FHA domain-containing protein

Overview
NameFHA domain-containing protein
Smed IDSMED30019275
Length (bp)1810
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of FHA domain-containing protein (SMED30019275) t-SNE clustered cells

Violin plots show distribution of expression levels for FHA domain-containing protein (SMED30019275) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of FHA domain-containing protein (SMED30019275) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for FHA domain-containing protein (SMED30019275) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019275

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymaSMED30019275SMESG000022990.1 dd_Smed_v4_13269_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
pigment cellSMED30019275SMESG000022990.1 SmedASXL_016771SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
X1 cellSMED30019275SMESG000022990.1 SmedASXL_016771SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30019275SMESG000022990.1 SmedASXL_016771SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
cephalic gangliaSMED30019275SMESG000022990.1 dd_Smed_v4_13269_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30019275SMESG000022990.1 dd_Smed_v4_13269_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30019275SMESG000022990.1 dd_Smed_v6_13269_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
body wall musculatureSMED30019275SMESG000022990.1 dd_Smed_v4_13269_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30019275SMESG000022990.1 dd_Smed_v4_13269_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30019275SMESG000022990.1 SMED30019275smed_20140614PMID:27523733
Lei et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30019275SMESG000022990.1 SMED_09673_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30019275SMESG000022990.1 SMED_09673_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of FHA domain-containing protein vs. Ensembl Human
Match: NBN (nibrin [Source:HGNC Symbol;Acc:HGNC:7652])

HSP 1 Score: 110.538 bits (275), Expect = 1.335e-24
Identity = 87/317 (27.44%), Postives = 143/317 (45.11%), Query Frame = 1
Query:   94 FLPSVTYTIGRVSADVILTH-TSISRKHAVLIWEC---------DLNYITIDDCSKFGTFINKAPLINK-KGNIKDGDIVTFGAQPGVDLNCSFVAFDIVCSTLSNADRVLLKQYLSIIGGNLLENCNDKVEYMVMSNLKATFKVVCALIKQIKIVKIDFVKAMVDYFKGINQILPDPDHYLPEIHNPDDCFIGLDYKPNPKRKCLFNNKQFYFLTQEKLSLLSEAVLSGGGIAMLLTDSDCRDQSLRVKLAHCDSIVMQEAVTTNLVNEISLI--------------LKGINKRLINDSEIGFAVMLASVDEYCNP 969
             L  V Y +GR +  +++ +  SISR HAVL             ++  +T+ D SK+GTF+N+  + N     +K GD +TFG   G      +       S L  + +  L Q +  +GG  + N  ++  ++VM ++K T K +CALI    IVK ++    +   +   Q  P  + + P +  P      +D     +RK +F  K F FL  ++   LS AV+ GGG A L+T+ +  + +  +    C        V T + N  +LI              L+    R I ++EIG AV+  +   YC+P
Sbjct:   18 LLTGVEYVVGRKNCAILIENDQSISRNHAVLTANFSVTNLSQTDEIPVLTLKDNSKYGTFVNEEKMQNGFSRTLKSGDGITFGVF-GSKFRIEYEPLVACSSCLDVSGKTALNQAILQLGGFTVNNWTEECTHLVMVSVKVTIKTICALICGRPIVKPEYFTEFLKAVESKKQP-PQIESFYPPLDEPSIGSKNVDLSGRQERKQIFKGKTFIFLNAKQHKKLSSAVVFGGGEARLITEENEEEHNFFLAPGTC-------VVDTGITNSQTLIPDCQKKWIQSIMDMLQRQGLRPIPEAEIGLAVIFMTTKNYCDP 325          
BLAST of FHA domain-containing protein vs. Ensembl Human
Match: NBN (nibrin [Source:HGNC Symbol;Acc:HGNC:7652])

HSP 1 Score: 84.7297 bits (208), Expect = 1.510e-16
Identity = 65/244 (26.64%), Postives = 107/244 (43.85%), Query Frame = 1
Query:  280 IKDGDIVTFGAQPGVDLNCSFVAFDIVCSTLSNADRVLLKQYLSIIGGNLLENCNDKVEYMVMSNLKATFKVVCALIKQIKIVKIDFVKAMVDYFKGINQILPDPDHYLPEIHNPDDCFIGLDYKPNPKRKCLFNNKQFYFLTQEKLSLLSEAVLSGGGIAMLLTDSDCRDQSLRVKLAHCDSIVMQEAVTTNLVNEISLI--------------LKGINKRLINDSEIGFAVMLASVDEYCNP 969
            +K GD +TFG   G      +       S L  + +  L Q +  +GG  + N  ++  ++VM ++K T K +CALI    IVK ++    +   +   Q  P  + + P +  P      +D     +RK +F  K F FL  ++   LS AV+ GGG A L+T+ +  + +  +    C        V T + N  +LI              L+    R I ++EIG AV+  +   YC+P
Sbjct:    9 LKSGDGITFGVF-GSKFRIEYEPLVACSSCLDVSGKTALNQAILQLGGFTVNNWTEECTHLVMVSVKVTIKTICALICGRPIVKPEYFTEFLKAVESKKQP-PQIESFYPPLDEPSIGSKNVDLSGRQERKQIFKGKTFIFLNAKQHKKLSSAVVFGGGEARLITEENEEEHNFFLAPGTC-------VVDTGITNSQTLIPDCQKKWIQSIMDMLQRQGLRPIPEAEIGLAVIFMTTKNYCDP 243          
BLAST of FHA domain-containing protein vs. Ensembl Human
Match: NBN (nibrin [Source:HGNC Symbol;Acc:HGNC:7652])

HSP 1 Score: 62.003 bits (149), Expect = 1.069e-10
Identity = 44/159 (27.67%), Postives = 72/159 (45.28%), Query Frame = 1
Query:  277 NIKDGDIVTFGAQPGVDLNCSFVAFDIVCSTLSNADRVLLKQYLSIIGGNLLENCNDKVEYMVMSNLKATFKVVCALIKQIKIVKIDFVKAMVDYFKGINQILPDPDHYLPEIHNPDDCFIGLDYKPNPKRKCLFNNKQFYFLTQEKLSLLSEAVLSGG 753
             +K GD +TFG   G      +       S L  + +  L Q +  +GG  + N  ++  ++VM ++K T K +CALI    IVK ++    +   +   Q  P  + + P +  P      +D     +RK +F  K F FL  ++   LS AV+ GG
Sbjct:    8 TLKSGDGITFGVF-GSKFRIEYEPLVACSSCLDVSGKTALNQAILQLGGFTVNNWTEECTHLVMVSVKVTIKTICALICGRPIVKPEYFTEFLKAVESKKQ-PPQIESFYPPLDEPSIGSKNVDLSGRQERKQIFKGKTFIFLNAKQHKKLSSAVVFGG 164          
BLAST of FHA domain-containing protein vs. Ensembl Fly
Match: nbs (gene:FBgn0261530 transcript:FBtr0306039)

HSP 1 Score: 100.908 bits (250), Expect = 8.849e-22
Identity = 80/309 (25.89%), Postives = 142/309 (45.95%), Query Frame = 1
Query:  112 YTIGRVSADVILTHT-SISRKHAVLIWECDLN---YITIDDC-SKFGTFI--------NKAPLINKKGNIKDGDIVTFGAQPGVDLNCSFVAFDIVCSTLSNADRVLLKQYLSIIGGNLLENCNDKVEYMVMSNLKATFKVVCALIKQIKIVKIDFVKAMVDYFKGIN--QILPDPDHYLPEIHNPDDCFIGLDYKPNPKRKCLFNNKQFYFLTQEKLSLLSEAVLSGGGIAMLLTDSDCRDQSLRVK---LAHCDSIVMQ-----EAVTTNLVNEISLILKGINKRLINDSEIGFAVMLASVDEYCNP 969
            YTIGR++ D+I+    SISR HA L+ + + +    + I+D  S++GTFI         K P       +  G  + FGA   +    + +      S L+ ++   L + L  +GG +  N  ++  ++ M+ +  T K++ A+++   IV   + + M+   + I+  +  P P+ Y P           +D    P+R  LF  K F F+ ++   +    V   G          C+D +  V+   L   D IV+Q     ++  T  +N I  IL+   +R+I + EIG A++  S+ E+CNP
Sbjct:   20 YTIGRLATDLIVAQDLSISRNHAQLLIQTEADGDDTLHIEDLGSRYGTFIFPKNSQKPRKVPA-KTSTPLPVGTRLRFGANMSI-WQVTQLKLVTTVSALTRSEVQELTKMLEPMGGTVTSNWTEECSHLTMNEVSVTVKLLHAMLENKPIVTFPYWRKMLQAAQSIHVKEGWPQPEDYQP---------TNIDVTWRPERTRLFAGKTFVFMNRKHFDMYGSVVQKAGAT--------CKDINSGVRKTFLTKSDVIVIQYVPSSQSQATESINSIQDILEQNGRRIIQEYEIGMALIHCSITEFCNP 309          
BLAST of FHA domain-containing protein vs. Ensembl Fly
Match: nbs (gene:FBgn0261530 transcript:FBtr0306040)

HSP 1 Score: 97.0561 bits (240), Expect = 1.366e-20
Identity = 80/311 (25.72%), Postives = 142/311 (45.66%), Query Frame = 1
Query:  112 YTIGRVSADVILTHT-SISRKHAVLIWECDLN---YITIDDC-SKFGTFI--------NKAPLINKKGNIKDGDIVTFGAQPGVDLNCSFVAFDIVCSTLSNADRVLLKQYLSIIGGNLLENCNDKVEYMVMSNLKATFKVVCALIKQIKIVKIDFVKAMVDYFKGIN--QILPDPDHYLPEIHNPDDCFIGLDYKPNPKRKCLFNNKQFYFLTQEKLSLLSEAVLSGGGIAMLLTDSDCRDQSLRVK---LAHCDSIVMQ-----EAVTTNLVNEIS--LILKGINKRLINDSEIGFAVMLASVDEYCNP 969
            YTIGR++ D+I+    SISR HA L+ + + +    + I+D  S++GTFI         K P       +  G  + FGA   +    + +      S L+ ++   L + L  +GG +  N  ++  ++ M+ +  T K++ A+++   IV   + + M+   + I+  +  P P+ Y P           +D    P+R  LF  K F F+ ++   +    V   G          C+D +  V+   L   D IV+Q     ++  T  +N I    IL+   +R+I + EIG A++  S+ E+CNP
Sbjct:   20 YTIGRLATDLIVAQDLSISRNHAQLLIQTEADGDDTLHIEDLGSRYGTFIFPKNSQKPRKVPA-KTSTPLPVGTRLRFGANMSI-WQVTQLKLVTTVSALTRSEVQELTKMLEPMGGTVTSNWTEECSHLTMNEVSVTVKLLHAMLENKPIVTFPYWRKMLQAAQSIHVKEGWPQPEDYQP---------TNIDVTWRPERTRLFAGKTFVFMNRKHFDMYGSVVQKAGAT--------CKDINSGVRKTFLTKSDVIVIQYVPSSQSQATESINSIQDRYILEQNGRRIIQEYEIGMALIHCSITEFCNP 311          
BLAST of FHA domain-containing protein vs. Ensembl Zebrafish
Match: nbn (nibrin [Source:NCBI gene;Acc:544655])

