELDELNLENNNISTLPEGLLSSLVKLTSLTLARNCFQSYPVGGPSQFSTIYSLNMEHNRINKIPFGIFSRAKVLSKLNMKDNQLTSLPLDFGTWTSMVE-LNLATNQLTKIPEDVSGLVSLEVLILSNNLLKKLPHGIGNLRKLRELDLEENKLESLPNEIAYLKDLQKLVLTNNQLTTLPRGIGHLTNLTHLGLGEN 504          

HSP 3 Score: 116.701 bits (291), Expect = 1.134e-25
Identity = 108/374 (28.88%), Postives = 179/374 (47.86%), Query Frame = 3
Query:  234 IPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPG---XXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPID-FKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFP 1343
            +P A+ +L  LT L L  N + +L      L NL+ L L+ N LT L + + N  KL+  ++  NK   +P  +  L+ L +     N +  V K I +L +LT L +  N +  LP  I EL NL  L + +N L +L   +     +  L++ +N+L  L   IG L  L  L L +N    IP ++ + S L  LNL  N+ I+ LP    S L+   S  L   C  S        ++ +  L++ +N I ++P   F     L+ L   +N++  +P  FG+   +  L+L+ N+L  +P  +  + SL  + LSNN     P  +  +  L  +++  N +E++P  I  L  LQ   L+ N++ + P
Sbjct:  115 LPSAVKELTQLTELYLYSNKLQSLPAEVGCLVNLVTLALSENSLTSLPDSLDNLKKLRMLDLRHNKLREIPSVVYRLTSLATLYLRFNRITTVEKDIKTLSKLTMLSIRENKIKQLPAEIGELCNLITLDVAHNQLEHLPEEIGSCTQITNLDLQHNELLDLPETIGNLSSLSRLGLRYNRLSAIPKSLAKCSELDELNLENNN-ISTLPEGLLSSLVKLTSLTLARNCFQSYPVGGPSQFSTIYSLNMEHNRINKIPFGIFSRAKVLSKLNMKDNQLTSLPLDFGTWTSMVELNLATNQLTKIPEDVSGLVSLEVLILSNNLLKKLPHGIGNLRKLRELDLEENKLESLPNEIAYLKDLQKLVLTNNQLTTLP 487          

HSP 4 Score: 98.5969 bits (244), Expect = 8.540e-20
Identity = 85/311 (27.33%), Postives = 158/311 (50.80%), Query Frame = 3
Query:  948 NNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFPW-LPE--SIIDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQIL-QMKNLTSISLRGNKIKDIESSFVLEFQDRLESLDLSNNAISALPATAFTKFSKLRYLNLQGNPCKIPPSDVFNCGQMI 1868
            N++R LD++   I  LP   K    L  L   +NK+  +P   G L  L  L LS N L SLP  ++ ++ LR ++L +N+    P ++ ++ +L ++ +  N I T+ + I +L++L   ++  NKI+  P  + E  ++I  D++ N +E +P+  +     I NL++ +     + E + +L+SL       +R   L+ I   L++ + L E+NL NN + ++PE +L  +  LTS++L  N  +        +F   + SL++ +N I+ +P   F++   L  LN++ N     P D      M+
Sbjct:  101 NSMR-LDLAKRSIHMLPSAVKELTQLTELYLYSNKLQSLPAEVGCLVNLVTLALSENSLTSLPDSLDNLKKLRMLDLRHNKLREIPSVVYRLTSLATLYLRFNRITTVEKDIKTLSKLTMLSIRENKIKQLPAEIGELCNLITLDVAHNQLEHLPEE-IGSCTQITNLDLQHNELLDLPETIGNLSSLSRLGLRYNR---LSAIPKSLAKCSELDELNLENNNISTLPEGLLSSLVKLTSLTLARNCFQSYPVGGPSQFST-IYSLNMEHNRINKIPFGIFSRAKVLSKLNMKDNQLTSLPLDFGTWTSMV 405          

HSP 5 Score: 77.7962 bits (190), Expect = 2.928e-13
Identity = 86/340 (25.29%), Postives = 152/340 (44.71%), Query Frame = 3
Query:  915 FSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFPWLP---ESIIDFDLSDNPVESIPQNFMAKLNYIENLNISNTN----SDGILEIVFSLNSLKIFK-----YDQDRGKKLTEID--------------GRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDIE---SSFVLEFQDRLESLDLSNNAISALPATAFTKFSKLRYLNLQGNPCKIPPSDV 1847
              SL  + G   NL  L +S N +T LP    N   L +L   +NK+ EIP V   L  L  L L  N + ++   ++ +  L  +++  N+    P  + ++  L ++++  N +E +PE I S T++   +L  N++   P       S+    L  N + +IP++ +AK + ++ LN+ N N     +G+L  +  L SL + +     Y      + + I               G  S+   L ++N+ +N L S+P       ++  ++L  N++  I    S  V      LE L LSNN +  LP        KLR L+L+ N  +  P+++
Sbjct:  135 LQSLPAEVGCLVNLVTLALSENSLTSLPDSLDNLKKLRMLDLRHNKLREIPSVVYRLTSLATLYLRFNRITTVEKDIKTLSKLTMLSIRENKIKQLPAEIGELCNLITLDVAHNQLEHLPEEIGSCTQITNLDLQHNELLDLPETIGNLSSLSRLGLRYNRLSAIPKS-LAKCSELDELNLENNNISTLPEGLLSSLVKLTSLTLARNCFQSYPVGGPSQFSTIYSLNMEHNRINKIPFGIFSRAKVLSKLNMKDNQLTSLPLDFGTWTSMVELNLATNQLTKIPEDVSGLV-----SLEVLILSNNLLKKLPH-GIGNLRKLRELDLEENKLESLPNEI 467          
BLAST of SMED30019284 vs. UniProt/SwissProt
Match: sp|Q8AVI4|SHOC2_XENLA (Leucine-rich repeat protein SHOC-2 OS=Xenopus laevis OX=8355 GN=shoc2 PE=2 SV=1)

HSP 1 Score: 155.606 bits (392), Expect = 3.073e-38
Identity = 139/475 (29.26%), Postives = 238/475 (50.11%), Query Frame = 3
Query:   60 KIFKTLTKEEIDNINEDFFEKEKINILNCSYSKVKKIGKL--------------CNCKDLEGLIVNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMD-IGKLKKLIVLNLSFNNFIEIP-SNIGELSSLKYLNLRGNSKITNLP-GXXXXXXXXXXXXDQCN-FSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNK-IQSFPW---LPESIIDFDLSDNPVESIPQNFMA 1418
            ++ K L+K   +N       K+ I++L  S   + +I +L               N  +L  L ++ N +T +P +++ LK L  L+L HN +  +    + L +L  L L  N +T + + +    KL   +I  NK   LP  +  L  L++ D +HN L  +PK IG+  Q+T L L HN+L DLP+TI  L +L  L L  N L+ +   + +   L ELN+ NN++  L    +  L K+  L L+ N F   P     + SS+  LN+  N +I  +P G      +   L  + N  +SL  DFG + ++  L+++ N +T++P D    +S+ VL  SNN + ++P   G+L+KL+ LDL  N+L+SLP  + Y++ L+K+ L+NN+    P  +  +  L  + +  N +  +PE I +L  L+   L+ N  + S P+   L   +    + + P+  +P   +A
Sbjct:   84 EVIKELSKCREENSTRLDLAKKSIHMLPVSIKDLTQITELYLYGNKLQSLPAEVGNLVNLVKLALSENSLTSLPDSLDNLKKLCMLDLRHNKLREIPPVVYRLSSLTTLFLRFNRITAVEKDLKMLPKLTMLSIRENKIKHLPAEIGELCNLITLDVAHNQLEHLPKEIGNCTQITNLDLQHNELLDLPDTIGNLSSLSRLGLRYNRLSAVPRSLSKCSELDELNLENNNISTLPEGLLSSLVKVNSLTLARNCFQSYPVGGPSQFSSIYSLNMEHN-RINKIPFGIFSRAKVLSKLNMKDNQLTSLPLDFGTWTSMVELNLATNQLTKIPEDVSGLVSIEVLILSNNLLKKLPHGIGNLRKLRELDLEENKLESLPNEIAYLKDLQKLVLTNNQLTTLPRGIGHLTNLTHLGLGENLLTHLPEEIGTLENLEELYLNDNPNLHSLPFELALCSKLSIMSIENCPLSHLPPQIVA 557          

HSP 2 Score: 116.701 bits (291), Expect = 1.426e-25
Identity = 117/452 (25.88%), Postives = 197/452 (43.58%), Query Frame = 3
Query:  480 FDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMS-LTRLQTFNLSGNKIQSFP-WLPE---SIIDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDIESSFVLEFQDRLESLDLSNNAISALPATAFTKFSKLRYLNLQGN 1820
             D +   ++ +P  I  L Q+T L L  N L  LP                         V  LVNL++L +  N L  L   +  LKKL +L+L  N   EIP  +  LSSL  L LR N                         +++  D      L +L I  N I  LP +     +L  L  ++N++  +P+  G+  ++  LDL +NEL  LP  +  + SL ++ L  NR +  P  L+K   L+ + +  N+I T+PE ++S L ++ +  L+ N  QS+P   P    SI   ++  N +  IP    ++   +  LN+ +     +     +  S+       +   +LT+I   +S L +++ + LSNN L  +P  I  ++ L  + L  NK++ + +     +   L+ L L+NN ++ LP       + L +L L  N
Sbjct:  100 LDLAKKSIHMLPVSIKDLTQITELYLYGNKLQSLPAE-----------------------VGNLVNLVKLALSENSLTSLPDSLDNLKKLCMLDLRHNKLREIPPVVYRLSSLTTLFLRFN-----------------------RITAVEKDLKMLPKLTMLSIRENKIKHLPAEIGELCNLITLDVAHNQLEHLPKEIGNCTQITNLDLQHNELLDLPDTIGNLSSLSRLGLRYNRLSAVPRSLSKCSELDELNLENNNISTLPEGLLSSLVKVNSLTLARNCFQSYPVGGPSQFSSIYSLNMEHNRINKIPFGIFSRAKVLSKLNMKDNQLTSLPLDFGTWTSMVELNLATN---QLTKIPEDVSGLVSIEVLILSNNLLKKLPHGIGNLRKLRELDLEENKLESLPNEIA--YLKDLQKLVLTNNQLTTLP-RGIGHLTNLTHLGLGEN 499          
BLAST of SMED30019284 vs. TrEMBL
Match: A0A267FJH2 (Death domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig006548g1 PE=4 SV=1)

HSP 1 Score: 292.738 bits (748), Expect = 2.242e-81
Identity = 206/699 (29.47%), Postives = 369/699 (52.79%), Query Frame = 3
Query:  159 VKKIGKLC--------------NCKDLEGLIVNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFPWL---PESIIDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDIESSFVLEFQDRLESLDLSNNAISALPATAFTKFSKLRYLNLQGNPCKIPPSDVFNCGQMIPICSYLTAYNEFDATILDRIMPIISNKFPISRTRHLFRKLRIPESVIIELESTYRGKYNQKLLLSKGLEAWRKYLVDKATTDSLIRCFFLINEKNLNAEFLYMKAIVNRIKL 2204
            +KK+G LC                K L+  + N N I   P +   L  LT L+LS N +  +  +    ++L +L+L +N +T + +   +F +L+  ++  N+   LPE       L S     N    +   + +L  L +L LN N L+ LP  +  L+ L+IL+L NN    +   +F+L +L+EL + +N +  +  +I KL +L +LNLSFNN  E+P+ IG LS LK LN  GN      P    L  L EL + + + +   ++F + +NLR+L++++N I  LP++F N   L++L  S+N +   PE+  +L  L++L L +N L  +   +  ++ L+++ L NN F  FP+ L ++ +L  + +T N +  +P+    L +L+     GN I+ FP +    + +   DL+ N +  +P++ +  L  +E+LN+SN N       V  + +L+  +  Q  GKKL +I   +  L+ L  ++LS+N L S+PE + ++ +L  + L+ N++K +  + V + +  L++L L NN I+ LP +      +       GNP K+PP+++   G++ PI +++  Y+E + +++ R++  I  +   +  RHLFRKL + E  +  +E+ ++GK   K  + +G  AW++     AT+  LIR   LI    ++AE    KA+ + I+L
Sbjct:   38 IKKLGFLCVSDNELHSISDFLEAAKGLKYFVANNNRIESFPKSSINLYQLTCLDLSFNRLREVPGSLESCKSLKFLNLCSNSITEIPDFCFSFRRLEVLSLGSNRIKCLPEIGSKNWTLKSLVLESNCFTELSGSVCNLVALQSLRLNGNSLTSLPRQLDSLEQLQILRLDNNKFEFIPCQIFDLESLVELGLSHNQISEVPEEIAKLARLDILNLSFNNIEELPNEIGYLSELKNLNAEGNPLQLIPPSLARLGCLLELNLGKADLTEFDENFCFCSNLRVLNLASNGILFLPLEFSNLKILSILDLSSNGLEIFPEIIATLPALEVLLLGDNRLTDVSDELGRLKRLKQLTLENNDFEEFPQSLCELESLQVLNLTGNRLANLPDDFKKLRQLRILQFPGNAIEEFPDVLCRMKQLEQLDLAGNRIAQLPED-LKHLTCLESLNLSNNNFSDFPTEVCVVPALRQLRLHQGSGKKLLQIHEDIGCLDLLTHLDLSDNELTSLPETLGRLTHLRDLLLQNNRLKVVPDA-VRQLKS-LKTLKLENNLIAYLPRSIEELGGQSVNFKADGNPSKVPPAEIVFGGEVKPIGAFVHKYDEREQSLVKRMIEAIQYRIDKADFRHLFRKLGVSEDRMTAIENEFKGKEKSKERIPQGFLAWQEEKAHLATSGELIRILHLIGLTKMSAELRSQKAVTDMIRL 733          

HSP 2 Score: 85.8853 bits (211), Expect = 4.040e-13
Identity = 86/328 (26.22%), Postives = 148/328 (45.12%), Query Frame = 3
Query:  924 LSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFPWLPESIIDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDIESSFVLEFQDRLESLDLSNNAISALPATAFTKFSKLRYLNLQGNPCKIPPSDVFNCGQMIPICSYLTAYNEFD 1907
            LSD+    N +  L++SN  + ++P+   +   L  L  S+N+++ I +   + K L+    +NN ++S P     +  L  ++LS NR    P  L    +L  + + +N I  IP+   S  RL+  +L  N+I+  P                E   +N+  K   +E+ N     S  +  +V +L SL++       G  LT +  +L  L  L+ + L NN    IP QI  +++L  + L  N+I ++          RL+ L+LS N I  LP       S+L+ LN +GNP ++ P  +   G ++ +        EFD
Sbjct:    8 LSDECYTSNGIVCLNLSNRGLKKIPVKAFDIKKLGFLCVSDNELHSISDFLEAAKGLKYFVANNNRIESFPKSSINLYQLTCLDLSFNRLREVPGSLESCKSLKFLNLCSNSITEIPDFCFSFRRLEVLSLGSNRIKCLP----------------EIGSKNWTLKSLVLES-NCFTELSGSVCNLV-ALQSLRL------NGNSLTSLPRQLDSLEQLQILRLDNNKFEFIPCQIFDLESLVELGLSHNQISEVPEEIA--KLARLDILNLSFNNIEELP-NEIGYLSELKNLNAEGNPLQLIPPSLARLGCLLELNLGKADLTEFD 308          
BLAST of SMED30019284 vs. TrEMBL
Match: A0A1I8ISL6 (Death domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000777g1 PE=4 SV=1)

HSP 1 Score: 291.967 bits (746), Expect = 4.342e-81
Identity = 207/699 (29.61%), Postives = 369/699 (52.79%), Query Frame = 3
Query:  159 VKKIGKLC--------------NCKDLEGLIVNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFPWL---PESIIDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDIESSFVLEFQDRLESLDLSNNAISALPATAFTKFSKLRYLNLQGNPCKIPPSDVFNCGQMIPICSYLTAYNEFDATILDRIMPIISNKFPISRTRHLFRKLRIPESVIIELESTYRGKYNQKLLLSKGLEAWRKYLVDKATTDSLIRCFFLINEKNLNAEFLYMKAIVNRIKL 2204
            +KK+G LC                K L+  + N N I   P +   L  LT L+LS N +  +  +    ++L +L+L +N +T + +   +F +L+  ++  N+   LPE       L S     N    +   + +L  L +L LN N L+ LP  +  L+ L+IL+L NN    +   +F+L +L+EL + +N +  +  +I KL +L +LNLSFNN  E+P+ IG LS LK LN  GN           L  L EL + + + +   ++F + +NLR+L++++N I  LP++F N   L++L  S+N +   PE+  +L  L++L L +N L  +   +  ++ L+++ L NN F  FP+ L ++ +L  + +T N +  +P+    L +L+   L GN I+ FP +    + +   DL+ N +  +P++ + +L  +E+LN+SN N       V  + +L+  +  Q  GKKL +I   +  L+ L  ++LS+N L S+PE + ++  L  + L+ N++K +  + V + +  L +L L NN I+ LP +      +    N +GNP K+PP+++   G++ PI +++  Y+E + +++ R++  I  +   +  RHLFRKL + E  +  +E  ++GK   K  + +G  AW++     AT+  LIR   LI    ++AE    KA+ + I+L
Sbjct:   38 IKKLGFLCVSDNELHSISDFLEAAKGLKYFVANNNRIESFPKSSINLYQLTCLDLSFNRLREVPGSLESCKSLKFLNLCSNSITEIPDFCFSFRRLEVLSLGSNRIKCLPEIGSKNWTLKSLVLESNCFTELSGSVCNLVALQSLRLNGNSLTSLPRQLDSLEQLQILRLDNNKFEFMPCQIFDLESLVELGLSHNQISEVPEEIAKLARLDILNLSFNNIEELPNEIGYLSELKNLNAEGNPLQLIPTSLARLGCLLELNLGKADLTEFDENFCFCSNLRVLNLASNGILFLPLEFSNLKILSILDLSSNGLEIFPEIIATLPALEVLLLGDNRLTDVSDELGRLKRLKQLTLENNDFEEFPQSLCELESLQVLNLTGNRLANLPDDFKKLRQLRILQLPGNAIEEFPDVLCRMKQLEQLDLAGNRIAQLPED-LKQLTCLESLNLSNNNFSDFPTEVCVVPALRQLRLHQGSGKKLLQIHEDIGCLDLLTHLDLSDNELTSLPETLGRLTQLRDLLLQNNRLKVVPDA-VRQLKS-LNTLKLENNLIAYLPRSIEELGGQSVNFNAEGNPSKVPPAEIVFGGEVKPIGAFVHKYDEREQSLVKRMIEAIQYRIDKADFRHLFRKLGVSEDRMTAIEKEFKGKEKSKERIPQGFLAWQEEKSHLATSGELIRILHLIGLTKMSAELRSQKAVTDMIRL 733          

HSP 2 Score: 82.4185 bits (202), Expect = 4.014e-12
Identity = 85/328 (25.91%), Postives = 147/328 (44.82%), Query Frame = 3
Query:  924 LSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFPWLPESIIDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDIESSFVLEFQDRLESLDLSNNAISALPATAFTKFSKLRYLNLQGNPCKIPPSDVFNCGQMIPICSYLTAYNEFD 1907
            LSD+    N    L++SN  + ++P    +   L  L  S+N+++ I +   + K L+    +NN ++S P     +  L  ++LS NR    P  L    +L  + + +N I  IP+   S  RL+  +L  N+I+  P                E   +N+  K   +E+ N     S  +  +V +L SL++       G  LT +  +L  L  L+ + L NN    +P QI  +++L  + L  N+I ++          RL+ L+LS N I  LP       S+L+ LN +GNP ++ P+ +   G ++ +        EFD
Sbjct:    8 LSDECYTSNGTVCLNLSNRGLKKIPAKAFDIKKLGFLCVSDNELHSISDFLEAAKGLKYFVANNNRIESFPKSSINLYQLTCLDLSFNRLREVPGSLESCKSLKFLNLCSNSITEIPDFCFSFRRLEVLSLGSNRIKCLP----------------EIGSKNWTLKSLVLES-NCFTELSGSVCNLV-ALQSLRL------NGNSLTSLPRQLDSLEQLQILRLDNNKFEFMPCQIFDLESLVELGLSHNQISEVPEEIA--KLARLDILNLSFNNIEELP-NEIGYLSELKNLNAEGNPLQLIPTSLARLGCLLELNLGKADLTEFD 308          
BLAST of SMED30019284 vs. TrEMBL
Match: A0A267EGN0 (Death domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000777g2 PE=4 SV=1)

HSP 1 Score: 291.967 bits (746), Expect = 4.517e-81
Identity = 207/699 (29.61%), Postives = 370/699 (52.93%), Query Frame = 3
Query:  159 VKKIGKLC--------------NCKDLEGLIVNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFPWL---PESIIDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDIESSFVLEFQDRLESLDLSNNAISALPATAFTKFSKLRYLNLQGNPCKIPPSDVFNCGQMIPICSYLTAYNEFDATILDRIMPIISNKFPISRTRHLFRKLRIPESVIIELESTYRGKYNQKLLLSKGLEAWRKYLVDKATTDSLIRCFFLINEKNLNAEFLYMKAIVNRIKL 2204
            +KK+G LC                K L+  + N N I   P +   L  LT L+LS N +  +  +    ++L +L+L +N +T + +   +F +L+  ++  N+   LPE       L S     N    +   + +L  L +L LN N L+ LP  +  L+ L+IL+L NN    +   +F+L +L+EL + +N +  +  +I KL +L +LNLSFNN  E+P+ IG LS LK LN  GN           L  L EL + + + +   ++F + +NLR+L++++N I  LP++F N   L++L  S+N +   PE+  +L  L++L L +N L  +   +  ++ L+++ L NN F  FP+ L ++ +L  + +T N +  +P+    L +L+   L GN I+ FP +    + +   DL+ N +  +P++ + +L  +E+LN+SN N       V  + +L+  +  Q  GKKL +I   +  L+ L  ++LS+N L S+PE + ++  L  + L+ N++K +  + V + +  L +L L NN I+ LP +      +    N +GNP K+PP+++   G++ PI +++  Y+E + +++ R++  I  +   +  RHLFRKL + E  +  +E+ ++GK   K  + +G  AW++     AT+  LIR   LI    ++AE    KA+ + I+L
Sbjct:   38 IKKLGFLCVSDNELHSISDFLEAAKGLKYFVANNNRIESFPKSSINLYQLTCLDLSFNRLREVPGSLESCKSLKFLNLCSNSITEIPDFCFSFRRLEVLSLGSNRIKCLPEIGSKNWTLKSLVLESNCFTELSGSVCNLVALQSLRLNGNSLTSLPRQLDSLEQLQILRLDNNKFEFMPCQIFDLESLVELGLSHNQINEVPEEIAKLARLDILNLSFNNIEELPNEIGYLSELKNLNAEGNPLQLIPTSLARLGCLLELNLGKADLTEFDENFCFCSNLRVLNLASNGILFLPLEFSNLKILSILDLSSNGLEIFPEIIATLPALEVLLLGDNRLTDVSDELGRLKRLKQLTLENNDFEEFPQSLCELESLQVLNLTGNRLANLPDDFKKLRQLRILQLPGNAIEEFPDVLCRMKQLEQLDLAGNRIAQLPED-LKQLTCLESLNLSNNNFSDFPTEVCVVPALRQLRLHQGSGKKLLQIHEDIGCLDLLTHLDLSDNELTSLPETLGRLTQLRDLLLQNNRLKVVPDA-VRQLKS-LNTLKLENNLIAYLPRSIEELGGQSVNFNAEGNPSKVPPAEIVFGGEVKPIGAFVHKYDEREQSLVKRMIEAIQYRIDKADFRHLFRKLGVSEDRMTAIENEFKGKEKSKERIPQGFLAWQEEKSHLATSGELIRILHLIGLTKMSAELRSQKAVTDMIRL 733          

HSP 2 Score: 82.4185 bits (202), Expect = 4.764e-12
Identity = 85/328 (25.91%), Postives = 147/328 (44.82%), Query Frame = 3
Query:  924 LSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFPWLPESIIDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDIESSFVLEFQDRLESLDLSNNAISALPATAFTKFSKLRYLNLQGNPCKIPPSDVFNCGQMIPICSYLTAYNEFD 1907
            LSD+    N    L++SN  + ++P    +   L  L  S+N+++ I +   + K L+    +NN ++S P     +  L  ++LS NR    P  L    +L  + + +N I  IP+   S  RL+  +L  N+I+  P                E   +N+  K   +E+ N     S  +  +V +L SL++       G  LT +  +L  L  L+ + L NN    +P QI  +++L  + L  N+I ++          RL+ L+LS N I  LP       S+L+ LN +GNP ++ P+ +   G ++ +        EFD
Sbjct:    8 LSDECYTSNGTVCLNLSNRGLKKIPAKAFDIKKLGFLCVSDNELHSISDFLEAAKGLKYFVANNNRIESFPKSSINLYQLTCLDLSFNRLREVPGSLESCKSLKFLNLCSNSITEIPDFCFSFRRLEVLSLGSNRIKCLP----------------EIGSKNWTLKSLVLES-NCFTELSGSVCNLV-ALQSLRL------NGNSLTSLPRQLDSLEQLQILRLDNNKFEFMPCQIFDLESLVELGLSHNQINEVPEEIA--KLARLDILNLSFNNIEELP-NEIGYLSELKNLNAEGNPLQLIPTSLARLGCLLELNLGKADLTEFD 308          
BLAST of SMED30019284 vs. TrEMBL
Match: A0A1I8INF0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 277.33 bits (708), Expect = 6.729e-76
Identity = 204/703 (29.02%), Postives = 369/703 (52.49%), Query Frame = 3
Query:  159 VKKIGKLC--------------NCKDLEGLIVNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFPWL---PESIIDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDIESSFVLEFQDRLESLDLSNNAISALPATAFTKFSKLRYLNLQGNPCKIPPSDVFNCGQMIPICSYLTAYNEFDATILDRIMPIISNKFPISRTRHLFRKLRIPESVIIELESTYRGKYNQKLLLSKGLEAWRKYLVDKATTDSLIR----CFFLINEKNLNAEFLYMKAIVNRIKL 2204
            +KK+G LC                K L+  + N N I   P +   L  LT L+LS N +  +  +    ++L +L+L +N +T + +   +F +L+  ++  N+   LPE       L S     N    +   + +L  L +L LN N L+ LP  +  L+ L+IL+L NN    +   +F+L +L+EL + +N +  +  +I KL +L +LNLSFNN  E+P+ IG LS LK LN  GN           L  L EL + + + +   ++F + +NLR+L++++N I  LP++F N   L++L  S+N +   PE+  +L  L++L L +N L  +   +  ++ L+++ L NN F  FP+ L ++ +L  + +T N +  +P+    L +L+   L GN I+ FP +    + +   DL+ N +  +P++ + +L  +E+LN+SN N       V  + +L+  +  Q  GKKL +I   +  L+ L  ++LS+N L S+PE + ++  L  + L+ N++K +  + V + +  L +L L NN I+ LP +      +    N +GNP K+PP+++   G++ PI +++  Y+E + +++ R++  I  +   +  RHLFRKL + E  +  +E+ ++GK   K  + +G  AW++   +K+   +  R       LI    ++AE    KA+ + I+L
Sbjct:   38 IKKLGFLCVSDNELHSISDFLEAAKGLKYFVANNNRIESFPKSSINLYQLTCLDLSFNRLREVPGSLESCKSLKFLNLCSNSITEIPDFCFSFRRLEVLSLGSNRIKCLPEIGSKNWTLKSLVLESNCFTELSGSVCNLVALQSLRLNGNSLTSLPRQLDSLEQLQILRLDNNKFEFMPCQIFDLESLVELGLSHNQINEVPEEIAKLARLDILNLSFNNIEELPNEIGYLSELKNLNAEGNPLQLIPTSLARLGCLLELNLGKADLTEFDENFCFCSNLRVLNLASNGILFLPLEFSNLKILSILDLSSNGLEIFPEIIATLPALEVLLLGDNRLTDVSDELGRLKRLKQLTLENNDFEEFPQSLCELESLQVLNLTGNRLANLPDDFKKLRQLRILQLPGNAIEEFPDVLCRMKQLEQLDLAGNRIAQLPED-LKQLTCLESLNLSNNNFSDFPTEVCVVPALRQLRLHQGSGKKLLQIHEDIGCLDLLTHLDLSDNELTSLPETLGRLTQLRDLLLQNNRLKVVPDA-VRQLKS-LNTLKLENNLIAYLPRSIEELGGQSVNFNAEGNPSKVPPAEIVFGGEVKPIGAFVHKYDEREQSLVKRMIEAIQYRIDKADFRHLFRKLGVSEDRMTAIENEFKGKEKSKERIPQGFLAWQE---EKSHFSNFRRINSNSAHLIGLTKMSAELRSQKAVTDMIRL 734          

