Myb_DNA-bind_7 domain-containing protein

Overview
NameMyb_DNA-bind_7 domain-containing protein
Smed IDSMED30019272
Length (bp)2572
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Myb_DNA-bind_7 domain-containing protein (SMED30019272) t-SNE clustered cells

Violin plots show distribution of expression levels for Myb_DNA-bind_7 domain-containing protein (SMED30019272) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Myb_DNA-bind_7 domain-containing protein (SMED30019272) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Myb_DNA-bind_7 domain-containing protein (SMED30019272) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019272

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30019272h1SMcG0022577 SmedASXL_015125SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30019272h1SMcG0022577 SmedASXL_008853SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30019272h1SMcG0022577 Contig39030uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019272h1SMcG0022577 Contig39030newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neoblastSMED30019272h1SMcG0022577 dd_Smed_v4_8936_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Myb_DNA-bind_7 domain-containing protein vs. Ensembl Human
Match: BDP1 (B double prime 1, subunit of RNA polymerase III transcription initiation factor IIIB [Source:HGNC Symbol;Acc:HGNC:13652])

HSP 1 Score: 53.5286 bits (127), Expect = 2.261e-6
Identity = 36/104 (34.62%), Postives = 55/104 (52.88%), Query Frame = 2
Query: 1763 FRIDLDGQIVIDDEEDETNMQISTEGMEEIVENAADLR----SSYRSYMKRRLSGKRWKAEETRNFYKALLAVKTDFTRMATIFKGRSRADLKKKFKVEEKLNS 2062
             ++  DG I++D EE  T   + T+G   + EN         ++Y S+ K   S K W  +ET  F+ A+  V TDF+ +  +F  R+R ++K KFK EEK N 
Sbjct:  248 VKVAEDGSIILD-EESLTVEVLRTKGPCVVEENDPIFERGSTTTYSSFRKNYYS-KPWSNKETDMFFLAISMVGTDFSMIGQLFPHRARIEIKNKFKREEKTNG 349          
BLAST of Myb_DNA-bind_7 domain-containing protein vs. Ensembl Human
Match: BDP1 (B double prime 1, subunit of RNA polymerase III transcription initiation factor IIIB [Source:HGNC Symbol;Acc:HGNC:13652])

HSP 1 Score: 53.5286 bits (127), Expect = 2.300e-6
Identity = 36/104 (34.62%), Postives = 55/104 (52.88%), Query Frame = 2
Query: 1763 FRIDLDGQIVIDDEEDETNMQISTEGMEEIVENAADLR----SSYRSYMKRRLSGKRWKAEETRNFYKALLAVKTDFTRMATIFKGRSRADLKKKFKVEEKLNS 2062
             ++  DG I++D EE  T   + T+G   + EN         ++Y S+ K   S K W  +ET  F+ A+  V TDF+ +  +F  R+R ++K KFK EEK N 
Sbjct:  248 VKVAEDGSIILD-EESLTVEVLRTKGPCVVEENDPIFERGSTTTYSSFRKNYYS-KPWSNKETDMFFLAISMVGTDFSMIGQLFPHRARIEIKNKFKREEKTNG 349          
BLAST of Myb_DNA-bind_7 domain-containing protein vs. Ensembl Human
Match: BDP1 (B double prime 1, subunit of RNA polymerase III transcription initiation factor IIIB [Source:HGNC Symbol;Acc:HGNC:13652])

HSP 1 Score: 53.5286 bits (127), Expect = 2.300e-6
Identity = 36/104 (34.62%), Postives = 55/104 (52.88%), Query Frame = 2
Query: 1763 FRIDLDGQIVIDDEEDETNMQISTEGMEEIVENAADLR----SSYRSYMKRRLSGKRWKAEETRNFYKALLAVKTDFTRMATIFKGRSRADLKKKFKVEEKLNS 2062
             ++  DG I++D EE  T   + T+G   + EN         ++Y S+ K   S K W  +ET  F+ A+  V TDF+ +  +F  R+R ++K KFK EEK N 
Sbjct:  248 VKVAEDGSIILD-EESLTVEVLRTKGPCVVEENDPIFERGSTTTYSSFRKNYYS-KPWSNKETDMFFLAISMVGTDFSMIGQLFPHRARIEIKNKFKREEKTNG 349          
BLAST of Myb_DNA-bind_7 domain-containing protein vs. Ensembl Human
Match: BDP1 (B double prime 1, subunit of RNA polymerase III transcription initiation factor IIIB [Source:HGNC Symbol;Acc:HGNC:13652])

HSP 1 Score: 51.9878 bits (123), Expect = 5.427e-6
Identity = 36/103 (34.95%), Postives = 55/103 (53.40%), Query Frame = 2
Query: 1766 RIDLDGQIVIDDEEDETNMQISTEGMEEIVENAADLR----SSYRSYMKRRLSGKRWKAEETRNFYKALLAVKTDFTRMATIFKGRSRADLKKKFKVEEKLNS 2062
            ++  DG I++D EE  T   + T+G   + EN         ++Y S+ K   S K W  +ET  F+ A+  V TDF+ +  +F  R+R ++K KFK EEK N 
Sbjct:  249 KVAEDGSIILD-EESLTVEVLRTKGPCVVEENDPIFERGSTTTYSSFRKNYYS-KPWSNKETDMFFLAISMVGTDFSMIGQLFPHRARIEIKNKFKREEKTNG 349          
BLAST of Myb_DNA-bind_7 domain-containing protein vs. Ensembl Human
Match: BDP1 (B double prime 1, subunit of RNA polymerase III transcription initiation factor IIIB [Source:HGNC Symbol;Acc:HGNC:13652])

HSP 1 Score: 51.9878 bits (123), Expect = 5.520e-6
Identity = 36/103 (34.95%), Postives = 55/103 (53.40%), Query Frame = 2
Query: 1766 RIDLDGQIVIDDEEDETNMQISTEGMEEIVENAADLR----SSYRSYMKRRLSGKRWKAEETRNFYKALLAVKTDFTRMATIFKGRSRADLKKKFKVEEKLNS 2062
            ++  DG I++D EE  T   + T+G   + EN         ++Y S+ K   S K W  +ET  F+ A+  V TDF+ +  +F  R+R ++K KFK EEK N 
Sbjct:  249 KVAEDGSIILD-EESLTVEVLRTKGPCVVEENDPIFERGSTTTYSSFRKNYYS-KPWSNKETDMFFLAISMVGTDFSMIGQLFPHRARIEIKNKFKREEKTNG 349          
BLAST of Myb_DNA-bind_7 domain-containing protein vs. Ensembl Celegans
Match: B0261.1 (pep chromosome:WBcel235:I:5263694:5268380:1 gene:WBGene00015091.1 transcript:B0261.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:B0261.1)