HSP 1 Score: 137.887 bits (346), Expect = 1.286e-33
Identity = 103/337 (30.56%), Postives = 161/337 (47.77%), Query Frame = 1
Query:   55 WKF---ENKNKNIVKYFLPSVTYTIGRVSADVILTH-TSISRKHAVLIWECDLNYITIDDCSKFGTFINKAPL-INKKGNIKDGDIVTFGA-QPGVDLNCSFVAFDIVCST-LSNADRVLLKQYLSIIGGNLLENCNDKVEYMVMSNLKATFKVVCALIKQIKIVKIDFVKAMVDYFKGINQILPDP--DHYLPEIHNPDDCFIGLDYKPNPKRKCLFNNKQFYFLTQEKLSLLSEAVLSGGGIAMLLTDSDCRDQSLRVKLAHCDSIVMQEAVTTN-----------LVNEISLILKGINKRLINDSEIGFAVMLASVDEYCNPYRALPKSHDKEN 1005
            WK    E+  ++++   L    Y +GR + +++LT+  SISR HAVL        +T+ D SK+GTF+N   L       ++ G  +TFG  Q    L    +   +VCS+ + N  +V L Q +  +GG L+ +      ++VM  +K T K +CAL+    IVK  F  A+    K + Q LP P  + + P+I  P      +D    P+RK LF  K F FL+ +++  LS AV  GGG++ LL +      +L V L    S  + + ++ N            ++ +  IL     R I +SE+G A +  S   YCNP  +L     K N
Sbjct:    2 WKLQPTESGGESVI--LLAGQEYVVGRKNCEILLTNDQSISRVHAVLT--VTEQAVTLKDSSKYGTFVNGEKLESGSTKTLQTGYKITFGVFQSKFSLEKECI---VVCSSCVDNEGKVTLSQDIRSVGGRLVSSWTSDCTHLVMPTVKVTIKTICALLCCRPIVKPAFFSALS---KAVQQKLPLPKAERFRPQIDEPSLARDDVDLSARPERKSLFKGKTFLFLSSKQMKRLSVAVSCGGGVSQLLDEG-----ALPVSLLESSSTCVLDMISGNSQPVISPASKKWLDSVGQILHRKGLRFITESEVGLAAIHVSNQTYCNPCSSLQSESVKTN 323          
BLAST of FHA domain-containing protein vs. Ensembl Zebrafish
Match: nbn (nibrin [Source:NCBI gene;Acc:544655])

HSP 1 Score: 137.887 bits (346), Expect = 1.371e-33
Identity = 103/337 (30.56%), Postives = 161/337 (47.77%), Query Frame = 1
Query:   55 WKF---ENKNKNIVKYFLPSVTYTIGRVSADVILTH-TSISRKHAVLIWECDLNYITIDDCSKFGTFINKAPL-INKKGNIKDGDIVTFGA-QPGVDLNCSFVAFDIVCST-LSNADRVLLKQYLSIIGGNLLENCNDKVEYMVMSNLKATFKVVCALIKQIKIVKIDFVKAMVDYFKGINQILPDP--DHYLPEIHNPDDCFIGLDYKPNPKRKCLFNNKQFYFLTQEKLSLLSEAVLSGGGIAMLLTDSDCRDQSLRVKLAHCDSIVMQEAVTTN-----------LVNEISLILKGINKRLINDSEIGFAVMLASVDEYCNPYRALPKSHDKEN 1005
            WK    E+  ++++   L    Y +GR + +++LT+  SISR HAVL        +T+ D SK+GTF+N   L       ++ G  +TFG  Q    L    +   +VCS+ + N  +V L Q +  +GG L+ +      ++VM  +K T K +CAL+    IVK  F  A+    K + Q LP P  + + P+I  P      +D    P+RK LF  K F FL+ +++  LS AV  GGG++ LL +      +L V L    S  + + ++ N            ++ +  IL     R I +SE+G A +  S   YCNP  +L     K N
Sbjct:    2 WKLQPTESGGESVI--LLAGQEYVVGRKNCEILLTNDQSISRVHAVLT--VTEQAVTLKDSSKYGTFVNGEKLESGSTKTLQTGYKITFGVFQSKFSLEKECI---VVCSSCVDNEGKVTLSQDIRSVGGRLVSSWTSDCTHLVMPTVKVTIKTICALLCCRPIVKPAFFSALS---KAVQQKLPLPKAERFRPQIDEPSLARDDVDLSARPERKSLFKGKTFLFLSSKQMKRLSVAVSCGGGVSQLLDEG-----ALPVSLLESSSTCVLDMISGNSQPVISPASKKWLDSVGQILHRKGLRFITESEVGLAAIHVSNQTYCNPCSSLQSESVKTN 323          
BLAST of FHA domain-containing protein vs. Ensembl Zebrafish
Match: nbn (nibrin [Source:NCBI gene;Acc:544655])

HSP 1 Score: 137.502 bits (345), Expect = 1.680e-33
Identity = 103/337 (30.56%), Postives = 161/337 (47.77%), Query Frame = 1
Query:   55 WKF---ENKNKNIVKYFLPSVTYTIGRVSADVILTH-TSISRKHAVLIWECDLNYITIDDCSKFGTFINKAPL-INKKGNIKDGDIVTFGA-QPGVDLNCSFVAFDIVCST-LSNADRVLLKQYLSIIGGNLLENCNDKVEYMVMSNLKATFKVVCALIKQIKIVKIDFVKAMVDYFKGINQILPDP--DHYLPEIHNPDDCFIGLDYKPNPKRKCLFNNKQFYFLTQEKLSLLSEAVLSGGGIAMLLTDSDCRDQSLRVKLAHCDSIVMQEAVTTN-----------LVNEISLILKGINKRLINDSEIGFAVMLASVDEYCNPYRALPKSHDKEN 1005
            WK    E+  ++++   L    Y +GR + +++LT+  SISR HAVL        +T+ D SK+GTF+N   L       ++ G  +TFG  Q    L    +   +VCS+ + N  +V L Q +  +GG L+ +      ++VM  +K T K +CAL+    IVK  F  A+    K + Q LP P  + + P+I  P      +D    P+RK LF  K F FL+ +++  LS AV  GGG++ LL +      +L V L    S  + + ++ N            ++ +  IL     R I +SE+G A +  S   YCNP  +L     K N
Sbjct:    2 WKLQPTESGGESVI--LLAGQEYVVGRKNCEILLTNDQSISRVHAVLT--VTEQAVTLKDSSKYGTFVNGEKLESGSTKTLQTGYKITFGVFQSKFSLEKECI---VVCSSCVDNEGKVTLSQDIRSVGGRLVSSWTSDCTHLVMPTVKVTIKTICALLCCRPIVKPAFFSALS---KAVQQKLPLPKAERFRPQIDEPSLARDDVDLSARPERKSLFKGKTFLFLSSKQMKRLSVAVSCGGGVSQLLDEG-----ALPVSLLESSSTCVLDMISGNSQPVISPASKKWLDSVGQILHRKGLRFITESEVGLAAIHVSNQTYCNPCSSLQSESVKTN 323          
BLAST of FHA domain-containing protein vs. Ensembl Zebrafish
Match: nbn (nibrin [Source:NCBI gene;Acc:544655])

HSP 1 Score: 60.4622 bits (145), Expect = 2.005e-10
Identity = 47/154 (30.52%), Postives = 78/154 (50.65%), Query Frame = 1
Query:   55 WKF---ENKNKNIVKYFLPSVTYTIGRVSADVILTH-TSISRKHAVLIWECDLNYITIDDCSKFGTFINKAPL-INKKGNIKDGDIVTFGA-QPGVDLNCSFVAFDIVCST-LSNADRVLLKQYLSIIGGNLLENCNDKVEYMVMSNLKATFKV 495
            WK    E+  ++++   L    Y +GR + +++LT+  SISR HAVL        +T+ D SK+GTF+N   L       ++ G  +TFG  Q    L    +   +VCS+ + N  +V L Q +  +GG L+ +      ++VM  +K T K+
Sbjct:    2 WKLQPTESGGESVI--LLAGQEYVVGRKNCEILLTNDQSISRVHAVLT--VTEQAVTLKDSSKYGTFVNGEKLESGSTKTLQTGYKITFGVFQSKFSLEKECI---VVCSSCVDNEGKVTLSQDIRSVGGRLVSSWTSDCTHLVMPTVKVTIKI 148          
BLAST of FHA domain-containing protein vs. Ensembl Xenopus
Match: adcy9 (adenylate cyclase 9 [Source:Xenbase;Acc:XB-GENE-999257])

HSP 1 Score: 124.02 bits (310), Expect = 5.387e-29
Identity = 100/319 (31.35%), Postives = 162/319 (50.78%), Query Frame = 1
Query:   91 YFLPSVTYTIGRVSADVILTH-TSISRKHAVLIWEC---------DLNYITIDDCSKFGTFINKA---PLINKKGNIKDGDIVTFGAQPGVDLNCSF-VAFD--IVCST-LSNADRVLLKQYLSIIGGNLLENCNDKVEYMVMSNLKATFKVVCALIKQIKIVKIDFVKAMVDYFKGINQILPDPDH--YLPEIHNPDDCFIGLDYKPNPKRKCLFNNKQFYFLTQEKLSLLSEAVLSGGGIAML---LTDSDCRDQSLR--VKLAHCDSIVMQEAVTTNLVNEISLILKGINKRLINDSEIGFAVMLASVDEYCNPYR 975
            Y L    Y +GR +  +++    SISR HA L              ++ +TI D SK+GT ++     P + +  ++K  D V FG       +  + V ++  +VCS+ L N ++  LKQ L  +GG++L N  +K  ++VM+++K T K +CALI    I+K D+ + +++    I Q  P P++  ++P I  P      LD   N KRK +F +K F FL  ++   LS AVL GGG A L   LTD+   + S    + +A  ++ + +   T   ++    +L     R I ++EIG AV+  S + YCNP R
Sbjct:   15 YILTGTDYVVGRKNCAILIPDDQSISRCHATLSVSYPSASLSQTNAVSVLTIKDSSKYGTTVSGERMQPAVPR--SLKPSDEVIFGC-----FHSKYRVEYEPLVVCSSCLDNTEKNSLKQNLIHLGGHMLNNWTEKCTHLVMTSIKVTIKTICALICCKPIIKPDYFRELIN---AIQQKRPLPEYRSFIPPIDEPSLNPESLDLSENVKRKSIFKDKVFLFLNTKQYMKLSPAVLLGGGKAHLLESLTDTSVLENSTTCVIDVAMTETQLSETQSTQPWISSTLDLLHSKGLRAIPEAEIGLAVINVSTEIYCNPRR 323          
BLAST of FHA domain-containing protein vs. Ensembl Xenopus
Match: adcy9 (adenylate cyclase 9 [Source:Xenbase;Acc:XB-GENE-999257])