HSP 2 Score: 82.4185 bits (202), Expect = 4.378e-12
Identity = 85/328 (25.91%), Postives = 147/328 (44.82%), Query Frame = 3
Query:  924 LSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFPWLPESIIDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDIESSFVLEFQDRLESLDLSNNAISALPATAFTKFSKLRYLNLQGNPCKIPPSDVFNCGQMIPICSYLTAYNEFD 1907
            LSD+    N    L++SN  + ++P    +   L  L  S+N+++ I +   + K L+    +NN ++S P     +  L  ++LS NR    P  L    +L  + + +N I  IP+   S  RL+  +L  N+I+  P                E   +N+  K   +E+ N     S  +  +V +L SL++       G  LT +  +L  L  L+ + L NN    +P QI  +++L  + L  N+I ++          RL+ L+LS N I  LP       S+L+ LN +GNP ++ P+ +   G ++ +        EFD
Sbjct:    8 LSDECYTSNGTVCLNLSNRGLKKIPAKAFDIKKLGFLCVSDNELHSISDFLEAAKGLKYFVANNNRIESFPKSSINLYQLTCLDLSFNRLREVPGSLESCKSLKFLNLCSNSITEIPDFCFSFRRLEVLSLGSNRIKCLP----------------EIGSKNWTLKSLVLES-NCFTELSGSVCNLV-ALQSLRL------NGNSLTSLPRQLDSLEQLQILRLDNNKFEFMPCQIFDLESLVELGLSHNQINEVPEEIAK--LARLDILNLSFNNIEELP-NEIGYLSELKNLNAEGNPLQLIPTSLARLGCLLELNLGKADLTEFD 308          
BLAST of SMED30019284 vs. TrEMBL
Match: A0A2T7PZ22 (Death domain-containing protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_01267 PE=4 SV=1)

HSP 1 Score: 275.018 bits (702), Expect = 7.667e-75
Identity = 206/697 (29.56%), Postives = 358/697 (51.36%), Query Frame = 3
Query:  195 LEGLIVNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHN-----------------------DLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCN-FSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFPWLPESIID---FDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDIESSFVLEFQDRLESLDLSNNAISALPATAFTKFSKLRYLNLQGNPCKIPPSDVFNCGQMIPICSYLTAYNEFDATILDRIMPIISNKFPISRTRHLFRKLRIPESVIIELESTYRGKYNQKLLLSKGLEAWRKYLVDKATTDSLIRCFFLINEKNLNAEFLYMKAIVNRIKL 2204
            L  L +  N+I EIP  I+ L++L  L LS N +T +  + F L NL  LDL+NN +  LS  +    KL+   I+GNK   +P ++  + EL     + N L+ +P  +G L+ L  L L  N                        ++ LP  ++ L +LE L L +N    +   VF L+NL EL +  N L  +  +IG LK+L +L L+ N    +P  I +L  LK L L+ N+ +  +P  I  +   + +    N  S + +   + +NL+IL +  N + +LP++F+N   L +L  S N+   +P  F +L++L+IL L  N L S+P  +  ++ ++ + L+NNRF +FP+ +  + +L +++++ N I +IP  I  LT L  FN+  N++  FP    S+I     D+SDN ++ +P+  +  +  +E+LN+SN +     +IV S+ SL+   + Q RG K+  +   + + +++  +N+S+N L ++P  +  M+ LT +    N+I  +  +    +  RL+ L L NN ++ LP   F +   LR L L  NP + PP DV   G + PI  ++    E +  ++ R+   +      +  R+L +KL+ P   I+ELE  Y GK      +   +  W++   +KAT+D LIR   ++  + L+ +   MK +  R++L
Sbjct:   68 LSCLFLGNNKINEIPDEISHLENLEMLILSENSLTTVNRSVFRLPNLQILDLSNNDIESLSSEVSGLHKLKQLVINGNKLREIPASIGFMKELRILGLNENRLHEIPDTLGQLENLEILGLERNCLEFFNPALCTIEGLKRLGLSGNQITSLPREVENLISLEQLLLDDNEFEFVPIQVFWLINLRELAMSGNHLTAIQAEIGLLKELRILGLNNNRLTVLPPEISQLKHLKILGLQ-NNLLEAMPADIAELFELQEVYAGSNKLSEIPEGLCWCSNLQILSLPKNSLERLPVEFENLKKLTMLILSENEFLYVPAAFCALEELEILHLDGNSLISIPEELGALKKMQHLTLNNNRFRDFPQAVCNMVSLVTLDLSNNVIISIPGEISQLTNLLFFNMKKNEVGVFPVELCSLIKLQMLDISDNMLKDLPEE-VGLMACLEDLNLSNNHFFEFPKIVCSIPSLQKLDFSQQRGTKVPSLPDEI-EFSSVWYLNVSHNTLRTLPRTLNAMRCLTDLIASHNEISSLPDTLC--YMKRLQVLHLDNNHLTTLPVD-FDQLKGLRDLRLHNNPLRTPPMDVCVSGVLQPIGCFIRRALEREDLLITRMFEAMKPALSKNELRYLMKKLKFPNEKIVELEQMYHGKDRLPDRVMAAMLFWKESYSEKATSDELIRVLHIVGYEQLSKQLWNMKIMSQRLRL 758          

HSP 2 Score: 128.257 bits (321), Expect = 2.738e-26
Identity = 128/457 (28.01%), Postives = 226/457 (49.45%), Query Frame = 3
Query:  483 DCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCN-FSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIP-EVF----------------------GSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFPWLPESIIDFD---LSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDIESSFVLEFQD--RLESLDLSNNAISALP 1766
            D S      +P+GI   + L+ L L +N ++++P+ I  L+NLE+L L  N+LT +   VF L NL  L++ NND++ LS ++  L KL  L ++ N   EIP++IG +  L+ L L  N ++  +P ++  +   E+L  + N     +        L+ L +S N IT LP + +N +SL  L   +N+   +P +VF                      G LK+L+IL L+NN L  LP  +  ++ L+ + L NN     P  + ++  L  +   +N +  IPE +   + LQ  +L  N ++  P   E++       LS+N    +P  F A    +E L I + + + ++ I   L +LK  ++      +  +    +  + +L  ++LSNN ++SIP +I Q+ NL   +++ N++      F +E     +L+ LD+S+N +  LP
Sbjct:   49 DLSGLQFTQIPEGIFDTQCLSCLFLGNNKINEIPDEISHLENLEMLILSENSLTTVNRSVFRLPNLQILDLSNNDIESLSSEVSGLHKLKQLVINGNKLREIPASIGFMKELRILGLNEN-RLHEIPDTLGQLENLEILGLERNCLEFFNPALCTIEGLKRLGLSGNQITSLPREVENLISLEQLLLDDNEFEFVPIQVFWLINLRELAMSGNHLTAIQAEIGLLKELRILGLNNNRLTVLPPEISQLKHLKILGLQNNLLEAMPADIAELFELQEVYAGSNKLSEIPEGLCWCSNLQILSLPKNSLERLPVEFENLKKLTMLILSENEFLYVPAAFCA----LEELEILHLDGNSLISIPEELGALKKMQHLTLNNNRFRDFPQAVCNMVSLVTLDLSNNVIISIPGEISQLTNLLFFNMKKNEV----GVFPVELCSLIKLQMLDISDNMLKDLP 496          

HSP 3 Score: 82.8037 bits (203), Expect = 3.795e-12
Identity = 83/321 (25.86%), Postives = 148/321 (46.11%), Query Frame = 3
Query:   72 TLTKEEIDNINEDFFEKEKINILNCSYSKVKKI-GKLCNCKDLEGLIVNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPE---TIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLS 1022
            +L K  ++ +  +F   +K+ +L  S ++   +    C  ++LE L ++GN +  IP  +  LK + +L L++N   +      ++ +L+ LDL+NN +  +   I   + L FFN+  N+    P  LCSL +L   D S N L  +P+ +G +  L  L L++N   + P+   +I  LQ L+  Q     + +L   + E  ++  LN+ +N L+ L   +  ++ L  L  S N    +P  +  +  L+ L+L  N+ +T LP                       DF     LR L + NN +   P+D   C+S
Sbjct:  348 SLPKNSLERLPVEFENLKKLTMLILSENEFLYVPAAFCALEELEILHLDGNSLISIPEELGALKKMQHLTLNNNRFRDFPQAVCNMVSLVTLDLSNNVIISIPGEISQLTNLLFFNMKKNEVGVFPVELCSLIKLQMLDISDNMLKDLPEEVGLMACLEDLNLSNNHFFEFPKIVCSIPSLQKLDFSQQRGTKVPSLPDEI-EFSSVWYLNVSHNTLRTLPRTLNAMRCLTDLIASHNEISSLPDTLCYMKRLQVLHL-DNNHLTTLPV----------------------DFDQLKGLRDLRLHNNPLRTPPMDV--CVS 642          
BLAST of SMED30019284 vs. Ensembl Cavefish
Match: shoc2 (SHOC2 leucine rich repeat scaffold protein [Source:NCBI gene;Acc:555476])

HSP 1 Score: 146.362 bits (368), Expect = 2.311e-36
Identity = 134/497 (26.96%), Postives = 228/497 (45.88%), Query Frame = 3
Query:   27 LKYFNASTNEDKIFKTLTKEEIDNINEDFFEKEKINILNCSYSKVKKIGKLCNCKDLEGLI---VNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFE------------------------LVNLLELNICNNDLQ-YLSMDIGKLKKLIVLNLSFNNFIEIPSNI-GELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNK-IQSFPW---LPESIIDFDLSDNPVESIPQNFMA 1418
            +K  +    E+     L+K  I  +     E  ++  L    +K++ +     C  L GL+   ++ N +T +P +++ LK L  L+L HN +  +    + + +L  L L  N +T + + I N +KL   +I  NK   LP  +  L  L++ D +HN L  +PK IG+  Q+T L L HN+L DLPETI  L ++  L L  N L+ +   + +                        LVNL  L +  N  Q Y      +   +  LN+  N   +IP  I      L  LN++ N                         +SL  DFG + ++  L+++ N +T++P D     SL VL  SNN + ++P   G+L+KL+ LDL  N+L+SLP  + Y++ L+K+ L+NN+    P  +  +  L  + +  N ++ +PE I +L  L+   L+ N  + S P+   L   +    + + P+  +P   +A
Sbjct:   43 IKELSKCREENSTRLDLSKRSIHLLPSSIKELTQLTELYLYSNKLQSLPPEVGC--LSGLVTLALSENSLTSLPDSLDNLKKLRMLDLRHNKLREIPAVVYRVTSLTTLYLRFNRITTVEKDIRNLAKLTMLSIRENKIKQLPAEIGELCNLITLDVAHNQLEHLPKEIGNCTQITNLDLQHNELLDLPETIGNLSSINRLGLRYNRLSAIPRSLAKCRELEELNLENNNISVLPEGLLSSLVNLTSLTLARNCFQSYPVGGPSQFSTIYSLNMEHNRINKIPFGIFSRAKVLSKLNMKDN-----------------------QLTSLPLDFGTWTSMVELNLATNQLTKIPEDICGLASLEVLILSNNLLKKLPHGIGNLRKLRELDLEENKLESLPNEIAYLKDLQKLVLTNNQLTTLPRGIGHLTNLTHLGLGENLLQHLPEEIGTLENLEELYLNDNPNLHSLPFELALCSKLSIMSIENCPLSHLPPQIVA 514          

HSP 2 Score: 103.219 bits (256), Expect = 2.782e-22
Identity = 122/471 (25.90%), Postives = 212/471 (45.01%), Query Frame = 3
Query:  660 VFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCN-FSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMS-LTRLQTFNLSGNKIQSFPW---------------------LPESIID-------FDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIF--------KYDQDRG--KKLTEID----------GRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDI-ESSFVLEFQDRLESLDLSNNA-ISALPATAFTKFSKLRYLNLQGNPCKIPPSDVFNCGQMIPICSYLTAYNEFDATI 1916
            + EL  L EL + +N LQ L  ++G L  L+ L LS N+   +P ++  L  L+ L+LR N K+  +P  +  ++    L  + N  +++  D      L +L I  N I QLP +     +L  L  ++N++  +P+  G+  ++  LDL +NEL  LP  +  + S+ ++ L  NR +  P  L K   L  + +  N+I  +PE ++S L  L +  L+ N  QS+P                      +P  I          ++ DN + S+P +F    + +E LN++      I E +  L SL++         K     G  +KL E+D            ++ L +L+++ L+NN L ++P  I  + NLT + L  N ++ + E    LE    LE L L++N  + +LP       SKL  ++++  P    P  +   G    I  +L     + A +
Sbjct:   71 IKELTQLTELYLYSNKLQSLPPEVGCLSGLVTLALSENSLTSLPDSLDNLKKLRMLDLRHN-KLREIPAVVYRVTSLTTLYLRFNRITTVEKDIRNLAKLTMLSIRENKIKQLPAEIGELCNLITLDVAHNQLEHLPKEIGNCTQITNLDLQHNELLDLPETIGNLSSINRLGLRYNRLSAIPRSLAKCRELEELNLENNNISVLPEGLLSSLVNLTSLTLARNCFQSYPVGGPSQFSTIYSLNMEHNRINKIPFGIFSRAKVLSKLNMKDNQLTSLPLDFGTWTSMVE-LNLATNQLTKIPEDICGLASLEVLILSNNLLKKLPHGIGNLRKLRELDLEENKLESLPNEIAYLKDLQKLVLTNNQLTTLPRGIGHLTNLTHLGLGENLLQHLPEEIGTLE---NLEELYLNDNPNLHSLPF-ELALCSKLSIMSIENCPLSHLPPQIVAGGPSF-IIQFLKMQGPYRAMV 534          
BLAST of SMED30019284 vs. Ensembl Cavefish
Match: shoc2 (SHOC2 leucine rich repeat scaffold protein [Source:NCBI gene;Acc:555476])

HSP 1 Score: 146.747 bits (369), Expect = 2.601e-36
Identity = 135/499 (27.05%), Postives = 229/499 (45.89%), Query Frame = 3
Query:   60 KIFKTLTKEEIDNINEDFFEKEKINILNCSYSKVKKIGKL-------------CNCKDLEGLI---VNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFE------------------------LVNLLELNICNNDLQ-YLSMDIGKLKKLIVLNLSFNNFIEIPSNI-GELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNK-IQSFPW---LPESIIDFDLSDNPVESIPQNFMA 1418
            ++ K L+K   +N       K  I++L  S  ++ ++ +L               C  L GL+   ++ N +T +P +++ LK L  L+L HN +  +    + + +L  L L  N +T + + I N +KL   +I  NK   LP  +  L  L++ D +HN L  +PK IG+  Q+T L L HN+L DLPETI  L ++  L L  N L+ +   + +                        LVNL  L +  N  Q Y      +   +  LN+  N   +IP  I      L  LN++ N                         +SL  DFG + ++  L+++ N +T++P D     SL VL  SNN + ++P   G+L+KL+ LDL  N+L+SLP  + Y++ L+K+ L+NN+    P  +  +  L  + +  N ++ +PE I +L  L+   L+ N  + S P+   L   +    + + P+  +P   +A
Sbjct:   72 EVIKELSKCREENSTRLDLSKRSIHLLPSSIKELTQLTELYLYSNKLQSLPPEVGC--LSGLVTLALSENSLTSLPDSLDNLKKLRMLDLRHNKLREIPAVVYRVTSLTTLYLRFNRITTVEKDIRNLAKLTMLSIRENKIKQLPAEIGELCNLITLDVAHNQLEHLPKEIGNCTQITNLDLQHNELLDLPETIGNLSSINRLGLRYNRLSAIPRSLAKCRELEELNLENNNISVLPEGLLSSLVNLTSLTLARNCFQSYPVGGPSQFSTIYSLNMEHNRINKIPFGIFSRAKVLSKLNMKDN-----------------------QLTSLPLDFGTWTSMVELNLATNQLTKIPEDICGLASLEVLILSNNLLKKLPHGIGNLRKLRELDLEENKLESLPNEIAYLKDLQKLVLTNNQLTTLPRGIGHLTNLTHLGLGENLLQHLPEEIGTLENLEELYLNDNPNLHSLPFELALCSKLSIMSIENCPLSHLPPQIVA 545          

HSP 2 Score: 102.834 bits (255), Expect = 5.003e-22
Identity = 122/471 (25.90%), Postives = 212/471 (45.01%), Query Frame = 3
Query:  660 VFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCN-FSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMS-LTRLQTFNLSGNKIQSFPW---------------------LPESIID-------FDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIF--------KYDQDRG--KKLTEID----------GRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDI-ESSFVLEFQDRLESLDLSNNA-ISALPATAFTKFSKLRYLNLQGNPCKIPPSDVFNCGQMIPICSYLTAYNEFDATI 1916
            + EL  L EL + +N LQ L  ++G L  L+ L LS N+   +P ++  L  L+ L+LR N K+  +P  +  ++    L  + N  +++  D      L +L I  N I QLP +     +L  L  ++N++  +P+  G+  ++  LDL +NEL  LP  +  + S+ ++ L  NR +  P  L K   L  + +  N+I  +PE ++S L  L +  L+ N  QS+P                      +P  I          ++ DN + S+P +F    + +E LN++      I E +  L SL++         K     G  +KL E+D            ++ L +L+++ L+NN L ++P  I  + NLT + L  N ++ + E    LE    LE L L++N  + +LP       SKL  ++++  P    P  +   G    I  +L     + A +
Sbjct:  102 IKELTQLTELYLYSNKLQSLPPEVGCLSGLVTLALSENSLTSLPDSLDNLKKLRMLDLRHN-KLREIPAVVYRVTSLTTLYLRFNRITTVEKDIRNLAKLTMLSIRENKIKQLPAEIGELCNLITLDVAHNQLEHLPKEIGNCTQITNLDLQHNELLDLPETIGNLSSINRLGLRYNRLSAIPRSLAKCRELEELNLENNNISVLPEGLLSSLVNLTSLTLARNCFQSYPVGGPSQFSTIYSLNMEHNRINKIPFGIFSRAKVLSKLNMKDNQLTSLPLDFGTWTSMVE-LNLATNQLTKIPEDICGLASLEVLILSNNLLKKLPHGIGNLRKLRELDLEENKLESLPNEIAYLKDLQKLVLTNNQLTTLPRGIGHLTNLTHLGLGENLLQHLPEEIGTLE---NLEELYLNDNPNLHSLPF-ELALCSKLSIMSIENCPLSHLPPQIVAGGPSF-IIQFLKMQGPYRAMV 565          
BLAST of SMED30019284 vs. Ensembl Cavefish
Match: lrrc1 (leucine rich repeat containing 1 [Source:NCBI gene;Acc:103023999])

HSP 1 Score: 127.872 bits (320), Expect = 2.979e-30
Identity = 109/385 (28.31%), Postives = 170/385 (44.16%), Query Frame = 3
Query:  189 KDLEGLIVNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFP 1343
            + LE L+++ N++ ++P    QL  L  L LS N I  L     +   L+ LD++ N +  + + I     LQ  + SGN    LP++   L  L     +   L  +P  IG+L  L +L L  N L+ LPE++ +L  LE                       EL++ NN+L  L   IG L  L  L L  N   EIP  +G + +L  L+L  N K+  LP                      ++    N+L  L +S N I  LP        L++LK   N++ ++PE  GS + L  L L+ N L SLP  +  ++ L   N   NR  + P+ +    +LN + +  N +  IP  +   T L  F++SGN++   P
Sbjct:   36 RSLEELLLDANQLRDLPKQFFQLVKLRKLGLSDNEIQRLPPEIANFMQLVELDVSRNDIIEIPDSISFCKALQVADFSGNPLTRLPDSFPELRNLTCLSINDISLQALPDNIGNLCNLVSLELRENMLTYLPESLCQLNRLE-----------------------ELDLGNNELYNLPETIGCLVSLKDLWLDGNQLAEIPPELGSMKNLLCLDLSEN-KLERLP----------------------EESAGLNSLTDLLVSQNLIDALPEGIGKLKRLSILKADQNRLVQLPESIGSCESLTELVLTENHLMSLPRSIGKLKKLSNFNCDRNRLTSLPKEIGGCSSLNVLCVRDNRLSRIPSELSQATELHVFDVSGNRLAFLP 374          

HSP 2 Score: 124.405 bits (311), Expect = 3.994e-29
Identity = 109/373 (29.22%), Postives = 177/373 (47.45%), Query Frame = 3
Query:   75 LTKEEIDNINEDFFEKEKINILNCSYSKVKKIG-KLCNCKDLEGLIVNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNR 1190
            L   ++ ++ + FF+  K+  L  S ++++++  ++ N   L  L V+ N+I EIP +I+  K+L   + S N +T L  +F +L NL  L + +  L  L + IGN   L    +  N    LPE+LC L+ L   D  +N L  +P+ IG L  L  L L+ N L+++P  +  ++NL  L L  N L  L      L +L +L +  N +  L   IGKLK+L +L    N  +++P +IG   SL  L L  N                       +  SL    G    L   +   N +T LP +   C SL VL   +N+++ IP       +L + D+S N L  LP+ +  +  L+ + LS+N+
Sbjct:   43 LDANQLRDLPKQFFQLVKLRKLGLSDNEIQRLPPEIANFMQLVELDVSRNDIIEIPDSISFCKALQVADFSGNPLTRLPDSFPELRNLTCLSINDISLQALPDNIGNLCNLVSLELRENMLTYLPESLCQLNRLEELDLGNNELYNLPETIGCLVSLKDLWLDGNQLAEIPPELGSMKNLLCLDLSENKLERLPEESAGLNSLTDLLVSQNLIDALPEGIGKLKRLSILKADQNRLVQLPESIGSCESLTELVLTEN-----------------------HLMSLPRSIGKLKKLSNFNCDRNRLTSLPKEIGGCSSLNVLCVRDNRLSRIPSELSQATELHVFDVSGNRLAFLPMSLTTLR-LKALWLSDNQ 391          

HSP 3 Score: 99.3673 bits (246), Expect = 4.964e-21
Identity = 91/332 (27.41%), Postives = 156/332 (46.99%), Query Frame = 3
Query:  903 DQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFP------------WL---------PE-----SIIDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDIESSFVLEFQDRLESLDLSNNAISALPATAFTKFSKLRYLNLQGN 1820
            D      L   F     LR L +S+N I +LP +  N + L  L  S N I EIP+     K LQ+ D S N L  LP     + +L  +++++      P+ +  +  L S+E+  N +  +PES+  L RL+  +L  N++ + P            WL         PE     +++  DLS+N +E +P+   A LN + +L +S    D + E +  L  L I K DQ+R  +L E  G      +L E+ L+ N LMS+P  I ++K L++ +   N++  +     +     L  L + +N +S +P +  ++ ++L   ++ GN
Sbjct:   44 DANQLRDLPKQFFQLVKLRKLGLSDNEIQRLPPEIANFMQLVELDVSRNDIIEIPDSISFCKALQVADFSGNPLTRLPDSFPELRNLTCLSINDISLQALPDNIGNLCNLVSLELRENMLTYLPESLCQLNRLEELDLGNNELYNLPETIGCLVSLKDLWLDGNQLAEIPPELGSMKNLLCLDLSENKLERLPEE-SAGLNSLTDLLVSQNLIDALPEGIGKLKRLSILKADQNRLVQLPESIG---SCESLTELVLTENHLMSLPRSIGKLKKLSNFNCDRNRLTSLPKE--IGGCSSLNVLCVRDNRLSRIP-SELSQATELHVFDVSGN 368          

HSP 4 Score: 70.4774 bits (171), Expect = 6.838e-12
Identity = 82/317 (25.87%), Postives = 135/317 (42.59%), Query Frame = 3
Query: 1068 EVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFP--------------------WLPESI------IDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDIES--------SFVLEFQDRL----------ESLD---LSNNAISALPATAFTKFSKLRYLNLQGNPCKIPPSDVFNCGQMIPIC 1877
            E++   + L+ L L  N+L  LP     +  LRK+ LS+N     P  +     L  ++++ NDI  IP+SI     LQ  + SGN +   P                     LP++I      +  +L +N +  +P++ + +LN +E L++ N     + E +  L SLK    D   G +L EI   L  + NL  ++LS N L  +PE+   + +LT + +  N I  +          S +   Q+RL          ESL    L+ N + +LP  +  K  KL   N   N     P ++  C  +  +C
Sbjct:   30 EIYRYSRSLEELLLDANQLRDLPKQFFQLVKLRKLGLSDNEIQRLPPEIANFMQLVELDVSRNDIIEIPDSISFCKALQVADFSGNPLTRLPDSFPELRNLTCLSINDISLQALPDNIGNLCNLVSLELRENMLTYLPES-LCQLNRLEELDLGNNELYNLPETIGCLVSLKDLWLD---GNQLAEIPPELGSMKNLLCLDLSENKLERLPEESAGLNSLTDLLVSQNLIDALPEGIGKLKRLSILKADQNRLVQLPESIGSCESLTELVLTENHLMSLP-RSIGKLKKLSNFNCDRNRLTSLPKEIGGCSSLNVLC 341          
BLAST of SMED30019284 vs. Ensembl Cavefish
Match: lrrc1 (leucine rich repeat containing 1 [Source:NCBI gene;Acc:103023999])

HSP 1 Score: 127.487 bits (319), Expect = 9.686e-30
Identity = 109/385 (28.31%), Postives = 170/385 (44.16%), Query Frame = 3
Query:  189 KDLEGLIVNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFP 1343
            + LE L+++ N++ ++P    QL  L  L LS N I  L     +   L+ LD++ N +  + + I     LQ  + SGN    LP++   L  L     +   L  +P  IG+L  L +L L  N L+ LPE++ +L  LE                       EL++ NN+L  L   IG L  L  L L  N   EIP  +G + +L  L+L  N K+  LP                      ++    N+L  L +S N I  LP        L++LK   N++ ++PE  GS + L  L L+ N L SLP  +  ++ L   N   NR  + P+ +    +LN + +  N +  IP  +   T L  F++SGN++   P
Sbjct:   36 RSLEELLLDANQLRDLPKQFFQLVKLRKLGLSDNEIQRLPPEIANFMQLVELDVSRNDIIEIPDSISFCKALQVADFSGNPLTRLPDSFPELRNLTCLSINDISLQALPDNIGNLCNLVSLELRENMLTYLPESLCQLNRLE-----------------------ELDLGNNELYNLPETIGCLVSLKDLWLDGNQLAEIPPELGSMKNLLCLDLSEN-KLERLP----------------------EESAGLNSLTDLLVSQNLIDALPEGIGKLKRLSILKADQNRLVQLPESIGSCESLTELVLTENHLMSLPRSIGKLKKLSNFNCDRNRLTSLPKEIGGCSSLNVLCVRDNRLSRIPSELSQATELHVFDVSGNRLAFLP 374          