HSP 1 Score: 52.373 bits (124), Expect = 1.492e-6
Identity = 43/128 (33.59%), Postives = 62/128 (48.44%), Query Frame = 2
Query: 1763 FRIDLDGQIVIDDEEDETNM-----QISTEGMEEIVENA-ADLRSSYRSYMKRRLSGKR--WKAEETRNFYKALLAVKTDFTRMATIFKGRSRADLKKKFKVEEKLNSKLVYEILVSPVVCDISNLVI 2122
             +I  DG++VID    ET++     QI+ E + E VE      + +  S+ KR   GK   W  +ET  FY+ L     DF  M+     R+R +LK K+  EEK+N   V   +  PV  D  NL +
Sbjct:  207 VKIGADGRLVID----ETSLVVHSAQINHESVWETVEEGRMGAKITSMSFRKRGF-GKSSFWSEKETDLFYEVLQCTGQDFGLMSHYLPKRTRPELKAKYNREEKINWARVLNAISHPVRLD-GNLEV 328          
BLAST of Myb_DNA-bind_7 domain-containing protein vs. Ensembl Fly
Match: Bdp1 (gene:FBgn0032512 transcript:FBtr0080471)

HSP 1 Score: 70.0922 bits (170), Expect = 5.846e-12
Identity = 61/237 (25.74%), Postives = 108/237 (45.57%), Query Frame = 2
Query: 1439 STCSSRISEASSANRLHGNSESSNGNRKRKEKSFVLKRHSELRAEDERDLSKLTLLELINIEPR---LPPPQSRLNKSNKRAGDSS----DQNLELERIXXXXXXXXXXXXXXXXFRIDLDGQIVIDDEEDETNMQISTEGMEEIVENAA----DLRSSYRSYMKRRLSGKRWKAEETRNFYKALLAVKTDFTRMATIFKGRSRADLKKKFKVEEKLNSKLVYEILVSPVVCDISNL 2116
            STCS+     S   +    S+S  G R    + F  + +  +      D S   ++++I   P    + P QS     ++  GD S     Q LE        + +S +     + ++D +G+++ID++  E       E   +++ N++    D  +    + KR      W ++ET  FY++L  + TDF+ M  +F  RSR DLK K+K EE+ N +L+ + L+ P   +I  L
Sbjct:  192 STCSTYSEGGSKQRKGDDRSQSQIGQRLNARRDFETRFNKGVP-----DKSTFKMMDMIFYNPENNPMVPKQSVTTIKDESGGDDSKPAVSQLLE-------PKGESTSAMLVPQLKLDANGEMIIDEKTLEIETTAEVEA-RKVLANSSLILMDETTGDNGFYKRHKRTPYWTSDETVRFYRSLQIIGTDFSLMCQMFPTRSRRDLKLKYKKEERTNGQLINKALLYPKAFNIQEL 415          
BLAST of Myb_DNA-bind_7 domain-containing protein vs. Ensembl Fly
Match: Bdp1 (gene:FBgn0032512 transcript:FBtr0342639)

HSP 1 Score: 70.0922 bits (170), Expect = 6.020e-12
Identity = 61/237 (25.74%), Postives = 108/237 (45.57%), Query Frame = 2
Query: 1439 STCSSRISEASSANRLHGNSESSNGNRKRKEKSFVLKRHSELRAEDERDLSKLTLLELINIEPR---LPPPQSRLNKSNKRAGDSS----DQNLELERIXXXXXXXXXXXXXXXXFRIDLDGQIVIDDEEDETNMQISTEGMEEIVENAA----DLRSSYRSYMKRRLSGKRWKAEETRNFYKALLAVKTDFTRMATIFKGRSRADLKKKFKVEEKLNSKLVYEILVSPVVCDISNL 2116
            STCS+     S   +    S+S  G R    + F  + +  +      D S   ++++I   P    + P QS     ++  GD S     Q LE        + +S +     + ++D +G+++ID++  E       E   +++ N++    D  +    + KR      W ++ET  FY++L  + TDF+ M  +F  RSR DLK K+K EE+ N +L+ + L+ P   +I  L
Sbjct:  192 STCSTYSEGGSKQRKGDDRSQSQIGQRLNARRDFETRFNKGVP-----DKSTFKMMDMIFYNPENNPMVPKQSVTTIKDESGGDDSKPAVSQLLE-------PKGESTSAMLVPQLKLDANGEMIIDEKTLEIETTAEVEA-RKVLANSSLILMDETTGDNGFYKRHKRTPYWTSDETVRFYRSLQIIGTDFSLMCQMFPTRSRRDLKLKYKKEERTNGQLINKALLYPKAFNIQEL 415          
BLAST of Myb_DNA-bind_7 domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000044453.1 (B double prime 1, subunit of RNA polymerase III transcription initiation factor IIIB [Source:NCBI gene;Acc:100491494])

HSP 1 Score: 58.5362 bits (140), Expect = 5.472e-8
Identity = 37/106 (34.91%), Postives = 60/106 (56.60%), Query Frame = 2
Query: 1763 FRIDLDGQIVIDDEEDETNMQIS-TEGMEEIVENAADL-----RSSYRSYMKRRLSGKRWKAEETRNFYKALLAVKTDFTRMATIFKGRSRADLKKKFKVEEKLNS 2062
             ++  DG I++D+E     +++S T+G   IVEN   +      ++Y S+ K + S K W  +ET  F+ A+  V TDF+ +  +F  R R ++K KFK EE+LN 
Sbjct:  367 VKVAEDGSIILDEES--LTVEVSRTKG--PIVENGDPIFERGSTTTYTSFRKSKYS-KPWSEKETDMFFLAISMVGTDFSMITHLFPHRQRIEIKNKFKREERLNG 467          
BLAST of Myb_DNA-bind_7 domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000044513.1 (B double prime 1, subunit of RNA polymerase III transcription initiation factor IIIB [Source:NCBI gene;Acc:100491494])

HSP 1 Score: 58.5362 bits (140), Expect = 6.224e-8
Identity = 37/106 (34.91%), Postives = 60/106 (56.60%), Query Frame = 2
Query: 1763 FRIDLDGQIVIDDEEDETNMQIS-TEGMEEIVENAADL-----RSSYRSYMKRRLSGKRWKAEETRNFYKALLAVKTDFTRMATIFKGRSRADLKKKFKVEEKLNS 2062
             ++  DG I++D+E     +++S T+G   IVEN   +      ++Y S+ K + S K W  +ET  F+ A+  V TDF+ +  +F  R R ++K KFK EE+LN 
Sbjct:  367 VKVAEDGSIILDEES--LTVEVSRTKG--PIVENGDPIFERGSTTTYTSFRKSKYS-KPWSEKETDMFFLAISMVGTDFSMITHLFPHRQRIEIKNKFKREERLNG 467          
BLAST of Myb_DNA-bind_7 domain-containing protein vs. Ensembl Mouse
Match: Bdp1 (B double prime 1, subunit of RNA polymerase III transcription initiation factor IIIB [Source:MGI Symbol;Acc:MGI:1347077])

HSP 1 Score: 54.6842 bits (130), Expect = 6.569e-7
Identity = 36/104 (34.62%), Postives = 55/104 (52.88%), Query Frame = 2
Query: 1763 FRIDLDGQIVIDDEEDETNMQISTEGMEEIVENAADLR----SSYRSYMKRRLSGKRWKAEETRNFYKALLAVKTDFTRMATIFKGRSRADLKKKFKVEEKLNS 2062
             ++  DG I++D EE  T   + T+G   + EN         ++Y S+ K   S K W  +ET  F+ A+  V TDF+ +  +F  R+R ++K KFK EEK N 
Sbjct:  250 VKVAEDGSIILD-EESLTVEVLRTKGPCVVEENDPIFERGSTTTYSSFRKNYYS-KPWSNKETDMFFLAISMVGTDFSMIGQLFPHRARIEIKNKFKREEKTNG 351          
BLAST of Myb_DNA-bind_7 domain-containing protein vs. Ensembl Mouse
Match: Bdp1 (B double prime 1, subunit of RNA polymerase III transcription initiation factor IIIB [Source:MGI Symbol;Acc:MGI:1347077])

