DUF3421 domain-containing protein

Overview
NameDUF3421 domain-containing protein
Smed IDSMED30019264
Length (bp)675
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DUF3421 domain-containing protein (SMED30019264) t-SNE clustered cells

Violin plots show distribution of expression levels for DUF3421 domain-containing protein (SMED30019264) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DUF3421 domain-containing protein (SMED30019264) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DUF3421 domain-containing protein (SMED30019264) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019264

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30019264SMESG000029906.1 dd_Smed_v4_2061_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30019264SMESG000029906.1 dd_Smed_v4_2061_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DUF3421 domain-containing protein vs. Ensembl Fly
Match: CG13321 (gene:FBgn0033787 transcript:FBtr0345371)

HSP 1 Score: 98.9821 bits (245), Expect = 1.051e-24
Identity = 54/137 (39.42%), Postives = 76/137 (55.47%), Query Frame = 3
Query:  234 GHIPNDSVNAGNS------YIARAVYNGEYIPGKIVRGENCAYICYDGKEISCSEYEVLVDTHNFGGQAYEW-KSTRGSVITKGSVIGGSDEGRPLYIGRARVANKLLAGKFQPEHGCTYIPYDSQENRKEDYDVLC 623
            G +P  ++ AG+       ++ RA +NGE +P K+V G+  AY+ + G+EIS  ++EVLV  H      + W  S+ GSV      +G + EG PLY+GR      L  GK  P H C YIPY  QE+R E Y+VL 
Sbjct:   13 GSLPPGAILAGHDSDQDPIFVGRAYHNGEMLPAKVVPGKQQAYVPWGGQEISKHDFEVLVGDH------FSWIPSSGGSVPPHAIQVGQTGEGEPLYVGRGYFQGSLTPGKVHPSHQCLYIPYGGQEHRLEAYEVLV 143          

HSP 2 Score: 91.2781 bits (225), Expect = 7.367e-22
Identity = 51/145 (35.17%), Postives = 70/145 (48.28%), Query Frame = 3
Query:  210 LSWQKASNGHIPNDSVNAGNS------YIARAVYNGEYIPGKIVRGENCAYICYDGKEISCSEYEVLVDTHNFGGQAYEWKSTRGSVITKGSVIGGSD-EGRPLYIGRARVANKLLAGKFQPEHGCTYIPYDSQENRKEDYDVLC 623
             SW  +S G +P  ++  G +      Y+ R  + G   PGK+     C YI Y G+E     YEVLV       Q   W ++ G  I  G+V+GG D +G  +Y+GRA     LL  K  P  GC Y+PY   E  K DY++L 
Sbjct:   76 FSWIPSSGGSVPPHAIQVGQTGEGEPLYVGRGYFQGSLTPGKVHPSHQCLYIPYGGQEHRLEAYEVLV-------QPETWIASSGRGIVPGTVVGGHDADGDQIYVGRAYHEGDLLPAKVIPNKGCAYVPYGGGEVVKHDYELLA 213          

HSP 3 Score: 83.1889 bits (204), Expect = 8.689e-19
Identity = 42/118 (35.59%), Postives = 63/118 (53.39%), Query Frame = 3
Query:  273 YIARAVYNGEYIPGKIVRGENCAYICYDGKEISCSEYEVLVDTHNFGGQAYEW-KSTRGSVITKGSVIGGSDEGRPLYIGRARVANKLLAGKFQPEHGCTYIPYDSQENRKEDYDVLC 623
            Y+ RA + G+ +P K++  + CAY+ Y G E+   +YE+L       G  Y W   + G+V     + G + +G PL+IGRA     L  GK    H C YIP+D +E R + Y+VL 
Sbjct:  173 YVGRAYHEGDLLPAKVIPNKGCAYVPYGGGEVVKHDYELLA------GYGYGWVHDSHGNVPGNAVLCGRTSDGEPLFIGRAHHHGSLTPGKIHQSHHCLYIPFDGEEVRIDHYEVLV 284          

HSP 4 Score: 51.9878 bits (123), Expect = 1.023e-7
Identity = 25/66 (37.88%), Postives = 39/66 (59.09%), Query Frame = 3
Query:  216 WQKASNGHIPNDSVNAGNS------YIARAVYNGEYIPGKIVRGENCAYICYDGKEISCSEYEVLV 395
            W   S+G++P ++V  G +      +I RA ++G   PGKI +  +C YI +DG+E+    YEVLV
Sbjct:  219 WVHDSHGNVPGNAVLCGRTSDGEPLFIGRAHHHGSLTPGKIHQSHHCLYIPFDGEEVRIDHYEVLV 284          
BLAST of DUF3421 domain-containing protein vs. Ensembl Fly
Match: CG13321 (gene:FBgn0033787 transcript:FBtr0087792)