HSP 1 Score: 123.635 bits (309), Expect = 6.958e-29
Identity = 100/319 (31.35%), Postives = 162/319 (50.78%), Query Frame = 1
Query:   91 YFLPSVTYTIGRVSADVILTH-TSISRKHAVLIWEC---------DLNYITIDDCSKFGTFINKA---PLINKKGNIKDGDIVTFGAQPGVDLNCSF-VAFD--IVCST-LSNADRVLLKQYLSIIGGNLLENCNDKVEYMVMSNLKATFKVVCALIKQIKIVKIDFVKAMVDYFKGINQILPDPDH--YLPEIHNPDDCFIGLDYKPNPKRKCLFNNKQFYFLTQEKLSLLSEAVLSGGGIAML---LTDSDCRDQSLR--VKLAHCDSIVMQEAVTTNLVNEISLILKGINKRLINDSEIGFAVMLASVDEYCNPYR 975
            Y L    Y +GR +  +++    SISR HA L              ++ +TI D SK+GT ++     P + +  ++K  D V FG       +  + V ++  +VCS+ L N ++  LKQ L  +GG++L N  +K  ++VM+++K T K +CALI    I+K D+ + +++    I Q  P P++  ++P I  P      LD   N KRK +F +K F FL  ++   LS AVL GGG A L   LTD+   + S    + +A  ++ + +   T   ++    +L     R I ++EIG AV+  S + YCNP R
Sbjct:   15 YILTGTDYVVGRKNCAILIPDDQSISRCHATLSVSYPSASLSQTNAVSVLTIKDSSKYGTTVSGERMQPAVPR--SLKPSDEVIFGC-----FHSKYRVEYEPLVVCSSCLDNTEKNSLKQNLIHLGGHMLNNWTEKCTHLVMTSIKVTIKTICALICCKPIIKPDYFRELIN---AIQQKRPLPEYRSFIPPIDEPSLNPESLDLSENVKRKSIFKDKVFLFLNTKQYMKLSPAVLLGGGKAHLLESLTDTSVLENSTTCVIDVAMTETQLSETQSTQPWISSTLDLLHSKGLRAIPEAEIGLAVINVSTEIYCNPRR 323          
BLAST of FHA domain-containing protein vs. Ensembl Xenopus
Match: adcy9 (adenylate cyclase 9 [Source:Xenbase;Acc:XB-GENE-999257])

HSP 1 Score: 123.635 bits (309), Expect = 7.402e-29
Identity = 100/319 (31.35%), Postives = 162/319 (50.78%), Query Frame = 1
Query:   91 YFLPSVTYTIGRVSADVILTH-TSISRKHAVLIWEC---------DLNYITIDDCSKFGTFINKA---PLINKKGNIKDGDIVTFGAQPGVDLNCSF-VAFD--IVCST-LSNADRVLLKQYLSIIGGNLLENCNDKVEYMVMSNLKATFKVVCALIKQIKIVKIDFVKAMVDYFKGINQILPDPDH--YLPEIHNPDDCFIGLDYKPNPKRKCLFNNKQFYFLTQEKLSLLSEAVLSGGGIAML---LTDSDCRDQSLR--VKLAHCDSIVMQEAVTTNLVNEISLILKGINKRLINDSEIGFAVMLASVDEYCNPYR 975
            Y L    Y +GR +  +++    SISR HA L              ++ +TI D SK+GT ++     P + +  ++K  D V FG       +  + V ++  +VCS+ L N ++  LKQ L  +GG++L N  +K  ++VM+++K T K +CALI    I+K D+ + +++    I Q  P P++  ++P I  P      LD   N KRK +F +K F FL  ++   LS AVL GGG A L   LTD+   + S    + +A  ++ + +   T   ++    +L     R I ++EIG AV+  S + YCNP R
Sbjct:   15 YILTGTDYVVGRKNCAILIPDDQSISRCHATLSVSYPSASLSQTNAVSVLTIKDSSKYGTTVSGERMQPAVPR--SLKPSDEVIFGC-----FHSKYRVEYEPLVVCSSCLDNTEKNSLKQNLIHLGGHMLNNWTEKCTHLVMTSIKVTIKTICALICCKPIIKPDYFRELIN---AIQQKRPLPEYRSFIPPIDEPSLNPESLDLSENVKRKSIFKDKVFLFLNTKQYMKLSPAVLLGGGKAHLLESLTDTSVLENSTTCVIDVAMTETQLSETQSTQPWISSTLDLLHSKGLRAIPEAEIGLAVINVSTEIYCNPRR 323          
BLAST of FHA domain-containing protein vs. Ensembl Xenopus
Match: adcy9 (adenylate cyclase 9 [Source:Xenbase;Acc:XB-GENE-999257])

HSP 1 Score: 123.635 bits (309), Expect = 7.637e-29
Identity = 100/319 (31.35%), Postives = 162/319 (50.78%), Query Frame = 1
Query:   91 YFLPSVTYTIGRVSADVILTH-TSISRKHAVLIWEC---------DLNYITIDDCSKFGTFINKA---PLINKKGNIKDGDIVTFGAQPGVDLNCSF-VAFD--IVCST-LSNADRVLLKQYLSIIGGNLLENCNDKVEYMVMSNLKATFKVVCALIKQIKIVKIDFVKAMVDYFKGINQILPDPDH--YLPEIHNPDDCFIGLDYKPNPKRKCLFNNKQFYFLTQEKLSLLSEAVLSGGGIAML---LTDSDCRDQSLR--VKLAHCDSIVMQEAVTTNLVNEISLILKGINKRLINDSEIGFAVMLASVDEYCNPYR 975
            Y L    Y +GR +  +++    SISR HA L              ++ +TI D SK+GT ++     P + +  ++K  D V FG       +  + V ++  +VCS+ L N ++  LKQ L  +GG++L N  +K  ++VM+++K T K +CALI    I+K D+ + +++    I Q  P P++  ++P I  P      LD   N KRK +F +K F FL  ++   LS AVL GGG A L   LTD+   + S    + +A  ++ + +   T   ++    +L     R I ++EIG AV+  S + YCNP R
Sbjct:   29 YILTGTDYVVGRKNCAILIPDDQSISRCHATLSVSYPSASLSQTNAVSVLTIKDSSKYGTTVSGERMQPAVPR--SLKPSDEVIFGC-----FHSKYRVEYEPLVVCSSCLDNTEKNSLKQNLIHLGGHMLNNWTEKCTHLVMTSIKVTIKTICALICCKPIIKPDYFRELIN---AIQQKRPLPEYRSFIPPIDEPSLNPESLDLSENVKRKSIFKDKVFLFLNTKQYMKLSPAVLLGGGKAHLLESLTDTSVLENSTTCVIDVAMTETQLSETQSTQPWISSTLDLLHSKGLRAIPEAEIGLAVINVSTEIYCNPRR 337          
BLAST of FHA domain-containing protein vs. Ensembl Mouse
Match: Nbn (nibrin [Source:MGI Symbol;Acc:MGI:1351625])

HSP 1 Score: 122.865 bits (307), Expect = 9.157e-29
Identity = 97/316 (30.70%), Postives = 152/316 (48.10%), Query Frame = 1
Query:   94 FLPSVTYTIGRVSADVILTH-TSISRKHAVL--------IWECD-LNYITIDDCSKFGTFINKAPL-INKKGNIKDGDIVTFGAQPGVDLNCSF-VAFD--IVCST-LSNADRVLLKQYLSIIGGNLLENCNDKVEYMVMSNLKATFKVVCALIKQIKIVKIDFVKAMVDYFKGINQILPDPDHYLPEIHNPDDCFIGLDYKPNPKRKCLFNNKQFYFLTQEKLSLLSEAVLSGGGIAMLLTDSDCRDQSLRVKLAHCDSIVMQEAVTTNLV------NEISLILKGINK---RLINDSEIGFAVMLASVDEYCNP 969
             L  V Y +GR +  +++ +  SISR HAVL        + + D +  +TI D SK+GTF+N+  +       +K GD VTFG          F V ++  +VCS+ L  + + +L Q +  +GG    N  ++  ++VMS +K T K +CALI    I+K ++    +   +   Q  PD + + P I  P      +D     +RK +F  K F FL  ++   LS AV  GGG A L+ + D  +QS       C  +V      T L+        I LI+  + +   R I ++EIG AV+  + + YCNP
Sbjct:   18 LLAGVEYVVGRKNCGILIENDQSISRNHAVLTVNFPVTSLSQTDEIPTLTIKDNSKYGTFVNEEKMQTGLSCTLKTGDRVTFGV-----FESKFRVEYEPLVVCSSCLDVSGKTVLNQAILQLGGLTANNWTEECTHLVMSAVKVTIKTICALICGRPIIKPEYFSEFLKAVESKKQP-PDIESFYPPIDEPAIGSKSVDLSGRHERKQIFKGKTFVFLNAKQHKKLSSAVAFGGGEARLMAEDDEEEQSFFSAPGTC--VVDVGITNTQLIISHSQKKWIHLIMDTLQRNGLRPIPEAEIGLAVIFMTTENYCNP 325          
BLAST of FHA domain-containing protein vs. Ensembl Mouse
Match: Nbn (nibrin [Source:MGI Symbol;Acc:MGI:1351625])