HSP 1 Score: 54.6842 bits (130), Expect = 6.912e-7
Identity = 36/104 (34.62%), Postives = 55/104 (52.88%), Query Frame = 2
Query: 1763 FRIDLDGQIVIDDEEDETNMQISTEGMEEIVENAADLR----SSYRSYMKRRLSGKRWKAEETRNFYKALLAVKTDFTRMATIFKGRSRADLKKKFKVEEKLNS 2062
             ++  DG I++D EE  T   + T+G   + EN         ++Y S+ K   S K W  +ET  F+ A+  V TDF+ +  +F  R+R ++K KFK EEK N 
Sbjct:  250 VKVAEDGSIILD-EESLTVEVLRTKGPCVVEENDPIFERGSTTTYSSFRKNYYS-KPWSNKETDMFFLAISMVGTDFSMIGQLFPHRARIEIKNKFKREEKTNG 351          
BLAST of Myb_DNA-bind_7 domain-containing protein vs. UniProt/SwissProt
Match: sp|O94481|TFC5_SCHPO (Transcription factor TFIIIB component B'' OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bdp1 PE=3 SV=2)

HSP 1 Score: 56.225 bits (134), Expect = 1.065e-6
Identity = 36/107 (33.64%), Postives = 57/107 (53.27%), Query Frame = 2
Query: 1775 LDGQIVIDDEEDETNMQ----ISTEGMEEIVENAADLRSSYRSYMKRRLSGKRWKAEETRNFYKALLAVKTDFTRMATIFKGRSRADLKKKFKVEEKLNSKLVYEIL 2083
            ++GQIV+D+   E +      +  E  E + EN+   R +  ++  R+   ++W A +T  FYKAL    TDF  +A +F  R+R  +K KFK EE+ N   V + L
Sbjct:  329 VNGQIVLDETSLEVDRHERDFVPAEEREYVEENSLSRRVTSATWGNRQ-KPEKWNAMDTEKFYKALSQWGTDFALIANMFPTRNRRQIKLKFKQEERRNPARVNQAL 434          
BLAST of Myb_DNA-bind_7 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q571C7|BDP1_MOUSE (Transcription factor TFIIIB component B'' homolog OS=Mus musculus OX=10090 GN=Bdp1 PE=2 SV=2)

HSP 1 Score: 54.6842 bits (130), Expect = 4.595e-6
Identity = 36/104 (34.62%), Postives = 55/104 (52.88%), Query Frame = 2
Query: 1763 FRIDLDGQIVIDDEEDETNMQISTEGMEEIVENAADLR----SSYRSYMKRRLSGKRWKAEETRNFYKALLAVKTDFTRMATIFKGRSRADLKKKFKVEEKLNS 2062
             ++  DG I++D EE  T   + T+G   + EN         ++Y S+ K   S K W  +ET  F+ A+  V TDF+ +  +F  R+R ++K KFK EEK N 
Sbjct:  250 VKVAEDGSIILD-EESLTVEVLRTKGPCVVEENDPIFERGSTTTYSSFRKNYYS-KPWSNKETDMFFLAISMVGTDFSMIGQLFPHRARIEIKNKFKREEKTNG 351          
BLAST of Myb_DNA-bind_7 domain-containing protein vs. TrEMBL
Match: A0A448XGC3 (SANT domain-containing protein (Fragment) OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS29582 PE=4 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 2.315e-13
Identity = 50/121 (41.32%), Postives = 66/121 (54.55%), Query Frame = 2
Query: 1766 RIDLDGQIVIDDEEDETNMQISTEG--MEEIVENAADLRSSYRSYMK-RRLSGKRWKAEETRNFYKALLAVKTDFTRMATIFKGRSRADLKKKFKVEEKLNSKLVYEILVSPVVCDISNLV 2119
            RID DG IVID+         S+EG  +  + E    + SSY S+   + L G RW  +ET  FY+AL  + TDF  M  +F  R+R+ LK KFK EEK+N  LV E L +    D+S L 
Sbjct:   86 RIDADGNIVIDETSLTIQRDTSSEGRILRHVNEENGIISSSYSSFKPPKALPGSRWSEKETTLFYRALNTIGTDFYLMGLLFPHRTRSQLKAKFKREEKINHHLVNEALKNRRSYDLSALC 206          
BLAST of Myb_DNA-bind_7 domain-containing protein vs. TrEMBL
Match: A0A1B6ETC7 (SANT domain-containing protein (Fragment) OS=Cuerna arida OX=1464854 GN=g.5980 PE=4 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 7.840e-13
Identity = 47/122 (38.52%), Postives = 65/122 (53.28%), Query Frame = 2
Query: 1778 DGQIVIDDEEDETNMQISTEGME---------EIVENAADLRSSYRSYMKRRLSGKRWKAEETRNFYKALLAVKTDFTRMATIFKGRSRADLKKKFKVEEKLNSKLVYEILVSPVVCDISNL 2116
            DGQI++D +    ++ I T GME         ++V+     R  Y +Y KR+     W A+ET  FYKAL  V +DF  M  +F  RSR +LK KFK EE++N  LV + + SP   D   L
Sbjct:    3 DGQIILDPK----SLVIETTGMEKSRAKLENSQVVQETGATR--YNTYSKRKAQRHEWTAQETLQFYKALHTVGSDFAIMTKLFPKRSRHELKLKFKREERINLNLVDKAMTSPADFDFITL 118          
BLAST of Myb_DNA-bind_7 domain-containing protein vs. TrEMBL
Match: A0A1I8G7M9 (Myb_DNA-bind_7 domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 9.073e-13
Identity = 46/113 (40.71%), Postives = 74/113 (65.49%), Query Frame = 2
Query: 1769 IDLDGQIVIDDEE---DETNMQISTEGMEEIVENAADLRSSYRSY--MKRRLS---GKRWKAEETRNFYKALLAVKTDFTRMATIFKGRSRADLKKKFKVEEKLNSKLVYEIL 2083
            +D  G IV+++E     E+   I    +EE+ E+ A+LR++YRS+  +  R +   G++W  +ET  FYKA+  + TDF+ MA++FKGRSR +LK+K+K EEK N  L+ ++L
Sbjct:   74 LDSRGNIVLNEESLYIRESAPAI----VEEVREDCAELRATYRSFRNVGGRGAATRGRQWSCKETLRFYKAVSTIGTDFSYMASLFKGRSREELKRKYKREEKANPHLIDQML 182          
BLAST of Myb_DNA-bind_7 domain-containing protein vs. TrEMBL
Match: A0A158RF02 (Myb_DNA-bind_7 domain-containing protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS8474 PE=4 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 9.110e-13
Identity = 50/142 (35.21%), Postives = 78/142 (54.93%), Query Frame = 2
Query: 1763 FRIDLDGQIVIDDEEDETNMQIST--EGMEEIVENAADLRSSYRSYMKRRLS--GKRWKAEETRNFYKALLAVKTDFTRMATIFKGRSRADLKKKFKVEEKLNSKLVYEILVSPVVCDISNLVIDSHLNQPTKHKKPRKDAV 2176
             R+D DG IV+D++    +   +T  E +  + E A    ++Y S+ +R +   G++W  ++T  FY+AL  + TDF  M  IF GR+R  L KKFK EE+L   LV E L +    DI+ +   S  +   K++K  KDA+
Sbjct:  212 LRLDADGNIVLDEQSLHISHPKTTVMEDLRHVAEEAGLYGTTYNSFRRRPIQHRGRKWTEKDTTRFYRALSTIGTDFYSMTKIFPGRTRGQLLKKFKREERLFPHLVDEALKNKRNYDIT-VFCKSESDSEEKYEKLTKDAI 352          
BLAST of Myb_DNA-bind_7 domain-containing protein vs. TrEMBL
Match: A0A1I8GWI4 (Myb_DNA-bind_7 domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 9.201e-13
Identity = 39/86 (45.35%), Postives = 62/86 (72.09%), Query Frame = 2
Query: 1841 MEEIVENAADLRSSYRSY--MKRRLS---GKRWKAEETRNFYKALLAVKTDFTRMATIFKGRSRADLKKKFKVEEKLNSKLVYEIL 2083
            +EE+ E+ A+LR++YRS+  +  R +   G++W  +ET  FYKA+  + TDF+ MA++FKGRSR +LK+K+K EEK N  L+ ++L
Sbjct:  172 VEEVREDCAELRATYRSFRNVGGRGAATRGRQWSCKETLRFYKAVSTIGTDFSYMASLFKGRSREELKRKYKREEKANPHLIDQML 257          
BLAST of Myb_DNA-bind_7 domain-containing protein vs. Ensembl Cavefish
Match: si:ch211-204c21.1 (si:ch211-204c21.1 [Source:ZFIN;Acc:ZDB-GENE-030429-35])