HSP 1 Score: 98.9821 bits (245), Expect = 1.051e-24
Identity = 54/137 (39.42%), Postives = 76/137 (55.47%), Query Frame = 3
Query:  234 GHIPNDSVNAGNS------YIARAVYNGEYIPGKIVRGENCAYICYDGKEISCSEYEVLVDTHNFGGQAYEW-KSTRGSVITKGSVIGGSDEGRPLYIGRARVANKLLAGKFQPEHGCTYIPYDSQENRKEDYDVLC 623
            G +P  ++ AG+       ++ RA +NGE +P K+V G+  AY+ + G+EIS  ++EVLV  H      + W  S+ GSV      +G + EG PLY+GR      L  GK  P H C YIPY  QE+R E Y+VL 
Sbjct:   13 GSLPPGAILAGHDSDQDPIFVGRAYHNGEMLPAKVVPGKQQAYVPWGGQEISKHDFEVLVGDH------FSWIPSSGGSVPPHAIQVGQTGEGEPLYVGRGYFQGSLTPGKVHPSHQCLYIPYGGQEHRLEAYEVLV 143          

HSP 2 Score: 91.2781 bits (225), Expect = 7.367e-22
Identity = 51/145 (35.17%), Postives = 70/145 (48.28%), Query Frame = 3
Query:  210 LSWQKASNGHIPNDSVNAGNS------YIARAVYNGEYIPGKIVRGENCAYICYDGKEISCSEYEVLVDTHNFGGQAYEWKSTRGSVITKGSVIGGSD-EGRPLYIGRARVANKLLAGKFQPEHGCTYIPYDSQENRKEDYDVLC 623
             SW  +S G +P  ++  G +      Y+ R  + G   PGK+     C YI Y G+E     YEVLV       Q   W ++ G  I  G+V+GG D +G  +Y+GRA     LL  K  P  GC Y+PY   E  K DY++L 
Sbjct:   76 FSWIPSSGGSVPPHAIQVGQTGEGEPLYVGRGYFQGSLTPGKVHPSHQCLYIPYGGQEHRLEAYEVLV-------QPETWIASSGRGIVPGTVVGGHDADGDQIYVGRAYHEGDLLPAKVIPNKGCAYVPYGGGEVVKHDYELLA 213          

HSP 3 Score: 83.1889 bits (204), Expect = 8.689e-19
Identity = 42/118 (35.59%), Postives = 63/118 (53.39%), Query Frame = 3
Query:  273 YIARAVYNGEYIPGKIVRGENCAYICYDGKEISCSEYEVLVDTHNFGGQAYEW-KSTRGSVITKGSVIGGSDEGRPLYIGRARVANKLLAGKFQPEHGCTYIPYDSQENRKEDYDVLC 623
            Y+ RA + G+ +P K++  + CAY+ Y G E+   +YE+L       G  Y W   + G+V     + G + +G PL+IGRA     L  GK    H C YIP+D +E R + Y+VL 
Sbjct:  173 YVGRAYHEGDLLPAKVIPNKGCAYVPYGGGEVVKHDYELLA------GYGYGWVHDSHGNVPGNAVLCGRTSDGEPLFIGRAHHHGSLTPGKIHQSHHCLYIPFDGEEVRIDHYEVLV 284          

HSP 4 Score: 51.9878 bits (123), Expect = 1.023e-7
Identity = 25/66 (37.88%), Postives = 39/66 (59.09%), Query Frame = 3
Query:  216 WQKASNGHIPNDSVNAGNS------YIARAVYNGEYIPGKIVRGENCAYICYDGKEISCSEYEVLV 395
            W   S+G++P ++V  G +      +I RA ++G   PGKI +  +C YI +DG+E+    YEVLV
Sbjct:  219 WVHDSHGNVPGNAVLCGRTSDGEPLFIGRAHHHGSLTPGKIHQSHHCLYIPFDGEEVRIDHYEVLV 284          
BLAST of DUF3421 domain-containing protein vs. Ensembl Fly
Match: CG31086 (gene:FBgn0051086 transcript:FBtr0084989)