HSP 1 Score: 121.709 bits (304), Expect = 1.066e-28
Identity = 98/317 (30.91%), Postives = 154/317 (48.58%), Query Frame = 1
Query:   94 FLPSVTYTIGRVSADVILTH-TSISRKHAVL--------IWECD-LNYITIDDCSKFGTFINKAPL-INKKGNIKDGDIVTFGAQPGVDLNCSF-VAFD--IVCST-LSNADRVLLKQYLSIIGGNLLENCNDKVEYMVMSNLKATFKVVCALIKQIKIVKIDFVKAMVDYFKGINQILPDPDHYLPEIHNPDDCFIGLDYKPNPKRKCLFNNKQFYFLTQEKLSLLSEAVLSGGGIAMLLTDSDCRDQSLRVKLAHCDSIVMQEAVT-TNLV------NEISLILKGINK---RLINDSEIGFAVMLASVDEYCNP 969
             L  V Y +GR +  +++ +  SISR HAVL        + + D +  +TI D SK+GTF+N+  +       +K GD VTFG          F V ++  +VCS+ L  + + +L Q +  +GG    N  ++  ++VMS +K T K +CALI    I+K ++    +   +   Q  PD + + P I  P      +D     +RK +F  K F FL  ++   LS AV  GGG A L+ + D  +QS       C   V+   +T T L+        I LI+  + +   R I ++EIG AV+  + + YCNP
Sbjct:   18 LLAGVEYVVGRKNCGILIENDQSISRNHAVLTVNFPVTSLSQTDEIPTLTIKDNSKYGTFVNEEKMQTGLSCTLKTGDRVTFGV-----FESKFRVEYEPLVVCSSCLDVSGKTVLNQAILQLGGLTANNWTEECTHLVMSAVKVTIKTICALICGRPIIKPEYFSEFLKAVESKKQP-PDIESFYPPIDEPAIGSKSVDLSGRHERKQIFKGKTFVFLNAKQHKKLSSAVAFGGGEARLMAEDDEEEQSFFSAPGTC---VVDVGITNTQLIISHSQKKWIHLIMDTLQRNGLRPIPEAEIGLAVIFMTTENYCNP 325          
BLAST of FHA domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9DE07|NBN_CHICK (Nibrin OS=Gallus gallus OX=9031 GN=NBN PE=1 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 2.501e-33
Identity = 97/315 (30.79%), Postives = 155/315 (49.21%), Query Frame = 1
Query:   94 FLPSVTYTIGRVS-ADVILTHTSISRKHAVLI---------WECDLNYITIDDCSKFGTFINKAPLINKKGNIKDGDIVTFGAQPGVDLNCSF-VAFD--IVCST-LSNADRVLLKQYLSIIGGNLLENCNDKVEYMVMSNLKATFKVVCALIKQIKIVKIDFVKAMVDYFKGINQILPDPDHYLPEIHNPDDCFIGLDYKPNPKRKCLFNNKQFYFLTQEKLSLLSEAVLSGGGIAMLLTDSDCRDQSLRVKLAHC-------DSIVMQEAVTTNLVNEISLILKGINKRLINDSEIGFAVMLASVDEYCNPYR 975
             L    Y +GR + A +I    SISR HAVL              +  +TI D SK+GTF+N + L     +++ GD V FG          F V ++  +VCS+ L  A +  L + +  +GG ++     +  +++M ++K T K +CALI    IVK +F   ++   +   Q LP P+ + P +  P      +D   +P+RK +F+ K F FLT ++   L  AV+ GGG A L+ + + ++ SL V    C       +S ++      N  + I  +L+  N R I ++EIG AV+  S + YCNP R
Sbjct:   16 LLVGTEYVVGRKNCAFLIQDDQSISRSHAVLTVSRPETTHSQSVSVPVLTIKDTSKYGTFVNGSKLSGASRSLQSGDRVNFGV-----FESKFRVEYESLVVCSSCLDVAQKTALNEAIQQLGGLVVNEWTKECTHLIMESVKVTVKTICALICGRPIVKPEFFSELMKAVQSRQQ-LPTPESFYPSVDEPAIGIDNMDLSGHPERKKIFSGKTFVFLTAKQHKKLGPAVILGGGEAKLMAE-ERKETSLLVSPEVCVVDVGVTNSQILGSESMRNWTDSILAVLESNNLRAIPEAEIGLAVIFMSTEIYCNPQR 323          
BLAST of FHA domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5I2W8|NBN_DANRE (Nibrin OS=Danio rerio OX=7955 GN=nbn PE=2 SV=2)

HSP 1 Score: 137.502 bits (345), Expect = 1.268e-32
Identity = 103/337 (30.56%), Postives = 161/337 (47.77%), Query Frame = 1
Query:   55 WKF---ENKNKNIVKYFLPSVTYTIGRVSADVILTH-TSISRKHAVLIWECDLNYITIDDCSKFGTFINKAPL-INKKGNIKDGDIVTFGA-QPGVDLNCSFVAFDIVCST-LSNADRVLLKQYLSIIGGNLLENCNDKVEYMVMSNLKATFKVVCALIKQIKIVKIDFVKAMVDYFKGINQILPDP--DHYLPEIHNPDDCFIGLDYKPNPKRKCLFNNKQFYFLTQEKLSLLSEAVLSGGGIAMLLTDSDCRDQSLRVKLAHCDSIVMQEAVTTN-----------LVNEISLILKGINKRLINDSEIGFAVMLASVDEYCNPYRALPKSHDKEN 1005
            WK    E+  ++++   L    Y +GR + +++LT+  SISR HAVL        +T+ D SK+GTF+N   L       ++ G  +TFG  Q    L    +   +VCS+ + N  +V L Q +  +GG L+ +      ++VM  +K T K +CAL+    IVK  F  A+    K + Q LP P  + + P+I  P      +D    P+RK LF  K F FL+ +++  LS AV  GGG++ LL +      +L V L    S  + + ++ N            ++ +  IL     R I +SE+G A +  S   YCNP  +L     K N
Sbjct:    2 WKLQPTESGGESVI--LLAGQEYVVGRKNCEILLTNDQSISRVHAVLT--VTEQAVTLKDSSKYGTFVNGEKLESGSTKTLQTGYKITFGVFQSKFSLEKECI---VVCSSCVDNEGKVTLSQDIRSVGGRLVSSWTSDCTHLVMPTVKVTIKTICALLCCRPIVKPAFFSALS---KAVQQKLPLPKAERFRPQIDEPSLARDDVDLSARPERKSLFKGKTFLFLSSKQMKRLSVAVSCGGGVSQLLDEG-----ALPVSLLESSSTCVLDMISGNSQPVISPASKKWLDSVGQILHRKGLRFITESEVGLAAIHVSNQTYCNPCSSLQSESVKTN 323          
BLAST of FHA domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9R207|NBN_MOUSE (Nibrin OS=Mus musculus OX=10090 GN=Nbn PE=1 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 6.405e-28
Identity = 97/316 (30.70%), Postives = 152/316 (48.10%), Query Frame = 1
Query:   94 FLPSVTYTIGRVSADVILTH-TSISRKHAVL--------IWECD-LNYITIDDCSKFGTFINKAPL-INKKGNIKDGDIVTFGAQPGVDLNCSF-VAFD--IVCST-LSNADRVLLKQYLSIIGGNLLENCNDKVEYMVMSNLKATFKVVCALIKQIKIVKIDFVKAMVDYFKGINQILPDPDHYLPEIHNPDDCFIGLDYKPNPKRKCLFNNKQFYFLTQEKLSLLSEAVLSGGGIAMLLTDSDCRDQSLRVKLAHCDSIVMQEAVTTNLV------NEISLILKGINK---RLINDSEIGFAVMLASVDEYCNP 969
             L  V Y +GR +  +++ +  SISR HAVL        + + D +  +TI D SK+GTF+N+  +       +K GD VTFG          F V ++  +VCS+ L  + + +L Q +  +GG    N  ++  ++VMS +K T K +CALI    I+K ++    +   +   Q  PD + + P I  P      +D     +RK +F  K F FL  ++   LS AV  GGG A L+ + D  +QS       C  +V      T L+        I LI+  + +   R I ++EIG AV+  + + YCNP
Sbjct:   18 LLAGVEYVVGRKNCGILIENDQSISRNHAVLTVNFPVTSLSQTDEIPTLTIKDNSKYGTFVNEEKMQTGLSCTLKTGDRVTFGV-----FESKFRVEYEPLVVCSSCLDVSGKTVLNQAILQLGGLTANNWTEECTHLVMSAVKVTIKTICALICGRPIIKPEYFSEFLKAVESKKQP-PDIESFYPPIDEPAIGSKSVDLSGRHERKQIFKGKTFVFLNAKQHKKLSSAVAFGGGEARLMAEDDEEEQSFFSAPGTC--VVDVGITNTQLIISHSQKKWIHLIMDTLQRNGLRPIPEAEIGLAVIFMTTENYCNP 325          
BLAST of FHA domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9JIL9|NBN_RAT (Nibrin OS=Rattus norvegicus OX=10116 GN=Nbn PE=1 SV=2)