HSP 1 Score: 52.373 bits (124), Expect = 2.420e-6
Identity = 35/105 (33.33%), Postives = 56/105 (53.33%), Query Frame = 2
Query: 1763 FRIDLDGQIVIDDEEDETNMQISTEGMEEIVENAA-----DLRSSYRSYMKRRLSGKRWKAEETRNFYKALLAVKTDFTRMATIFKGRSRADLKKKFKVEEKLNS 2062
             R+  DG IV+D+E     +Q ++    + VEN++        ++YRS+ +     K W   ET  F+ A+  V TDF+ +  +   RSR ++K KFK EE+ NS
Sbjct:  367 VRVAEDGSIVLDEESLTVRVQRTS--TTKAVENSSAQFEQGFTTTYRSF-RNWTHVKSWSVRETDMFFLAISMVGTDFSLIGMLLPHRSRTEIKNKFKKEERANS 468          
BLAST of Myb_DNA-bind_7 domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000053151.1 (transcription factor TFIIIB component B'' homolog [Source:NCBI gene;Acc:103025922])

HSP 1 Score: 51.6026 bits (122), Expect = 3.847e-6
Identity = 33/109 (30.28%), Postives = 56/109 (51.38%), Query Frame = 2
Query: 1763 FRIDLDGQIVIDDEEDETNMQISTEGMEEIVENAADLR---------SSYRSYMKRRLSGKRWKAEETRNFYKALLAVKTDFTRMATIFKGRSRADLKKKFKVEEKLNS 2062
             ++  DG ++ID+E       ++ E +     N A+ R         ++Y S+ K   + K W  +ET  F+ A+  V TDF+ +  +F  R+R ++K KFK EE+ NS
Sbjct:  415 VKVAEDGSLIIDEE------SLTVEVLRVKGPNPAEDRDPIFERGSTTTYSSFRKGTYT-KPWSNKETDMFFLAISMVGTDFSMIGQLFPHRARIEIKNKFKKEERANS 516          
BLAST of Myb_DNA-bind_7 domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000046411.1 (transcription factor TFIIIB component B'' homolog [Source:NCBI gene;Acc:103025922])

HSP 1 Score: 51.6026 bits (122), Expect = 3.847e-6
Identity = 33/109 (30.28%), Postives = 56/109 (51.38%), Query Frame = 2
Query: 1763 FRIDLDGQIVIDDEEDETNMQISTEGMEEIVENAADLR---------SSYRSYMKRRLSGKRWKAEETRNFYKALLAVKTDFTRMATIFKGRSRADLKKKFKVEEKLNS 2062
             ++  DG ++ID+E       ++ E +     N A+ R         ++Y S+ K   + K W  +ET  F+ A+  V TDF+ +  +F  R+R ++K KFK EE+ NS
Sbjct:  415 VKVAEDGSLIIDEE------SLTVEVLRVKGPNPAEDRDPIFERGSTTTYSSFRKGTYT-KPWSNKETDMFFLAISMVGTDFSMIGQLFPHRARIEIKNKFKKEERANS 516          
BLAST of Myb_DNA-bind_7 domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000017002.2 (transcription factor TFIIIB component B'' homolog [Source:NCBI gene;Acc:103025922])

HSP 1 Score: 51.2174 bits (121), Expect = 5.050e-6
Identity = 33/109 (30.28%), Postives = 56/109 (51.38%), Query Frame = 2
Query: 1763 FRIDLDGQIVIDDEEDETNMQISTEGMEEIVENAADLR---------SSYRSYMKRRLSGKRWKAEETRNFYKALLAVKTDFTRMATIFKGRSRADLKKKFKVEEKLNS 2062
             ++  DG ++ID+E       ++ E +     N A+ R         ++Y S+ K   + K W  +ET  F+ A+  V TDF+ +  +F  R+R ++K KFK EE+ NS
Sbjct:  415 VKVAEDGSLIIDEE------SLTVEVLRVKGPNPAEDRDPIFERGSTTTYSSFRKGTYT-KPWSNKETDMFFLAISMVGTDFSMIGQLFPHRARIEIKNKFKKEERANS 516          
BLAST of Myb_DNA-bind_7 domain-containing protein vs. Ensembl Yeast
Match: BDP1 (Essential subunit of RNA polymerase III transcription factor (TFIIIB); TFIIIB is involved in transcription of genes encoding tRNAs, 5S rRNA, U6 snRNA, and other small RNAs [Source:SGD;Acc:S000004984])

HSP 1 Score: 51.2174 bits (121), Expect = 5.549e-7
Identity = 34/101 (33.66%), Postives = 50/101 (49.50%), Query Frame = 2
Query: 1763 FRIDLDGQIVIDDE----EDETNMQISTEGMEEIVENAADLRSSYRSYMKRRLSGKRWKAEETRNFYKALLAVKTDFTRMATIFKGRSRADLKKKFKVEEK 2053
             +++ DG + ID+E    +   N  I  E  E++ EN      +Y SY +   +   W  EE   FYKAL    TDF  ++ ++  RSR  +K KF  EEK
Sbjct:  364 LKLNPDGTMAIDEETMVVDRHKNASIENEYKEKVDENPFANLYNYGSYGRGSYTDP-WTVEEMIKFYKALSMWGTDFNLISQLYPYRSRKQVKAKFVNEEK 463          
BLAST of Myb_DNA-bind_7 domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000003629.2 (transcription factor TFIIIB component B'' homolog [Source:NCBI gene;Acc:101173800])