HSP 1 Score: 93.2041 bits (230), Expect = 7.676e-24
Identity = 55/143 (38.46%), Postives = 73/143 (51.05%), Query Frame = 3
Query:  213 SWQKASNGHIPNDSVNAGNS------YIARAVYNGEYIPGKIVRGENCAYICYDGKEISCSEYEVLVDTHNFGGQAYEWKSTRGSVITKGSV-IGGSDEGRPLYIGRARVANKLLAGKFQPEHGCTYIPYDSQENRKEDYDVL 620
            SW   SNG IP  +V AG+       +I RA Y  + +P KI+  +  AY+ Y  +E+    YEVL       G  YEW       +  G+V +G + +G  LY GR   A  L  GK  P HGC YIPYDS+E +   Y+VL
Sbjct:    5 SWLHFSNGAIPQAAVVAGHDSDGDTIFIGRAFYCNDMLPAKIIPNKGKAYVAYANQEVELENYEVL------SGFNYEWLPAENGEVPPGAVKVGQNVDGETLYAGRGYHAGSLTVGKVHPSHGCLYIPYDSEEVKIFAYEVL 141          
BLAST of DUF3421 domain-containing protein vs. Ensembl Fly
Match: CG31086 (gene:FBgn0051086 transcript:FBtr0307341)

HSP 1 Score: 93.2041 bits (230), Expect = 7.676e-24
Identity = 55/143 (38.46%), Postives = 73/143 (51.05%), Query Frame = 3
Query:  213 SWQKASNGHIPNDSVNAGNS------YIARAVYNGEYIPGKIVRGENCAYICYDGKEISCSEYEVLVDTHNFGGQAYEWKSTRGSVITKGSV-IGGSDEGRPLYIGRARVANKLLAGKFQPEHGCTYIPYDSQENRKEDYDVL 620
            SW   SNG IP  +V AG+       +I RA Y  + +P KI+  +  AY+ Y  +E+    YEVL       G  YEW       +  G+V +G + +G  LY GR   A  L  GK  P HGC YIPYDS+E +   Y+VL
Sbjct:    5 SWLHFSNGAIPQAAVVAGHDSDGDTIFIGRAFYCNDMLPAKIIPNKGKAYVAYANQEVELENYEVL------SGFNYEWLPAENGEVPPGAVKVGQNVDGETLYAGRGYHAGSLTVGKVHPSHGCLYIPYDSEEVKIFAYEVL 141          
BLAST of DUF3421 domain-containing protein vs. Ensembl Fly
Match: CG32633 (gene:FBgn0052633 transcript:FBtr0073800)

HSP 1 Score: 93.2041 bits (230), Expect = 1.496e-22
Identity = 54/149 (36.24%), Postives = 77/149 (51.68%), Query Frame = 3
Query:  216 WQKASNGHIPNDSVNAGNS------YIARAVYNGEYIPGKIVRGENCAYICYDGKEISCSEYEVLVDTHNFGGQAYEWKSTRGSVITKGSV-IGGSDEGRPLYIGRARVANKLLAGKFQPEHGCTYIPYDSQENRKEDYDVLCFLKRRV 641
            W   SNG +P ++V AG+       Y+ RA ++ + +P K++  +  AY+ Y  +E     YEVL       G  YEW S     +  G+V +G + +G  LY GR   A  L  GK  P HGC YIPYDS E +   Y+VLC  +R +
Sbjct:    6 WMHFSNGSVPPNAVVAGHDSDGDTIYVGRAFFSNDMLPAKVIPNKGKAYVAYAREEHELENYEVL------SGYNYEWLSAENGEVPPGAVKVGRNVDGEYLYAGRGYHAGSLTMGKVHPSHGCLYIPYDSDEVKIFAYEVLCQPERWI 148          

HSP 2 Score: 73.9442 bits (180), Expect = 2.181e-15
Identity = 45/143 (31.47%), Postives = 71/143 (49.65%), Query Frame = 3
Query:  216 WQKASNGHIPNDSVNAGNS------YIARAVYNGEYIPGKIVRGENCAYICYDGKEISCSEYEVLVDTHNFGGQAYEWKSTRGSVITKGSVIGGSD-EGRPLYIGRARVANKLLAGKFQPEHGCTYIPYDSQENRKEDYDVLC 623
            W   +  +IP+ ++ AG+       Y+ R   NG+ +P K+V  +  AY  Y   E   ++ +VL       G  + W       +  G++  G + +G PLY+GRA   + L  GK  P HGC YIP+  +E R E+Y+VL 
Sbjct:  147 WIDTTATNIPDGALVAGHDSNGDTIYVGRVFRNGDLLPAKVVPAKGKAYAAYAQAEHELTDVQVLT------GSGFRWVPASHGNVAPGALSSGPNVDGEPLYVGRAIYCDSLSVGKIHPSHGCIYIPFGGEEVRLENYEVLV 283          
BLAST of DUF3421 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q66S13|NATT4_THANI (Natterin-4 OS=Thalassophryne nattereri OX=289382 PE=2 SV=1)