HSP 1 Score: 119.013 bits (297), Expect = 1.334e-26
Identity = 95/314 (30.25%), Postives = 152/314 (48.41%), Query Frame = 1
Query:   94 FLPSVTYTIGRVSADVILTH-TSISRKHAVL--------IWECD-LNYITIDDCSKFGTFINKAPLINK-KGNIKDGDIVTFGAQPGVDLNCSF-VAFD--IVCST-LSNADRVLLKQYLSIIGGNLLENCNDKVEYMVMSNLKATFKVVCALIKQIKIVKIDFVKAMVDYFKGINQILPDPDHYLPEIHNPDDCFIGLDYKPNPKRKCLFNNKQFYFLTQEKLSLLSEAVLSGGGIAMLLTDSDCRDQSLRVKLAHCDSIV----MQEAVTTNLVNEISLILKGINK---RLINDSEIGFAVMLASVDEYCNP 969
             L  V Y +GR +  +++ +  SISR HAVL        + + D +  +TI D SK+GTFIN+  + N     +K GD VTFG          F V ++  +VCS+ L  + + +L Q +  +GG    +  ++  ++ MS++K T K +CALI    IVK ++    +   +   Q  P+ + + P I  P      +D     +RK +F  K F FL  ++   L  AV+ GGG A L+ +    +QS       C   V     Q  +T +    I LI+  + +   R I ++EIG AV+  + + YCNP
Sbjct:   18 LLAGVEYIVGRKNCAILIENDQSISRNHAVLRVNFPVTSLSQTDEIPTLTIKDNSKYGTFINEEKMQNGLSSTLKTGDRVTFGV-----FESKFRVEYEPLVVCSSCLDVSGKTVLNQAILQLGGLTANSWTEECTHLAMSSVKVTIKTICALICGRPIVKPEYFSEFLKAVESKTQP-PEIESFYPPIDEPAIGNKSVDLSGRRERKQIFKGKTFVFLNAKQHKKLGSAVVFGGGEARLMAEGGEEEQSFFSAPGTCVVDVGITNTQLIITDSQRKWIHLIMDILQRHGLRPIPEAEIGLAVIFMTTESYCNP 325          
BLAST of FHA domain-containing protein vs. UniProt/SwissProt
Match: sp|O60934|NBN_HUMAN (Nibrin OS=Homo sapiens OX=9606 GN=NBN PE=1 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 6.411e-24
Identity = 87/317 (27.44%), Postives = 143/317 (45.11%), Query Frame = 1
Query:   94 FLPSVTYTIGRVSADVILTH-TSISRKHAVLIWEC---------DLNYITIDDCSKFGTFINKAPLINK-KGNIKDGDIVTFGAQPGVDLNCSFVAFDIVCSTLSNADRVLLKQYLSIIGGNLLENCNDKVEYMVMSNLKATFKVVCALIKQIKIVKIDFVKAMVDYFKGINQILPDPDHYLPEIHNPDDCFIGLDYKPNPKRKCLFNNKQFYFLTQEKLSLLSEAVLSGGGIAMLLTDSDCRDQSLRVKLAHCDSIVMQEAVTTNLVNEISLI--------------LKGINKRLINDSEIGFAVMLASVDEYCNP 969
             L  V Y +GR +  +++ +  SISR HAVL             ++  +T+ D SK+GTF+N+  + N     +K GD +TFG   G      +       S L  + +  L Q +  +GG  + N  ++  ++VM ++K T K +CALI    IVK ++    +   +   Q  P  + + P +  P      +D     +RK +F  K F FL  ++   LS AV+ GGG A L+T+ +  + +  +    C        V T + N  +LI              L+    R I ++EIG AV+  +   YC+P
Sbjct:   18 LLTGVEYVVGRKNCAILIENDQSISRNHAVLTANFSVTNLSQTDEIPVLTLKDNSKYGTFVNEEKMQNGFSRTLKSGDGITFGVF-GSKFRIEYEPLVACSSCLDVSGKTALNQAILQLGGFTVNNWTEECTHLVMVSVKVTIKTICALICGRPIVKPEYFTEFLKAVESKKQP-PQIESFYPPLDEPSIGSKNVDLSGRQERKQIFKGKTFIFLNAKQHKKLSSAVVFGGGEARLITEENEEEHNFFLAPGTC-------VVDTGITNSQTLIPDCQKKWIQSIMDMLQRQGLRPIPEAEIGLAVIFMTTKNYCDP 325          
BLAST of FHA domain-containing protein vs. TrEMBL
Match: A0A4S2MI43 (FHA domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_000762 PE=4 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 7.494e-40
Identity = 102/316 (32.28%), Postives = 164/316 (51.90%), Query Frame = 1
Query:  112 YTIGRVSADVILTHTSISRKHAVLIWEC----DLNYITIDDCSKFGTFINKAPLINKKGNIKDGDIVTFGAQPGVDLNCSFVAFDIVCSTLSNADRVLLKQYLSIIGGNLLENCNDKVEYMVMSNLKATFKVVCALIKQIKIVKIDFVKAMVDYFKGINQILPDPDHYLPEIHNPDDCFIGLD---YKPNPKRKCLFNNKQFYFLTQEKLSLLSEAVLSGGGIAMLLTDSDCRDQSLRVKLAHCDSI--------------VMQEAVTTNLVNEISLI---LKGINKRLINDSEIGFAVMLASVDEYCNPYRALPK 987
            +T+GR+ AD+I+   S+SRKHA L  +      L +I + D SKFGTF+N  PL   K  +K GD VTFG QPGV+ +      ++  S+++ A+R  +K   +++ G L+  C D   ++VM +L  T KVVCAL+  + IV   +++  ++    I  + P+ +++LP +   ++  +  D   + PN KR  LF  K F+ LT    S LS  V  GGG  +L+  S+   Q    +   C ++              V+       L +   ++   L+GI +R I +SE+GFAV+  S + YCNP    P+
Sbjct:   26 FTVGRIDADIIIPDKSVSRKHAGLEIQAAQSGGLEFI-LHDHSKFGTFVNGIPLNGSKRILKKGDKVTFGVQPGVNFSLQETVLNVAVSSMNKAERQRIKTITNLLHGELVPTCTDSCTFLVMPHLVVTVKVVCALLAMVPIVTPLYMEKFLEAASYIPFVRPNFENFLPPVR--EERLVDSDAIRFLPNAKRPSLFMGKVFFVLTHAHFSELSPIVRLGGGKVVLIDSSEAFVQHYEEQSGTCGNVERDLQEVLRREGSCVIHAQSVPGLEDWQRVVYSALRGIRRRPILESELGFAVLYISTNGYCNPETKCPE 338          
BLAST of FHA domain-containing protein vs. TrEMBL
Match: A0A4V6AQV8 (Nibrin Nijmegen breakage syndrome protein 1-like protein OS=Collichthys lucidus OX=240159 GN=D9C73_016161 PE=4 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 4.181e-35
Identity = 112/323 (34.67%), Postives = 155/323 (47.99%), Query Frame = 1
Query:   91 YFLPSVTYTIGRVSADVIL-THTSISRKHAVLIWECDLNYITIDDCSKFGTFINKAPLI-NKKGNIKDGDIVTFGAQPGVDLNCSFVAF---DIVCST-LSNADRVLLKQYLSIIGGNLLENCNDKVEYMVMSNLKATFKVVCALIKQIKIVKIDFVKAMVDYFKGINQILPDP--DHYLPEIHNPDDCFIGLDYKPNPKRKCLFNNKQFYFLTQEKLSLLSEAVLSGGGIAMLLTDSDC-RD-----QSLRVKLAHCDSIVMQEAVTTNLVNEISLILKGINKRLINDSEIGFAVMLASVDEYCNPYRALPKSHDKENNNPK 1017
            Y L S  Y +GR + D++L +  SISR HA L        +T+ D SK+GTF+N   L  N   N+K GD VTFG          F       +VCS+ L N  +  L Q L  +GG L+        ++VM   K T K +CAL+    IVK +F     +  K   Q LP P  + ++PEI  P      ++    P RK LF  K F FL+ ++L  LS AV  GGG + LL +    RD     QS  +      S  +  + TT   N +  I++    R+I +SEIG A + AS D+YCNP R +  S      NP+
Sbjct:   15 YLLSSKDYVVGRKNCDILLPSDQSISRAHAHLT--ATGQTLTLKDTSKYGTFVNGQQLTANTPANLKSGDNVTFGV-----FESKFSVEHQKPVVCSSCLDNDGKTSLTQALLAVGGKLVNTWTQDCTHLVMPTAKVTIKTICALLCCRPIVKPEF---FSELGKAAQQKLPPPKAESFIPEIDEPSLSKEDVNLGAIPVRKQLFAGKTFIFLSAKQLKRLSAAVGFGGGRSQLLEEGSLPRDVLESPQSCVIDATTGSSQPLLSSSTTEWANTVKNIVQRKGLRVIAESEIGLAAIYASCDQYCNPSRLITDSESLPKVNPR 327          
BLAST of FHA domain-containing protein vs. TrEMBL
Match: A0A1S3K6I0 (nibrin OS=Lingula unguis OX=7574 GN=LOC106179244 PE=4 SV=1)

HSP 1 Score: 151.754 bits (382), Expect = 6.986e-35
Identity = 102/308 (33.12%), Postives = 164/308 (53.25%), Query Frame = 1
Query:  118 IGRVSADVILTH-TSISRKHAVLIWECDLNYI---------TIDDCSKFGTFINKAPLINKKGNIKDGDIVTFGAQPGVDLNCSFVAFDIVCSTLSNADRVLLKQYLSIIGGNLLENCNDKVEYMVMSNLKATFKVVCALIKQIKIVKIDFVKAMVDYFKGINQILPDPDHYLPEIH----NPDDCFIGLDYKPNPKRKCLFNNKQFYFLTQEKLSLLSEAVLSGGGIAMLLTDS--DCRDQSLRVK---LAHCDSIVMQEAVTTN---LVNEISLILKGINKRLINDSEIGFAVMLASVDEYCNPYR 975
            IGR   D+++    S+SRKHAV I     N++         TI D SKFGTF+N +  I  +  +KDGD + FGAQ    +      F +  S L N+ +  +K  +  +GG++L +   + + +VMS +  T KVVCALI Q  IV  +++  +++ +   N+ LP+PD ++P +     NPD+    + +K NP R+ LF+  +F FL+ ++   LS AV   GG  +L+ +   D  D+ L  +   + +C+     + ++ N    V  +   LK   +R I D+E+GFAV+  S D YCNP R
Sbjct:   23 IGRKDCDILIEGDQSMSRKHAVAIVVHPENHLPFPHKPPVLTIKDTSKFGTFVNGS-RIQGERELKDGDEIKFGAQSSFRVKRE--PFIVTTSCLDNSVKKSVKGVIRQLGGHVLGDWRRECDMLVMSTISVTIKVVCALISQKPIVTPEYLTQLLEAYDQ-NKQLPNPDDFIPALAELLLNPDE----VSFKKNPARQTLFSGMKFIFLSPKQFRKLSIAVELAGGTPVLMEEGTDDNNDKVLIERGTCVMYCEPPTNPQLLSKNARDWVTHVQRYLKRHKQRQIQDAELGFAVLYCSTDSYCNPER 322          
BLAST of FHA domain-containing protein vs. TrEMBL
Match: A0A4W6BPE5 (FHA domain-containing protein OS=Lates calcarifer OX=8187 GN=nbn PE=4 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 4.060e-34
Identity = 110/323 (34.06%), Postives = 158/323 (48.92%), Query Frame = 1
Query:   91 YFLPSVTYTIGRVSADVILTH-TSISRKHAVLIWECDLNYITIDDCSKFGTFINKAPLI-NKKGNIKDGDIVTFGAQPGVDLNCSFVA---FDIVCST-LSNADRVLLKQYLSIIGGNLLENCNDKVEYMVMSNLKATFKVVCALIKQIKIVKIDFVKAMVDYFKGINQILP--DPDHYLPEIHNPDDCFIGLDYKPNPKRKCLFNNKQFYFLTQEKLSLLSEAVLSGGGIAMLLTDSDC-RD-----QSLRVKLAHCDSIVMQEAVTTNLVNEISLILKGINKRLINDSEIGFAVMLASVDEYCNPYRALPKSHDKENNNPK 1017
            Y L    Y +GR + D++LT+  SISR HA L        +T+ D SK+GTF+N   L  N   N+K GD VTFGA      N  F       +VCS+ L N  +  L Q L  +GG L+    +   ++ M ++K T K + AL+    IVK +F     +    + Q LP   P+ ++PEI  P      ++ K  P RK LF  K F FL+ ++L  LS AV  G G + LL +    RD     QS  V +    S  +  +  T+  N +  I++    R+I +SEIG A + AS D+YCNP   +P S       P+
Sbjct:   15 YLLARKEYVVGRKNCDILLTNDQSISRAHAHLT--ATDQILTLKDTSKYGTFVNSQRLTDNTPVNLKSGDSVTFGA-----FNSKFSVDHQKPVVCSSCLDNDGKASLSQALLALGGKLVNTWTEDCTHLAMPSVKVTIKTISALLCCRPIVKPEF---FSELHNAVQQKLPPPKPESFIPEIDEPSLSKEDVNLKVIPGRKHLFTEKTFIFLSAKQLKRLSAAVSFGRGKSQLLEEGSLPRDLLESPQSCVVDVMTGSSQPLLSSSATDWANSVKNIVERKGLRVIPESEIGLAAIYASCDKYCNPSSVMPDSESAPKVKPR 327          
BLAST of FHA domain-containing protein vs. TrEMBL
Match: A0A4W6BIH3 (FHA domain-containing protein OS=Lates calcarifer OX=8187 GN=nbn PE=4 SV=1)