HSP 1 Score: 54.6842 bits (130), Expect = 5.460e-7
Identity = 35/104 (33.65%), Postives = 56/104 (53.85%), Query Frame = 2
Query: 1763 FRIDLDGQIVIDDEEDETNMQISTEGMEEIVENAADLR----SSYRSYMKRRLSGKRWKAEETRNFYKALLAVKTDFTRMATIFKGRSRADLKKKFKVEEKLNS 2062
             ++  DG ++ID EE  T   + ++G   I +          ++Y S+ K   + K W  EET  FY A+  V TDF+ +  +F  R+R+++K KFK EE+ NS
Sbjct:  373 VKVAEDGSLIID-EESLTVEVLRSKGPNTIQDRDPIFERGSTTTYSSFRKGTYT-KPWSIEETDMFYLAISMVGTDFSMICQLFTHRARSEIKNKFKREERENS 474          
BLAST of Myb_DNA-bind_7 domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000042388.1 (transcription factor TFIIIB component B'' homolog [Source:NCBI gene;Acc:101173800])

HSP 1 Score: 54.299 bits (129), Expect = 6.021e-7
Identity = 35/104 (33.65%), Postives = 56/104 (53.85%), Query Frame = 2
Query: 1763 FRIDLDGQIVIDDEEDETNMQISTEGMEEIVENAADLR----SSYRSYMKRRLSGKRWKAEETRNFYKALLAVKTDFTRMATIFKGRSRADLKKKFKVEEKLNS 2062
             ++  DG ++ID EE  T   + ++G   I +          ++Y S+ K   + K W  EET  FY A+  V TDF+ +  +F  R+R+++K KFK EE+ NS
Sbjct:  373 VKVAEDGSLIID-EESLTVEVLRSKGPNTIQDRDPIFERGSTTTYSSFRKGTYT-KPWSIEETDMFYLAISMVGTDFSMICQLFTHRARSEIKNKFKREERENS 474          
BLAST of Myb_DNA-bind_7 domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000045898.1 (transcription factor TFIIIB component B'' homolog [Source:NCBI gene;Acc:101173800])

HSP 1 Score: 54.299 bits (129), Expect = 6.167e-7
Identity = 35/104 (33.65%), Postives = 56/104 (53.85%), Query Frame = 2
Query: 1763 FRIDLDGQIVIDDEEDETNMQISTEGMEEIVENAADLR----SSYRSYMKRRLSGKRWKAEETRNFYKALLAVKTDFTRMATIFKGRSRADLKKKFKVEEKLNS 2062
             ++  DG ++ID EE  T   + ++G   I +          ++Y S+ K   + K W  EET  FY A+  V TDF+ +  +F  R+R+++K KFK EE+ NS
Sbjct:  373 VKVAEDGSLIID-EESLTVEVLRSKGPNTIQDRDPIFERGSTTTYSSFRKGTYT-KPWSIEETDMFYLAISMVGTDFSMICQLFTHRARSEIKNKFKREERENS 474          
BLAST of Myb_DNA-bind_7 domain-containing protein vs. Planmine SMEST
Match: SMESG000016335.1 (SMESG000016335.1)

HSP 1 Score: 947.192 bits (2447), Expect = 0.000e+0
Identity = 522/612 (85.29%), Postives = 542/612 (88.56%), Query Frame = 2
Query:  518 ETVTNLMTLRAVKTTINTQSSGDEEASEFDNNNKGIIGIRLKSHCNGNDRI---LSKNGERNPNENGMSNKVA--SSQSGSLPRTNCNSNPHWPPGNPNSKKYLKRRRESAVDKAYGATGTTRPSERNSKPRKSARLSKLSINISDNHSETPDSDNITIDSLQNLQIPDVPIESLDSPGTTHRSLPREKSPKITVESSDSLKVTPDAPHTPECHKPTEKSIIPLSPPVATATMKFXXXXXXXXXXXXXXXXXXTTEIQIHLSDICTSSKSNAIVPFVTNSNLPLFKSPEKASKIIRRMACPSAVQSETDDNLSTCSSRISEASSANRLHGNSESSNGNRKRKEKSFVLKRHSELRAEDERDLSKLTLLELINIEPRLPPPQSRLNKSNKRAGDSSDQNLELERIXXXXXXXXXXXXXXXXFRIDLDGQIVIDDEEDETNMQISTEGMEEIVENAADLRSSYRSYMKRRLSGKRWKAEETRNFYKALLAVKTDFTRMATIFKGRSRADLKKKFKVEEKLNSKLVYEILVSPVVCDISNLVIDSHLNQPTKHKKPRKDAVKRNLRGSTQSDSDVESVKPKPKRRYRKFDIKQAKLDPTATDLPDYLKAYEKIMK 2338
            ET+    +L      +  QS+ DEEAS+ DN  +G++G  L         I   +   G+    E  +  K+   S ++G                      +  +RRESAVDKAYGATG++RPSER+SKPRKSARLSKLSINISDNHSETPDSDNITIDSLQNLQIPDVPI+SLDSPG THRSLPREKSPKITVESSDSLKVTPDAPHTPECHKPTEKSIIPLSPPVATATMKFNLKNAVNKSAVAVAPPKPTTEIQIHLSDICTSSKSNAIVPFVTNSNLPLFKSPEKASKIIRRMACPSAVQSETDDNLSTCSSRISEASSANRLHGNSESSNGNRKRKEKSFVLKRHSELRAEDERDLSKLTLLELINIEPRLPPPQSRLNKSNKRAGDSSDQNLELERISSSSQQKSANKSKSKKFRIDLDGQIVIDDEEDETNMQISTEGMEEIVENAADLRSSYRSYMKRRLSGKRWKAEETRNFYKALLAVKTDFTRMATIFKGRSRADLKKKFKVEEKLNSKLVYEILVSPVVCDISNLVIDSHLNQPTKHKKPRKDAVKRNLRGSTQSDSDVESVKPKPKRRYRKFDIKQAKLDPTATDLPDYLKAYEKIMK
Sbjct:  431 ETLETAESLWQPNGQVILQSTCDEEASKTDNKTEGVVGTTLGCSLEPGSDIEGSIGAEGDFTGIEKDIKQKITKKSRKAG----------------------HAIKRRESAVDKAYGATGSSRPSERDSKPRKSARLSKLSINISDNHSETPDSDNITIDSLQNLQIPDVPIDSLDSPGATHRSLPREKSPKITVESSDSLKVTPDAPHTPECHKPTEKSIIPLSPPVATATMKFNLKNAVNKSAVAVAPPKPTTEIQIHLSDICTSSKSNAIVPFVTNSNLPLFKSPEKASKIIRRMACPSAVQSETDDNLSTCSSRISEASSANRLHGNSESSNGNRKRKEKSFVLKRHSELRAEDERDLSKLTLLELINIEPRLPPPQSRLNKSNKRAGDSSDQNLELERISSSSQQKSANKSKSKKFRIDLDGQIVIDDEEDETNMQISTEGMEEIVENAADLRSSYRSYMKRRLSGKRWKAEETRNFYKALLAVKTDFTRMATIFKGRSRADLKKKFKVEEKLNSKLVYEILVSPVVCDISNLVIDSHLNQPTKHKKPRKDAVKRNLRGSTQSDSDVESVKPKPKRRYRKFDIKQAKLDPTATDLPDYLKAYEKIMK 1020          