HSP 2 Score: 124.79 bits (312), Expect = 7.431e-29
Identity = 109/373 (29.22%), Postives = 177/373 (47.45%), Query Frame = 3
Query:   75 LTKEEIDNINEDFFEKEKINILNCSYSKVKKIG-KLCNCKDLEGLIVNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNR 1190
            L   ++ ++ + FF+  K+  L  S ++++++  ++ N   L  L V+ N+I EIP +I+  K+L   + S N +T L  +F +L NL  L + +  L  L + IGN   L    +  N    LPE+LC L+ L   D  +N L  +P+ IG L  L  L L+ N L+++P  +  ++NL  L L  N L  L      L +L +L +  N +  L   IGKLK+L +L    N  +++P +IG   SL  L L  N                       +  SL    G    L   +   N +T LP +   C SL VL   +N+++ IP       +L + D+S N L  LP+ +  +  L+ + LS+N+
Sbjct:   43 LDANQLRDLPKQFFQLVKLRKLGLSDNEIQRLPPEIANFMQLVELDVSRNDIIEIPDSISFCKALQVADFSGNPLTRLPDSFPELRNLTCLSINDISLQALPDNIGNLCNLVSLELRENMLTYLPESLCQLNRLEELDLGNNELYNLPETIGCLVSLKDLWLDGNQLAEIPPELGSMKNLLCLDLSENKLERLPEESAGLNSLTDLLVSQNLIDALPEGIGKLKRLSILKADQNRLVQLPESIGSCESLTELVLTEN-----------------------HLMSLPRSIGKLKKLSNFNCDRNRLTSLPKEIGGCSSLNVLCVRDNRLSRIPSELSQATELHVFDVSGNRLAFLPMSLTTLR-LKALWLSDNQ 391          

HSP 3 Score: 97.4413 bits (241), Expect = 3.282e-20
Identity = 89/332 (26.81%), Postives = 156/332 (46.99%), Query Frame = 3
Query:  903 DQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFP------------WL---------PE-----SIIDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDIESSFVLEFQDRLESLDLSNNAISALPATAFTKFSKLRYLNLQGN 1820
            D      L   F     LR L +S+N I +LP +  N + L  L  S N I EIP+     K LQ+ D S N L  LP     + +L  +++++      P+ +  +  L S+E+  N +  +PES+  L RL+  +L  N++ + P            WL         PE     +++  DLS+N +E +P+   A LN + +L +S    D + E +  L  L I K DQ+R   L ++   +    +L E+ L+ N LMS+P  I ++K L++ +   N++  +     +     L  L + +N +S +P +  ++ ++L   ++ GN
Sbjct:   44 DANQLRDLPKQFFQLVKLRKLGLSDNEIQRLPPEIANFMQLVELDVSRNDIIEIPDSISFCKALQVADFSGNPLTRLPDSFPELRNLTCLSINDISLQALPDNIGNLCNLVSLELRENMLTYLPESLCQLNRLEELDLGNNELYNLPETIGCLVSLKDLWLDGNQLAEIPPELGSMKNLLCLDLSENKLERLPEE-SAGLNSLTDLLVSQNLIDALPEGIGKLKRLSILKADQNR---LVQLPESIGSCESLTELVLTENHLMSLPRSIGKLKKLSNFNCDRNRLTSLPKE--IGGCSSLNVLCVRDNRLSRIP-SELSQATELHVFDVSGN 368          

HSP 4 Score: 68.5514 bits (166), Expect = 3.109e-11
Identity = 82/317 (25.87%), Postives = 135/317 (42.59%), Query Frame = 3
Query: 1068 EVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFP--------------------WLPESI------IDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDIES--------SFVLEFQDRL----------ESLD---LSNNAISALPATAFTKFSKLRYLNLQGNPCKIPPSDVFNCGQMIPIC 1877
            E++   + L+ L L  N+L  LP     +  LRK+ LS+N     P  +     L  ++++ NDI  IP+SI     LQ  + SGN +   P                     LP++I      +  +L +N +  +P++ + +LN +E L++ N     + E +  L SLK    D   G +L EI   L  + NL  ++LS N L  +PE+   + +LT + +  N I  +          S +   Q+RL          ESL    L+ N + +LP  +  K  KL   N   N     P ++  C  +  +C
Sbjct:   30 EIYRYSRSLEELLLDANQLRDLPKQFFQLVKLRKLGLSDNEIQRLPPEIANFMQLVELDVSRNDIIEIPDSISFCKALQVADFSGNPLTRLPDSFPELRNLTCLSINDISLQALPDNIGNLCNLVSLELRENMLTYLPES-LCQLNRLEELDLGNNELYNLPETIGCLVSLKDLWLD---GNQLAEIPPELGSMKNLLCLDLSENKLERLPEESAGLNSLTDLLVSQNLIDALPEGIGKLKRLSILKADQNRLVQLPESIGSCESLTELVLTENHLMSLP-RSIGKLKKLSNFNCDRNRLTSLPKEIGGCSSLNVLC 341          
BLAST of SMED30019284 vs. Ensembl Cavefish
Match: lrrc40 (leucine rich repeat containing 40 [Source:NCBI gene;Acc:103027596])

HSP 1 Score: 125.946 bits (315), Expect = 2.342e-29
Identity = 143/515 (27.77%), Postives = 235/515 (45.63%), Query Frame = 3
Query:  102 NEDFFEKEKINILNCSYSKVKKIGKLCNCKDLEGLIV---NGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNK--------------------FN---TLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPE-----TIKELQ----NLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKIT-----------------------NLPGXXXXXXXXXXXXDQCNFS-----SLSDD-FGYYNNLRILDI--SNNHITQLP---IDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETI-PESIMSLTRLQTFNLSGNKIQSFPWLPE-----SIIDFDLSDNPVESIPQNFMAK 1421
            ++ ++E+  +  L  S +K++ + +  + K L  L+V   + N++  +P  I +L+ L  LNLSHN +T+L    ++L NL  L L  N L  L   +G   +L+  ++S NK                    FN   +LP  +  +  L   DCS N L  VP  +  +  L  L L HN L  LPE     T+KEL      +E+L+           ++  L  L  L + +N ++ L  +I  L+ L  L+L+ N+   IP  +G L  L  L L GN   T                        LP    +   +   +    +S     ++ DD F   ++  ++++  S N +T++P   ++ K+  +LA L    NK++ +P  F  L++L  +DL NN L SLP+ +E ++ LR I LS NRF  FP++L +I +L +I ++ N +  I P  +  L +L T +L  N I   P  PE     S+    L  NP  +     +AK
Sbjct:   73 SDRWWEQTDLTKLLLSSNKLETLSE--DVKLLPALVVLDIHDNQLRTLPATIGELEQLQKLNLSHNKMTHLPLELWNLTNLRCLHLQQNLLEQLPSELGQLCQLEDLDLSNNKLIIVPDGLANLNNLVKLNLSFNSLKSLPSAISEMKNLRMLDCSRNQLESVPPVLAQMASLEQLYLRHNKLRFLPELPSCKTLKELHCGNNQIEVLEAA---------HLKHLSALSVLELRDNKVKSLPEEITLLQGLQRLDLTNNDLSSIPCGLGNLPKLTSLTLEGNPLRTIRRELLTVKEPDGNLKDEPKTAMTLPSQSRINVHAIKTLKTLEYSQKQEVAIPDDVFDAVSDGAVVNVNFSKNQLTEVPPRIVELKD--TLADLNLGFNKLSAVPIEFSKLQQLVHVDLRNNLLTSLPMELESLK-LRSIILSFNRFKAFPDVLYRILSLETILMSNNQVGAIDPLRLKLLDKLSTLDLQNNDIMQVP--PELGNCTSLRALMLDGNPFRNPRAAIVAK 571          

HSP 2 Score: 114.39 bits (285), Expect = 1.117e-25
Identity = 134/511 (26.22%), Postives = 235/511 (45.99%), Query Frame = 3
Query:  411 FNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVI-MEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSF--PWLPESIIDFDLSDNPVESIPQNFMAKLNY-----IENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQL-NNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIK----DIES----SFVLEFQD------------RLESLDLSNNAISALPATAFTKFSKLRYLNLQGNPCKIPPSDVFNC 1856
             N+SG     +P+++  L+     +   N              LT L+L+ N L  L E +K L  L +L + +N L  L   + EL  L +LN+ +N + +L +++  L  L  L+L  N   ++PS +G+L  L+ L+L  N  I    G   L +L +L +   +  SL        NLR+LD S N +  +P       SL  L   +NK+  +PE   S K L+ L   NN+++ L    ++++ +L  + L +N+  + PE +T +  L  +++T ND+ +IP  + +L +L +  L GN +++     L     D +L D P  ++     +++N      ++ L  S      I + VF   S            +LTE+  R+ +L + L ++NL  N L ++P +  +++ L  + LR N +     ++ES    S +L F               LE++ +SNN + A+         KL  L+LQ N     P ++ NC
Sbjct:   39 LNLSGRGLTEVPQSVWRLNIDPPEEAQQNVSFSASDRWWEQTDLTKLLLSSNKLETLSEDVKLLPALVVLDIHDNQLRTLPATIGELEQLQKLNLSHNKMTHLPLELWNLTNLRCLHLQQNLLEQLPSELGQLCQLEDLDLSNNKLIIVPDGLANLNNLVKLNLSFNSLKSLPSAISEMKNLRMLDCSRNQLESVPPVLAQMASLEQLYLRHNKLRFLPE-LPSCKTLKELHCGNNQIEVLEAAHLKHLSALSVLELRDNKVKSLPEEITLLQGLQRLDLTNNDLSSIPCGLGNLPKLTSLTLEGNPLRTIRRELLTVKEPDGNLKDEPKTAMTLPSQSRINVHAIKTLKTLEYSQKQEVAIPDDVFDAVSDGAVVNVNFSKNQLTEVPPRIVELKDTLADLNLGFNKLSAVPIEFSKLQQLVHVDLRNNLLTSLPMELESLKLRSIILSFNRFKAFPDVLYRILSLETILMSNNQVGAIDPLRLKLLDKLSTLDLQNNDIMQVPPELGNC 548          

HSP 3 Score: 112.849 bits (281), Expect = 3.502e-25
Identity = 151/575 (26.26%), Postives = 258/575 (44.87%), Query Frame = 3
Query:  171 GKLCNCKDLEGLIVNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQL-PIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNF-PEILTKIPTLNSIEITANDIETIPES----IMSLTRLQTFNLSGNKIQSFP------WLPESIIDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDIESSFVLEFQDRLESLDLSNNAISALPATAFTKFSKLRYLNLQGNPCKIPPSDVFNCG 1859
            G L   +    L ++G  +TE+P ++ +L          N   +    +++  +L  L L++N L  LSE +     L   +I  N+  TLP T+  L +L   + SHN +  +P  + +L  L  L L  N L  LP  + +L  LE L L NN L  +   +  L NL++LN+  N L+ L   I ++K L +L+ S N    +P  + +++SL+ L LR N K+  LP                       +      L+ L   NN I  L     K+  +L+VL+  +NK+  +PE    L+ LQ LDL+NN+L S+P  +  +  L  + L  N       E+LT      +++       T+P      + ++  L+T   S  +  + P          ++++ + S N +  +P   +   + + +LN+   N    + I FS   L+   +   R   LT +   L  L  L+ I LS N   + P+ + ++ +L +I +  N++  I+    L+  D+L +LDL NN I  +P       + LR L L GNP + P + +   G
Sbjct:   28 GLLKGARQSGQLNLSGRGLTEVPQSVWRLNIDPPEEAQQNVSFSASDRWWEQTDLTKLLLSSNKLETLSEDVKLLPALVVLDIHDNQLRTLPATIGELEQLQKLNLSHNKMTHLPLELWNLTNLRCLHLQQNLLEQLPSELGQLCQLEDLDLSNNKLIIVPDGLANLNNLVKLNLSFNSLKSLPSAISEMKNLRMLDCSRNQLESVPPVLAQMASLEQLYLRHN-KLRFLP-----------------------ELPSCKTLKELHCGNNQIEVLEAAHLKHLSALSVLELRDNKVKSLPEEITLLQGLQRLDLTNNDLSSIPCGLGNLPKLTSLTLEGNPLRTIRRELLTVKEPDGNLKDEPKTAMTLPSQSRINVHAIKTLKTLEYSQKQEVAIPDDVFDAVSDGAVVNVNFSKNQLTEVPPRIVELKDTLADLNLG-FNKLSAVPIEFS--KLQQLVHVDLRNNLLTSLPMELESL-KLRSIILSFNRFKAFPDVLYRILSLETILMSNNQVGAID-PLRLKLLDKLSTLDLQNNDIMQVPP-ELGNCTSLRALMLDGNPFRNPRAAIVAKG 572          

HSP 4 Score: 75.485 bits (184), Expect = 1.872e-13
Identity = 103/399 (25.81%), Postives = 173/399 (43.36%), Query Frame = 3
Query:   27 LKYFNASTNEDKIFKTL--TKEEIDNINEDFFEKEKINILNCSYSKVKKIGKLCNCKDLEGLIVNGNEITEIPLA-INQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVN---LLELNICNNDLQYLSMDIGKLKKLIV-LNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEI-PEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNN 1199
            LK   ++ +E K  + L  ++ +++++     +   +  L   ++K++ + +L +CK L+ L    N+I  +  A +  L +L+ L L  N + +L      L+ L  LDL NN L+ +   +GN  KL    + GN   T+        ELL+      +L   PK   +L   + + ++          IK L+ LE  Q     + +    VF+ V+   ++ +N   N L  +   I +LK  +  LNL FN    +P    +L  L +++LR N+ +T+LP                   SL         LR + +S N     P      LSL  +  SNN++  I P     L KL  LDL NN++  +P  +    SLR + L  N F N
Sbjct:  207 LKSLPSAISEMKNLRMLDCSRNQLESVPPVLAQMASLEQLYLRHNKLRFLPELPSCKTLKELHCGNNQIEVLEAAHLKHLSALSVLELRDNKVKSLPEEITLLQGLQRLDLTNNDLSSIPCGLGNLPKLTSLTLEGNPLRTI------RRELLTVKEPDGNLKDEPKTAMTLPSQSRINVH---------AIKTLKTLEYSQKQEVAIPDD---VFDAVSDGAVVNVNFSKNQLTEVPPRIVELKDTLADLNLGFNKLSAVPIEFSKLQQLVHVDLR-NNLLTSLP---------------MELESL--------KLRSIILSFNRFKAFPDVLYRILSLETILMSNNQVGAIDPLRLKLLDKLSTLDLQNNDIMQVPPELGNCTSLRALMLDGNPFRN 563          
BLAST of SMED30019284 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004940.1 (pep scaffold:Pmarinus_7.0:GL476356:339323:347865:-1 gene:ENSPMAG00000004448.1 transcript:ENSPMAT00000004940.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 147.902 bits (372), Expect = 1.591e-37
Identity = 125/443 (28.22%), Postives = 215/443 (48.53%), Query Frame = 3
Query:  165 KIGKLCNCKDLEGLIVNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYL----------------------SMDIG---KLKKLIVLNLSFNNFIEIPSNI-GELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNK-IQSFPW---LPESIIDFDLSDNPVESIP 1403
            +IG L N   L  L +N N +T +P  +  L SL  L+L HN + ++    + L +L  L L  N +T + + IGN SKL   ++  NK   LP  +  L  LL+ D +HN L  +P+ IG+  Q+T L L HN+L DLP++I  L +L  L L  N L+ +   +     L +LN+ NN++  L                      +  +G   +   +  LN+  N+  +IP  I     +L  LN++ N                         +SL  D G + ++  L+++ N +T++P D     SL +L  SNN + ++P   G+L+KL+ LDL  N+L+SLP  + Y++ L+K+ L+NN+  + P  +  + +L  + +  N +  +PE I +L  L+   L+ N  + + P+   L   ++   + + P+  +P
Sbjct:   90 EIGCLVN---LVTLALNENSLTGLPDTLTGLTSLRMLDLRHNKLRSIPPVVYRLTSLTVLYLRFNRITQVEKDIGNLSKLTMLSVRENKIKLLPAEIGELRSLLTLDVAHNQLEHLPEEIGNCVQVTNLDLQHNELLDLPDSIGNLASLNRLGLRYNRLSAVPTTLANCTELEDLNLENNNISTLPEGLLSSLVNLSSLTLARNCFQAYPVGGPSQFTTVYSLNMEHNHIGKIPFGIFSRAKALSKLNMKDNQ-----------------------LTSLPLDIGTWKSMVELNLATNQLTKIPDDISELTSLEILVLSNNLLRKLPHGLGNLRKLRELDLEENKLESLPNEIAYLKDLQKLVLTNNQLTSLPRGIGHLCSLTHLMVGENQLTHVPEEIGTLENLEELYLNDNPNLHNLPFELALCSKLLIMSIENCPLSQLP 506          

HSP 2 Score: 117.472 bits (293), Expect = 1.351e-27
Identity = 130/546 (23.81%), Postives = 232/546 (42.49%), Query Frame = 3
Query:  267 TYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLP-------------IDFKNCL------------SLAVLKWSNNKINEIP-EVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFPWLPESIIDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNK-IKDIESSFVLEFQDRLESLDLSNNAISALPATAFTKFSK--LRYLNLQG 1817
            T L+L+   I +L     +L  L  L L  N L  L   IG    L    ++ N    LP+TL  L+ L   D  HN L  +P  +  L  LT L L  N ++ + + I  L  L +L +  N +  L   + EL +LL L++ +N L++L  +IG   ++  L+L  N  +++P +IG L+SL  L LR N                         S++         L  L++ NN+I+ LP                +NC             ++  L   +N I +IP  +F   K L  L++ +N+L SLP+ +   +S+ ++NL+ N+    P+ ++++ +L  + ++ N +  +P  + +L +L+  +L  NK++S P                     N +A L  ++ L ++N                           +LT +   +  L +L  + +  N L  +PE+I  ++NL  + L  N  + ++   F L    +L  + + N  +S LP    +      ++YL +QG
Sbjct:   52 TRLDLAKRSIASLPPNIKELTQLTELYLYGNRLPCLPTEIGCLVNLVTLALNENSLTGLPDTLTGLTSLRMLDLRHNKLRSIPPVVYRLTSLTVLYLRFNRITQVEKDIGNLSKLTMLSVRENKIKLLPAEIGELRSLLTLDVAHNQLEHLPEEIGNCVQVTNLDLQHNELLDLPDSIGNLASLNRLGLRYN-----------------------RLSAVPTTLANCTELEDLNLENNNISTLPEGLLSSLVNLSSLTLARNCFQAYPVGGPSQFTTVYSLNMEHNHIGKIPFGIFSRAKALSKLNMKDNQLTSLPLDIGTWKSMVELNLATNQLTKIPDDISELTSLEILVLSNNLLRKLPHGLGNLRKLRELDLEENKLESLP---------------------NEIAYLKDLQKLVLTN--------------------------NQLTSLPRGIGHLCSLTHLMVGENQLTHVPEEIGTLENLEELYLNDNPNLHNL--PFELALCSKLLIMSIENCPLSQLPGPIVSSGPSFIIQYLKMQG 525          

HSP 3 Score: 110.538 bits (275), Expect = 2.390e-25
Identity = 102/380 (26.84%), Postives = 171/380 (45.00%), Query Frame = 3
Query:  216 GNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLP---GXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPID-FKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFP 1343
            GN +  +P  I  L +L  L L+ N +T L  T   L +L  LDL +N L  +  ++   + L    +  N+   + + + +LS+L       N +  +P  IG L+ L TL + HN L  LPE I                          V +  L++ +N+L  L   IG L  L  L L +N    +P+ +   + L+ LNL  N+ I+ LP    S L+   S  L   C  +        +  +  L++ +NHI ++P   F    +L+ L   +N++  +P   G+ K +  L+L+ N+L  +P  +  + SL  + LSNN     P  L  +  L  +++  N +E++P  I  L  LQ   L+ N++ S P
Sbjct:   81 GNRLPCLPTEIGCLVNLVTLALNENSLTGLPDTLTGLTSLRMLDLRHNKLRSIPPVVYRLTSLTVLYLRFNRITQVEKDIGNLSKLTMLSVRENKIKLLPAEIGELRSLLTLDVAHNQLEHLPEEIG-----------------------NCVQVTNLDLQHNELLDLPDSIGNLASLNRLGLRYNRLSAVPTTLANCTELEDLNLE-NNNISTLPEGLLSSLVNLSSLTLARNCFQAYPVGGPSQFTTVYSLNMEHNHIGKIPFGIFSRAKALSKLNMKDNQLTSLPLDIGTWKSMVELNLATNQLTKIPDDISELTSLEILVLSNNLLRKLPHGLGNLRKLRELDLEENKLESLPNEIAYLKDLQKLVLTNNQLTSLP 436          

HSP 4 Score: 107.842 bits (268), Expect = 1.949e-24
Identity = 133/512 (25.98%), Postives = 240/512 (46.88%), Query Frame = 3
Query:  411 FNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLP-VIMEYMESLRKINLSNNRFNNFP-EILTKIPTLNSIEITANDIETIPESIMSLTR-LQTFNLSGNKIQSFP-----WLPESIIDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDI-ESSFVLEFQDRLESLDLSNNA-ISALPATAFTKFSKLRYLNLQGNPCKIPPSDVFNCGQMIPICSYLTAYNEFDATI 1916
             +++     +LP  +  L++L       N L  +P  IG L  L TL LN N L+ LP+T+  L +L +L L +N L ++   V+ L +L  L +  N +  +  DIG L KL +L++  N    +P+ IGEL SL  L++  N                           L ++ G    +  LD+ +N +  LP    N  SL  L    N+++ +P    +  +L+ L+L NN + +LP  ++  + +L  + L+ N F  +P    ++  T+ S+ +  N I  IP  I S  + L   N+  N++ S P     W  +S+++ +L+ N +  IP + +++L  +E L +SN   + + ++   L +L+  +       KL  +   ++ L +L+++ L+NN L S+P  I  + +LT + +  N++  + E    LE    LE L L++N  +  LP       SKL  ++++  P    P  + + G    I  YL     + A +
Sbjct:   54 LDLAKRSIASLPPNIKELTQLTELYLYGNRLPCLPTEIGCLVNLVTLALNENSLTGLPDTLTGLTSLRMLDLRHNKLRSIPPVVYRLTSLTVLYLRFNRITQVEKDIGNLSKLTMLSVRENKIKLLPAEIGELRSLLTLDVAHNQ-----------------------LEHLPEEIGNCVQVTNLDLQHNELLDLPDSIGNLASLNRLGLRYNRLSAVPTTLANCTELEDLNLENNNISTLPEGLLSSLVNLSSLTLARNCFQAYPVGGPSQFTTVYSLNMEHNHIGKIPFGIFSRAKALSKLNMKDNQLTSLPLDIGTW--KSMVELNLATNQLTKIPDD-ISELTSLEILVLSN---NLLRKLPHGLGNLRKLRELDLEENKLESLPNEIAYLKDLQKLVLTNNQLTSLPRGIGHLCSLTHLMVGENQLTHVPEEIGTLE---NLEELYLNDNPNLHNLPF-ELALCSKLLIMSIENCPLSQLPGPIVSSGPSF-IIQYLKMQGPYRAMV 531          
BLAST of SMED30019284 vs. Ensembl Sea Lamprey
Match: lrrc40 (leucine rich repeat containing 40 [Source:NCBI gene;Acc:334130])

HSP 1 Score: 142.124 bits (357), Expect = 2.968e-35
Identity = 147/560 (26.25%), Postives = 249/560 (44.46%), Query Frame = 3
Query:  264 LTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQL-PIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETI------PESIMSLT-----RLQTFNLSGNKIQSFPWLPESIIDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRG-KKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDIESSFVLEFQDRLESLDLSNNAISALPATAFTKFSKLRYLNLQGNPCKIPPSDVFNCGQMIPICSYLTAYNEF 1904
            LT L L+ N +  L      L  L  LD+ +N LT L +++G    LQ  N+S NK  TLPE+L ++S LLS    HN L  +   IG+L +L  L L+ N L+ LP T+                        +L  + +LN+  N L+ L  +I  +K L  L  + N    +P+ +G ++SL+ L LR N ++ +LP             +  N ++L +          L + NN I++L P   +   +++VL   +NK+ E+P+    L  L+ LDL+NN++ SLP  +  +  L+ + L  N        +    T   ++   + IE        P+++ ++T      +  F +S  K   +          D+ D   E+I  + +  +++ +N          +  I   +  LK    D + G  K++ +   L  L NL  ++L NN L S+P ++  +  L SI +  N+ ++I    VL     LE+L  S+N I  + AT      +L  L+LQ N   + P  +  C   + + S L   N F
Sbjct:   86 LTKLILASNRLRALSDDLQLLPALTVLDVHDNQLTELPQVLGELVNLQKLNVSHNKLQTLPESLWAISSLLSLHVEHNELEGISNNIGNLARLEELDLSSNRLTALPGTLG-----------------------KLTRVTKLNVAENKLRELPTEIKSMKGLCQLEATHNLLESVPAALGGMASLQQLYLRHN-RLKSLP-------------ELHNCAALKE----------LHVGNNQISELGPEHLRPLGAISVLDLRDNKLKELPDEVTLLHGLERLDLTNNDISSLPNALGNLGKLKSLALEGNPLRAIRRDIINRGTQEILKFLRSRIEEPTGSEDSPDTVTAMTLPSQGGINAFTISAQKALHY----SGKKAADIPDEVFEAIRGSTVTAVDFSKN---------QLSTIPPRIVELKDMVTDVNVGFNKISVLSLELCMLGNLTHLDLRNNALSSLPNEMEALSRLQSIIISCNRFREIPP--VLYRVGTLETLLASDNQIGVVDATGLRSLERLGTLDLQNNDITVVPPQLGLC---VSLRSLLLGGNRF 580          