HSP 1 Score: 149.443 bits (376), Expect = 5.644e-34
Identity = 110/323 (34.06%), Postives = 158/323 (48.92%), Query Frame = 1
Query:   91 YFLPSVTYTIGRVSADVILTH-TSISRKHAVLIWECDLNYITIDDCSKFGTFINKAPLI-NKKGNIKDGDIVTFGAQPGVDLNCSFVA---FDIVCST-LSNADRVLLKQYLSIIGGNLLENCNDKVEYMVMSNLKATFKVVCALIKQIKIVKIDFVKAMVDYFKGINQILP--DPDHYLPEIHNPDDCFIGLDYKPNPKRKCLFNNKQFYFLTQEKLSLLSEAVLSGGGIAMLLTDSDC-RD-----QSLRVKLAHCDSIVMQEAVTTNLVNEISLILKGINKRLINDSEIGFAVMLASVDEYCNPYRALPKSHDKENNNPK 1017
            Y L    Y +GR + D++LT+  SISR HA L        +T+ D SK+GTF+N   L  N   N+K GD VTFGA      N  F       +VCS+ L N  +  L Q L  +GG L+    +   ++ M ++K T K + AL+    IVK +F     +    + Q LP   P+ ++PEI  P      ++ K  P RK LF  K F FL+ ++L  LS AV  G G + LL +    RD     QS  V +    S  +  +  T+  N +  I++    R+I +SEIG A + AS D+YCNP   +P S       P+
Sbjct:   15 YLLARKEYVVGRKNCDILLTNDQSISRAHAHLT--ATDQILTLKDTSKYGTFVNSQRLTDNTPVNLKSGDSVTFGA-----FNSKFSVDHQKPVVCSSCLDNDGKASLSQALLALGGKLVNTWTEDCTHLAMPSVKVTIKTISALLCCRPIVKPEF---FSELHNAVQQKLPPPKPESFIPEIDEPSLSKEDVNLKVIPGRKHLFTEKTFIFLSAKQLKRLSAAVSFGRGKSQLLEEGSLPRDLLESPQSCVVDVMTGSSQPLLSSSATDWANSVKNIVERKGLRVIPESEIGLAAIYASCDKYCNPSSVMPDSESAPKVKPR 327          
BLAST of FHA domain-containing protein vs. Ensembl Cavefish
Match: nbn (nibrin [Source:NCBI gene;Acc:103021427])

HSP 1 Score: 147.517 bits (371), Expect = 7.017e-37
Identity = 95/303 (31.35%), Postives = 149/303 (49.17%), Query Frame = 1
Query:   91 YFLPSVTYTIGRVSADVILTH-TSISRKHAVLIWECDLNYITIDDCSKFGTFINKAPLI-NKKGNIKDGDIVTFGA-QPGVDLNCSFVAFDIVCST-LSNADRVLLKQYLSIIGGNLLENCNDKVEYMVMSNLKATFKVVCALIKQIKIVKIDFVKAMVDYFKGINQILPDPDHYLPEIHNPDDCFIGLDYKPNPKRKCLFNNKQFYFLTQEKLSLLSEAVLSGGGIAMLLTDSDCRDQSLR------VKLAHCDSIVMQEAVTTNLVNEISLILKGINKRLINDSEIGFAVMLASVDEYCNP 969
            Y LP   Y +GR + D++L +  SISR HA L        +T+ D SK+GTF+N   L  N    + DGD +TFG  Q    L  + +   +VCS+ + N  +  L + +  +GG L+ + +    ++VM  +K T K +CAL+    IVK +F   +    +   ++LP   ++ PEI  P      +D  P P+RK LF +K F FL  +++  LS+A+  GGG+  LL +       L+      + +    S  +    T   V+ +  +L     R I +SEIG A +  S   YCNP
Sbjct:   15 YLLPGKEYVVGRKNCDILLANDQSISRVHAQLT--VADQTVTLKDSSKYGTFVNDEQLTTNSTKTVHDGDRLTFGVFQSKFRLKLNSM---VVCSSCVDNEGKAALSKAVQSVGGRLVNSWSPDCTHLVMPTVKVTIKTICALLCCRPIVKAEFFTELSRAVQRKEKVLPAAQNFKPEIDEPSLTKQDVDLGPRPERKSLFRDKTFVFLNVKQMKRLSQAITCGGGVTQLLEEGSLPLPLLQSTGTCVIDVGAGASQALVPPATKKWVDSVGQVLHRNGLRFIAESEIGLAAIYVSNQTYCNP 312          
BLAST of FHA domain-containing protein vs. Ensembl Cavefish
Match: nbn (nibrin [Source:NCBI gene;Acc:103021427])

HSP 1 Score: 147.517 bits (371), Expect = 7.928e-37
Identity = 95/303 (31.35%), Postives = 149/303 (49.17%), Query Frame = 1
Query:   91 YFLPSVTYTIGRVSADVILTH-TSISRKHAVLIWECDLNYITIDDCSKFGTFINKAPLI-NKKGNIKDGDIVTFGA-QPGVDLNCSFVAFDIVCST-LSNADRVLLKQYLSIIGGNLLENCNDKVEYMVMSNLKATFKVVCALIKQIKIVKIDFVKAMVDYFKGINQILPDPDHYLPEIHNPDDCFIGLDYKPNPKRKCLFNNKQFYFLTQEKLSLLSEAVLSGGGIAMLLTDSDCRDQSLR------VKLAHCDSIVMQEAVTTNLVNEISLILKGINKRLINDSEIGFAVMLASVDEYCNP 969
            Y LP   Y +GR + D++L +  SISR HA L        +T+ D SK+GTF+N   L  N    + DGD +TFG  Q    L  + +   +VCS+ + N  +  L + +  +GG L+ + +    ++VM  +K T K +CAL+    IVK +F   +    +   ++LP   ++ PEI  P      +D  P P+RK LF +K F FL  +++  LS+A+  GGG+  LL +       L+      + +    S  +    T   V+ +  +L     R I +SEIG A +  S   YCNP
Sbjct:   15 YLLPGKEYVVGRKNCDILLANDQSISRVHAQLT--VADQTVTLKDSSKYGTFVNDEQLTTNSTKTVHDGDRLTFGVFQSKFRLKLNSM---VVCSSCVDNEGKAALSKAVQSVGGRLVNSWSPDCTHLVMPTVKVTIKTICALLCCRPIVKAEFFTELSRAVQRKEKVLPAAQNFKPEIDEPSLTKQDVDLGPRPERKSLFRDKTFVFLNVKQMKRLSQAITCGGGVTQLLEEGSLPLPLLQSTGTCVIDVGAGASQALVPPATKKWVDSVGQVLHRNGLRFIAESEIGLAAIYVSNQTYCNP 312          
BLAST of FHA domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004190.1 (pep scaffold:Pmarinus_7.0:GL476745:100200:113784:1 gene:ENSPMAG00000003821.1 transcript:ENSPMAT00000004190.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 110.923 bits (276), Expect = 1.227e-26
Identity = 92/319 (28.84%), Postives = 149/319 (46.71%), Query Frame = 1
Query:  112 YTIGRVSADVILTH-TSISRKHAVLI---WECDLN------YITIDDCSKFGTFINKAPLIN-KKGNIKDGDIVTFGAQPGVDLNCSFVAFD--IVCSTLSNAD-RVLLKQYLSIIGGNLLENCNDKVEYMVMSNLKATFKVVCALIKQIKIVKIDFVKAMVDYFKGINQILPDPDH--YLPEIHNPDDCFIGLDYKPNPKRKCLFNNKQFYFLTQEKLSLLSEAVLSGGGIAMLLTDSDCRDQSLRVKLAHCDSIVMQEAVTTNL------------VNEISLILKGINKRLINDSEIGFAVMLASVDEYCNPYRALP 984
            + +GR    +++ +  SISR HAVL     E  L        +++ D SK+GTF+N   L +  +  +  GD++ FG    V  +   VA+   +VCS+  +A+ + +L   L  +GG+ +        ++VM+++K T K +CALI  I IV+  F   +V   +  +   P P H  + P    P      LD  P P+R+ LF  K F FL  ++   L+  +   GG A+ L     R +  R   A C  +V  EA  + L              ++ + L  +  R+I ++E+G AV+  S   YCNP   LP
Sbjct:   29 HVVGRKDCGILIGNDQSISRVHAVLTVSHAESSLARPSCRPALSVKDSSKYGTFVNGEKLTSGSERALCCGDLLKFG----VFESKYRVAYSPLVVCSSCLDAESKHVLSSALLALGGHFVSQWTSDCTHLVMTSIKVTVKTICALITSIPIVQPVFFSTLVTAIRSRS---PQPSHSSFWPLADEPGINPGDLDLTPRPERRLLFQGKTFQFLHAKQHKRLAVPIALAGGAALCLCSPGQRAEP-RHGEAFC--VVEPEAGCSQLSSQVLAQDARAWAAQVGVRLHTLGLRMITEAEVGLAVVYCSTHTYCNPSARLP 337          
BLAST of FHA domain-containing protein vs. Ensembl Nematostella
Match: EDO41630 (Nibrin [Source:UniProtKB/TrEMBL;Acc:A7S415])