HSP 2 Score: 55.4546 bits (132), Expect = 1.952e-7
Identity = 35/64 (54.69%), Postives = 43/64 (67.19%), Query Frame = 1
Query:   97 FKTVVDVINEYQNNSLPGEL----KILSSQFEQ---TNETNVKIIIRSSVLNFEVKE*NLSQSN 267
            F+ V DVIN++QNNSL  EL    KI SSQFE     N  N+K II +SV+N ++K  NLSQSN
Sbjct:   80 FEAVHDVINDFQNNSLSDELVKEIKISSSQFEPLRSDNALNIKTIIPTSVINCDIKPENLSQSN 143          
BLAST of Myb_DNA-bind_7 domain-containing protein vs. Planmine SMEST
Match: SMESG000016302.1 (SMESG000016302.1)

HSP 1 Score: 440.269 bits (1131), Expect = 5.732e-150
Identity = 217/221 (98.19%), Postives = 218/221 (98.64%), Query Frame = 2
Query:  536 MTLRAVKTTINTQSSGDEEASEFDNNNKGIIGIRLKSHCNGNDRILSKNGERNPNENGMSNKVASSQSGSLPRTNCNSNPHWPPGNPNSKKYLKRRRESAVDKAYGATGTTRPSERNSKPRKSARLSKLSINISDNHSETPDSDNITIDSLQNLQIPDVPIESLDSPGTTHRSLPREKSPKITVESSDSLKVTPDAPHTPECHKPTEKSIIPLSPPVATAT 1198
            MTLRAVKTTINTQSSGDEEASEFDNNNKGIIGIRLKSHCNGNDRILSKNGERNPNENGMSNKVASSQSGSLPRTNCNSNPHWPPGNPNSKKYLKRRRESAVDKAYGATGTTRPSERNSKPRKSARLSKLSINIS NHSETPDSDNITIDSLQNLQIPDVPIESLDSPGTTHRSLPREKSPKITVESSDSLKVTPDAP TPECHKPTE+SIIPLSPP ATAT
Sbjct:    1 MTLRAVKTTINTQSSGDEEASEFDNNNKGIIGIRLKSHCNGNDRILSKNGERNPNENGMSNKVASSQSGSLPRTNCNSNPHWPPGNPNSKKYLKRRRESAVDKAYGATGTTRPSERNSKPRKSARLSKLSINISGNHSETPDSDNITIDSLQNLQIPDVPIESLDSPGTTHRSLPREKSPKITVESSDSLKVTPDAPRTPECHKPTEESIIPLSPPAATAT 221          
BLAST of Myb_DNA-bind_7 domain-containing protein vs. Planmine SMEST
Match: SMESG000023131.1 (SMESG000023131.1)

HSP 1 Score: 313.153 bits (801), Expect = 7.971e-98
Identity = 179/251 (71.31%), Postives = 196/251 (78.09%), Query Frame = 2
Query: 1571 EDERDLSKLTLLELINIEPRLPPPQSRLNKSNKRAGDSSDQNLELERIXXXXXXXXXXXXXXXXFRIDLDGQIVIDDEEDETNMQISTEGMEEIVENAADLRSSYRSYMKRRLSGKRWKAEETRNFYKALLAVKTDFTRMATIFKGRSRADLKKKFKVEEKLNSKLVYEILVSPVVCDISNLVIDSHLNQPTKHKKPRKDAVKRNLRGSTQSDSDVESVKPKPKRRYRKFDIKQAKLDPTATDLPDYLKAY 2323
            EDERD SKLTLLELINI+  LP    RL KSNKR+G++SD+N+ELE+IS SSQQKS +K KSKKFRIDLDGQIVIDD+EDETNMQI  E MEEIVENAADLR SYR   K RLSGKRW AEET NFY ALL VKTDFTRMAT+FKGRSRADLKKKFKVEEK N + V +IL + + CDISNLVIDSHLN PTK KKP             QS  D ES   KPKRRYRKFDIK+A LDP+A DLPDY K +
Sbjct:  145 EDERDPSKLTLLELINIDLPLPHTPPRLKKSNKRSGNNSDRNMELEQISGSSQQKSIDKQKSKKFRIDLDGQIVIDDDEDETNMQIGIEAMEEIVENAADLRMSYRDQRKHRLSGKRWNAEETSNFYLALLYVKTDFTRMATVFKGRSRADLKKKFKVEEKANLEFVDKILEAQLDCDISNLVIDSHLNPPTKRKKPGY---------YFQSSRDEES--DKPKRRYRKFDIKKANLDPSAGDLPDYFKPF 384          
BLAST of Myb_DNA-bind_7 domain-containing protein vs. Planmine SMEST
Match: SMESG000023131.1 (SMESG000023131.1)

HSP 1 Score: 312.768 bits (800), Expect = 1.040e-97
Identity = 179/255 (70.20%), Postives = 198/255 (77.65%), Query Frame = 2
Query: 1571 EDERDLSKLTLLELINIEPRLPPPQSRLNKSNKRAGDSSDQNLELERIXXXXXXXXXXXXXXXXFRIDLDGQIVIDDEEDETNMQISTEGMEEIVENAADLRSSYRSYMKRRLSGKRWKAEETRNFYKALLAVKTDFTRMATIFKGRSRADLKKKFKVEEKLNSKLVYEILVSPVVCDISNLVIDSHLNQPTKHKKPRKDAVKRNLRGSTQSDSDVESVKPKPKRRYRKFDIKQAKLDPTATDLPDYLKAYEKIM 2335
            EDERD SKLTLLELINI+  LP    RL KSNKR+G++SD+N+ELE+IS SSQQKS +K KSKKFRIDLDGQIVIDD+EDETNMQI  E MEEIVENAADLR SYR   K RLSGKRW AEET NFY ALL VKTDFTRMAT+FKGRSRADLKKKFKVEEK N + V +IL + + CDISNLVIDSHLN PTK KKP             QS  D ES   KPKRRYRKFDIK+A LDP+A DLPDY K ++  +
Sbjct:  145 EDERDPSKLTLLELINIDLPLPHTPPRLKKSNKRSGNNSDRNMELEQISGSSQQKSIDKQKSKKFRIDLDGQIVIDDDEDETNMQIGIEAMEEIVENAADLRMSYRDQRKHRLSGKRWNAEETSNFYLALLYVKTDFTRMATVFKGRSRADLKKKFKVEEKANLEFVDKILEAQLDCDISNLVIDSHLNPPTKRKKPGY---------YFQSSRDEES--DKPKRRYRKFDIKKANLDPSAGDLPDYFKPFKNYI 388          
BLAST of Myb_DNA-bind_7 domain-containing protein vs. Planmine SMEST
Match: SMESG000023131.1 (SMESG000023131.1)