HSP 2 Score: 112.849 bits (281), Expect = 8.577e-26
Identity = 118/440 (26.82%), Postives = 190/440 (43.18%), Query Frame = 3
Query:  168 IGKLCNCKDLEGLIVNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNS------KITNLPGXXXXXXXXXXXXDQCNFSSLSDDF---------GYYNNLRI-----LDISNNHITQLPIDFKNCL---SLAVLKWSNNKINEIPEVFGSLKK------------------------LQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETI-PESIMSLTRLQTFNLSGNKIQSFP 1343
            +G+L N   L+ L V+ N++  +P ++  + SL  L++ HN +  +     +L  L  LDL++N LT L   +G  +++   N++ NK   LP  + S+  L   + +HN L  VP  +G +  L  L L HN L  LPE        E+    N        ++  L  +  L++ +N L+ L  ++  L  L  L+L+ N+   +P+ +G L  LK L L GN        I N  G+  ++      I++   S  S D          G  N   I     L  S      +P +    +   ++  + +S N+++ IP     LK                         L  LDL NN L SLP  ME +  L+ I +S NRF   P +L ++ TL ++  + N I  +    + SL RL T +L  N I   P
Sbjct:  126 LGELVN---LQKLNVSHNKLQTLPESLWAISSLLSLHVEHNELEGISNNIGNLARLEELDLSSNRLTALPGTLGKLTRVTKLNVAENKLRELPTEIKSMKGLCQLEATHNLLESVPAALGGMASLQQLYLRHNRLKSLPELHNCAALKELHVGNNQISELGPEHLRPLGAISVLDLRDNKLKELPDEVTLLHGLERLDLTNNDISSLPNALGNLGKLKSLALEGNPLRAIRRDIINR-GTQEILKFLRSRIEEPTGSEDSPDTVTAMTLPSQGGINAFTISAQKALHYSGKKAADIPDEVFEAIRGSTVTAVDFSKNQLSTIPPRIVELKDMVTDVNVGFNKISVLSLELCMLGNLTHLDLRNNALSSLPNEMEALSRLQSIIISCNRFREIPPVLYRVGTLETLLASDNQIGVVDATGLRSLERLGTLDLQNNDITVVP 561          

HSP 3 Score: 110.153 bits (274), Expect = 5.039e-25
Identity = 122/467 (26.12%), Postives = 214/467 (45.82%), Query Frame = 3
Query:  663 FELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCN-FSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDI-ETIPESIMSLTRLQTFNLSGNKIQSFP---WLPESIIDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDR---------------------------------------GKKLTEIDGRLSQL---NNLKEINLSNNCLMSIPEQILQMKNL-TSISLRGNKIKDIESSFVLEFQDRLESLDLSNNAISALPATAFTKFSKLRYLNLQGNPCKIPPSDVFNCGQMIPICSYLTAYNEFDATIL 1919
            +E  +L +L + +N L+ LS D+  L  L VL++  N   E+P  +GEL +L+ LN+  N K+  LP S+  IS    L  + N    +S++ G    L  LD+S+N +T LP        +  L  + NK+ E+P    S+K L  L+ ++N L+S+P  +  M SL+++ L +NR  + PE L     L  + +  N I E  PE +  L  +   +L  NK++  P    L   +   DL++N + S+P N +  L  +++L +       I   + +  + +I K+ + R                                       GKK  +I   + +    + +  ++ S N L +IP +I+++K++ T +++  NKI  +  S  L     L  LDL NNA+S+LP       S+L+ + +  N  +  P  ++  G +  + +        DAT L
Sbjct:   81 WEQADLTKLILASNRLRALSDDLQLLPALTVLDVHDNQLTELPQVLGELVNLQKLNVSHN-KLQTLPESLWAISSLLSLHVEHNELEGISNNIGNLARLEELDLSSNRLTALPGTLGKLTRVTKLNVAENKLRELPTEIKSMKGLCQLEATHNLLESVPAALGGMASLQQLYLRHNRLKSLPE-LHNCAALKELHVGNNQISELGPEHLRPLGAISVLDLRDNKLKELPDEVTLLHGLERLDLTNNDISSLP-NALGNLGKLKSLALEGNPLRAIRRDIINRGTQEILKFLRSRIEEPTGSEDSPDTVTAMTLPSQGGINAFTISAQKALHYSGKKAADIPDEVFEAIRGSTVTAVDFSKNQLSTIPPRIVELKDMVTDVNVGFNKISVL--SLELCMLGNLTHLDLRNNALSSLP-NEMEALSRLQSIIISCNRFREIPPVLYRVGTLETLLASDNQIGVVDATGL 541          

HSP 4 Score: 69.3218 bits (168), Expect = 2.951e-12
Identity = 90/379 (23.75%), Postives = 157/379 (41.42%), Query Frame = 3
Query:  150 YSKVKKIGKLCNCKDLEGLIVNGNEITEI-PLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLC--SLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKE--LQNLEIXXXXXXXXXXXXHY-----------VFELVN---LLELNICNNDLQYLSMDIGKLKKLIV-LNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEV-FGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNN-FPEILTK 1220
            ++++K + +L NC  L+ L V  N+I+E+ P  +  L +++ L+L  N +  L      L  L  LDL NN ++ L   +GN  KL+   + GN    +   +      E+L F                   L + I       D P+T+    L +   +     +     HY           VFE +    +  ++   N L  +   I +LK ++  +N+ FN    +   +  L +L +L+LR N+                        SSL ++    + L+ + IS N   ++P       +L  L  S+N+I  +      SL++L  LDL NN++  +P  +    SLR + L  NRF +  P +L+K
Sbjct:  254 HNRLKSLPELHNCAALKELHVGNNQISELGPEHLRPLGAISVLDLRDNKLKELPDEVTLLHGLERLDLTNNDISSLPNALGNLGKLKSLALEGNPLRAIRRDIINRGTQEILKF-------------------LRSRIEEPTGSEDSPDTVTAMTLPSQGGINAFTISAQKALHYSGKKAADIPDEVFEAIRGSTVTAVDFSKNQLSTIPPRIVELKDMVTDVNVGFNKISVLSLELCMLGNLTHLDLRNNA-----------------------LSSLPNEMEALSRLQSIIISCNRFREIPPVLYRVGTLETLLASDNQIGVVDATGLRSLERLGTLDLQNNDITVVPPQLGLCVSLRSLLLGGNRFRSPRPALLSK 590          
BLAST of SMED30019284 vs. Ensembl Sea Lamprey
Match: scrib (scribble planar cell polarity protein [Source:NCBI gene;Acc:368473])

HSP 1 Score: 122.479 bits (306), Expect = 1.900e-28
Identity = 101/316 (31.96%), Postives = 143/316 (45.25%), Query Frame = 3
Query:  174 KLCNCKDLEGLIVNGNEITEIPLAINQLKSLTYLNL-----------------------SHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNK 1052
            KLC C  LE +  +GN +T +P    QLKSL YL+L                         N +  L T+   L  L  LDL NN L  L   +G+   ++   + GN+   LP  +  L  L+  D S N L  +P  IG L  LT  + + N L +LPE + +L++L IL+   N LT+L   + +  NL EL +  N L  L   IGKL KL  LNL  N    IP  IG   +L  L+LR N ++T +PG                      +    + + +LD++ N +  LPI+    LSL  L  S N+
Sbjct:   49 KLCTC--LEVVDFSGNPLTRLPEGFTQLKSLIYLSLNDVSLQGLPDDIGNLSNLVTLELRENLLKTLPTSLHLLVKLEQLDLGNNELETLPGSLGSLPNVRELWLDGNQLEALPSEIGELRRLVCLDISQNRLERLPDAIGGLAALTDFLASQNHLEELPEELGKLKHLSILKADQNRLTHLPEAIGDCENLTELILTENQLVTLPASIGKLTKLTNLNLDKNRLNSIPPEIGGCGALNVLSLRDN-RLTQVPG----------------------EISGASQIHVLDLAGNRLENLPIELAK-LSLKALWLSENQ 338          

HSP 2 Score: 118.242 bits (295), Expect = 3.687e-27
Identity = 113/348 (32.47%), Postives = 174/348 (50.00%), Query Frame = 3
Query:  315 FFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPET--LCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLP-GXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFPWL 1349
            FF L NL  L L++N L  L   I NF  L   ++S N    +P++  LC+  E++ F  S N L  +P+G   LK L  L LN   L  LP+ I  L NL  L+L  N L  L   +  LV L +L++ NN+L+ L   +G L  +  L L  N    +PS IGEL  L  L++  N ++  LP     L +L++ L  Q +   L ++ G   +L IL    N +T LP    +C +L  L  + N++  +P   G L KL  L+L  N L+S+P  +    +L  ++L +NR    P  ++    ++ +++  N +E +P  +  L+ L+   LS N  QS P L
Sbjct:    2 FFRLHNLRKLGLSDNELQRLPPDIANFMHLVDLDMSRNDIAEIPDSIKLCTCLEVVDF--SGNPLTRLPEGFTQLKSLIYLSLNDVSLQGLPDDIGNLSNLVTLELRENLLKTLPTSLHLLVKLEQLDLGNNELETLPGSLGSLPNVRELWLDGNQLEALPSEIGELRRLVCLDISQN-RLERLPDAIGGLAALTDFLASQNHLEELPEELGKLKHLSILKADQNRLTHLPEAIGDCENLTELILTENQLVTLPASIGKLTKLTNLNLDKNRLNSIPPEIGGCGALNVLSLRDNRLTQVPGEISGASQIHVLDLAGNRLENLPIELAKLS-LKALWLSEN--QSQPML 343          

HSP 3 Score: 104.375 bits (259), Expect = 7.911e-23
Identity = 101/387 (26.10%), Postives = 170/387 (43.93%), Query Frame = 3
Query:  663 FELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFPWLPESIIDF-DLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDIESSFVLEFQDRLESLDLSNNAISALPATAFTKFSKLRYLNLQGN 1820
            F L NL +L + +N+LQ L  DI     L+ L++S N+  EIP +I               K+                   C              L ++D S N +T+LP  F    SL  L  ++  +  +P+  G+L  L  L+L  N L +LP  +  +  L +++L NN     P  L  +P +  + +  N +E +P  I  L RL   ++S N+++    LP++I     L+D         F+A  N++E L           E +  L  L I K DQ+R   LT +   +    NL E+ L+ N L+++P  I ++  LT+++L  N++  I     +     L  L L +N ++ +P    +  S++  L+L GN
Sbjct:    3 FRLHNLRKLGLSDNELQRLPPDIANFMHLVDLDMSRNDIAEIPDSI---------------KLCT-----------------C--------------LEVVDFSGNPLTRLPEGFTQLKSLIYLSLNDVSLQGLPDDIGNLSNLVTLELRENLLKTLPTSLHLLVKLEQLDLGNNELETLPGSLGSLPNVRELWLDGNQLEALPSEIGELRRLVCLDISQNRLER---LPDAIGGLAALTD---------FLASQNHLEELP----------EELGKLKHLSILKADQNR---LTHLPEAIGDCENLTELILTENQLVTLPASIGKLTKLTNLNLDKNRLNSIPPE--IGGCGALNVLSLRDNRLTQVPGE-ISGASQIHVLDLAGN 315          

HSP 4 Score: 91.2781 bits (225), Expect = 7.113e-19
Identity = 86/314 (27.39%), Postives = 148/314 (47.13%), Query Frame = 3
Query:  936 FGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFPW----LPESIIDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDIESSFVLEFQDRLESLDLSNNAISALPATAFTKFSKLRYLNLQGNPCKIPPSDVFNCGQM 1865
            F   +NLR L +S+N + +LP D  N + L  L  S N I EIP+       L+++D S N L  LP     ++SL  ++L++      P+ +  +  L ++E+  N ++T+P S+  L +L+  +L  N++++ P     LP ++ +  L  N +E++P   + +L  +  L+IS    + + + +  L +L  F   Q+  ++L E  G+L  L+ LK      N L  +PE I   +NLT                          L L+ N +  LPA+   K +KL  LNL  N     P ++  CG +
Sbjct:    2 FFRLHNLRKLGLSDNELQRLPPDIANFMHLVDLDMSRNDIAEIPDSIKLCTCLEVVDFSGNPLTRLPEGFTQLKSLIYLSLNDVSLQGLPDDIGNLSNLVTLELRENLLKTLPTSLHLLVKLEQLDLGNNELETLPGSLGSLP-NVRELWLDGNQLEALPSE-IGELRRLVCLDISQNRLERLPDAIGGLAALTDFLASQNHLEELPEELGKLKHLSILK---ADQNRLTHLPEAIGDCENLTE-------------------------LILTENQLVTLPAS-IGKLTKLTNLNLDKNRLNSIPPEIGGCGAL 284          
BLAST of SMED30019284 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008894.1 (pep scaffold:Pmarinus_7.0:GL484493:7018:36468:1 gene:ENSPMAG00000008055.1 transcript:ENSPMAT00000008894.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 100.523 bits (249), Expect = 7.698e-22
Identity = 102/414 (24.64%), Postives = 184/414 (44.44%), Query Frame = 3
Query:  195 LEGLIVNGNEIT--EIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFN--TLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIP-SNIGELSSLKYLNLRGNSK-ITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNR--FNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFPWLPESIID---FDLSDNPVESIP 1403
            + G+ ++GN+      P  I  + SL +L L+H  ++ L      L+ L +L +++N LT L   I     L+      N+     +P  + +L +L   D SHN L  VP  + + K +  L L+HN +  +P  +                         L ++L L++ NN L  L   + +L  L  L L+ N  +      +  +++L+ L++R   + ++NLP  +               + L+D          +D+S+N + ++P       +L  L  S+N I E+        +LQ L+LS N+L SLP  +  +  LRK+ +++NR  F   P  + K+  L       N++E IPES+    +L+   L+ N++ + P L   + D    D+ +NP   +P
Sbjct:   10 VRGIDLSGNDFKGGNFPERIGAMSSLRWLKLNHTGLSYLPEELAVLQKLEHLSVSHNQLTTLHSDITALPCLRAIVARANQLTNPGVPPDIFNLEDLSVLDLSHNQLTEVPNELENAKNMLVLNLSHNSIETIPTQL----------------------FINLTDVLYLDLSNNRLDSLPPQMRRLVHLQTLMLNNNPLLHAQLRQLTAMTALETLHMRNTQRTLSNLPTQLEA------------LTHLAD----------VDLSHNELARVPECLYTLSALRRLNLSDNHITELSLCMDQWTQLQTLNLSRNQLTSLPSSISKLAKLRKLFVNSNRLDFEGIPSSVWKLGNLEQFVAADNNLELIPESLCRCAKLKKLVLNKNRLITLPELVHYLTDLEVLDVRENPNLVMP 379          

HSP 2 Score: 86.2705 bits (212), Expect = 2.181e-17
Identity = 111/392 (28.32%), Postives = 182/392 (46.43%), Query Frame = 3
Query:  513 PKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQ--YLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNK-INEIPEVFGSLKKLQILDLSNNE--LDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFPWLPESIIDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGN 1673
            P+ IG++  L  L LNH  LS LPE +  LQ LE L + +N LT L   +  L  L  +    N L    +  DI  L+ L VL+LS N   E+P+ +    ++  LNL  NS I  +P  +              F +L+D       +  LD+SNN +  LP   +  + L  L  +NN  ++       ++  L+ L + N +  L +LP  +E +  L  ++LS+N     PE L  +  L  + ++ N I  +   +   T+LQT NLS N++ S   LP SI               + +AKL  +  +N +  + +GI   V+ L +L+ F    +    L  I   L +   LK++ L+ N L+++PE +  + +L  + +R N
Sbjct:   26 PERIGAMSSLRWLKLNHTGLSYLPEELAVLQKLEHLSVSHNQLTTLHSDITALPCLRAIVARANQLTNPGVPPDIFNLEDLSVLDLSHNQLTEVPNELENAKNMLVLNLSHNS-IETIPTQL--------------FINLTD-------VLYLDLSNNRLDSLPPQMRRLVHLQTLMLNNNPLLHAQLRQLTAMTALETLHMRNTQRTLSNLPTQLEALTHLADVDLSHNELARVPECLYTLSALRRLNLSDNHITELSLCMDQWTQLQTLNLSRNQLTS---LPSSI---------------SKLAKLRKL-FVNSNRLDFEGIPSSVWKLGNLEQFVAADN---NLELIPESLCRCAKLKKLVLNKNRLITLPELVHYLTDLEVLDVREN 373          

HSP 3 Score: 83.5741 bits (205), Expect = 1.211e-16
Identity = 89/344 (25.87%), Postives = 155/344 (45.06%), Query Frame = 3
Query:  174 KLCNCKDLEGLIVNGNEITEIPLAINQLKSLTYLNLSHNYITN--LETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETL-CSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHN--------------------------DLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNN 1118
            +L   + LE L V+ N++T +   I  L  L  +    N +TN  +    F+LE+L  LDL++N LT +   + N   +   N+S N   T+P  L  +L+++L  D S+N L+ +P  +  L  L TL+LN+N                           LS+LP  ++ L +L  + L +N L  +   ++ L  L  LN+ +N +  LS+ + +  +L  LNLS N    +PS+I +L+ L+ L +  N                     + +F  +        NL     ++N++  +P     C  L  L  + N++  +PE+   L  L++LD+  N
Sbjct:   51 ELAVLQKLEHLSVSHNQLTTLHSDITALPCLRAIVARANQLTNPGVPPDIFNLEDLSVLDLSHNQLTEVPNELENAKNMLVLNLSHNSIETIPTQLFINLTDVLYLDLSNNRLDSLPPQMRRLVHLQTLMLNNNPLLHAQLRQLTAMTALETLHMRNTQRTLSNLPTQLEALTHLADVDLSHNELARVPECLYTLSALRRLNLSDNHITELSLCMDQWTQLQTLNLSRNQLTSLPSSISKLAKLRKLFVNSN---------------------RLDFEGIPSSVWKLGNLEQFVAADNNLELIPESLCRCAKLKKLVLNKNRLITLPELVHYLTDLEVLDVREN 373          

HSP 4 Score: 80.4925 bits (197), Expect = 1.155e-15
Identity = 100/393 (25.45%), Postives = 177/393 (45.04%), Query Frame = 3
Query:  660 VFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIP-EVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFP-EILTKIPTLNSIEI--TANDIETIPESIMSLTRLQTFNLSGNKIQSFPWLPESIIDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDIES--SFVLEFQDRLESLDLSNNAISALPATAFTKFSKLRYLNLQGN 1820
            +  + +L  L + +  L YL  ++  L+KL  L++S N    + S+I  L  L+ +  R N ++TN PG                   +  D     +L +LD+S+N +T++P + +N  ++ VL  S+N I  IP ++F +L  +  LDLSNN LDSLP  M  +  L+ + L+NN   +     LT +  L ++ +  T   +  +P  + +LT L                     D DLS N +  +P+  +  L+ +  LN+S+ +                          +TE+   + Q   L+ +NLS N L S+P  I ++  L  + +  N++ D E   S V +  + LE    ++N +  +P +   + +KL+ L L  N
Sbjct:   29 IGAMSSLRWLKLNHTGLSYLPEELAVLQKLEHLSVSHNQLTTLHSDITALPCLRAIVARAN-QLTN-PG-------------------VPPDIFNLEDLSVLDLSHNQLTEVPNELENAKNMLVLNLSHNSIETIPTQLFINLTDVLYLDLSNNRLDSLPPQMRRLVHLQTLMLNNNPLLHAQLRQLTAMTALETLHMRNTQRTLSNLPTQLEALTHL--------------------ADVDLSHNELARVPE-CLYTLSALRRLNLSDNH--------------------------ITELSLCMDQWTQLQTLNLSRNQLTSLPSSISKLAKLRKLFVNSNRL-DFEGIPSSVWKLGN-LEQFVAADNNLELIPES-LCRCAKLKKLVLNKN 350          
BLAST of SMED30019284 vs. Ensembl Sea Lamprey
Match: lgr4 (Danio rerio leucine-rich repeat containing G protein-coupled receptor 4 (lgr4), mRNA. [Source:RefSeq mRNA;Acc:NM_001353862])

HSP 1 Score: 82.4185 bits (202), Expect = 3.429e-16
Identity = 87/303 (28.71%), Postives = 143/303 (47.19%), Query Frame = 3
Query:  954 LRILDISNNHITQLP-IDFKNCLSLAVLKWSNNKINEIPE-VFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKI-PTLNSIEITANDIETIPE-SIMSLTRLQTFNLSGNKIQSFPWLP-----ESIIDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQ-MKNLTSISLRGNKIKDIESSFVLEFQDRLESLDLSNNAISALPATAFTKFSKLRYLNLQGNPCKI 1832
            L+ L ++ N I  +P   F+N   L VL   NN+I  + +  F  L  L+ LDL+ N+L   P  ++ + +LR++   +NR    PE   +  P L +I    N I  + + +  +L  LQT  L G     F  LP      ++    L+   + S+PQ+F  +++ ++ L++SN +       + +L+SL+                G L+    L+EI+L NN L +I E   Q +  L S+ L  NKI+++     L  +  L  LDLS+N +S +P         L +L L GNP  I
Sbjct:   47 LQALTLALNRIAHIPNGAFRNLSGLVVLHLHNNQIQSLGDRCFNGLHNLETLDLNYNQLSQFPKAIKDLPNLRELAFHSNRIEMIPEHAFRSNPLLKTIHFYDNPIRVVGKTAFQNLAELQTLLLRGAAEVDF--LPILNGTTNLESLTLTGTNISSLPQDFCKQMHKLQVLDLSNNH-------IQTLHSLQ----------------GCLA----LEEISLQNNELKAIGEDTFQYLAFLKSLDLSENKIQEVHPHAFLTLRG-LSKLDLSSNGLSWVPTEG---LEGLVHLKLGGNPALI 316          

HSP 2 Score: 51.9878 bits (123), Expect = 7.402e-7
Identity = 76/319 (23.82%), Postives = 137/319 (42.95%), Query Frame = 3
Query:  735 KLKKLIVLNLSFNNFIEIPSN-IGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPE-VFGSLKKLQILDLSNNELDSLP-VIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIM-SLTRLQTFNLSGNKIQSFPWLPESII--DFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGN 1673
            +L  L  L L+ N    IP+     LS L  L+L  N++I +L              D+C        F   +NL  LD++ N ++Q P   K+  +L  L + +N+I  IPE  F S   L+ +   +N +  +     + +  L+ + L      +F  IL     L S+ +T  +I ++P+     + +LQ  +LS N IQ+   L   +   +  L +N +++I ++    L ++++L++S      +    F                 LT        L  L +++LS+N L  +P + L+   L  + L GN
Sbjct:   43 ELPALQALTLALNRIAHIPNGAFRNLSGLVVLHLH-NNQIQSL-------------GDRC--------FNGLHNLETLDLNYNQLSQFPKAIKDLPNLRELAFHSNRIEMIPEHAFRSNPLLKTIHFYDNPIRVVGKTAFQNLAELQTLLLRGAAEVDFLPILNGTTNLESLTLTGTNISSLPQDFCKQMHKLQVLDLSNNHIQTLHSLQGCLALEEISLQNNELKAIGEDTFQYLAFLKSLDLSENKIQEVHPHAF-----------------LT--------LRGLSKLDLSSNGLSWVPTEGLE--GLVHLKLGGN 312          
BLAST of SMED30019284 vs. Ensembl Yeast
Match: CYR1 (Adenylate cyclase; required for cAMP production and cAMP-dependent protein kinase signaling; the cAMP pathway controls a variety of cellular processes, including metabolism, cell cycle, stress response, stationary phase, and sporulation [Source:SGD;Acc:S000003542])

HSP 1 Score: 83.9593 bits (206), Expect = 1.205e-16
Identity = 129/496 (26.01%), Postives = 224/496 (45.16%), Query Frame = 3
Query:  402 LQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFN--NFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCL-SLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPV-IMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFPWLPESIIDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLK-IFKYDQDRGKKLT-----------EIDGRLSQL----NNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDIESSFVLEFQDRLESLDLSNNAISALPATAFTKFSKLRYLNLQGNPCK 1829
            L+  NI  +KF   P  +    +L+S +   N +  VP  I  L  LT L L  N+L  LP    EL+NL++L L +N   +    +    NLL++++  N +Q L      L KL  +NLS N  NFI    ++ E++ L+ LNLR N +I+++               + N S          NL+ L +++N I+    +F++ L  L  L+   N I  I       K +  L L+  +L S+P  ++  +  L K+ L+ N     P+ ++K+  L  + +  N +E IP  +  L  L+T +L  N I+ F                           ++ +ENL +++ N   I    F  +SL+  F ++   G KL+           + D  +  L     NLK +NLS N    +    ++++++T + L GNK+  +    VL++   L++L L++N + +LPA   +  S+L   ++  N  K
Sbjct:  845 LRMVNIRASKF---PSNITKAYKLVSLELQRNFIRKVPNSIMKLSNLTILNLQCNELESLPAGFVELKNLQLLDLSSNKFMHYPEVINYCTNLLQIDLSYNKIQSLPQSTKYLVKLAKMNLSHNKLNFI---GDLSEMTDLRTLNLRYN-RISSI---------------KTNAS----------NLQNLFLTDNRIS----NFEDTLPKLRALEIQENPITSISFKDFYPKNMTSLTLNKAQLSSIPGELLTKLSFLEKLELNQNNLTRLPQEISKLTKLVFLSVARNKLEYIPPELSQLKSLRTLDLHSNNIRDF---------------------------VDGMENLELTSLN---ISSNAFGNSSLENSFYHNMSYGSKLSKSLMFFIAADNQFDDAMWPLFNCFVNLKVLNLSYNNFSDVSH--MKLESITELYLSGNKLTTLSGDTVLKWSS-LKTLMLNSNQMLSLPA-ELSNLSQLSVFDVGANQLK 1270          

HSP 2 Score: 78.5666 bits (192), Expect = 4.876e-15
Identity = 106/428 (24.77%), Postives = 197/428 (46.03%), Query Frame = 3
Query:  195 LEGLIVNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLT-----------------------TLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNL-----------------------LELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINE-IPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFP-EILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQ 1334
            L  L +  N I ++P +I +L +LT LNL  N + +L   F +L+NL  LDL++N      E+I   + L   ++S NK  +LP++   L +L   + SHN LNF    IG L ++T                        L L  N +S+  +T+ +L+ LEI +    +++    Y   + +L                       LELN   N+L  L  +I KL KL+ L+++ N    IP  + +L SL+ L+L  N+ I +    +  + L+ L I    F + S +  +Y+N+                 K   SL     ++N+ ++ +  +F     L++L+LS N    +  +   +ES+ ++ LS N+      + + K  +L ++ + +N + ++P  + +L++L  F++  N+++
Sbjct:  865 LVSLELQRNFIRKVPNSIMKLSNLTILNLQCNELESLPAGFVELKNLQLLDLSSNKFMHYPEVINYCTNLLQIDLSYNKIQSLPQSTKYLVKLAKMNLSHNKLNF----IGDLSEMTDLRTLNLRYNRISSIKTNASNLQNLFLTDNRISNFEDTLPKLRALEIQENPITSISFKDFYPKNMTSLTLNKAQLSSIPGELLTKLSFLEKLELN--QNNLTRLPQEISKLTKLVFLSVARNKLEYIPPELSQLKSLRTLDLHSNN-IRDFVDGMENLELTSLNISSNAFGNSSLENSFYHNMS-------------YGSKLSKSLMFFIAADNQFDDAMWPLFNCFVNLKVLNLSYNNFSDVSHMK--LESITELYLSGNKLTTLSGDTVLKWSSLKTLMLNSNQMLSLPAELSNLSQLSVFDVGANQLK 1270          