HSP 1 Score: 120.168 bits (300), Expect = 2.443e-28
Identity = 98/330 (29.70%), Postives = 154/330 (46.67%), Query Frame = 1
Query:   58 KFENKNKNIVKYFLPSVTYTIGRVSADVIL-THTSISRKHAVLIW---------ECDLNYITIDDCSKFGTFINKAPLINKKG-NIKDGDIVTFGAQPGVDLNCSFVAFDIVCSTLSNADRVLLKQYLSIIGGNLL-ENCNDKVEYMVMSNLKATFKVVCALIKQIKIVKIDFVKAMVDYFKGINQILPDPDHYLPEIHNPDDCFIGLDYKPNPKRKCLFNNKQFYFLTQEKLSLLSEAVLSGGGIAMLLTDSDCRDQSLRVKLAHCDSIVMQEA--------VTTNLVNEISLILKGINKRLINDSEIGFAVMLASVDEYCNP-YRALP 984
            K ++ N+  V+ F+    Y +GR    +++    SISRKHAV               L  +T+ D SK+G  +N   L +     + +GD++ FG         S++      S L    + +LK+ +  +GG+LL E   D   ++VM  L  T KV+ AL     IV  +FV  M+   +  N+ L D  +YLP I        G  + PNP RK LF+ K F FL++++     EAV   GG   L   +DC   S  +  ++C  ++M +A         T   + +   +LK    R I +SE+G A++  S+  YCNP   A+P
Sbjct:   10 KAQDINQGTVR-FIVDKEYVVGRKDCQILINGDPSISRKHAVFTIGFNISDLGDTSKLPEVTVRDTSKYGVSVNGTKLESGGSCQLANGDVILFGTH-NSSYRLSYIQTVFATSCLDTNKKKILKKQIHKLGGHLLSEWRRDCTTHLVMEGLTFTVKVIQALASCCPIVTPEFVDEMIKSSEE-NRPLQDYRNYLPPIKEETIKSDGEKFLPNPDRKSLFSGKNFVFLSKKQYKRTFEAVEQCGGRTSLYESADCLVDSENLVASNC-CVMMVDAKERESLAPATRQFIGQAMDVLKRHRMRPIPESELGLAILQVSLSTYCNPNMEAVP 335          
BLAST of FHA domain-containing protein vs. Ensembl Medaka
Match: nbn (nibrin [Source:NCBI gene;Acc:101172437])

HSP 1 Score: 116.316 bits (290), Expect = 1.059e-26
Identity = 93/311 (29.90%), Postives = 141/311 (45.34%), Query Frame = 1
Query:   70 KNKNIVKYFLPSVTYTIGRVSADVIL-THTSISRKHAVLIWECDLNYITIDDCSKFGTFINKAPLINKKGNIKDGDIVTFGAQPGVDLNCSFVAFD---IVCST-LSNADRVLLKQYLSIIGGNLLENCNDKVEYMVMSNLKATFKVVCALIKQIKIVKIDFVKAMVDYFKGINQILPDPDHYLPEIHNPDDCFIGLDYKPNPKRKCLFNNKQFYFLTQEKLSLLSEAVLSGGGIAMLLTDSDCRDQSLR------VKLAHCDSIVMQEAVTTNLVNEISLILKGINKRLINDSEIGFAVMLASVDEYCNP 969
            +N     Y      Y +GR +  ++L +  SISR HA L        +T+ D SK+GTF+     +    N+  GD VTFG       +  F       +VCS+ L N  +  L + L  +GG L+ + +    ++ M  +K T K + AL+    IVK +F   +    +   +  P P+ + PEI  P      ++      RK LF  K F FL  ++L  LS AV  GGG + LL +       L+      V +    S ++  A  T   N +  +L     R+I +SEIG A + AS D+YCNP
Sbjct:    8 ENGGETHYIFCGKEYVVGRKNCAILLPSDQSISRAHANLT--ATDQTLTLKDSSKYGTFVRNQ-RVTSPVNLTPGDEVTFGV-----FHSKFRVIHQKLVVCSSCLDNDGKASLTEALLALGGKLVNSWSLDCTHLAMPTVKVTIKTISALLCCCPIVKPEFFSELNSAVQQ-KRPPPKPESFNPEIDEPVLSDENVNLGAVSARKQLFRGKTFIFLNAKQLKRLSGAVRFGGGSSQLLEEGALPCNLLQSPNTCVVDILTASSQILLPASITEWANSVKNLLARKGLRVIPESEIGLAAIYASCDQYCNP 309          
BLAST of FHA domain-containing protein vs. Planmine SMEST
Match: SMESG000022990.1 (SMESG000022990.1)