HSP 1 Score: 312.383 bits (799), Expect = 1.928e-97
Identity = 179/255 (70.20%), Postives = 198/255 (77.65%), Query Frame = 2
Query: 1571 EDERDLSKLTLLELINIEPRLPPPQSRLNKSNKRAGDSSDQNLELERIXXXXXXXXXXXXXXXXFRIDLDGQIVIDDEEDETNMQISTEGMEEIVENAADLRSSYRSYMKRRLSGKRWKAEETRNFYKALLAVKTDFTRMATIFKGRSRADLKKKFKVEEKLNSKLVYEILVSPVVCDISNLVIDSHLNQPTKHKKPRKDAVKRNLRGSTQSDSDVESVKPKPKRRYRKFDIKQAKLDPTATDLPDYLKAYEKIM 2335
            EDERD SKLTLLELINI+  LP    RL KSNKR+G++SD+N+ELE+IS SSQQKS +K KSKKFRIDLDGQIVIDD+EDETNMQI  E MEEIVENAADLR SYR   K RLSGKRW AEET NFY ALL VKTDFTRMAT+FKGRSRADLKKKFKVEEK N + V +IL + + CDISNLVIDSHLN PTK KKP             QS  D ES   KPKRRYRKFDIK+A LDP+A DLPDY K ++  +
Sbjct:  145 EDERDPSKLTLLELINIDLPLPHTPPRLKKSNKRSGNNSDRNMELEQISGSSQQKSIDKQKSKKFRIDLDGQIVIDDDEDETNMQIGIEAMEEIVENAADLRMSYRDQRKHRLSGKRWNAEETSNFYLALLYVKTDFTRMATVFKGRSRADLKKKFKVEEKANLEFVDKILEAQLDCDISNLVIDSHLNPPTKRKKPGY---------YFQSSRDEES--DKPKRRYRKFDIKKANLDPSAGDLPDYFKPFKNYI 388          
The following BLAST results are available for this feature:
BLAST of Myb_DNA-bind_7 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BDP12.261e-634.62B double prime 1, subunit of RNA polymerase III tr... [more]
BDP12.300e-634.62B double prime 1, subunit of RNA polymerase III tr... [more]
BDP12.300e-634.62B double prime 1, subunit of RNA polymerase III tr... [more]
BDP15.427e-634.95B double prime 1, subunit of RNA polymerase III tr... [more]
BDP15.520e-634.95B double prime 1, subunit of RNA polymerase III tr... [more]
back to top
BLAST of Myb_DNA-bind_7 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
B0261.11.492e-633.59pep chromosome:WBcel235:I:5263694:5268380:1 gene:W... [more]
back to top
BLAST of Myb_DNA-bind_7 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Bdp15.846e-1225.74gene:FBgn0032512 transcript:FBtr0080471[more]
Bdp16.020e-1225.74gene:FBgn0032512 transcript:FBtr0342639[more]
back to top
BLAST of Myb_DNA-bind_7 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Myb_DNA-bind_7 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSXETT00000044453.15.472e-834.91B double prime 1, subunit of RNA polymerase III tr... [more]
ENSXETT00000044513.16.224e-834.91B double prime 1, subunit of RNA polymerase III tr... [more]
back to top
BLAST of Myb_DNA-bind_7 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Bdp16.569e-734.62B double prime 1, subunit of RNA polymerase III tr... [more]
Bdp16.912e-734.62B double prime 1, subunit of RNA polymerase III tr... [more]
back to top
BLAST of Myb_DNA-bind_7 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|O94481|TFC5_SCHPO1.065e-633.64Transcription factor TFIIIB component B'' OS=Schiz... [more]
sp|Q571C7|BDP1_MOUSE4.595e-634.62Transcription factor TFIIIB component B'' homolog ... [more]
back to top
BLAST of Myb_DNA-bind_7 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A448XGC32.315e-1341.32SANT domain-containing protein (Fragment) OS=Proto... [more]
A0A1B6ETC77.840e-1338.52SANT domain-containing protein (Fragment) OS=Cuern... [more]
A0A1I8G7M99.073e-1340.71Myb_DNA-bind_7 domain-containing protein OS=Macros... [more]
A0A158RF029.110e-1335.21Myb_DNA-bind_7 domain-containing protein OS=Hydati... [more]
A0A1I8GWI49.201e-1345.35Myb_DNA-bind_7 domain-containing protein OS=Macros... [more]
back to top
BLAST of Myb_DNA-bind_7 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
si:ch211-204c21.12.420e-633.33si:ch211-204c21.1 [Source:ZFIN;Acc:ZDB-GENE-030429... [more]
ENSAMXT00000053151.13.847e-630.28transcription factor TFIIIB component B'' homolog ... [more]
ENSAMXT00000046411.13.847e-630.28transcription factor TFIIIB component B'' homolog ... [more]
ENSAMXT00000017002.25.050e-630.28transcription factor TFIIIB component B'' homolog ... [more]
back to top
BLAST of Myb_DNA-bind_7 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Myb_DNA-bind_7 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
BDP15.549e-733.66Essential subunit of RNA polymerase III transcript... [more]
back to top
BLAST of Myb_DNA-bind_7 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Myb_DNA-bind_7 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSORLT00000003629.25.460e-733.65transcription factor TFIIIB component B'' homolog ... [more]
ENSORLT00000042388.16.021e-733.65transcription factor TFIIIB component B'' homolog ... [more]
ENSORLT00000045898.16.167e-733.65transcription factor TFIIIB component B'' homolog ... [more]
back to top
BLAST of Myb_DNA-bind_7 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000016335.11.952e-785.29SMESG000016335.1[more]
SMESG000016302.15.732e-15098.19SMESG000016302.1[more]
SMESG000023131.17.971e-9871.31SMESG000023131.1[more]
SMESG000023131.11.040e-9770.20SMESG000023131.1[more]
SMESG000023131.11.928e-9770.20SMESG000023131.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019272 ID=SMED30019272|Name=Myb_DNA-bind_7 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2572bp
TTTATATATTATATAATTAATATTTAAATATTAATTTTTGATGAATTTAA
ATTGAATGCTGCGATTAAGAAAAATAATAGTGAATCTAAAGATCACTTTA
AAACGGTTGTTGACGTTATTAACGAATACCAAAACAATTCTTTACCGGGT
GAACTAAAAATTTTATCATCTCAATTTGAGCAAACAAATGAAACGAATGT
AAAAATTATAATTCGTTCATCAGTTTTAAATTTTGAAGTAAAAGAATAAA
ATCTATCTCAATCCAATCAATCTAAAGCTTTTTCATTCACAACAAAATTT
AAATTTAAAAATGCAGTAAATAAAACTAACAAAAAAGTCGATTAATGAAA
CAAATGATCAAATTTTTTCTGAGAAATGAATTTTGCGAAACGAATCTGAT
GGAAATGATTTTCAGGAAATTCCAGTTGTTAAAAACATTGAAATTTTGAG
AAATGTGAATGAGAAGCAAGATAAGAATCTTTCGGATTACTAGGAAGGGA
TTTGCACAGAACCAAACGAAACAGTAACAAACTTGATGACCCTGAGAGCG
GTGAAAACTACCATTAACACACAAAGCAGCGGTGATGAAGAAGCCAGCGA
GTTCGACAATAACAACAAAGGAATCATCGGAATAAGATTGAAATCTCATT
GTAACGGGAACGACCGGATATTGTCCAAAAATGGGGAGAGAAATCCAAAT
GAAAATGGCATGTCAAACAAAGTTGCCAGCTCCCAATCAGGCTCGTTGCC
AAGGACTAATTGTAACAGCAATCCGCATTGGCCGCCCGGAAATCCTAACA
GTAAAAAATATCTCAAGAGAAGAAGAGAATCGGCTGTCGATAAGGCGTAT
GGTGCAACTGGCACCACTCGACCCTCTGAAAGGAATTCCAAACCAAGGAA
AAGTGCGAGATTATCAAAGTTATCAATCAATATCAGTGACAATCACTCAG
AAACACCCGATAGCGACAATATTACCATTGACTCTCTACAAAACCTTCAA
ATCCCAGACGTTCCCATAGAATCACTGGATAGCCCCGGCACTACACATCG
ATCACTACCGAGAGAAAAAAGTCCCAAAATTACCGTTGAATCATCAGATA
GCCTCAAAGTTACCCCAGACGCGCCACACACACCTGAGTGCCACAAACCA
ACCGAAAAATCGATTATCCCCCTCAGCCCGCCCGTCGCGACGGCTACAAT
GAAATTCAACCTGAAAAATGCGGTCAACAAATCCGCAGTTGCGGTGGCCC
CCCCAAAACCGACCACAGAGATCCAGATTCATCTCAGTGATATCTGCACC
TCGAGCAAATCAAACGCCATCGTTCCGTTCGTAACCAATTCGAATCTTCC
GCTATTCAAATCACCGGAAAAAGCGAGTAAAATCATCCGCCGAATGGCCT
GCCCGTCGGCCGTCCAATCAGAAACTGATGATAATTTGTCAACGTGCTCA
AGCCGCATCTCAGAGGCATCGTCTGCCAACCGTCTCCATGGCAACAGCGA
GAGCAGCAATGGTAATAGAAAGCGGAAGGAGAAATCATTCGTATTGAAGC
GACACTCAGAGCTCCGAGCTGAAGATGAGCGGGATCTGAGCAAACTGACG
CTGCTAGAGCTGATCAATATCGAGCCGCGGCTGCCTCCCCCGCAGTCGCG
ATTAAATAAGTCCAACAAACGGGCTGGAGATAGTTCTGATCAGAATCTGG
AACTCGAGCGAATCTCCAGCAGCAGCCAACAGAAATCTGCCAACAAATCA
AAATCGAAGAAATTCCGAATCGATCTGGACGGACAAATCGTAATCGACGA
TGAAGAGGACGAGACAAACATGCAAATCAGCACTGAGGGAATGGAGGAAA
TTGTCGAGAATGCTGCTGACCTCAGATCGAGTTATCGCAGCTACATGAAA
CGGCGCCTTTCAGGCAAGCGCTGGAAGGCCGAGGAGACGAGAAATTTCTA
TAAAGCTCTTTTGGCTGTGAAAACTGATTTCACTCGCATGGCAACCATTT
TCAAGGGCAGGAGCCGCGCAGACTTGAAGAAAAAGTTCAAAGTTGAAGAG
AAACTCAATTCGAAACTTGTCTACGAAATATTAGTGAGTCCGGTCGTGTG
CGACATATCAAATCTAGTTATTGACTCTCACCTGAATCAGCCAACGAAAC
ATAAAAAACCTAGAAAGGATGCTGTTAAGAGAAATTTGCGAGGTTCCACT
CAGTCGGACAGTGATGTAGAATCCGTCAAACCAAAACCGAAGAGGCGATA
TAGGAAATTTGATATAAAACAAGCAAAGCTCGACCCGACTGCAACAGATT
TGCCAGATTATTTAAAGGCCTATGAGAAGATAATGAAATAATTTACTAAT
AAAATGTCTATTTTTTCTCTAATTTGTTTGAAACTGATTGGTGGAATTTG
CAAATTTTTTGACTAATCATCTGCCTGTGTTTTGATTGGCTGATATGTTA
TGATGTAATAGTTGTCCAATGATGTAATAATTATCTAATAATGAAAACGT
TTTTTCAAATGAAATTTATCAGGCCAATCAAGTTCTTTTGTTTCGTGATA
TGCTTGTTTATTTATGCCCTAC
back to top