HSP 1 Score: 51.2174 bits (121), Expect = 2.324e-6
Identity = 44/144 (30.56%), Postives = 64/144 (44.44%), Query Frame = 3
Query:  210 LSWQKASNGHIPNDSVNAGNSYIARAVY-------NGEYIPGKIVRGENCAYICYDGKEISCSEYEVLVDTHNFGGQAYEWKSTRGSVITKGSVIGGSDEGRPLYIGRARVANKLLAGKFQPEHGCTYIPYDSQENRKEDYDVL 620
            L W +  NGHIP+++V   N+Y+ R  Y        G Y P K   G +C Y  Y   E     + +LV+  NF  +  EWK   G  + + +V    D    LY+ +    NK   GK    H   Y+P+   E +  +Y VL
Sbjct:   76 LEWVRW-NGHIPSNAVKISNTYVGREDYVCRVGCEAGYYTPKK---GPSCFYP-YGFTEQHSKMFHILVNRDNF--EILEWKWKTGGEVPENAVKACRD----LYVAK----NKYGLGKLHQSHHVFYLPWKGTEYKYNEYYVL 204          
BLAST of DUF3421 domain-containing protein vs. TrEMBL
Match: A0A1I8I9L7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig020479g1 PE=4 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 5.618e-34
Identity = 66/162 (40.74%), Postives = 98/162 (60.49%), Query Frame = 3
Query:  165 MSKVKSAAGKGIEISLSWQKASNGHIPNDSVN-AGNSYIARAVYNGEYIPGKIVRGENCAYICYDGKEISCSEYEVLVDTHNFG---GQAYEWKSTRGSVITKGSVIGGSDEGRPLYIGRARVANKLLAGKFQPEHGCTYIPYDSQENRKE-DYDVLCFLKR 635
            MS  KS+ GKG+++ LSW  A+NG IP  +V+  G+ ++AR   +GE +PGK+  G N  Y  YDG+E  C  Y+VL +T N G   G  +EW +  G+   K ++I GSD+GRPLY+ +A +  +  AGK+ P++G  Y      E+ KE D++VL    R
Sbjct:    1 MSTFKSSGGKGVDLCLSWVNAANGEIPAGAVSIGGDVFVARCFSDGELLPGKVAAGHNSCYAPYDGEEKCCDTYQVLCETCNHGLTGGPGFEWVAWSGNTAPKHALISGSDQGRPLYVAKANIDGEWCAGKYIPDYGKAYFSCGGAEHEKEDDFEVLVMCTR 162          
BLAST of DUF3421 domain-containing protein vs. TrEMBL
Match: A0A1I8H8B2 (DUF3421 domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig012514g1 PE=4 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 1.973e-31
Identity = 65/155 (41.94%), Postives = 96/155 (61.94%), Query Frame = 3
Query:  165 MSKVKSAAGKGIEISLSWQKASNGHIPNDSVNAG-NSYIARAVYNGEYIPGKIVRGENCAYICYDGKEISCSEYEVLVDTH-NFGGQAYEWKSTRGSVITKGSVIGGSDEGRPLYIGRARVANKLLAGKFQPEHGCTYIPYDSQENR-KEDYDVL 620
            MS+V     +GIE+ LSW  ASNG IP  +V AG + Y+ARA + GE++PGK+  G   AY+ Y  +E+  SEYEVLV +     G  Y+W   +G+ + KG+++ G D G PLY+ RA    ++  GK QP+  C YI +  +E++  +DY+VL
Sbjct:    1 MSRVNHNDIEGIELCLSWHPASNGDIPAGAVKAGEDCYVARAKHEGEWVPGKLSAGHTSAYVPYGDEEVPYSEYEVLVSSEIGHFGCGYQWLPAKGNSVPKGALVSGYDNGAPLYVARATFEGEVCCGKAQPDLECAYISWGGKEHKIVDDYEVL 155          
BLAST of DUF3421 domain-containing protein vs. TrEMBL
Match: Q5DHE4 (SJCHGC04453 protein OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 4.991e-31
Identity = 62/151 (41.06%), Postives = 92/151 (60.93%), Query Frame = 3
Query:  189 GKGIEISLSWQKASNGHIPNDSVN-AGNSYIARAVYNGEYIPGKIVRGENCAYICYDGKEISCSEYEVLVDTHNFG-GQAYEWKSTRGSVITKGSVIGGSDEGRPLYIGRARVANKLLAGKFQPEHGCTYIPYDSQENRKEDYDVLCFLKR 635