HSP 3 Score: 75.0998 bits (183), Expect = 5.507e-14
Identity = 77/301 (25.58%), Postives = 140/301 (46.51%), Query Frame = 3
Query:  951 NLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFPWLPESIIDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLS----QLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDIESSFVLEFQDRLESLDLSNNAISALPATAFTKFSKLRYLNLQGNPCK-IPP 1838
            +LR+++I     ++ P +      L  L+   N I ++P     L  L IL+L  NEL+SLP     +++L+ ++LS+N+F ++PE++     L  I+++ N I+++P+S   L +L   NLS NK+                         NF+  L+ + +L   N             N +   K +    + L   D R+S     L  L+ + +  N + SI  +    KN+TS++L   ++  I    + +    LE L+L+ N ++ LP    +K +KL +L++  N  + IPP
Sbjct:  844 SLRMVNI---RASKFPSNITKAYKLVSLELQRNFIRKVPNSIMKLSNLTILNLQCNELESLPAGFVELKNLQLLDLSSNKFMHYPEVINYCTNLLQIDLSYNKIQSLPQSTKYLVKLAKMNLSHNKL-------------------------NFIGDLSEMTDLRTLN----------LRYNRISSIKTNASNLQNLFLTDNRISNFEDTLPKLRALEIQENPITSISFKDFYPKNMTSLTLNKAQLSSIPGELLTKLS-FLEKLELNQNNLTRLPQ-EISKLTKLVFLSVARNKLEYIPP 1104          
BLAST of SMED30019284 vs. Ensembl Yeast
Match: SOG2 (Key component of the RAM signaling network; required for proper cell morphogenesis and cell separation after mitosis [Source:SGD;Acc:S000005880])

HSP 1 Score: 62.3882 bits (150), Expect = 3.056e-10
Identity = 36/95 (37.89%), Postives = 55/95 (57.89%), Query Frame = 3
Query:  912 NFSSLSD-DFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLP--VIMEYMESLRKINLSNN 1187
            N  S+SD D GY  N+  L +  NH+T LP  FK    L  L   NN   EIP +     +L+ILDLS+NE+++LP  +   + +++R ++L +N
Sbjct:   53 NIKSISDEDVGYIQNVERLSLRKNHLTSLPASFKRLSRLQYLDLHNNNFKEIPYILTQCPQLEILDLSSNEIEALPDEISSFWQDNIRVLSLKDN 147          
BLAST of SMED30019284 vs. Ensembl Yeast
Match: CCR4 (Component of the CCR4-NOT transcriptional complex; CCR4-NOT is involved in regulation of gene expression; component of the major cytoplasmic deadenylase, which is involved in mRNA poly(A) tail shortening [Source:SGD;Acc:S000000019])

HSP 1 Score: 51.9878 bits (123), Expect = 5.467e-7
Identity = 30/78 (38.46%), Postives = 40/78 (51.28%), Query Frame = 3
Query:  195 LEGLIVNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGN 428
            L  L +NGN +TE+P  I  L +L  L+LSHN +T+L         L Y    +N +T L    GN   LQF  + GN
Sbjct:  359 LTRLYLNGNSLTELPAEIKNLSNLRVLDLSHNRLTSLPAELGSCFQLKYFYFFDNMVTTLPWEFGNLCNLQFLGVEGN 436          
BLAST of SMED30019284 vs. Ensembl Nematostella
Match: EDO37499 (Leucine-rich repeat protein soc-2 homolog [Source:UniProtKB/Swiss-Prot;Acc:A7SFP1])

HSP 1 Score: 145.206 bits (365), Expect = 4.109e-36
Identity = 129/454 (28.41%), Postives = 234/454 (51.54%), Query Frame = 3
Query:   84 EEIDNINEDFFEKEKINILNCSYSKVKKIGKLCNCKDLEGLIVNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDI-GKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLN--LRGNSKITNLP-GXXXXXXXXXXXXDQCN-FSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNK-IQSFPW---LPESIIDFDLSDNPVESIPQNFMA 1418
            +E+ ++ E +    +I +L        ++G L N   LE L ++ N +T +P  + +L  L  L+L HN I  +    + L  L  L L  N ++V+   IGN   L+  ++  NK   LP  +  L  L++ D SHNH+  +P  IG+   +T+L L HND+  LP++I  L  +  L L  N L++L   +     + E NI  N++  L   +   LK L  L LS N F   P+  G       +N  +  ++++  +P G          L  + N  +SL  DFG + +L  L+++ N I++LP D +  ++L VL  SNN + ++P   G+L+KL++LD+  N+L+S+P  +EY+ SL ++ L +N   + P  +  + ++  + +  N++ ++P+ I ++  L+   L+ N+ +QS P+   L  S+    + + P+ ++P   +A
Sbjct:  106 KELTSLRELYLYGNRIAVLP------PEVGLLPN---LETLALSENNLTTLPDNLVKLTKLKVLDLRHNKIKEIPDVIYKLTTLTTLYLRFNRISVVESGIGNLKLLERLSLRENKIKILPRVIGQLVHLVTLDISHNHIENLPAEIGNCVHMTSLDLQHNDIPSLPDSIGRLTAMTRLGLRYNQLSSLPDSLANCSGIDEFNIEGNNIAELPEKLLSSLKNLTSLTLSRNKFEVFPA--GPPKQFCQVNTFIMEHNRMQKIPFGVFNKAKYLSKLNVKDNQLTSLPLDFGSWISLVELNVATNQISKLPEDIQWLVNLEVLILSNNLLKKLPRGIGALRKLRVLDIEENKLESIPTEIEYLRSLERLVLQSNCLGSLPRSIGYLSSVTYLSVGENELVSVPQEIGNMESLEQLYLNDNENLQSLPYELVLCGSLQIMSIENCPLSALPSQIVA 548          

HSP 2 Score: 106.301 bits (264), Expect = 1.538e-23
Identity = 132/544 (24.26%), Postives = 230/544 (42.28%), Query Frame = 3
Query:  327 ENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPE-VFGSLKKLQILDLSNNELDSLPV------------IMEY-------------MESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFPWLPESIID---FDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDIES-SFVLEFQDRLESLDLSNNAISALPATAFTKFSKL--RYLNLQGN-----PCKIPPSDV 1847
            E    LDL+   +TVL + +   + L+   + GN+   LP  +  L  L +   S N+L  +P  +  L +L  L L HN + ++P+ I +L  L  L L  N ++ +   +  L  L  L++  N ++ L   IG+L  L+ L++S N+   +P+ IG    +  L+L+ N                       +  SL D  G    +  L +  N ++ LP    NC  +       N I E+PE +  SLK L  L LS N+ +  P             IME+              + L K+N+ +N+  + P       +L  + +  N I  +PE I  L  L+   LS N ++  P    ++      D+ +N +ESIP     ++ Y+ +L            +V   N              L  +   +  L+++  +++  N L+S+P++I  M++L  + L  N  ++++S  + L     L+ + + N  +SALP+        L  +YL LQG         +P SDV
Sbjct:   86 EGATRLDLSKAAVTVLPKELKELTSLRELYLYGNRIAVLPPEVGLLPNLETLALSENNLTTLPDNLVKLTKLKVLDLRHNKIKEIPDVIYKLTTLTTLYLRFNRISVVESGIGNLKLLERLSLRENKIKILPRVIGQLVHLVTLDISHNHIENLPAEIGNCVHMTSLDLQHN-----------------------DIPSLPDSIGRLTAMTRLGLRYNQLSSLPDSLANCSGIDEFNIEGNNIAELPEKLLSSLKNLTSLTLSRNKFEVFPAGPPKQFCQVNTFIMEHNRMQKIPFGVFNKAKYLSKLNVKDNQLTSLPLDFGSWISLVELNVATNQISKLPEDIQWLVNLEVLILSNNLLKKLPRGIGALRKLRVLDIEENKLESIP----TEIEYLRSLE----------RLVLQSNC-------------LGSLPRSIGYLSSVTYLSVGENELVSVPQEIGNMESLEQLYLNDN--ENLQSLPYELVLCGSLQIMSIENCPLSALPSQIVAGGPSLVIQYLRLQGPYNGMVDTGVPTSDV 577          
BLAST of SMED30019284 vs. Ensembl Nematostella
Match: EDO46974 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNR2])

HSP 1 Score: 138.658 bits (348), Expect = 5.559e-35
Identity = 116/358 (32.40%), Postives = 184/358 (51.40%), Query Frame = 3
Query:  189 KDLEGLIVNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNN-----------------------FIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCN-FSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNR 1190
            K LE + ++ N++ ++P  +  L++L  L LS N +T L +   +L NL  LD + N +  + E I +   LQ  + S N    +PET C L+ L     +   L+F+P   G L  L  L L  N L  LP+++ +L+NLE L +GNN  T L   V  L+NL EL + +N ++ L  +IG L++L+ L++S N                         IEIP  IG L  L+ L L  N  +  LP SI  +   E LI  CN   SL    GY   LR+L+I  N +  +P +  +C ++ +L   +N++  +P+  G + KLQ+++L++N L+ LP     + SL+ + LS N+
Sbjct:   25 KALEEVYLDANQLRDLPRGLFNLQNLQVLGLSDNELTILPSVLSNLVNLRILDFSKNGIIDIPETIKHCKNLQEIDASVNPIGKIPETFCHLANLTHLYLNDAFLDFLPGNFGRLISLRILELRENHLRVLPKSMSQLKNLERLDIGNNEFTELPMVVGCLLNLTELWMDSNAIKELRPEIGLLRRLMFLDVSKNRLEWLPPEIESLQSLTDLYLSNNLLIEIPEQIGALGKLQTLKLEEN-HLGELPNSIGKLVELEELILTCNELVSLPPSLGYLRKLRVLNIDENFLESIPSELGSCTAMTILSLRDNRLVHLPDSIGRMPKLQVINLASNRLEYLPYSFHKLVSLKALWLSENQ 381          

HSP 2 Score: 102.834 bits (255), Expect = 5.301e-23
Identity = 108/424 (25.47%), Postives = 173/424 (40.80%), Query Frame = 3
Query:  417 ISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFPWLPESIIDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDI 1688
            +  N+   LP  L +L  L     S N L  +P  + +L  L  L  + N + D+PETIK  +NL+ +    N +  +      L NL  L                      LN +F +F+  P N G L SL+ L LR N                       +   L        NL  LDI NN  T+LP+     L+L  L   +N I E+    G L++L  LD+S N L+ LP  +E ++SL  + LSNN     PE +  +  L ++++  N +  +P SI  L  L+   L+ N++ S P                          L Y+  L + N + + +  I   L S         R  +L  +   + ++  L+ INL++N L  +P    ++ +L ++ L  N+ K +
Sbjct:   32 LDANQLRDLPRGLFNLQNLQVLGLSDNELTILPSVLSNLVNLRILDFSKNGIIDIPETIKHCKNLQEIDASVNPIGKIPETFCHLANLTHL---------------------YLNDAFLDFL--PGNFGRLISLRILELREN-----------------------HLRVLPKSMSQLKNLERLDIGNNEFTELPMVVGCLLNLTELWMDSNAIKELRPEIGLLRRLMFLDVSKNRLEWLPPEIESLQSLTDLYLSNNLLIEIPEQIGALGKLQTLKLEENHLGELPNSIGKLVELEELILTCNELVSLP------------------------PSLGYLRKLRVLNIDENFLESIPSELGSCTAMTILSLRDNRLVHLPDSIGRMPKLQVINLASNRLEYLPYSFHKLVSLKALWLSENQSKPM 385          

HSP 3 Score: 101.679 bits (252), Expect = 1.185e-22
Identity = 93/304 (30.59%), Postives = 147/304 (48.36%), Query Frame = 3
Query:  153 SKVKKIGKL----CNCKDLEGLIVNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNK 1052
            + V  IGK+    C+  +L  L +N   +  +P    +L SL  L L  N++  L  +   L+NL  LD+ NN  T L  ++G    L    +  N    L   +  L  L+  D S N L ++P  I SL+ LT L L++N L ++PE I  L  L+ L+L  N+L  L + + +LV L EL +  N+L  L   +G L+KL VLN+  N    IPS +G  +++  L+LR N ++ +LP                      D  G    L+++++++N +  LP  F   +SL  L  S N+
Sbjct:  101 ASVNPIGKIPETFCHLANLTHLYLNDAFLDFLPGNFGRLISLRILELRENHLRVLPKSMSQLKNLERLDIGNNEFTELPMVVGCLLNLTELWMDSNAIKELRPEIGLLRRLMFLDVSKNRLEWLPPEIESLQSLTDLYLSNNLLIEIPEQIGALGKLQTLKLEENHLGELPNSIGKLVELEELILTCNELVSLPPSLGYLRKLRVLNIDENFLESIPSELGSCTAMTILSLRDN-RLVHLP----------------------DSIGRMPKLQVINLASNRLEYLPYSFHKLVSLKALWLSENQ 381          

HSP 4 Score: 92.8189 bits (229), Expect = 8.473e-20
Identity = 89/322 (27.64%), Postives = 151/322 (46.89%), Query Frame = 3
Query:  951 NLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVF-----------------------GSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFPWLP------ESIIDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDIESSFVLEFQDRLESLDLSNNAISALPATAFTKFSKLRYLNLQGNPCK 1829
            NLRILD S N I  +P   K+C +L  +  S N I +IPE F                       G L  L+IL+L  N L  LP  M  +++L ++++ NN F   P ++  +  L  + + +N I+ +   I  L RL   ++S N+++   WLP      +S+ D  LS+N +  IP+   A L  ++ L +   +   + E+  S+  L   +       +L  +   L  L  L+ +N+  N L SIP ++     +T +SLR N++  +  S  +    +L+ ++L++N +  LP  +F K   L+ L L  N  K
Sbjct:   72 NLRILDFSKNGIIDIPETIKHCKNLQEIDASVNPIGKIPETFCHLANLTHLYLNDAFLDFLPGNFGRLISLRILELRENHLRVLPKSMSQLKNLERLDIGNNEFTELPMVVGCLLNLTELWMDSNAIKELRPEIGLLRRLMFLDVSKNRLE---WLPPEIESLQSLTDLYLSNNLLIEIPEQIGA-LGKLQTLKLEENH---LGELPNSIGKLVELEELILTCNELVSLPPSLGYLRKLRVLNIDENFLESIPSELGSCTAMTILSLRDNRLVHLPDS--IGRMPKLQVINLASNRLEYLPY-SFHKLVSLKALWLSENQSK 383          

HSP 5 Score: 90.1225 bits (222), Expect = 6.551e-19
Identity = 86/296 (29.05%), Postives = 141/296 (47.64%), Query Frame = 3
Query:   15 ECDDLKYFNASTNE-DKIFKT-----------LTKEEIDNINEDFFEKEKINILNCSYSKVKKIGK-LCNCKDLEGLIVNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLP 863
             C +L+  +AS N   KI +T           L    +D +  +F     + IL    + ++ + K +   K+LE L +  NE TE+P+ +  L +LT L +  N I  L      L  L++LD++ N L  L   I +   L    +S N    +PE + +L +L +     NHL  +P  IG L +L  LIL  N+L  LP ++  L+ L +L +  N L ++   +     +  L++ +N L +L   IG++ KL V+NL+ N    +P +  +L SLK L L  N     +P
Sbjct:   92 HCKNLQEIDASVNPIGKIPETFCHLANLTHLYLNDAFLDFLPGNFGRLISLRILELRENHLRVLPKSMSQLKNLERLDIGNNEFTELPMVVGCLLNLTELWMDSNAIKELRPEIGLLRRLMFLDVSKNRLEWLPPEIESLQSLTDLYLSNNLLIEIPEQIGALGKLQTLKLEENHLGELPNSIGKLVELEELILTCNELVSLPPSLGYLRKLRVLNIDENFLESIPSELGSCTAMTILSLRDNRLVHLPDSIGRMPKLQVINLASNRLEYLPYSFHKLVSLKALWLSENQSKPMIP 387          

HSP 6 Score: 86.6557 bits (213), Expect = 8.413e-18
Identity = 78/311 (25.08%), Postives = 145/311 (46.62%), Query Frame = 3
Query:  939 GYYN--NLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFPWLPESIIDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDIESSFVLEFQDRLESLDLSNNAISALPATAFTKFSKLRYLNLQGNPCKIPPSDVFNCGQM 1865
            G +N  NL++L +S+N +T LP    N ++L +L +S N I +IPE     K LQ +D S N +  +P    ++ +L  + L++   +  P    ++ +L  +E+  N +  +P+S+  L  L+  ++  N+    P +   ++                        NL     +S+ I E+   +  L+   +      +L  +   +  L +L ++ LSNN L+ IPEQI  +  L ++ L  N + ++ +S     +  LE L L+ N + +LP  +     KLR LN+  N  +  PS++ +C  M
Sbjct:   43 GLFNLQNLQVLGLSDNELTILPSVLSNLVNLRILDFSKNGIIDIPETIKHCKNLQEIDASVNPIGKIPETFCHLANLTHLYLNDAFLDFLPGNFGRLISLRILELRENHLRVLPKSMSQLKNLERLDIGNNEFTELPMVVGCLL------------------------NLTELWMDSNAIKELRPEIGLLRRLMFLDVSKNRLEWLPPEIESLQSLTDLYLSNNLLIEIPEQIGALGKLQTLKLEENHLGELPNSIGKLVE--LEELILTCNELVSLPP-SLGYLRKLRVLNIDENFLESIPSELGSCTAM 326          
BLAST of SMED30019284 vs. Ensembl Nematostella
Match: EDO48217 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKB1])

HSP 1 Score: 136.346 bits (342), Expect = 3.719e-33
Identity = 146/545 (26.79%), Postives = 244/545 (44.77%), Query Frame = 3
Query:  264 LTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSL-SDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSL--PVIME----YMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFP------WLPESIIDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDIESSFVLEFQDRLESLDLSNNAISALPATAFTKFSKLRYLNLQGNPCKIPPSDVFNCG 1859
            LT L L+ N +T +    F+L  L+ LD+ +N LT L E IG+ S LQ  N+  NK ++LP ++  L  L S    HN    +   +GSL+ L  L +++N +S LP                         +  L +L  LN+ NN L+ L  +   L+ L  LN+S N     P  +  + SL+ L+ R N  +T++P      SL EL +     + L S  F  Y+ L +LD+ +N +T +P D      L  L  +NN I+ +P   G++  L+ L L+ N L  L   ++M      M+ L+     ++   + P+    +  L S+ + ++        + +L   +T N SG K  S P       +   +   D S N +  +P+   A  + + +LN+       +   + S   L+       R  +L+ +    + L +L+EI +S N    +P  +  M +L ++    N+I  I+   +L     LE+LDL NN IS +P         L+ L L GNP + P + +   G
Sbjct:   79 LTKLILASNSLTEISGDVFNLPALVLLDIHDNSLTTLPEEIGSLSCLQKLNLGHNKISSLPMSMAQLESLCSLKLEHNSFKSLECWLGSLRNLEELDVSYNMVSSLPS------------------------LAGLKHLRTLNLSNNALEMLPPEFDHLQALDDLNISSNKICNFPGKLYNMKSLRRLDCRQN-HLTSVPSVGQCPSLKELYLAYNKIAELDSKVFAGYSGLTVLDLHDNLLTSIPEDIIILRDLERLDLTNNDISGLPYKIGNMSNLKSLVLNGNPLRELRRDIVMRGTQAIMKHLKSRIPDDDGATDQPD--ASVAPLPSVSMGSSGAVV---DMHTLGHTKTLNYSGKKSASIPVEVLEAAVTSEVKTVDFSKNMLTDLPERITALSSSVSDLNLGFNKITSLPSGICSFTQLEFLDL---RNNQLSSLPDGFASLRSLREIIISYNRFSCLPPVLYSMTSLRTLLACDNQIAVIDVDGLLRMS-VLETLDLQNNNISQVPP-ELGNVRGLKALQLGGNPFRTPRAAILAKG 588          

HSP 2 Score: 101.679 bits (252), Expect = 4.418e-22
Identity = 144/547 (26.33%), Postives = 223/547 (40.77%), Query Frame = 3
Query:   72 TLTKEEIDNINEDFFEKEKINILNC----------------SYSKVKKIGKLCNCKDLEGLIVNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLE-----------------------NLIYLDLANNHLTVLSELIG-------------------NFSKLQF---FNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETI-KELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNI---GELSSLKYLNLR----------GNSKITNLPGXXXXXXXXXX------XXDQCNFSSLSD--------DFGYYNNLRILDISNNHITQLPIDFKNCLSLAV--LKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIP-ESIMSLTRLQTFNLSGNKIQSFPWLPE-----SIIDFDLSDNPVESIPQNFMAK 1421
            T   E++  IN D  E+ K   L+C                S S  +  G + N   L  L ++ N +T +P  I  L  L  LNL HN I++L  +   LE                       NL  LD++ N ++ L  L G                    F  LQ     NIS NK    P  L ++  L   DC  NHL  VP  +G    L  L L +N +++L   +      L +L L +N LT++   +  L +L  L++ NND+  L   IG +  L  L L+ N   E+  +I   G  + +K+L  R           ++ +  LP   +  S + +           N+S            +    + ++ +D S N +T LP +    LS +V  L    NKI  +P    S  +L+ LDL NN+L SLP     + SLR+I +S NRF+  P +L  + +L ++    N I  I  + ++ ++ L+T +L  N I   P  PE      +    L  NP  +     +AK
Sbjct:   45 TEVPEKVWRINLDVPEEAKSVSLDCEDRWWDQVDLTKLILASNSLTEISGDVFNLPALVLLDIHDNSLTTLPEEIGSLSCLQKLNLGHNKISSLPMSMAQLESLCSLKLEHNSFKSLECWLGSLRNLEELDVSYNMVSSLPSLAGLKHLRTLNLSNNALEMLPPEFDHLQALDDLNISSNKICNFPGKLYNMKSLRRLDCRQNHLTSVPS-VGQCPSLKELYLAYNKIAELDSKVFAGYSGLTVLDLHDNLLTSIPEDIIILRDLERLDLTNNDISGLPYKIGNMSNLKSLVLNGNPLRELRRDIVMRGTQAIMKHLKSRIPDDDGATDQPDASVAPLPSVSMGSSGAVVDMHTLGHTKTLNYSGKKSASIPVEVLEAAVTSEVKTVDFSKNMLTDLP-ERITALSSSVSDLNLGFNKITSLPSGICSFTQLEFLDLRNNQLSSLPDGFASLRSLREIIISYNRFSCLPPVLYSMTSLRTLLACDNQIAVIDVDGLLRMSVLETLDLQNNNISQVP--PELGNVRGLKALQLGGNPFRTPRAAILAK 587          

HSP 3 Score: 89.3521 bits (220), Expect = 3.265e-18
Identity = 88/294 (29.93%), Postives = 145/294 (49.32%), Query Frame = 3
Query:  951 NLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFPWLPESIIDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQ-MKNLTSISLRGNKIKDIESSFVLEFQDRLESLDLSNNAISALPATAFTKFSKLRYLNLQGNPCK 1829
            +L  L +++N +T++  D  N  +L +L   +N +  +PE  GSL  LQ L+L +N++ SLP+ M  +ESL  + L +N F +    L  +  L  ++++ N + ++P S+  L  L+T NLS N ++  P  PE    FD                L  +++LNIS   S+ I      L ++K  +    R   LT +   + Q  +LKE+ L+ N +  +  ++      LT + L  N +  I    ++  +D LE LDL+NN IS LP       S L+ L L GNP +
Sbjct:   78 DLTKLILASNSLTEISGDVFNLPALVLLDIHDNSLTTLPEEIGSLSCLQKLNLGHNKISSLPMSMAQLESLCSLKLEHNSFKSLECWLGSLRNLEELDVSYNMVSSLP-SLAGLKHLRTLNLSNNALEMLP--PE----FD---------------HLQALDDLNIS---SNKICNFPGKLYNMKSLRRLDCRQNHLTSVPS-VGQCPSLKELYLAYNKIAELDSKVFAGYSGLTVLDLHDNLLTSIPEDIII-LRD-LERLDLTNNDISGLP-YKIGNMSNLKSLVLNGNPLR 342          
BLAST of SMED30019284 vs. Ensembl Nematostella
Match: EDO38039 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SE32])

HSP 1 Score: 123.635 bits (309), Expect = 6.325e-30
Identity = 132/458 (28.82%), Postives = 206/458 (44.98%), Query Frame = 3
Query:  219 NEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXX-XXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHI--TQLPIDFKNC--LSLAVLKWSNNKINEIPEVFGSLKKLQILDLS-------------NNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFPWLPE------SIIDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYD 1520
            N++  +P  +  L SLT L L+ N +T+L   F  L NL  L L  N L  L E +G  SKL+  N++GNK   L +                       G G L  LT L ++ NDLS+L  +   ++NL++                       L + +N ++ L  D G L+KL V+NLS NN  ++P + G L  LK  ++ GN  I NLP        L  L  D  N + L D FG   N+  L +S+N +  + LP  F +    +L+ L  S N+I ++P+  G LK+L+ L L               N L  LP     M +L K++L  N+    P+    +  L  +++  N IE +P+S  +L++L    LS N +     LPE      S+++  L  N + S+P +F A L  ++ L++       I  ++  L +L     D
Sbjct:    9 NDLQRLPDDLGSLASLTELYLTGNLLTSLPDVFARLGNLTELHLNENSLEELPESLGKLSKLRVLNLTGNKLEKLRDDF---------------------GAG-LASLTELRIDENDLSELSVSFTLMKNLKV-----------------------LELGDNHIERLPEDFGNLRKLEVVNLSQNNIEKLPESFGFLCCLKSFDITGN-HIENLPERFESACFLEHLYADNNNITWLPDWFGDLPNIINLCLSDNELSDSALPDHFGSISGKTLSSLDLSGNRITKLPDSMGELKELKTLHLGSTINELERRAFQNGNWLSHLPDSFSQMANLTKLHLDENQVVCLPDDFGDLVNLEWLDVGQNRIEMLPDSFCNLSKLWFLQLSKNHLTE---LPENFGNLTSLVELRLDSNQLSSLPASF-ANLTNVKTLDLYRNKLSEIPRVLLKLENLMRLDLD 416          

HSP 2 Score: 122.479 bits (306), Expect = 1.305e-29
Identity = 107/351 (30.48%), Postives = 174/351 (49.57%), Query Frame = 3
Query:  255 LKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQ--YLSMDIGKL--KKLIVLNLSFNNFIEIPSNIGELSSLKYLNL------------RGNSKITNLPGX-XXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITAN 1256
            L SLT L +  N ++ L  +F  ++NL  L+L +NH+  L E  GN  KL+  N+S N    LPE+   L  L SFD + NH+  +P+   S   L  L  ++N+++ LP+                       +  +L N++ L + +N+L    L    G +  K L  L+LS N   ++P ++GEL  LK L+L            +  + +++LP S   + +L++L +D+     L DDFG   NL  LD+  N I  LP  F N   L  L+ S N + E+PE FG+L  L  L L +N+L SLP     + +++ ++L  N+ +  P +L K+  L  +++  N
Sbjct:   91 LASLTELRIDENDLSELSVSFTLMKNLKVLELGDNHIERLPEDFGNLRKLEVVNLSQNNIEKLPESFGFLCCLKSFDITGNHIENLPERFESACFLEHLYADNNNITWLPD-----------------------WFGDLPNIINLCLSDNELSDSALPDHFGSISGKTLSSLDLSGNRITKLPDSMGELKELKTLHLGSTINELERRAFQNGNWLSHLPDSFSQMANLTKLHLDENQVVCLPDDFGDLVNLEWLDVGQNRIEMLPDSFCNLSKLWFLQLSKNHLTELPENFGNLTSLVELRLDSNQLSSLPASFANLTNVKTLDLYRNKLSEIPRVLLKLENLMRLDLDGN 418          