HSP 1 Score: 1141.33 bits (2951), Expect = 0.000e+0
Identity = 577/581 (99.31%), Postives = 577/581 (99.31%), Query Frame = 1
Query:   49 MPWKFENKNKNIVKYFLPSVTYTIGRVSADVILTHTSISRKHAVLIWECDLNYITIDDCSKFGTFINKAPLINKKGNIKDGDIVTFGAQPGVDLNCSFVAFDIVCSTLSNADRVLLKQYLSIIGGNLLENCNDKVEYMVMSNLKATFKVVCALIKQIKIVKIDFVKAMVDYFKGINQILPDPDHYLPEIHNPDDCFIGLDYKPNPKRKCLFNNKQFYFLTQEKLSLLSEAVLSGGGIAMLLTDSDCRDQSLRVKLAHCDSIVMQEAVTTNLVNEISLILKGINKRLINDSEIGFAVMLASVDEYCNPYRALPKSHDKENNNPKQNPFPSLDKLPCKEEPSTNHPNKQVHNNSLGELRAHDINAIDFXXXXXXXXXXXXXXXXXXXNSNAHQHSLRRNQENNSPKPNLSVSKFFNLSTTNLPTMKRKFAMHSHDEFNNDFDNISIPGLQRIPANTLILEPTSRTIFSNFQDEEQNAHNIFPKKRKMNNTTDRSVSSCKIQNMSQTTKLVTDKQLFDLQLIREIPTRIQINPANEMDIRSCMENVKFAQLIKEKYIERKNYKMFIKSSPIYIERNSVPLVQFR 1791
            MPWK ENKNKNIVKYFLPSVTYTIGRVSADVILTHTSISRKHAVLIWECDLNYITIDDCSKFGTFINKAPLINKKGNIKDGDIVTFGAQPGVDLNCSFVAFDIVCSTLSNADRVLLKQYLSIIGGNLLENCNDKVEYMVMSNLKATFKVVCALIKQIKIVKIDFVKAMVDYFKGINQILPDPDHYLPEIHNPDDCFIGLDYKPNPKRKCLFNNKQFYFLTQEKLSLLSEAVLSGGGIAMLLTDSDCRDQSLRVKLAHCDSIVMQEAVTTNLVNEISLILKGINKRLINDSEIGFAVMLASVDEYCNPYRALPKSHDKENNNPKQNPFPSLDKLPCKEEPSTNHPNKQVHNNSLGELRAHDINAIDFDRDRDQIITISDTDSESDTNSNAHQHSLRRNQENNSPKPNLSVSKFFNLSTTNLPTMKRKFAMHSHDEFNNDFDNISIPGLQRIPANTLILE TSRTIFSNFQDEEQNAHNIFPKKRKMNNTTDRSVSSCKIQNMSQTTKLVTDKQLFDLQLIREIPTRIQINPANEMDIRSC ENVKFAQLIKEKYIE KNYKMFIKSSPIYIERNSVPLVQFR
Sbjct:    1 MPWKLENKNKNIVKYFLPSVTYTIGRVSADVILTHTSISRKHAVLIWECDLNYITIDDCSKFGTFINKAPLINKKGNIKDGDIVTFGAQPGVDLNCSFVAFDIVCSTLSNADRVLLKQYLSIIGGNLLENCNDKVEYMVMSNLKATFKVVCALIKQIKIVKIDFVKAMVDYFKGINQILPDPDHYLPEIHNPDDCFIGLDYKPNPKRKCLFNNKQFYFLTQEKLSLLSEAVLSGGGIAMLLTDSDCRDQSLRVKLAHCDSIVMQEAVTTNLVNEISLILKGINKRLINDSEIGFAVMLASVDEYCNPYRALPKSHDKENNNPKQNPFPSLDKLPCKEEPSTNHPNKQVHNNSLGELRAHDINAIDFDRDRDQIITISDTDSESDTNSNAHQHSLRRNQENNSPKPNLSVSKFFNLSTTNLPTMKRKFAMHSHDEFNNDFDNISIPGLQRIPANTLILESTSRTIFSNFQDEEQNAHNIFPKKRKMNNTTDRSVSSCKIQNMSQTTKLVTDKQLFDLQLIREIPTRIQINPANEMDIRSCTENVKFAQLIKEKYIECKNYKMFIKSSPIYIERNSVPLVQFR 581          
The following BLAST results are available for this feature:
BLAST of FHA domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
NBN1.335e-2427.44nibrin [Source:HGNC Symbol;Acc:HGNC:7652][more]
NBN1.510e-1626.64nibrin [Source:HGNC Symbol;Acc:HGNC:7652][more]
NBN1.069e-1027.67nibrin [Source:HGNC Symbol;Acc:HGNC:7652][more]
back to top
BLAST of FHA domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FHA domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
nbs8.849e-2225.89gene:FBgn0261530 transcript:FBtr0306039[more]
nbs1.366e-2025.72gene:FBgn0261530 transcript:FBtr0306040[more]
back to top
BLAST of FHA domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
nbn1.286e-3330.56nibrin [Source:NCBI gene;Acc:544655][more]
nbn1.371e-3330.56nibrin [Source:NCBI gene;Acc:544655][more]
nbn1.680e-3330.56nibrin [Source:NCBI gene;Acc:544655][more]
nbn2.005e-1030.52nibrin [Source:NCBI gene;Acc:544655][more]
back to top
BLAST of FHA domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
adcy95.387e-2931.35adenylate cyclase 9 [Source:Xenbase;Acc:XB-GENE-99... [more]
adcy96.958e-2931.35adenylate cyclase 9 [Source:Xenbase;Acc:XB-GENE-99... [more]
adcy97.402e-2931.35adenylate cyclase 9 [Source:Xenbase;Acc:XB-GENE-99... [more]
adcy97.637e-2931.35adenylate cyclase 9 [Source:Xenbase;Acc:XB-GENE-99... [more]
back to top
BLAST of FHA domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Nbn9.157e-2930.70nibrin [Source:MGI Symbol;Acc:MGI:1351625][more]
Nbn1.066e-2830.91nibrin [Source:MGI Symbol;Acc:MGI:1351625][more]
back to top
BLAST of FHA domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9DE07|NBN_CHICK2.501e-3330.79Nibrin OS=Gallus gallus OX=9031 GN=NBN PE=1 SV=1[more]
sp|Q5I2W8|NBN_DANRE1.268e-3230.56Nibrin OS=Danio rerio OX=7955 GN=nbn PE=2 SV=2[more]
sp|Q9R207|NBN_MOUSE6.405e-2830.70Nibrin OS=Mus musculus OX=10090 GN=Nbn PE=1 SV=1[more]
sp|Q9JIL9|NBN_RAT1.334e-2630.25Nibrin OS=Rattus norvegicus OX=10116 GN=Nbn PE=1 S... [more]
sp|O60934|NBN_HUMAN6.411e-2427.44Nibrin OS=Homo sapiens OX=9606 GN=NBN PE=1 SV=1[more]
back to top
BLAST of FHA domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2MI437.494e-4032.28FHA domain-containing protein OS=Opisthorchis feli... [more]
A0A4V6AQV84.181e-3534.67Nibrin Nijmegen breakage syndrome protein 1-like p... [more]
A0A1S3K6I06.986e-3533.12nibrin OS=Lingula unguis OX=7574 GN=LOC106179244 P... [more]
A0A4W6BPE54.060e-3434.06FHA domain-containing protein OS=Lates calcarifer ... [more]
A0A4W6BIH35.644e-3434.06FHA domain-containing protein OS=Lates calcarifer ... [more]
back to top
BLAST of FHA domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
nbn7.017e-3731.35nibrin [Source:NCBI gene;Acc:103021427][more]
nbn7.928e-3731.35nibrin [Source:NCBI gene;Acc:103021427][more]
back to top
BLAST of FHA domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000004190.11.227e-2628.84pep scaffold:Pmarinus_7.0:GL476745:100200:113784:1... [more]
back to top
BLAST of FHA domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FHA domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO416302.443e-2829.70Nibrin [Source:UniProtKB/TrEMBL;Acc:A7S415][more]
back to top
BLAST of FHA domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
nbn1.059e-2629.90nibrin [Source:NCBI gene;Acc:101172437][more]
back to top
BLAST of FHA domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000022990.10.000e+099.31SMESG000022990.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019275 ID=SMED30019275|Name=FHA domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1810bp
AAATATTTAACTTTATATTGTAATTGGCTTTATTAAAATATATTCTAAAT
GCCTTGGAAGTTTGAAAATAAAAATAAAAATATTGTTAAATATTTTCTTC
CATCCGTTACATATACAATTGGCAGAGTATCTGCAGATGTCATTCTTACC
CACACGTCTATCAGCCGAAAACATGCAGTTTTAATTTGGGAATGTGATCT
CAATTATATTACAATTGATGATTGCTCCAAATTTGGCACATTTATTAATA
AAGCACCTTTAATTAACAAGAAAGGAAATATTAAAGATGGCGATATCGTT
ACTTTTGGTGCTCAACCCGGAGTTGATTTAAATTGTTCATTTGTAGCTTT
TGATATCGTCTGTTCGACTCTGTCTAATGCAGACAGAGTTTTGTTAAAAC
AATATTTGTCTATTATCGGTGGGAATTTGTTAGAAAATTGTAATGATAAA
GTTGAATATATGGTTATGAGTAATTTAAAAGCTACATTTAAGGTTGTATG
TGCTTTAATCAAGCAAATAAAAATTGTTAAAATTGATTTTGTCAAGGCAA
TGGTGGATTATTTTAAAGGAATTAATCAAATTTTACCCGATCCCGATCAT
TACTTGCCAGAAATTCACAATCCAGATGATTGCTTTATTGGATTGGATTA
TAAACCGAATCCTAAGCGCAAATGTTTATTCAACAACAAACAGTTTTATT
TTTTAACTCAAGAAAAACTTTCTCTACTCAGTGAAGCTGTATTGTCCGGT
GGGGGAATTGCAATGCTGCTCACCGATTCCGATTGCCGTGATCAATCGCT
GAGAGTAAAACTTGCCCATTGTGATAGTATTGTAATGCAGGAGGCCGTTA
CAACAAATCTCGTGAATGAAATATCTCTCATTCTGAAAGGAATAAACAAG
CGGTTAATTAATGATTCTGAAATCGGATTCGCCGTTATGCTCGCTTCTGT
TGATGAATATTGCAACCCGTACAGAGCCCTTCCCAAATCGCACGACAAAG
AAAACAACAATCCCAAACAAAATCCGTTTCCTTCACTCGACAAATTGCCT
TGCAAAGAGGAGCCTTCTACAAACCATCCAAACAAGCAAGTGCACAATAA
TTCGCTGGGTGAACTTCGTGCGCACGACATAAACGCCATTGATTTTGATC
GCGATCGCGACCAGATCATAACTATCAGTGATACGGATAGTGAAAGCGAT
ACCAATAGCAATGCTCATCAACATTCACTCAGAAGGAATCAGGAAAACAA
TTCTCCCAAACCAAATTTATCGGTTTCGAAATTCTTTAACTTATCCACAA
CTAATTTGCCGACAATGAAACGGAAATTTGCAATGCATAGTCATGACGAA
TTTAATAATGATTTTGACAATATTTCCATTCCTGGACTGCAAAGGATTCC
AGCTAATACACTGATCCTAGAACCTACCAGTAGAACCATTTTCAGCAACT
TCCAAGATGAAGAACAAAATGCTCATAATATATTTCCAAAGAAAAGAAAA
ATGAACAATACTACTGACAGATCTGTAAGCAGTTGCAAAATACAAAATAT
GTCTCAAACGACAAAATTAGTAACTGATAAACAGTTATTCGACCTACAGC
TGATCAGAGAGATTCCAACGAGAATTCAGATAAATCCCGCCAATGAAATG
GATATTAGATCTTGCATGGAAAATGTCAAATTTGCCCAACTGATCAAAGA
AAAATATATTGAACGTAAAAATTACAAAATGTTTATAAAGAGTTCTCCAA
TTTATATTGAACGTAATTCCGTGCCGCTCGTTCAGTTTCGTTAATAAATA
TTAAACTTTC
back to top

protein sequence of SMED30019275-orf-1

>SMED30019275-orf-1 ID=SMED30019275-orf-1|Name=SMED30019275-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=582bp
MPWKFENKNKNIVKYFLPSVTYTIGRVSADVILTHTSISRKHAVLIWECD
LNYITIDDCSKFGTFINKAPLINKKGNIKDGDIVTFGAQPGVDLNCSFVA
FDIVCSTLSNADRVLLKQYLSIIGGNLLENCNDKVEYMVMSNLKATFKVV
CALIKQIKIVKIDFVKAMVDYFKGINQILPDPDHYLPEIHNPDDCFIGLD
YKPNPKRKCLFNNKQFYFLTQEKLSLLSEAVLSGGGIAMLLTDSDCRDQS
LRVKLAHCDSIVMQEAVTTNLVNEISLILKGINKRLINDSEIGFAVMLAS
VDEYCNPYRALPKSHDKENNNPKQNPFPSLDKLPCKEEPSTNHPNKQVHN
NSLGELRAHDINAIDFDRDRDQIITISDTDSESDTNSNAHQHSLRRNQEN
NSPKPNLSVSKFFNLSTTNLPTMKRKFAMHSHDEFNNDFDNISIPGLQRI
PANTLILEPTSRTIFSNFQDEEQNAHNIFPKKRKMNNTTDRSVSSCKIQN
MSQTTKLVTDKQLFDLQLIREIPTRIQINPANEMDIRSCMENVKFAQLIK
EKYIERKNYKMFIKSSPIYIERNSVPLVQFR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006302double-strand break repair
GO:0007095mitotic G2 DNA damage checkpoint
GO:0000723telomere maintenance
GO:0006281DNA repair
GO:0006974cellular response to DNA damage stimulus
GO:0007049cell cycle
GO:0007093mitotic cell cycle checkpoint
GO:0051321meiotic cell cycle
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000240body wall musculature
PLANA:0000420parapharyngeal region
PLANA:0000429neoblast
PLANA:0002075pigment cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR043014Nibrin_BRCT2_sf
IPR036420BRCT_dom_sf
IPR040227Nibrin-rel
IPR000253FHA_dom
IPR001357BRCT_dom
IPR032429Nibrin_BRCT2
IPR008984SMAD_FHA_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0000781chromosome, telomeric region
GO:0005634nucleus
GO:0030870Mre11 complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000253Forkhead-associated (FHA) domainSMARTSM00240FHA_2coord: 21..71
e-value: 7.0E-9
score: 45.5
IPR000253Forkhead-associated (FHA) domainPFAMPF00498FHAcoord: 22..87
e-value: 4.7E-14
score: 52.5
IPR000253Forkhead-associated (FHA) domainPROSITEPS50006FHA_DOMAINcoord: 22..71
score: 10.291
IPR000253Forkhead-associated (FHA) domainCDDcd00060FHAcoord: 15..88
e-value: 3.72798E-15
score: 69.3374
NoneNo IPR availableGENE3DG3DSA:2.60.200.20coord: 3..93
e-value: 2.3E-17
score: 64.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 378..408
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 376..408
NoneNo IPR availableCDDcd17741BRCT_nibrincoord: 103..172
e-value: 2.00816E-11
score: 57.9973
IPR043014Nibrin, second BRCT domain superfamilyGENE3DG3DSA:3.40.50.10980coord: 199..309
e-value: 5.7E-22
score: 80.2
IPR032429Nibrin, second BRCT domainPFAMPF16508NIBRIN_BRCT_IIcoord: 205..307
e-value: 4.7E-13
score: 49.5
IPR036420BRCT domain superfamilyGENE3DG3DSA:3.40.50.10190coord: 96..193
e-value: 4.7E-7
score: 31.8
IPR036420BRCT domain superfamilySUPERFAMILYSSF52113BRCT domaincoord: 100..171
IPR040227Nibrin-relatedPANTHERPTHR12162NIBRIN-RELATEDcoord: 13..466
IPR008984SMAD/FHA domain superfamilySUPERFAMILYSSF49879SMAD/FHA domaincoord: 12..88