protein sequence of SMED30019272-orf-1

>SMED30019272-orf-1 ID=SMED30019272-orf-1|Name=SMED30019272-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=602bp
MTLRAVKTTINTQSSGDEEASEFDNNNKGIIGIRLKSHCNGNDRILSKNG
ERNPNENGMSNKVASSQSGSLPRTNCNSNPHWPPGNPNSKKYLKRRRESA
VDKAYGATGTTRPSERNSKPRKSARLSKLSINISDNHSETPDSDNITIDS
LQNLQIPDVPIESLDSPGTTHRSLPREKSPKITVESSDSLKVTPDAPHTP
ECHKPTEKSIIPLSPPVATATMKFNLKNAVNKSAVAVAPPKPTTEIQIHL
SDICTSSKSNAIVPFVTNSNLPLFKSPEKASKIIRRMACPSAVQSETDDN
LSTCSSRISEASSANRLHGNSESSNGNRKRKEKSFVLKRHSELRAEDERD
LSKLTLLELINIEPRLPPPQSRLNKSNKRAGDSSDQNLELERISSSSQQK
SANKSKSKKFRIDLDGQIVIDDEEDETNMQISTEGMEEIVENAADLRSSY
RSYMKRRLSGKRWKAEETRNFYKALLAVKTDFTRMATIFKGRSRADLKKK
FKVEEKLNSKLVYEILVSPVVCDISNLVIDSHLNQPTKHKKPRKDAVKRN
LRGSTQSDSDVESVKPKPKRRYRKFDIKQAKLDPTATDLPDYLKAYEKIM
K*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR039467TFIIIB_B''_Myb
IPR009057Homeobox-like_sf
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0001026TFIIIB-type transcription factor activity
Vocabulary: cellular component
TermDefinition
GO:0000126transcription factor TFIIIB complex
Vocabulary: biological process
TermDefinition
GO:0006359regulation of transcription from RNA polymerase III promoter
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR039467Transcription factor TFIIIB component B'', Myb domainPFAMPF15963Myb_DNA-bind_7coord: 452..527
e-value: 6.2E-18
score: 64.5
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 387..403
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 292..333
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..20
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 367..408
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 47..85
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 47..144
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 293..322
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..23
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 535..570
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 124..144
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 161..211
NoneNo IPR availablePANTHERPTHR22929RNA POLYMERASE III TRANSCRIPTION INITIATION FACTOR Bcoord: 44..540
NoneNo IPR availablePANTHERPTHR22929:SF0TRANSCRIPTION FACTOR TFIIIB COMPONENT B'' HOMOLOGcoord: 44..540
IPR009057Homeobox-like domain superfamilySUPERFAMILYSSF46689Homeodomain-likecoord: 446..505