HSP 3 Score: 114.005 bits (284), Expect = 1.087e-26
Identity = 125/465 (26.88%), Postives = 210/465 (45.16%), Query Frame = 3
Query:  540 LTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGE-LSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDI--ETIPESIMSLT--RLQTFNLSGNKIQSFPWLPESIIDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDIESSFVLEFQDRLESLDLSNNAISALPATAFTKFSKLRYLNLQGNPCKIPPSDVFNCGQMIPICSYLTAYNEFDATIL 1919
            +TTL L+ NDL  LP+ +  L +L  L L  N LT+L      L NL EL++  N L+ L   +GKL KL VLNL+ N   ++  + G  L+SL  L +                       D+ + S LS  F    NL++L++ +NHI +LP DF N   L V+  S N I ++PE FG L  L+  D++ N +++LP   E    L  +   NN     P+    +P + ++ ++ N++    +P+   S++   L + +LSGN+I   P                     + M +L  ++ L++ +T           +N L+   +    G  L+ +    SQ+ NL +++L  N ++ +P+    + NL  + +  N+I+ +  SF      +L  L LS N ++ LP   F   + L  L L  N     P+   N   +  +  Y    +E    +L
Sbjct:    1 ITTLKLDFNDLQRLPDDLGSLASLTELYLTGNLLTSLPDVFARLGNLTELHLNENSLEELPESLGKLSKLRVLNLTGNKLEKLRDDFGAGLASLTELRI-----------------------DENDLSELSVSFTLMKNLKVLELGDNHIERLPEDFGNLRKLEVVNLSQNNIEKLPESFGFLCCLKSFDITGNHIENLPERFESACFLEHLYADNNNITWLPDWFGDLPNIINLCLSDNELSDSALPDHFGSISGKTLSSLDLSGNRITKLP---------------------DSMGELKELKTLHLGST-----------INELERRAFQN--GNWLSHLPDSFSQMANLTKLHLDENQVVCLPDDFGDLVNLEWLDVGQNRIEMLPDSFC--NLSKLWFLQLSKNHLTELPEN-FGNLTSLVELRLDSNQLSSLPASFANLTNVKTLDLYRNKLSEIPRVLL 405          

HSP 4 Score: 113.235 bits (282), Expect = 1.822e-26
Identity = 119/461 (25.81%), Postives = 203/461 (44.03%), Query Frame = 3
Query:  357 NHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNEL--DSLPVIMEYM--ESLRKINLSNNRFNNFPEILTKIPTLNSIEI--TANDIET-----------IPESIMSLTRLQTFNLSGNKIQSFPWLPESIID---FDLSDNPVESIPQNF--MAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGN 1673
            N L  L + +G+ + L    ++GN   +LP+    L  L     + N L  +P+ +G L +L  L L  N L  L +                       +   L +L EL I  NDL  LS+    +K L VL L  N+   +P + G L  L+ +NL                        Q N   L + FG+   L+  DI+ NHI  LP  F++   L  L   NN I  +P+ FG L  +  L LS+NEL   +LP     +  ++L  ++LS NR    P+ + ++  L ++ +  T N++E            +P+S   +  L   +L  N++   P     +++    D+  N +E +P +F  ++KL +++   +S  +   + E   +L SL   + D +   +L+ +    + L N+K ++L  N L  IP  +L+++NL  + L GN
Sbjct:    9 NDLQRLPDDLGSLASLTELYLTGNLLTSLPDVFARLGNLTELHLNENSLEELPESLGKLSKLRVLNLTGNKLEKLRDD----------------------FGAGLASLTELRIDENDLSELSVSFTLMKNLKVLELGDNHIERLPEDFGNLRKLEVVNLS-----------------------QNNIEKLPESFGFLCCLKSFDITGNHIENLPERFESACFLEHLYADNNNITWLPDWFGDLPNIINLCLSDNELSDSALPDHFGSISGKTLSSLDLSGNRITKLPDSMGELKELKTLHLGSTINELERRAFQNGNWLSHLPDSFSQMANLTKLHLDENQVVCLPDDFGDLVNLEWLDVGQNRIEMLPDSFCNLSKLWFLQ---LSKNHLTELPENFGNLTSLVELRLDSN---QLSSLPASFANLTNVKTLDLYRNKLSEIPRVLLKLENLMRLDLDGN 418          

HSP 5 Score: 78.1814 bits (191), Expect = 6.081e-15
Identity = 46/133 (34.59%), Postives = 73/133 (54.89%), Query Frame = 3
Query:  213 NGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNL 611
            NGN ++ +P + +Q+ +LT L+L  N +  L   F DL NL +LD+  N + +L +   N SKL F  +S N    LPE   +L+ L+      N L+ +P    +L  + TL L  N LS++P  + +L+NL
Sbjct:  278 NGNWLSHLPDSFSQMANLTKLHLDENQVVCLPDDFGDLVNLEWLDVGQNRIEMLPDSFCNLSKLWFLQLSKNHLTELPENFGNLTSLVELRLDSNQLSSLPASFANLTNVKTLDLYRNKLSEIPRVLLKLENL 410          
BLAST of SMED30019284 vs. Ensembl Nematostella
Match: EDO33432 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SS78])

HSP 1 Score: 110.923 bits (276), Expect = 1.236e-24
Identity = 101/343 (29.45%), Postives = 153/343 (44.61%), Query Frame = 3
Query:  315 FFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFP 1343
            FF L N+  L L++N +  L   +GN + LQ F+IS N    +PE +     L+S D S N ++ +P G   L+ LTTL LN   L  LP  I  L  L +                       L    N +++L + +  L KL  L+L  N   E+P  +G L SL    L GN                          +L  + G    L+I D+S N I  LP +   C SL  L  S N + E+P+  G LKKLQ+L +  N L +L   +    +L+++ L+ N  +  P  + K+  L+ + +  N +E +P  + S T+L  F+L  N +Q  P
Sbjct:    2 FFRLYNIRRLGLSDNEIARLPPEVGNLANLQEFDISRNDICDIPENIKYCKSLVSLDLSGNPISKLPDGFSQLQHLTTLCLNDVSLIRLPPDIGSLTELTV-----------------------LEARENLIKFLPVSLAFLSKLERLDLGCNELEELPDVVGSLPSLAEFWLDGNL-----------------------LKTLPTEIGNLKKLQIFDVSENKIEYLPDEICFCGSLTDLHLSQNLLEELPDTIGKLKKLQLLKVDQNRLITLTPAIGGCIALQELILTENLLDVLPSTMGKLHKLSLLNVDRNRLEVLPVELGSCTKLSVFSLRDNLLQRLP 298          

HSP 2 Score: 102.834 bits (255), Expect = 3.907e-22
Identity = 105/364 (28.85%), Postives = 169/364 (46.43%), Query Frame = 3
Query:  111 FFEKEKINILNCSYSKVKK----IGKLCNCKDLEGLIVNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNR 1190
            FF    I  L  S +++ +    +G L N ++ +   ++ N+I +IP  I   KSL  L+LS N I+ L   F  L++L  L L +  L  L   IG+ ++L       N    LP +L  LS+L   D   N L  +P  +GSL  L    L+ N L  LP  I  L+ L+I                        ++  N ++YL  +I     L  L+LS N   E+P  IG+L  L+ L +  N  IT  P     I+L EL++ +     L    G  + L +L++  N +  LP++  +C  L+V    +N +  +P   G+ + L +LD+S N L+ LP+ +  +  L+ + LS N+
Sbjct:    2 FFRLYNIRRLGLSDNEIARLPPEVGNLANLQEFD---ISRNDICDIPENIKYCKSLVSLDLSGNPISKLPDGFSQLQHLTTLCLNDVSLIRLPPDIGSLTELTVLEARENLIKFLPVSLAFLSKLERLDLGCNELEELPDVVGSLPSLAEFWLDGNLLKTLPTEIGNLKKLQI-----------------------FDVSENKIEYLPDEICFCGSLTDLHLSQNLLEELPDTIGKLKKLQLLKVDQNRLITLTPAIGGCIALQELILTENLLDVLPSTMGKLHKLSLLNVDRNRLEVLPVELGSCTKLSVFSLRDNLLQRLPTEIGNCRNLHVLDVSGNRLECLPLTIGTL-PLKALWLSENQ 338          

HSP 3 Score: 67.3958 bits (163), Expect = 2.806e-11
Identity = 80/338 (23.67%), Postives = 137/338 (40.53%), Query Frame = 3
Query:  951 NLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDS----------------------------------------------LPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFPWLPE------SIIDFDLSDNPVESIPQNFMAKLNYI-----ENLNISNTNSDG----ILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDIESSFVLEFQDRLESLDLSNNAISALPATAFT 1781
            N+R L +S+N I +LP +  N  +L     S N I +IPE     K L  LDLS N +                                                LPV + ++  L +++L  N     P+++  +P+L    +  N ++T+P  I +L +LQ F++S NKI+   +LP+      S+ D  LS N +E +P               +N  I+ T + G    + E++ + N L +                 + +L+ L  +N+  N L  +P ++     L+  SLR N ++ + +   +     L  LD+S N +  LP T  T
Sbjct:    7 NIRRLGLSDNEIARLPPEVGNLANLQEFDISRNDICDIPENIKYCKSLVSLDLSGNPISKLPDGFSQLQHLTTLCLNDVSLIRLPPDIGSLTELTVLEARENLIKFLPVSLAFLSKLERLDLGCNELEELPDVVGSLPSLAEFWLDGNLLKTLPTEIGNLKKLQIFDVSENKIE---YLPDEICFCGSLTDLHLSQNLLEELPDTIGKLKKLQLLKVDQNRLITLTPAIGGCIALQELILTENLLDVLPST-------------MGKLHKLSLLNVDRNRLEVLPVELGSCTKLSVFSLRDNLLQRLPTE--IGNCRNLHVLDVSGNRLECLPLTIGT 326          

HSP 4 Score: 52.373 bits (124), Expect = 1.247e-6
Identity = 67/288 (23.26%), Postives = 135/288 (46.88%), Query Frame = 3
Query: 1074 FGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFPWLPESIID---FDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDIESSFVLEF--------QDR-------------LESLDLSNNAISALPATAFTKFSKLRYLNLQGNPCKIPPSDVFNCGQM 1865
            F  L  ++ L LS+NE+  LP  +  + +L++ ++S N   + PE +    +L S++++ N I  +P+    L  L T  L+   +   P    S+ +    +  +N ++ +P + +A L+ +E L++     + + ++V SL SL  F  D   G  L  +   +  L  L+  ++S N +  +P++I    +LT + L  N ++++  +             Q+R             L+ L L+ N +  LP+T   K  KL  LN+  N  ++ P ++ +C ++
Sbjct:    2 FFRLYNIRRLGLSDNEIARLPPEVGNLANLQEFDISRNDICDIPENIKYCKSLVSLDLSGNPISKLPDGFSQLQHLTTLCLNDVSLIRLPPDIGSLTELTVLEARENLIKFLPVS-LAFLSKLERLDLGCNELEELPDVVGSLPSLAEFWLD---GNLLKTLPTEIGNLKKLQIFDVSENKIEYLPDEICFCGSLTDLHLSQNLLEELPDTIGKLKKLQLLKVDQNRLITLTPAIGGCIALQELILTENLLDVLPST-MGKLHKLSLLNVDRNRLEVLPVELGSCTKL 284          
BLAST of SMED30019284 vs. Ensembl Medaka
Match: shoc2 (SHOC2 leucine rich repeat scaffold protein [Source:NCBI gene;Acc:101159973])

HSP 1 Score: 149.443 bits (376), Expect = 4.468e-37
Identity = 135/497 (27.16%), Postives = 229/497 (46.08%), Query Frame = 3
Query:   27 LKYFNASTNEDKIFKTLTKEEIDNINEDFFEKEKINILNCSYSKVKKIGKLCNCKDLEGLI---VNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFE------------------------LVNLLELNICNNDLQ-YLSMDIGKLKKLIVLNLSFNNFIEIPSNI-GELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNK-IQSFPW---LPESIIDFDLSDNPVESIPQNFMA 1418
            +K  N    E+ +   L+K  I  +     E  ++  L    +K++ +     C  L GL+   ++ N +T +P +++ LK L  L+L HN +  +    + L +L  L L  N +T + + I N SKL   +I  NK   LP  +  L  L++ D +HN L  +PK IG+  Q+T L L HN+L DLPETI  L ++  L L  N L+ +   + +                        LVNL  L +  N  Q Y      +   +  LN+  N+  +IP  I      L  LN++ N                         +SL  DFG + ++  L+++ N + ++P D    +SL VL  SNN + ++P   G+L+KL+ LDL  N+L+ LP  + Y++ L+K+ L+NN+    P  +  +  L  + +  N ++ +PE I +L  L+   L+ N  + S P+   L   +    + + P+  +P   +A
Sbjct:   91 IKELNKCREENSMRLDLSKRSIHMLPTSIKELNQLAELYLYSNKLQSLPAEVGC--LSGLVTLALSENSLTSLPDSLDSLKKLRMLDLRHNKLREIPAVVYRLTSLTTLYLRFNRITTVEKDIRNLSKLTMLSIRENKIKQLPAEIGELCNLITLDVAHNQLEHLPKEIGNCTQITNLDLQHNELLDLPETIGNLASINRLGLRYNRLSAIPRSLAKCRELEELNLENNNISVLPEGLLSSLVNLTSLTLARNCFQSYPVGGPSQFSTIYSLNMEHNHINKIPFGIFSRAKVLSKLNMKDN-----------------------QLTSLPLDFGTWTSMVELNLATNQLAKIPEDVCGLVSLEVLILSNNLLKKLPHGIGNLRKLRELDLEENKLECLPNEIAYLKDLQKLVLTNNQLTTLPRGIGHLTNLTHLGLGENLLQHLPEEIGTLENLEELYLNDNPNLHSLPFELALCSKLAIMSIENCPLTHLPAQIVA 562          

HSP 2 Score: 103.99 bits (258), Expect = 2.170e-22
Identity = 123/471 (26.11%), Postives = 214/471 (45.44%), Query Frame = 3
Query:  660 VFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCN-FSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMS-LTRLQTFNLSGNKIQSFPW---------------------LPESIID-------FDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIF--------KYDQDRG--KKLTEID----------GRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDI-ESSFVLEFQDRLESLDLSNNA-ISALPATAFTKFSKLRYLNLQGNPCKIPPSDVFNCGQMIPICSYLTAYNEFDATI 1916
            + EL  L EL + +N LQ L  ++G L  L+ L LS N+   +P ++  L  L+ L+LR N K+  +P  +  ++    L  + N  +++  D    + L +L I  N I QLP +     +L  L  ++N++  +P+  G+  ++  LDL +NEL  LP  +  + S+ ++ L  NR +  P  L K   L  + +  N+I  +PE ++S L  L +  L+ N  QS+P                      +P  I          ++ DN + S+P +F    + +E LN++      I E V  L SL++         K     G  +KL E+D            ++ L +L+++ L+NN L ++P  I  + NLT + L  N ++ + E    LE    LE L L++N  + +LP       SKL  ++++  P    P+ +   G    I  +L     + A +
Sbjct:  119 IKELNQLAELYLYSNKLQSLPAEVGCLSGLVTLALSENSLTSLPDSLDSLKKLRMLDLRHN-KLREIPAVVYRLTSLTTLYLRFNRITTVEKDIRNLSKLTMLSIRENKIKQLPAEIGELCNLITLDVAHNQLEHLPKEIGNCTQITNLDLQHNELLDLPETIGNLASINRLGLRYNRLSAIPRSLAKCRELEELNLENNNISVLPEGLLSSLVNLTSLTLARNCFQSYPVGGPSQFSTIYSLNMEHNHINKIPFGIFSRAKVLSKLNMKDNQLTSLPLDFGTWTSMVE-LNLATNQLAKIPEDVCGLVSLEVLILSNNLLKKLPHGIGNLRKLRELDLEENKLECLPNEIAYLKDLQKLVLTNNQLTTLPRGIGHLTNLTHLGLGENLLQHLPEEIGTLE---NLEELYLNDNPNLHSLPF-ELALCSKLAIMSIENCPLTHLPAQIVAGGPSF-IIQFLKMQGPYRAMV 582          
BLAST of SMED30019284 vs. Ensembl Medaka
Match: lrrc40 (leucine rich repeat containing 40 [Source:NCBI gene;Acc:101158008])

HSP 1 Score: 130.954 bits (328), Expect = 4.653e-31
Identity = 134/479 (27.97%), Postives = 222/479 (46.35%), Query Frame = 3
Query:  132 NILNCSYSKVKKIGKLCNCKDLEGLIVNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPE-TIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGN----------SKITN-----LPGXXXXXXXXXXXXDQC-NFSSLSD-DFGYYNNLRILDISNNHITQLPID---FKNCLSLAVLKWSNNKINEIP----EVFGSLKKLQI--------------------LDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETI-PESIMSLTRLQTFNLSGNKIQSFP---WLPESIIDFDLSDNPVESIPQNFMAK 1421
            N LN  +S    IG+L   ++L+ L ++ N+++ +P+ +  L++L  L L  N + NL   F  LENL  LDL+ N LT L + +G  + LQ  ++S NK + LP+ L  L+ +   DCS+N L+ VP  +  +  L  L L HN L  LP+     L+ L +       L        + +++LEL   +N ++ +   +  L  L  L+L+ N+   +P+++  L +LK L + GN          +K TN     L G +     S         F S +  +      L +LD S+  +  +P +        ++    +S NK+  IP    ++  SL +L +                    LDL NN+L  LP  ME +  LR I LS NRF +FPE+L ++ ++ ++ +  N + ++ P  +  L  L T +LS N + S P    L  S+    L  NP  +     +AK
Sbjct:  110 NQLNTLHSA---IGEL---QELQTLRLSHNQLSSLPVEVCMLRNLRSLTLQQNLLENLPEEFGQLENLTELDLSKNRLTDLPQSLGRLTGLQKISLSHNKLSCLPDCLSQLTNVKLLDCSNNQLSDVPASLAHMLSLEQLHLRHNRLQRLPQLHAPALKELYVGNNQVGVLEAEQLECLKAISVLELR--DNKIRAVPEQMSLLHTLTRLDLTNNDIGSLPASLSLLPNLKVLLVEGNPLRGIRRDLLTKGTNELLKYLRGRVKEEPESSEDPPTAMTFPSQARINVHSIKTLGVLDQSDMQVDSIPDEAFLAAEGQNVVTANFSKNKLTSIPARLLQLSSSLTELNLGFNQLDHCGVEVCRLLQLTHLDLRNNQLKDLPADMENLAKLRCIILSYNRFKSFPEVLYQMFSMETVLMANNQVSSVDPARLARLEHLSTLDLSNNDLLSIPPELGLCTSLRSLSLQGNPFRTPRAAIVAK 580          

HSP 2 Score: 127.872 bits (320), Expect = 5.467e-30
Identity = 141/574 (24.56%), Postives = 263/574 (45.82%), Query Frame = 3
Query:  210 VNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCL-SLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPES-----------------IMSLTRLQTFNLSGNKIQSFP------WLPESIIDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDIESSFVLEFQDRLESLDLSNNAISALPATAFTKFSKLRYLNLQGNPCKIPPSDVFNCG 1859
            ++G  +T++P ++ ++      N+S          +++  +L  L L++N ++ +SE I     L   ++  N+ NTL   +  L EL +   SHN L+ +P  +  L+ L +L L  N L +LPE   +L+NL  L L  N LT+L   +  L  L ++++ +N L  L   + +L  + +L+ S N   ++P+++  + SL+ L+LR N ++  LP                          +   L+ L + NN +  L  +   CL +++VL+  +NKI  +PE    L  L  LDL+NN++ SLP  +  + +L+ + +  N        L    T   ++     ++  PES                 + S+  L   + S  ++ S P         ++++  + S N + SIP   +   + +  LN+     D     V  L  L++   D  R  +L ++   +  L  L+ I LS N   S PE + QM ++ ++ +  N++  ++ + +    + L +LDLSNN + ++P       + LR L+LQGNP + P + +   G
Sbjct:   42 LSGRALTKVPQSVYRVNEEAQQNVSFGA----SDRWWEQTDLTKLLLSSNQISQISEDIRLLPALVTLDLHDNQLNTLHSAIGELQELQTLRLSHNQLSSLPVEVCMLRNLRSLTLQQNLLENLPEEFGQLENLTELDLSKNRLTDLPQSLGRLTGLQKISLSHNKLSCLPDCLSQLTNVKLLDCSNNQLSDVPASLAHMLSLEQLHLRHN-RLQRLPQL------------------------HAPALKELYVGNNQVGVLEAEQLECLKAISVLELRDNKIRAVPEQMSLLHTLTRLDLTNNDIGSLPASLSLLPNLKVLLVEGNPLRGIRRDLLTKGTNELLKYLRGRVKEEPESSEDPPTAMTFPSQARINVHSIKTLGVLDQSDMQVDSIPDEAFLAAEGQNVVTANFSKNKLTSIPARLLQLSSSLTELNLGFNQLDHCGVEVCRL--LQLTHLDL-RNNQLKDLPADMENLAKLRCIILSYNRFKSFPEVLYQMFSMETVLMANNQVSSVDPARLARL-EHLSTLDLSNNDLLSIPPE-LGLCTSLRSLSLQGNPFRTPRAAIVAKG 581          

HSP 3 Score: 117.087 bits (292), Expect = 1.543e-26
Identity = 133/557 (23.88%), Postives = 238/557 (42.73%), Query Frame = 3
Query:  264 LTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCL-SLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFP-EILTK---------------------------------------IPTLNSIEITANDIETIPESIMSLTRLQ---TFNLSGNKIQSFP----WLPESIIDF-----------------------DLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEID-GRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDIESSFVLEFQD 1718
            LT L LS N I+ +      L  L+ LDL +N L  L   IG   +LQ   +S N+ ++LP  +C L  L S     N L  +P+  G L+ LT L L+ N L+DLP+++  L  L+                       ++++ +N L  L   + +L  + +L+ S N   ++P+++  + SL+ L+LR N ++  LP                          +   L+ L + NN +  L  +   CL +++VL+  +NKI  +PE    L  L  LDL+NN++ SLP  +  + +L+ + +  N       ++LTK                                       I TL  ++ +   +++IP+        Q   T N S NK+ S P     L  S+ +                        DL +N ++ +P + M  L  +  + +S        E+++ + S++      +   +++ +D  RL++L +L  ++LSNN L+SIP ++    +L S+SL+GN  +   ++ V +  D
Sbjct:   79 LTKLLLSSNQISQISEDIRLLPALVTLDLHDNQLNTLHSAIGELQELQTLRLSHNQLSSLPVEVCMLRNLRSLTLQQNLLENLPEEFGQLENLTELDLSKNRLTDLPQSLGRLTGLQ-----------------------KISLSHNKLSCLPDCLSQLTNVKLLDCSNNQLSDVPASLAHMLSLEQLHLRHN-RLQRLPQL------------------------HAPALKELYVGNNQVGVLEAEQLECLKAISVLELRDNKIRAVPEQMSLLHTLTRLDLTNNDIGSLPASLSLLPNLKVLLVEGNPLRGIRRDLLTKGTNELLKYLRGRVKEEPESSEDPPTAMTFPSQARINVHSIKTLGVLDQSDMQVDSIPDEAFLAAEGQNVVTANFSKNKLTSIPARLLQLSSSLTELNLGFNQLDHCGVEVCRLLQLTHLDLRNNQLKDLPAD-MENLAKLRCIILSYNRFKSFPEVLYQMFSMETVLMANN---QVSSVDPARLARLEHLSTLDLSNNDLLSIPPELGLCTSLRSLSLQGNPFRTPRAAIVAKGTD 583          
BLAST of SMED30019284 vs. Ensembl Medaka
Match: shoc2 (SHOC2 leucine rich repeat scaffold protein [Source:NCBI gene;Acc:101159973])

HSP 1 Score: 124.02 bits (310), Expect = 5.474e-29
Identity = 119/473 (25.16%), Postives = 215/473 (45.45%), Query Frame = 3
Query:   27 LKYFNASTNEDKIFKTLTKEEIDNINEDFFEKEKINILNCSYSKVKKIGKLCNCKDLEGLI---VNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQ-YLSMDIGKLKKLIVLNLSFNNFIEIPSNI-GELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNK-IQSFPW---LPESIIDFDLSDNPVESIPQNFMA 1418
            +K  N    E+ +   L+K  I  +     E  ++  L    +K++ +     C  L GL+   ++ N +T +P +++ LK L  L+L HN +  +    + L +L  L L  N +T + + I N SKL   +I  NK   LP  + +L+ +      +N L+ +P+ +   ++L  L L +N++S LPE +                      +  LVNL  L +  N  Q Y      +   +  LN+  N+  +IP  I      L  LN++ N                         +SL  DFG + ++  L+++ N + ++P D    +SL VL  SNN + ++P   G+L+KL+ LDL  N+L+ LP  + Y++ L+K+ L+NN+    P  +  +  L  + +  N ++ +PE I +L  L+   L+ N  + S P+   L   +    + + P+  +P   +A
Sbjct:   91 IKELNKCREENSMRLDLSKRSIHMLPTSIKELNQLAELYLYSNKLQSLPAEVGC--LSGLVTLALSENSLTSLPDSLDSLKKLRMLDLRHNKLREIPAVVYRLTSLTTLYLRFNRITTVEKDIRNLSKLTMLSIRENKIKQLPAEIGNLASINRLGLRYNRLSAIPRSLAKCRELEELNLENNNISVLPEGL----------------------LSSLVNLTSLTLARNCFQSYPVGGPSQFSTIYSLNMEHNHINKIPFGIFSRAKVLSKLNMKDN-----------------------QLTSLPLDFGTWTSMVELNLATNQLAKIPEDVCGLVSLEVLILSNNLLKKLPHGIGNLRKLRELDLEENKLECLPNEIAYLKDLQKLVLTNNQLTTLPRGIGHLTNLTHLGLGENLLQHLPEEIGTLENLEELYLNDNPNLHSLPFELALCSKLAIMSIENCPLTHLPAQIVA 516          

HSP 2 Score: 92.8189 bits (229), Expect = 5.361e-19
Identity = 114/430 (26.51%), Postives = 209/430 (48.60%), Query Frame = 3
Query:  660 VFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCN-FSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLP-VIMEYMESLRKINLSNNRFNNFP-EILTKIPTLNSIEITANDIETIPESIMSLTR-LQTFNLSGNKIQSFP-----WLPESIIDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDI-ESSFVLEFQDRLESLDLSNNA-ISALPATAFTKFSKLRYLNLQGNPCKIPPSDVFNCGQMIPICSYLTAYNEFDATI 1916
            + EL  L EL + +N LQ L  ++G L  L+ L LS N+   +P ++  L  L+ L+LR N K+  +P  +  ++    L  + N  +++  D    + L +L I  N I QLP +  N  S+  L    N+++ IP      ++L+ L+L NN +  LP  ++  + +L  + L+ N F ++P    ++  T+ S+ +  N I  IP  I S  + L   N+  N++ S P     W   S+++ +L+ N +  IP++    L  +E L +SN     +   + +L  L+    +++   KL  +   ++ L +L+++ L+NN L ++P  I  + NLT + L  N ++ + E    LE    LE L L++N  + +LP       SKL  ++++  P    P+ +   G    I  +L     + A +
Sbjct:  119 IKELNQLAELYLYSNKLQSLPAEVGCLSGLVTLALSENSLTSLPDSLDSLKKLRMLDLRHN-KLREIPAVVYRLTSLTTLYLRFNRITTVEKDIRNLSKLTMLSIRENKIKQLPAEIGNLASINRLGLRYNRLSAIPRSLAKCRELEELNLENNNISVLPEGLLSSLVNLTSLTLARNCFQSYPVGGPSQFSTIYSLNMEHNHINKIPFGIFSRAKVLSKLNMKDNQLTSLPLDFGTW--TSMVELNLATNQLAKIPEDVCG-LVSLEVLILSNNLLKKLPHGIGNLRKLRELDLEEN---KLECLPNEIAYLKDLQKLVLTNNQLTTLPRGIGHLTNLTHLGLGENLLQHLPEEIGTLE---NLEELYLNDNPNLHSLPF-ELALCSKLAIMSIENCPLTHLPAQIVAGGPSF-IIQFLKMQGPYRAMV 536          
BLAST of SMED30019284 vs. Ensembl Medaka
Match: lrrc1 (leucine rich repeat containing 1 [Source:NCBI gene;Acc:101169728])

HSP 1 Score: 121.709 bits (304), Expect = 1.505e-28
Identity = 100/323 (30.96%), Postives = 151/323 (46.75%), Query Frame = 3
Query:  222 EITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNR 1190
            ++ EIP +I+  K+L   + S N +T L  TF DL++L+ L + +  L  L +  GN S L    +  N    LP++L  L +L   D   N L  +PK IG+L  L  L L+ N L +LP T+  ++NL  L +  N L  L   +  L NL +L +  N ++ L   IGKL+KL +L +  N    +P +IG   SL  L L  N                          SL    G    L  L+   N +T LP +   C SL V    +N++  IP       +L +LD+S N L  LP+ +  ++ L+ + LS N+
Sbjct:   43 DVYEIPESISHCKALQVADFSGNPLTRLPATFPDLQSLVCLSINDISLQRLPDDFGNLSNLVSLELRENILTFLPDSLSELHKLEGLDLGSNELEELPKSIGNLSNLKELWLDGNQLVELPATLCRIRNLVCLDVSENKLEGLPQELGGLENLTDLLVSQNSIEALPESIGKLQKLSILKVDQNRLNCLPESIGSCESLAELILTEN-----------------------QIKSLPRSIGKLKKLFNLNCDRNQLTSLPKEIGGCCSLNVFCMRDNRLTRIPAELSQATELHVLDVSGNRLAYLPLSLTTLQ-LKALWLSENQ 341          

HSP 2 Score: 115.546 bits (288), Expect = 1.848e-26
Identity = 92/290 (31.72%), Postives = 136/290 (46.90%), Query Frame = 3
Query:  192 DLEGLI---VNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNK 1052
            DL+ L+   +N   +  +P     L +L  L L  N +T L  +  +L  L  LDL +N L  L + IGN S L+   + GN+   LP TLC +  L+  D S N L  +P+ +G L+ LT L+++ N +  LPE+I +LQ L IL++  N L  L   +    +L EL +  N ++ L   IGKLKKL  LN   N    +P  IG   SL    +R N ++T +P                       +      L +LD+S N +  LP+     L L  L  S N+
Sbjct:   76 DLQSLVCLSINDISLQRLPDDFGNLSNLVSLELRENILTFLPDSLSELHKLEGLDLGSNELEELPKSIGNLSNLKELWLDGNQLVELPATLCRIRNLVCLDVSENKLEGLPQELGGLENLTDLLVSQNSIEALPESIGKLQKLSILKVDQNRLNCLPESIGSCESLAELILTENQIKSLPRSIGKLKKLFNLNCDRNQLTSLPKEIGGCCSLNVFCMRDN-RLTRIPA----------------------ELSQATELHVLDVSGNRLAYLPLSLTT-LQLKALWLSENQ 341          

HSP 3 Score: 103.219 bits (256), Expect = 1.948e-22
Identity = 91/315 (28.89%), Postives = 156/315 (49.52%), Query Frame = 3
Query:  783 EIPSNIGELSSLKYLNLRGNSKITNLPGX-XXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFP---WLPESIIDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDIESSFVLEFQ 1715
            EIP +I    +L+  +  GN  +T LP +   L SL  L I+  +   L DDFG  +NL  L++  N +T LP        L  L   +N++ E+P+  G+L  L+ L L  N+L  LP  +  + +L  +++S N+    P+ L  +  L  + ++ N IE +PESI  L +L    +  N++   P      ES+ +  L++N ++S+P++ + KL  + NLN        + + +    SL +F     R  +LT I   LSQ   L  +++S N L  +P       +LT++ L+   + + +S  +L FQ
Sbjct:   46 EIPESISHCKALQVADFSGNP-LTRLPATFPDLQSLVCLSINDISLQRLPDDFGNLSNLVSLELRENILTFLPDSLSELHKLEGLDLGSNELEELPKSIGNLSNLKELWLDGNQLVELPATLCRIRNLVCLDVSENKLEGLPQELGGLENLTDLLVSQNSIEALPESIGKLQKLSILKVDQNRLNCLPESIGSCESLAELILTENQIKSLPRS-IGKLKKLFNLNCDRNQLTSLPKEIGGCCSLNVFCM---RDNRLTRIPAELSQATELHVLDVSGNRLAYLP------LSLTTLQLKALWLSENQSQPLLSFQ 349          

HSP 4 Score: 87.0409 bits (214), Expect = 2.959e-17
Identity = 74/298 (24.83%), Postives = 139/298 (46.64%), Query Frame = 3
Query:  984 ITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFPWL---PESIIDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDG--------------------RLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDIESSFVLEFQDRLESLDLSNNAISALPATAFTKFSKLRYLN 1808
            + ++P    +C +L V  +S N +  +P  F  L+ L  L +++  L  LP     + +L  + L  N     P+ L+++  L  +++ +N++E +P+SI +L+ L+   L GN++   P       +++  D+S+N +E +PQ  +  L  + +L +S  + + + E +  L  L I K DQ+R   L E  G                     + +L  L  +N   N L S+P++I    +L    +R N++  I +   L     L  LD+S N ++ LP +  T   K  +L+
Sbjct:   44 VYEIPESISHCKALQVADFSGNPLTRLPATFPDLQSLVCLSINDISLQRLPDDFGNLSNLVSLELRENILTFLPDSLSELHKLEGLDLGSNELEELPKSIGNLSNLKELWLDGNQLVELPATLCRIRNLVCLDVSENKLEGLPQE-LGGLENLTDLLVSQNSIEALPESIGKLQKLSILKVDQNRLNCLPESIGSCESLAELILTENQIKSLPRSIGKLKKLFNLNCDRNQLTSLPKEIGGCCSLNVFCMRDNRLTRIPAE--LSQATELHVLDVSGNRLAYLPLSLTTLQLKALWLS 338          

HSP 5 Score: 84.3445 bits (207), Expect = 2.406e-16
Identity = 59/194 (30.41%), Postives = 100/194 (51.55%), Query Frame = 3
Query:  162 KKIGKLCNCKDLEGLIVNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLK 743
            K IG L N K+L    ++GN++ E+P  + ++++L  L++S N +  L      LENL  L ++ N +  L E IG   KL    +  N+ N LPE++ S   L     + N +  +P+ IG LK+L  L  + N L+ LP+ I    +L +  + +N LT +   + +   L  L++  N L YL + +  L+
Sbjct:  141 KSIGNLSNLKEL---WLDGNQLVELPATLCRIRNLVCLDVSENKLEGLPQELGGLENLTDLLVSQNSIEALPESIGKLQKLSILKVDQNRLNCLPESIGSCESLAELILTENQIKSLPRSIGKLKKLFNLNCDRNQLTSLPKEIGGCCSLNVFCMRDNRLTRIPAELSQATELHVLDVSGNRLAYLPLSLTTLQ 331          

HSP 6 Score: 55.4546 bits (132), Expect = 2.745e-7
Identity = 56/208 (26.92%), Postives = 96/208 (46.15%), Query Frame = 3
Query: 1257 DIETIPESIMSLTRLQTFNLSGNKIQSFPW-LP--ESIIDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVF-----SLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDIESSFVLEFQDRLESLDLSNNAISALPATAFTKFSKLRYLNLQGNPCKIPPSDVFNC 1856
            D+  IPESI     LQ  + SGN +   P   P  +S++   ++D  ++ +P +F          N+SN  S  + E +      SL+ L   +       +L E+   +  L+NLKE+ L  N L+ +P  + +++NL  + +  NK++ +     L   + L  L +S N+I ALP +   K  KL  L +  N     P  + +C
Sbjct:   43 DVYEIPESISHCKALQVADFSGNPLTRLPATFPDLQSLVCLSINDISLQRLPDDFG---------NLSNLVSLELRENILTFLPDSLSELHKLEGLDLGSNELEELPKSIGNLSNLKELWLDGNQLVELPATLCRIRNLVCLDVSENKLEGLPQE--LGGLENLTDLLVSQNSIEALPES-IGKLQKLSILKVDQNRLNCLPESIGSC 238          
BLAST of SMED30019284 vs. Ensembl Medaka
Match: lrrc7 (leucine rich repeat containing 7 [Source:NCBI gene;Acc:101170832])

HSP 1 Score: 125.176 bits (313), Expect = 2.029e-28
Identity = 117/384 (30.47%), Postives = 198/384 (51.56%), Query Frame = 3
Query:  117 EKEKINILNCSYSKVKKIGK--LCNCKDLEGLIVNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANN-------------HLTVLSELIGNFSKL-----QFFNISGNKFNT-----LPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCN-FSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNR 1190
            E+E I++L+ S+  ++++ K      + LE L ++ N+I E+P  +   ++L  L++  N ++NL TT   L NL  LD++ N              L+V+   +   +KL     Q  N++    N      LP     LS+L   +   NHL  +PK I  L QL  L L  N+ S++PE ++++ NL+ L L NN+L  +   + +L  L  L++  N ++ L  D+   + L  L LS N    +P +IG L  L  L +  N ++T+LP +I  +SL E     CN   SL    GY ++LR      N +T+LP +  NC ++ V+   +NK+  +P+  G + KL++L+LS+N L +LP     ++ L  + LS+N+
Sbjct:   33 EEEVISVLDYSHCSLQQVPKEIFSFERTLEELYLDANQIEELPKQLFNCQALKKLSMPDNDLSNLPTTIASLVNLKELDISKNGIQEFPDNIKCCKGLSVVEASVNPITKLPDGFTQLLNLTQLFLNDAFLEYLPANFGRLSKLRILELRENHLKTMPKSIHRLTQLERLDLGSNEFSEVPEVLEQIHNLKELWLDNNSLQTIPGSIGKLRQLRYLDLAKNRIETLDSDVSGCEALEDLLLSSNMLQHLPDSIGMLKKLTTLKVDDN-QLTSLPHTIGSLSLLEEFDCSCNELESLPPTIGYLHSLRTFAADENFLTELPREIGNCRNVTVMSLRSNKLEFLPDEIGQMTKLRVLNLSDNRLKNLPFTFTKLKDLAALWLSDNQ 415          

HSP 2 Score: 101.679 bits (252), Expect = 3.170e-21
Identity = 109/416 (26.20%), Postives = 196/416 (47.12%), Query Frame = 3
Query:  666 ELVNLLELNICNNDLQYLSMDIGKLKK-LIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVF-----------------------GSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQS--------------------FPWLPESI------IDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDIESSFVLEFQDRLESLDLSNNAISAL 1763
            E++++L+ + C+  LQ +  +I   ++ L  L L  N   E+P  +    +LK L++  N  ++NLP                  +SL        NL+ LDIS N I + P + K C  L+V++ S N I ++P+ F                       G L KL+IL+L  N L ++P  +  +  L +++L +N F+  PE+L +I  L  + +  N ++TIP SI  L +L+  +L+ N+I++                       LP+SI          + DN + S+P   +  L+ +E  + S    + +   +  L+SL+ F  D++    LTE+   +    N+  ++L +N L  +P++I QM  L  ++L  N++K++  +F  + +D L +L LS+N   AL
Sbjct:   35 EVISVLDYSHCS--LQQVPKEIFSFERTLEELYLDANQIEELPKQLFNCQALKKLSMPDND-LSNLP---------------TTIASLV-------NLKELDISKNGIQEFPDNIKCCKGLSVVEASVNPITKLPDGFTQLLNLTQLFLNDAFLEYLPANFGRLSKLRILELRENHLKTMPKSIHRLTQLERLDLGSNEFSEVPEVLEQIHNLKELWLDNNSLQTIPGSIGKLRQLRYLDLAKNRIETLDSDVSGCEALEDLLLSSNMLQHLPDSIGMLKKLTTLKVDDNQLTSLPHT-IGSLSLLEEFDCSCNELESLPPTIGYLHSLRTFAADENF---LTELPREIGNCRNVTVMSLRSNKLEFLPDEIGQMTKLRVLNLSDNRLKNLPFTFT-KLKD-LAALWLSDNQSKAL 419          

HSP 3 Score: 97.4413 bits (241), Expect = 6.522e-20
Identity = 75/247 (30.36%), Postives = 122/247 (49.39%), Query Frame = 3
Query:  123 EKINILNCSYSKVKKIGKLCNCKDLEGLIVNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLP 863
            E++++ +  +S+V ++  L    +L+ L ++ N +  IP +I +L+ L YL+L+ N I  L++     E L  L L++N L  L + IG   KL    +  N+  +LP T+ SLS L  FDCS N L  +P  IG L  L T   + N L++LP  I   +N+ +                       +++ +N L++L  +IG++ KL VLNLS N    +P    +L  L  L L  N     +P
Sbjct:  200 ERLDLGSNEFSEVPEV--LEQIHNLKELWLDNNSLQTIPGSIGKLRQLRYLDLAKNRIETLDSDVSGCEALEDLLLSSNMLQHLPDSIGMLKKLTTLKVDDNQLTSLPHTIGSLSLLEEFDCSCNELESLPPTIGYLHSLRTFAADENFLTELPREIGNCRNVTV-----------------------MSLRSNKLEFLPDEIGQMTKLRVLNLSDNRLKNLPFTFTKLKDLAALWLSDNQSKALIP 421          

HSP 4 Score: 60.4622 bits (145), Expect = 1.175e-8
Identity = 73/265 (27.55%), Postives = 117/265 (44.15%), Query Frame = 3
Query: 1077 GSLKKLQILDLSNNELDSLPV-IMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFP---WLPESIIDFDLSDNPVESIPQNFMAKLNYIE-NLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDIESSFVLEFQDRLESLDLSNNAISALPATAFTKFSKLRYLNLQGNPCKIPPSDVFNC 1856
            G  + + +LD S+  L  +P  I  +  +L ++ L  N+    P+ L     L  + +  ND+  +P +I SL  L+  ++S N IQ FP      + +   + S NP+  +P  F   LN  +  LN      D  LE                    L    GRLS+L  L+   L  N L ++P+ I ++  L  + L  N+  ++    VLE    L+ L L NN++  +P +   K  +LRYL+L  N  +   SDV  C
Sbjct:   32 GEEEVISVLDYSHCSLQQVPKEIFSFERTLEELYLDANQIEELPKQLFNCQALKKLSMPDNDLSNLPTTIASLVNLKELDISKNGIQEFPDNIKCCKGLSVVEASVNPITKLPDGFTQLLNLTQLFLN------DAFLEY-------------------LPANFGRLSKLRILE---LRENHLKTMPKSIHRLTQLERLDLGSNEFSEVPE--VLEQIHNLKELWLDNNSLQTIPGS-IGKLRQLRYLDLAKNRIETLDSDVSGC 265          
BLAST of SMED30019284 vs. Planmine SMEST
Match: SMESG000077670.1 (SMESG000077670.1)

HSP 1 Score: 944.88 bits (2441), Expect = 0.000e+0
Identity = 490/494 (99.19%), Postives = 491/494 (99.39%), Query Frame = 3
Query:  723 MDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFPWLPESIIDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDIESSFVLEFQDRLESLDLSNNAISALPATAFTKFSKLRYLNLQGNPCKIPPSDVFNCGQMIPICSYLTAYNEFDATILDRIMPIISNKFPISRTRHLFRKLRIPESVIIELESTYRGKYNQKLLLSKGLEAWRKYLVDKATTDSLIRCFFLINEKNLNAEFLYMKAIVNRIKL 2204
            MDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKI NLPGSILLISLSELLIDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESI+SLTRLQTFNLSGNKIQSFPWLPESIIDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISL GNKIKDIESSFVLEFQDRLESLDLSNNAISALPATAFTKFSKLRYLNLQGNPCKIPPSDVFNCGQMIPICSYLTAYNEFDATILDRIMPIISNKFPISRTRHLFRKLRIPESVIIELESTYRGKYNQKLLLSKGLEAWRKYLVDKATTDSLIRCFFLINEKNLNAE LYMKAIVNRIKL
Sbjct:    1 MDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKIINLPGSILLISLSELLIDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIISLTRLQTFNLSGNKIQSFPWLPESIIDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLSGNKIKDIESSFVLEFQDRLESLDLSNNAISALPATAFTKFSKLRYLNLQGNPCKIPPSDVFNCGQMIPICSYLTAYNEFDATILDRIMPIISNKFPISRTRHLFRKLRIPESVIIELESTYRGKYNQKLLLSKGLEAWRKYLVDKATTDSLIRCFFLINEKNLNAELLYMKAIVNRIKL 494          

HSP 2 Score: 83.5741 bits (205), Expect = 3.522e-16
Identity = 112/400 (28.00%), Postives = 180/400 (45.00%), Query Frame = 3
Query:  168 IGKLCNCKDLEGLIVNGNEITEIPLAINQLKSLTYLNLSHNY-ITNLE-TTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLS-LAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVI---MEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIM--SLTRLQTFNLSGNKIQSFP 1343
            IGKL   K L  L ++ N   EIP  I +L SL YLNL  N  I NL  +      + + +D  N   + LS+  G ++ L+  +IS N    LP    +   L     S+N +N +P+  GSLK+L  L L++N+L  LP  ++ +++L                        ++N+ NN        + K+  L  + ++ N+   IP +I  L+ L+  NL GN KI + P     I                 DF         D+S+N +  +P +F   L+ +  L  SN   + I E+  SL  L+I     +    L  I   +  + +L++INLSNN   + PE + ++  L SI ++ N I+ I  S +     RL++ +LS N I + P
Sbjct:    3 IGKL---KKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKIINLPGSILLISLSELLIDQCN--FSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLR-----------------------KINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIISLTRLQTFNLSGN-KIQSFPWLPESII----------------DF---------DLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLSGNKIKDIESSFVLEFQDRLESLDLSNNAISALP 348          

HSP 3 Score: 78.5666 bits (192), Expect = 1.066e-14
Identity = 91/342 (26.61%), Postives = 147/342 (42.98%), Query Frame = 3
Query:  192 DLEGLIVNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSD---LPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMD-IGKLKKLIVLNLSFNN---FIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPE--VFGSLKKLQILDLSNNELDSLPVI-MEYMESLRKINLSNN 1187
            +L  L ++ N IT++P+      SL  L  S+N I  +   F  L+ L  LDL+NN L  L  ++     L+  N+S N+FN  PE L  +  L S + + N +  +P+ I SL +L T  L+ N +     LPE+I                             ++ ++ +N ++ +  + + KL  +  LN+S  N    +EI  ++  L   KY   RG  K+T + G                           NNL+ +++SNN +  +P       +L  +  S NKI +I    V     +L+ LDLSNN + +LP         LR +NL  N
Sbjct:   77 NLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIISLTRLQTFNLSGNKIQSFPWLPESI-----------------------------IDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRG-KKLTEIDGR----------------------LSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLSGNKIKDIESSFVLEFQDRLESLDLSNNAISALPATAFTKFSKLRYLNLQGN 366          
BLAST of SMED30019284 vs. Planmine SMEST
Match: SMESG000077669.1 (SMESG000077669.1)

HSP 1 Score: 497.664 bits (1280), Expect = 1.064e-166
Identity = 262/350 (74.86%), Postives = 301/350 (86.00%), Query Frame = 1
Query: 2359 MLNEALQLPESLLPFINGNQLAIDCGISSSKIVFSVQLENHEQVFRSLGLLNEELKTVLLEIQETFGQKVFEKIFVVGFKNLWAKTVVKSVFDADANVVEEISALSNGVQLISDNFQLSXXXXXXXXSLHLYEKYKINFANPLWNKFLQAMKFPSTDDANPNKGILKFPNIMILAGSTIKYYLLNNDRTAKLINYSMFAGETLKGLFKCLVDSNNFNENILLASKGNREKTDTQIWEMISDNTNSPYGENPLNLPILSFGKCADYNKDKEYFNSNDILDSLSFVFLNETNNQMHKLCKAFKINHVYVCGGIFNSPIYTQYFQFGVTYIPNQIETKILNVDYILALGALMK 3408
            MLNEALQLPESLLPFINGNQLAIDCGISSSKIVFSVQLENHEQVFRSLGLLNEELKTVLLEIQETFGQKVFEKIFVVGFKNLWA TVVKSVFD DANVVEEISALSNGVQL+SDNFQLSEIEIK EESL LY+KYKI+  NP++ K +QAM+  + ++    +GI+ FP+I++L GS +K+YLLN+D +AKLI YSMFAGETLKGLFKCLVDSNNF ENILLAS G+REK DTQ++E++S+N NSPYG+ P +LPI SFGKCADYNK KE  N ND+L+SLSF+FL ETNNQ++ LCKAFK  +VY CG IFN  ++++  Q G   +P  IETKILNV+YILALG L K
Sbjct:    1 MLNEALQLPESLLPFINGNQLAIDCGISSSKIVFSVQLENHEQVFRSLGLLNEELKTVLLEIQETFGQKVFEKIFVVGFKNLWATTVVKSVFDVDANVVEEISALSNGVQLVSDNFQLSEIEIKNEESLSLYDKYKIDLKNPMFQKVIQAMQISTPNETKSGEGIIHFPSIIVLGGSALKFYLLNSDGSAKLIAYSMFAGETLKGLFKCLVDSNNFKENILLASIGDREKIDTQVYEVLSENLNSPYGQFPPDLPIFSFGKCADYNKGKEDVNPNDLLESLSFLFLIETNNQVNTLCKAFKTKYVYFCGDIFNYQLFSKILQLGEILLPRLIETKILNVNYILALGTLKK 350          
BLAST of SMED30019284 vs. Planmine SMEST
Match: SMESG000077668.1 (SMESG000077668.1)

HSP 1 Score: 302.368 bits (773), Expect = 1.376e-95
Identity = 160/161 (99.38%), Postives = 160/161 (99.38%), Query Frame = 1
Query: 2359 MLNEALQLPESLLPFINGNQLAIDCGISSSKIVFSVQLENHEQVFRSLGLLNEELKTVLLEIQETFGQKVFEKIFVVGFKNLWAKTVVKSVFDADANVVEEISALSNGVQLISDNFQLSXXXXXXXXSLHLYEKYKINFANPLWNKFLQAMKFPSTDDANP 2841
            MLNEALQLPESLLPFINGNQLAIDCGISSSKIVFSVQLENHEQVFRSLGLLNEELKTVLLEIQETFGQKVFEKIFVVGFKNLWAKTVVKSVFDADANVVEEISALSNGVQLISDNFQLSEIEIKIEE LHLYEKYKINFANPLWNKFLQAMKFPSTDDANP
Sbjct:    1 MLNEALQLPESLLPFINGNQLAIDCGISSSKIVFSVQLENHEQVFRSLGLLNEELKTVLLEIQETFGQKVFEKIFVVGFKNLWAKTVVKSVFDADANVVEEISALSNGVQLISDNFQLSEIEIKIEEGLHLYEKYKINFANPLWNKFLQAMKFPSTDDANP 161          
BLAST of SMED30019284 vs. Planmine SMEST
Match: SMESG000077667.1 (SMESG000077667.1)

HSP 1 Score: 298.13 bits (762), Expect = 3.321e-91
Identity = 157/352 (44.60%), Postives = 234/352 (66.48%), Query Frame = 1
Query: 2359 MLNEALQLPESLLPFINGNQLAIDCGISSSKIVFSVQLENHEQVFRSLGLLNEELKTVLLEIQETFGQKVFEKIFVVGFKNLWAKTVVKSVFDADANVVEEISALSNGVQLISDNFQLSXXXXXX--XXSLHLYEKYKINFANPLWNKFLQAMKFPSTDDANPNKGILKFPNIMILAGSTIKYYLLNNDRTAKLINYSMFAGETLKGLFKCLVDSNNFNENILLASKGNREKTDTQIWEMISDNTNSPYGENPLNLPILSFGKCADYNKDKEYFNSNDILDSLSFVFLNETNNQMHKLCKAFKINHVYVCGGIFNSPIYTQYFQFGVTYIPNQIETKILNVDYILALGALMK 3408
            ML E   L ES LPFI+ N LAIDCGI  +KIVF  + +     F ++   N++L + LLEI E F ++   KI++ GFKNL  + +VK++F+ DA +V+E  A+ NG  LIS N +LSEIE KI  E +    +KYK++  NP++ +F++ M+  + ++   ++  +  P+I+ILAGSTIKY+L+  D++ +L++ S   GET +G  KCLVDSNN+ E +  A+KGNRE TDTQ+WE++SDN  SPYG+ P  LPI SFGK ADYNK KE F+ +DIL+SL  +F NET   + +LCK  K+  +Y CGG+F +P+  ++ +         ++ K+++ DY++ALGA+ K
Sbjct:    1 MLIEGAVLLESFLPFIDENSLAIDCGIVLAKIVFICRTDKVSLRFSTVA--NDKLDSFLLEIHEGFDRQTINKIYLTGFKNLSIRKIVKAIFNIDAILVDESFAVFNGFDLISKNMKLSEIEYKIDNESTTENVDKYKVDMNNPMFKQFIKGMQIKTDNETPSDEDCINVPHILILAGSTIKYFLVKKDKSVQLLDSSFCGGETFRGFCKCLVDSNNYGELMEKANKGNRENTDTQVWEVMSDNEKSPYGKLPQQLPIFSFGKSADYNKGKEDFSPDDILESLCSLFFNETMIHVIQLCKTHKLKTIYFCGGMFKAPVILKFLRIRNKIFSVDLKIKVIDCDYLIALGAMKK 350          
BLAST of SMED30019284 vs. Planmine SMEST
Match: SMESG000016748.1 (SMESG000016748.1)

HSP 1 Score: 217.624 bits (553), Expect = 7.955e-59
Identity = 188/700 (26.86%), Postives = 333/700 (47.57%), Query Frame = 3
Query:  186 CKDLEGLIVNGNEITEIPLAINQLKSLTYLNLSHNYITNLETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPETLCSLSELLSFDCSHNHLNFVP-KGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQ----SFPWLPESIIDFDLSDNPVESIPQNFMAKLNYI--------------------ENLNISNTNSDGILEIVFSL---NSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDIESSFVLEFQDRLESLDLSNNAISALPATAFTKFSKLRYLNLQGNPCKIPPSDVFNCGQMIPICSYLTAYNEFDATILDRIMPIISNKFPISRTRHLFRKLRIPESVIIELESTYRGKYNQKLLLSKGLEAWRKYLVDKATTDSLIRCFFLINEKNLNAEF----LYMKAIV 2189
             + L+ L V+ N++  IP+ I  L  L Y N SHN +  L  T F L  L Y++L++N +  + E IGN   LQ F I+ N+   +P ++ +++ L + + S+N +  +P   +GSLK   TL L+ N    +P  I                       ++   +  L++  N L+++ +++ KL+ L  L+LSFN+   IP  +G  + L   N+ GN+ IT  P                   SL  +  +      L+IS   + + P+   NC  L  L+   N++NE+P+ F     ++ L ++NN  + +P+ +  + +L +++ S+N     P  +  +  L  + ++ N+I   P     L+ L   N+S NKI     S  W+   +   DLS N + + P   + +L Y+                    E L   + +++   E    L   +S++   +DQ  G K+  +   +  L  L E+NLSNN  ++IP  I++++NL  + +  N +K++  +  L     LE++D+ NN ++ LP +  T  +K+++    G+P   PP  V   G M  I S+L     F+  +L ++  +I  K    +T+HL RKL++PE +I ++   Y  +YN+K  +  GLEAW+ +   +AT+  L+    LI  K+L  E     LY K I+
Sbjct:   97 ARGLQSLDVSNNKLEVIPVEIANLGHLEYFNCSHNKLKALPLTIFGLLKLQYMNLSHNQIQDIPEEIGNLKSLQTFLINSNEIVLIPSSISTITSLKTIEASNNQMCHLPISWVGSLK---TLKLDGNQFQFIPSQI-----------------------YDCCEMKYLSLAKNYLKFIPIELVKLRNLRQLDLSFNSIEYIPCEMGYWTKLVDFNIHGNN-ITYFP------------------QSLIANHKFV----CLNISGCQLKEFPLLLCNCYDLMELRVGENELNELPDKFQLFCNMKYLFMNNNNFELIPLQVCLLSTLVELDFSHNFLWQVPPGIFSLKHLRKLNLSFNNILIFPGCTAELSYLSELNVSHNKISEICDSISWM-TFLYYLDLSFNELSTFPSA-IFQLRYLKYLNLSNNLLDNFSKTDKKWEELRTIDFSNNKFTEFPVELCVHDSIRKLVFDQKEGTKIKSLPVEIKNLWRLAELNLSNNEFLTIPPVIMELENLKVLEMANNILKELPLN--LSDAKNLENIDVRNNQLTELPFSLTTLSNKIKF-KFDGSPLVNPPLIVCIGGNMESIQSFLRHNQAFEDVLLSKMFSVIVEKLQGDKTKHLLRKLKVPEEIIQQVYKKYPNRYNRKNQIKYGLEAWKSHCKFEATSKRLLFVIDLIGIKDLFIELRAISLYSKRII 742          

HSP 2 Score: 104.375 bits (259), Expect = 2.190e-22
Identity = 121/463 (26.13%), Postives = 214/463 (46.22%), Query Frame = 3
Query:  429 KFNTLPETLCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKELQNLEIXXXXXXXXXXXXHYVFELVNLLELNICNNDLQYLSMDIGKLKKLIVLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGXXXXXXXXXXXXDQCN-FSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNKINEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFPWL---PESIIDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDIESSFVLEFQDRLESLDLSNNAISALPATAFTKFSKLRYL 1805
            KF+   E L    EL  F     +L  VPK I     +  + L+ N +SDL + I  L  L    +  N L  +   +F    L  L++ NN L+ + ++I  L  L   N S N    +P  I  L  L+Y+NL  N +I ++P  I  +   +  +   N    +        +L+ ++ SNN +  LPI +    SL  LK   N+   IP       +++ L L+ N L  +P+ +  + +LR+++LS N     P  +     L    I  N+I   P+S+++  +    N+SG +++ FP L      +++  + +N +  +P  F    N ++ L ++N N + I   V  L++L    +  +    L ++   +  L +L+++NLS N ++  P    ++  L+ +++  NKI +I  S  + +   L  LDLS N +S  P+  F    +LRYL
Sbjct:   17 KFHPSGEGLFEYQELKCFVYVMQNLYDVPKEIYFHPDVELINLSKNKISDLSDEIIALSKLRHFFVNGNMLRTINVNLFYARGLQSLDVSNNKLEVIPVEIANLGHLEYFNCSHNKLKALPLTIFGLLKLQYMNLSHN-QIQDIPEEIGNLKSLQTFLINSNEIVLIPSSISTITSLKTIEASNNQMCHLPISWVG--SLKTLKLDGNQFQFIPSQIYDCCEMKYLSLAKNYLKFIPIELVKLRNLRQLDLSFNSIEYIPCEMGYWTKLVDFNIHGNNITYFPQSLIANHKFVCLNISGCQLKEFPLLLCNCYDLMELRVGENELNELPDKFQLFCN-MKYLFMNNNNFELIPLQVCLLSTLVELDFSHNF---LWQVPPGIFSLKHLRKLNLSFNNILIFPGCTAELSYLSELNVSHNKISEICDS--ISWMTFLYYLDLSFNELSTFPSAIF----QLRYL 466          

HSP 3 Score: 55.0694 bits (131), Expect = 3.574e-7
Identity = 66/241 (27.39%), Postives = 116/241 (48.13%), Query Frame = 3
Query: 1167 KINLSNNRFNNFPEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFPWLPESII------DFDLSDNPVESIPQN-FMAKLNYIENLNISNTNSDGILEIVFSLNSLKIFKYDQDRGKKLT-EIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLTSISLRGNKIKDIESSFVLEFQDRLESLDLSNNAISALPATAFTKFSKLRYLNLQGNPCKIPPSDVFNCGQM 1865
            KI+    +F+   E L +   L        ++  +P+ I     ++  NLS NKI     L + II       F ++ N + +I  N F A+   +++L++SN   + I   + +L  L+ F    ++ K L   I G L     L+ +NLS+N +  IPE+I  +K+L +  +  N+I  I SS  +     L++++ SNN +  LP +       L+ L L GN  +  PS +++C +M
Sbjct:   10 KIHSYCQKFHPSGEGLFEYQELKCFVYVMQNLYDVPKEIYFHPDVELINLSKNKISD---LSDEIIALSKLRHFFVNGNMLRTINVNLFYAR--GLQSLDVSNNKLEVIPVEIANLGHLEYFNCSHNKLKALPLTIFGLLK----LQYMNLSHNQIQDIPEEIGNLKSLQTFLINSNEIVLIPSS--ISTITSLKTIEASNNQMCHLPISW---VGSLKTLKLDGNQFQFIPSQIYDCCEM 236          
The following BLAST results are available for this feature:
BLAST of SMED30019284 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LRRD11.419e-6130.55leucine rich repeats and death domain containing 1... [more]
LRRD11.419e-6130.55leucine rich repeats and death domain containing 1... [more]
SHOC21.473e-3730.02SHOC2 leucine rich repeat scaffold protein [Source... [more]
LRRC12.182e-3130.21leucine rich repeat containing 1 [Source:HGNC Symb... [more]
SHOC21.197e-2925.53SHOC2 leucine rich repeat scaffold protein [Source... [more]
back to top
BLAST of SMED30019284 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
soc-21.869e-3429.36Leucine-rich repeat protein soc-2 [Source:UniProt... [more]
soc-22.169e-3429.36Leucine-rich repeat protein soc-2 [Source:UniProt... [more]
soc-22.187e-3429.36Leucine-rich repeat protein soc-2 [Source:UniProt... [more]
soc-22.187e-3429.36Leucine-rich repeat protein soc-2 [Source:UniProt... [more]
soc-23.415e-3429.36Leucine-rich repeat protein soc-2 [Source:UniProt... [more]
back to top
BLAST of SMED30019284 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sur-83.142e-3327.96gene:FBgn0038504 transcript:FBtr0339532[more]
Sur-83.142e-3327.96gene:FBgn0038504 transcript:FBtr0083448[more]
Sur-83.142e-3327.96gene:FBgn0038504 transcript:FBtr0083447[more]
Sur-83.432e-3327.96gene:FBgn0038504 transcript:FBtr0339531[more]
scrib3.762e-3028.15gene:FBgn0263289 transcript:FBtr0308633[more]
back to top
BLAST of SMED30019284 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
shoc21.843e-3727.36SHOC2 leucine rich repeat scaffold protein [Source... [more]
shoc21.843e-3727.36SHOC2 leucine rich repeat scaffold protein [Source... [more]
shoc21.843e-3727.36SHOC2 leucine rich repeat scaffold protein [Source... [more]
lrrc401.317e-3630.28leucine rich repeat containing 40 [Source:NCBI gen... [more]
BX511222.18.579e-3129.82malignant fibrous histiocytoma amplified sequence ... [more]
back to top
BLAST of SMED30019284 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LRRD11.241e-6531.37leucine-rich repeats and death domain containing 1... [more]
shoc24.939e-4029.47SHOC2 leucine-rich repeat scaffold protein [Source... [more]
shoc28.028e-4029.47SHOC2 leucine-rich repeat scaffold protein [Source... [more]
pparg2.346e-3426.49peroxisome proliferator activated receptor gamma [... [more]
pparg5.087e-3426.12peroxisome proliferator activated receptor gamma [... [more]
back to top
BLAST of SMED30019284 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lrrd16.004e-4527.39leucine rich repeats and death domain containing 1... [more]
Shoc21.118e-3730.02Shoc2, leucine rich repeat scaffold protein [Sourc... [more]
Shoc21.118e-3730.02Shoc2, leucine rich repeat scaffold protein [Sourc... [more]
Lrrc13.658e-3029.95leucine rich repeat containing 1 [Source:MGI Symbo... [more]
Lrriq47.071e-2926.63leucine-rich repeats and IQ motif containing 4 [So... [more]
back to top
BLAST of SMED30019284 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A4D1F6|LRRD1_HUMAN6.816e-6130.55Leucine-rich repeat and death domain-containing pr... [more]
sp|Q4R6F0|LRRD1_MACFA8.669e-6030.40Leucine-rich repeat and death domain-containing pr... [more]
sp|Q8C0R9|LRRD1_MOUSE4.200e-4427.39Leucine-rich repeat and death domain-containing pr... [more]
sp|Q5F4C4|SHOC2_CHICK1.025e-3931.13Leucine-rich repeat protein SHOC-2 OS=Gallus gallu... [more]
sp|Q8AVI4|SHOC2_XENLA3.073e-3829.26Leucine-rich repeat protein SHOC-2 OS=Xenopus laev... [more]
back to top
BLAST of SMED30019284 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267FJH22.242e-8129.47Death domain-containing protein OS=Macrostomum lig... [more]
A0A1I8ISL64.342e-8129.61Death domain-containing protein OS=Macrostomum lig... [more]
A0A267EGN04.517e-8129.61Death domain-containing protein OS=Macrostomum lig... [more]
A0A1I8INF06.729e-7629.02Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A2T7PZ227.667e-7529.56Death domain-containing protein OS=Pomacea canalic... [more]
back to top
BLAST of SMED30019284 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
shoc22.311e-3626.96SHOC2 leucine rich repeat scaffold protein [Source... [more]
shoc22.601e-3627.05SHOC2 leucine rich repeat scaffold protein [Source... [more]
lrrc12.979e-3028.31leucine rich repeat containing 1 [Source:NCBI gene... [more]
lrrc19.686e-3028.31leucine rich repeat containing 1 [Source:NCBI gene... [more]
lrrc402.342e-2927.77leucine rich repeat containing 40 [Source:NCBI gen... [more]
back to top
BLAST of SMED30019284 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000004940.11.591e-3728.22pep scaffold:Pmarinus_7.0:GL476356:339323:347865:-... [more]
lrrc402.968e-3526.25leucine rich repeat containing 40 [Source:NCBI gen... [more]
scrib1.900e-2831.96scribble planar cell polarity protein [Source:NCBI... [more]
ENSPMAT00000008894.17.698e-2224.64pep scaffold:Pmarinus_7.0:GL484493:7018:36468:1 ge... [more]
lgr43.429e-1628.71Danio rerio leucine-rich repeat containing G prote... [more]
back to top
BLAST of SMED30019284 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
CYR11.205e-1626.01Adenylate cyclase; required for cAMP production an... [more]
SOG23.056e-1037.89Key component of the RAM signaling network; requir... [more]
CCR45.467e-738.46Component of the CCR4-NOT transcriptional complex;... [more]
back to top
BLAST of SMED30019284 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO374994.109e-3628.41Leucine-rich repeat protein soc-2 homolog [Source... [more]
EDO469745.559e-3532.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO482173.719e-3326.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO380396.325e-3028.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO334321.236e-2429.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30019284 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
shoc24.468e-3727.16SHOC2 leucine rich repeat scaffold protein [Source... [more]
lrrc404.653e-3127.97leucine rich repeat containing 40 [Source:NCBI gen... [more]
shoc25.474e-2925.16SHOC2 leucine rich repeat scaffold protein [Source... [more]
lrrc11.505e-2830.96leucine rich repeat containing 1 [Source:NCBI gene... [more]
lrrc72.029e-2830.47leucine rich repeat containing 7 [Source:NCBI gene... [more]
back to top
BLAST of SMED30019284 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000077670.13.522e-1699.19SMESG000077670.1[more]
SMESG000077669.11.064e-16674.86SMESG000077669.1[more]
SMESG000077668.11.376e-9599.38SMESG000077668.1[more]
SMESG000077667.13.321e-9144.60SMESG000077667.1[more]
SMESG000016748.17.955e-5926.86SMESG000016748.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019284 ID=SMED30019284|Name=SMED30019284|organism=Schmidtea mediterranea sexual|type=transcript|length=3559bp
CTTATCTAATGATTGAATGCGATGACTTAAAATATTTTAACGCATCTACT
AATGAAGATAAAATTTTTAAAACTCTAACAAAAGAAGAAATTGATAATAT
TAATGAAGATTTCTTTGAAAAAGAAAAAATAAACATCCTTAATTGTAGCT
ATTCTAAAGTAAAGAAAATCGGTAAATTGTGTAATTGTAAAGATTTAGAA
GGACTTATAGTAAACGGTAATGAAATAACAGAAATTCCATTAGCAATTAA
TCAACTAAAATCTCTTACGTATTTGAATCTTTCTCATAATTATATTACTA
ATTTGGAAACCACTTTTTTCGATTTGGAAAATTTGATTTATTTAGATTTA
GCTAATAATCATTTAACAGTATTATCAGAATTAATCGGGAATTTTTCAAA
ACTTCAATTTTTTAATATAAGTGGAAATAAATTTAATACATTACCGGAAA
CCTTATGTTCTCTGTCGGAATTATTATCTTTTGATTGCAGCCACAATCAC
TTAAATTTCGTTCCAAAGGGTATTGGTTCACTTAAACAGCTTACGACTTT
AATATTAAATCATAATGACTTGAGTGATTTACCTGAAACAATTAAAGAAC
TTCAAAACCTTGAAATTTTACAACTTGGAAATAATAATTTGACAAATTTG
ACTCATTATGTTTTCGAATTGGTTAATCTTTTGGAATTAAACATTTGTAA
CAATGATTTACAATATTTGTCAATGGATATAGGAAAATTGAAAAAGTTGA
TCGTTTTAAATCTATCATTTAATAACTTTATCGAAATTCCATCAAACATT
GGAGAACTATCATCTTTAAAATACTTAAATCTTCGTGGGAATTCCAAAAT
TACAAATTTACCTGGATCAATTCTGTTGATATCGTTGAGTGAATTGTTGA
TTGATCAATGTAATTTTTCATCTCTTTCTGATGATTTTGGTTATTATAAC
AATTTGAGAATACTCGATATCAGTAACAATCACATTACCCAGTTGCCGAT
AGATTTTAAAAACTGTCTCTCTTTAGCCGTTTTGAAATGGTCGAATAATA
AAATCAATGAGATTCCGGAAGTTTTTGGTTCCCTTAAAAAATTGCAAATT
TTAGATTTAAGCAACAACGAACTGGATTCTTTACCGGTAATTATGGAATA
TATGGAATCTCTTCGAAAAATTAACCTTTCAAATAATAGGTTCAATAACT
TTCCAGAAATCCTCACAAAAATCCCTACATTAAATTCCATTGAAATTACA
GCCAATGACATCGAGACAATTCCAGAATCAATAATGTCTTTGACGCGATT
GCAGACATTCAATTTGAGTGGAAACAAAATCCAGTCATTTCCATGGTTAC
CCGAGTCAATAATTGATTTTGATTTGTCGGATAATCCCGTGGAATCAATT
CCACAAAATTTTATGGCCAAATTGAATTATATAGAAAATCTGAATATATC
AAACACAAATAGTGATGGAATTCTTGAAATTGTTTTTTCATTAAATTCAT
TGAAAATATTCAAATACGATCAAGATAGAGGGAAAAAACTGACAGAAATA
GATGGGCGTTTGAGTCAGTTGAATAATCTTAAAGAAATCAATTTATCAAA
TAATTGTCTAATGTCGATTCCTGAGCAGATATTACAAATGAAAAATTTAA
CTTCGATTTCATTGAGAGGAAATAAAATCAAAGATATAGAATCTAGTTTT
GTATTGGAATTTCAAGACAGACTTGAATCTTTGGATTTGTCGAACAATGC
AATTTCAGCTCTTCCGGCTACCGCCTTTACAAAATTTAGTAAACTAAGAT
ATTTGAATTTACAAGGAAATCCCTGCAAAATTCCTCCGTCTGATGTATTC
AATTGTGGACAAATGATTCCAATATGCAGTTATCTTACAGCATATAATGA
ATTTGATGCTACCATTCTTGATCGAATAATGCCAATTATCAGTAATAAAT
TCCCAATTTCAAGGACTCGGCATTTGTTTCGTAAACTTCGAATTCCCGAA
TCAGTAATTATTGAACTTGAATCTACATATCGAGGCAAATACAATCAGAA
ACTTTTGTTAAGCAAAGGTTTGGAGGCCTGGAGAAAATATTTAGTTGACA
AAGCGACAACCGACTCTCTGATCCGATGTTTCTTTTTGATTAATGAAAAA
AATCTCAATGCTGAGTTCCTTTATATGAAGGCTATTGTTAATCGAATCAA
ATTGTGACAATTGATCAGTATAGATTTGCACAGTGCGATTGATTAATGGG
TAAATGTGTGTGCTGAGTGTGTTATGTATTAAATATTTATTTTCTTTGCC
TTTTGAAAATTAATCATTTGTTTTATTTATTTGTTCACAATTTTTAATCG
ACTTTGAAATGTTAAATGAAGCTTTACAGTTACCGGAATCGTTATTGCCA
TTTATTAATGGTAATCAGTTGGCCATTGACTGTGGGATTTCTTCGTCAAA
AATAGTTTTCAGTGTTCAGCTTGAAAATCATGAACAAGTATTTCGTTCTC
TAGGTCTTCTCAATGAAGAATTGAAAACTGTTCTTTTGGAAATTCAAGAA
ACATTTGGACAAAAAGTGTTTGAGAAAATATTTGTAGTTGGTTTTAAAAA
TCTATGGGCAAAAACGGTGGTAAAATCTGTATTTGATGCCGATGCAAATG
TTGTTGAGGAGATTTCAGCACTTTCTAATGGAGTGCAATTGATTTCGGAT
AATTTTCAATTAAGTGAAATTGAAATAAAAATAGAAGAAAGTCTACATCT
TTATGAGAAATATAAAATAAACTTCGCCAATCCATTATGGAATAAGTTTC
TTCAAGCAATGAAATTTCCATCGACAGATGACGCAAATCCTAATAAAGGA
ATCTTAAAGTTTCCTAACATCATGATATTGGCTGGCTCAACAATTAAATA
CTATTTGCTAAACAATGATAGAACAGCGAAGTTAATAAATTATTCCATGT
TTGCAGGAGAAACTCTGAAGGGTCTCTTTAAATGTCTCGTCGATTCAAAC
AATTTTAATGAAAACATTTTACTGGCATCTAAAGGCAACCGAGAGAAAAC
CGATACGCAAATATGGGAAATGATATCTGACAATACAAATTCTCCGTACG
GAGAAAATCCTCTAAATTTACCTATATTGTCTTTCGGTAAATGTGCGGAT
TATAATAAAGATAAAGAATATTTTAATTCAAATGATATATTGGACTCCTT
GAGTTTTGTATTTTTAAACGAAACTAATAATCAGATGCATAAACTGTGCA
AGGCTTTTAAAATAAACCATGTTTACGTTTGTGGGGGTATATTTAACTCT
CCAATATATACGCAATATTTTCAATTTGGAGTGACATATATACCAAATCA
AATAGAAACTAAAATTCTGAATGTTGATTATATTCTTGCTTTAGGTGCTT
TGATGAAATGATATTTCAATTCAGATGTTATTTAAAGATTAATGGATTTA
CAAAATGTTTTTTTTAATAAAAACATATATCATAGCTTTTACTTTTCTAT
TTGTAAAAGTAATTTTTGGAATTTTAATTTATTGAAACTATAAAAGTATT
CAAAAACGG
back to top

protein sequence of SMED30019284-orf-1

>SMED30019284-orf-1 ID=SMED30019284-orf-1|Name=SMED30019284-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=735bp
YLMIECDDLKYFNASTNEDKIFKTLTKEEIDNINEDFFEKEKINILNCSY
SKVKKIGKLCNCKDLEGLIVNGNEITEIPLAINQLKSLTYLNLSHNYITN
LETTFFDLENLIYLDLANNHLTVLSELIGNFSKLQFFNISGNKFNTLPET
LCSLSELLSFDCSHNHLNFVPKGIGSLKQLTTLILNHNDLSDLPETIKEL
QNLEILQLGNNNLTNLTHYVFELVNLLELNICNNDLQYLSMDIGKLKKLI
VLNLSFNNFIEIPSNIGELSSLKYLNLRGNSKITNLPGSILLISLSELLI
DQCNFSSLSDDFGYYNNLRILDISNNHITQLPIDFKNCLSLAVLKWSNNK
INEIPEVFGSLKKLQILDLSNNELDSLPVIMEYMESLRKINLSNNRFNNF
PEILTKIPTLNSIEITANDIETIPESIMSLTRLQTFNLSGNKIQSFPWLP
ESIIDFDLSDNPVESIPQNFMAKLNYIENLNISNTNSDGILEIVFSLNSL
KIFKYDQDRGKKLTEIDGRLSQLNNLKEINLSNNCLMSIPEQILQMKNLT
SISLRGNKIKDIESSFVLEFQDRLESLDLSNNAISALPATAFTKFSKLRY
LNLQGNPCKIPPSDVFNCGQMIPICSYLTAYNEFDATILDRIMPIISNKF
PISRTRHLFRKLRIPESVIIELESTYRGKYNQKLLLSKGLEAWRKYLVDK
ATTDSLIRCFFLINEKNLNAEFLYMKAIVNRIKL*
back to top

protein sequence of SMED30019284-orf-2

>SMED30019284-orf-2 ID=SMED30019284-orf-2|Name=SMED30019284-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=351bp
MLNEALQLPESLLPFINGNQLAIDCGISSSKIVFSVQLENHEQVFRSLGL
LNEELKTVLLEIQETFGQKVFEKIFVVGFKNLWAKTVVKSVFDADANVVE
EISALSNGVQLISDNFQLSEIEIKIEESLHLYEKYKINFANPLWNKFLQA
MKFPSTDDANPNKGILKFPNIMILAGSTIKYYLLNNDRTAKLINYSMFAG
ETLKGLFKCLVDSNNFNENILLASKGNREKTDTQIWEMISDNTNSPYGEN
PLNLPILSFGKCADYNKDKEYFNSNDILDSLSFVFLNETNNQMHKLCKAF
KINHVYVCGGIFNSPIYTQYFQFGVTYIPNQIETKILNVDYILALGALMK
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR004567Type_II_PanK
IPR003591Leu-rich_rpt_typical-subtyp
IPR001611Leu-rich_rpt
IPR032675LRR_dom_sf
IPR011029DEATH-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0004594pantothenate kinase activity
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0015937coenzyme A biosynthetic process
GO:0007165signal transduction
Vocabulary: cellular component
TermDefinition
GO:0005886plasma membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00019LEURICHRPTcoord: 361..374
score: 53.93
coord: 318..331
score: 42.25
NoneNo IPR availableSMARTSM00365LRR_sd22_2coord: 200..218
e-value: 650.0
score: 0.8
coord: 177..195
e-value: 660.0
score: 0.7
coord: 546..567
e-value: 36.0
score: 11.1
coord: 315..335
e-value: 780.0
score: 0.1
coord: 108..129
e-value: 100.0
score: 7.4
coord: 430..458
e-value: 190.0
score: 5.1
coord: 361..389
e-value: 85.0
score: 8.0
coord: 571..603
e-value: 290.0
score: 3.7
coord: 85..103
e-value: 200.0
score: 5.0
coord: 269..288
e-value: 430.0
score: 2.2
NoneNo IPR availableSMARTSM00364LRR_bac_2coord: 177..196
e-value: 20.0
score: 11.4
coord: 108..127
e-value: 7.1
score: 14.8
coord: 131..150
e-value: 62.0
score: 7.7
coord: 384..403
e-value: 23.0
score: 10.9
coord: 361..380
e-value: 8.8
score: 14.1
coord: 315..335
e-value: 220.0
score: 3.4
coord: 246..265
e-value: 66.0
score: 7.5
coord: 338..357
e-value: 570.0
score: 0.3
coord: 269..289
e-value: 120.0
score: 5.5
coord: 430..449
e-value: 410.0
score: 1.4
coord: 85..104
e-value: 150.0
score: 4.8
coord: 523..542
e-value: 94.0
score: 6.3
coord: 571..590
e-value: 16.0
score: 12.1
coord: 200..219
e-value: 87.0
score: 6.5
NoneNo IPR availablePANTHERPTHR16083LEUCINE RICH REPEAT CONTAINING PROTEINcoord: 317..505
coord: 154..305
coord: 510..613
coord: 57..172
coord: 291..447
NoneNo IPR availableSUPERFAMILYSSF52058L domain-likecoord: 32..308
NoneNo IPR availableSUPERFAMILYSSF52058L domain-likecoord: 289..620
IPR003591Leucine-rich repeat, typical subtypeSMARTSM00369LRR_typ_2coord: 317..337
e-value: 27.0
score: 9.7
coord: 573..594
e-value: 0.57
score: 19.2
coord: 361..383
e-value: 12.0
score: 12.7
coord: 177..199
e-value: 7.6
score: 14.2
coord: 108..130
e-value: 11.0
score: 13.0
coord: 85..107
e-value: 4.9
score: 15.8
coord: 200..223
e-value: 0.047
score: 22.8
coord: 595..618
e-value: 190.0
score: 2.8
coord: 246..269
e-value: 1.2
score: 18.2
coord: 292..314
e-value: 330.0
score: 0.8
coord: 384..406
e-value: 28.0
score: 9.6
coord: 131..154
e-value: 18.0
score: 11.2
coord: 430..452
e-value: 19.0
score: 10.9
coord: 523..546
e-value: 0.031
score: 23.4
IPR001611Leucine-rich repeatPFAMPF13855LRR_8coord: 548..607
e-value: 2.1E-11
score: 43.4
coord: 87..144
e-value: 9.1E-10
score: 38.2
coord: 317..374
e-value: 2.8E-9
score: 36.6
coord: 386..443
e-value: 1.0E-6
score: 28.4
IPR001611Leucine-rich repeatPFAMPF00560LRR_1coord: 525..540
e-value: 1.3
score: 9.8
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 363..384
score: 8.236
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 64..85
score: 5.841
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 386..407
score: 6.757
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 548..569
score: 8.251
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 87..108
score: 7.997
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 179..200
score: 7.265
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 573..594
score: 7.658
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 156..177
score: 4.578
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 133..155
score: 5.602
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 225..247
score: 5.517
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 525..546
score: 7.766
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 597..617
score: 5.64
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 110..131
score: 7.604
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 317..338
score: 7.874
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 340..361
score: 6.28
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 202..223
score: 7.419
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 248..269
score: 6.688
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 432..453
score: 7.288
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 409..430
score: 4.832
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 271..293
score: 6.788
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 292..510
e-value: 8.9E-43
score: 148.5
coord: 511..630
e-value: 2.6E-22
score: 80.9
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 145..291
e-value: 1.2E-29
score: 104.6
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 7..144
e-value: 2.3E-25
score: 90.9