            GKGI+I LSW  A++G++P++++N +G+ Y+ R+ ++G +IPGK V G N AY   +G+EI   EYEVL DT   G  + YEW+S  G  + K ++I G     PLYI R  V  ++  GK    H C Y P+   E+   DY+VL + K+
Sbjct:    5 GKGIQIPLSWVPATDGNVPHNAINVSGDIYVIRSKHDGHWIPGKAVIGHNTAYYPMNGQEIKTREYEVLCDTSLSGHNKGYEWESESGGNVPKNAIIAGMSGNDPLYIARGSVNGEVCVGKVHYGHNCAYFPWGGNEHSVNDYEVLVWKKK 155          
BLAST of DUF3421 domain-containing protein vs. TrEMBL
Match: A0A267GMN7 (DUF3421 domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig020417g1 PE=4 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 2.050e-30
Identity = 59/151 (39.07%), Postives = 94/151 (62.25%), Query Frame = 3
Query:  183 AAGKGIEISLSWQKASNGHIPNDSVNAGNS-YIARAVYNGEYIPGKIVRGENCAYICYDGKEISCSEYEVLVDTH-NFGGQAYEWKSTRGSVITKGSVIGG-SDEGRPLYIGRARVANKLLAGKFQPEHGCTYIPYDSQENRKEDYDVLCF 626
            A+G   +++LSW  A  G IPN ++  G+  ++ARA + GE IPGK   G + AY+ Y G+E + S+YE+L DTH    G  Y W+   G  + +G++IGG S + +P YIGR+++  +++AGK    HGC Y P+  QE+R  ++++L  
Sbjct:   14 ASGGNPQVTLSWIPARGGQIPNGAIQVGHGVFVARAQHAGELIPGKASMGHHAAYVSYGGQEHAVSDYEILCDTHMQCFGCNYTWERCHGRSVPRGALIGGYSADRKPYYIGRSQINGEMVAGKVFEPHGCAYFPWGGQEHRSNEFEILVL 164          
BLAST of DUF3421 domain-containing protein vs. TrEMBL
Match: A0A1I8H2V3 (DUF3421 domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 3.627e-30
Identity = 59/151 (39.07%), Postives = 93/151 (61.59%), Query Frame = 3
Query:  183 AAGKGIEISLSWQKASNGHIPNDSVNAGNS-YIARAVYNGEYIPGKIVRGENCAYICYDGKEISCSEYEVLVDTH-NFGGQAYEWKSTRGSVITKGSVIGG-SDEGRPLYIGRARVANKLLAGKFQPEHGCTYIPYDSQENRKEDYDVLCF 626
            A+G   +++LSW  A  G IPN ++  G+  ++ARA + GE IPGK   G   AY+ Y G+E + S+YE+L DTH    G  Y W+   G  + +G++IGG S + +P YIGR+++  +++AGK    HGC Y P+  QE+R  ++++L  
Sbjct:   14 ASGGNPQVTLSWIPARGGQIPNGAIQVGHGVFVARAQHAGELIPGKASMGHQAAYVSYGGQEHAVSDYEILCDTHMQCFGCNYTWERCHGRSVPRGALIGGYSADRQPYYIGRSQINGEMVAGKVFEPHGCAYFPWGGQEHRSNEFEILVL 164          
BLAST of DUF3421 domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000055806.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000027.1:7684441:7697076:-1 gene:ENSAMXG00000043142.1 transcript:ENSAMXT00000055806.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 52.373 bits (124), Expect = 9.767e-8
Identity = 48/146 (32.88%), Postives = 66/146 (45.21%), Query Frame = 3
Query:  204 ISLSWQKASNGHIPNDSVNAGNSYIARAVY-------NGEYIPGKIVRGENCAYICYDGKEISCSEYEVLVDTHNFGGQAYEWKSTRGSVITKGSVIGGSDEGRPLYIGRARVANKLLAGKFQPEHGCTYIPYDSQENRKEDYDVL 620
            +SL W    NG +PN +VN  N Y  R  Y        G Y P K   G  C Y  Y   E   S++EVLV+   F  +  EW+S     +   SV   S     +Y+G+    NK   GK  P H   ++P++ +E   + YDVL
Sbjct:   50 VSLKWV-TWNGSLPNGAVNIYNGYTKRTDYICKYNCEAGFYTPSK---GPYC-YYPYADSEYPASKFEVLVNEDYF--EFLEWRSGSYGSVPPNSVRTCSRGD--IYVGK----NKYGLGKVVPRHEAFFLPWEGKEYWYKKYDVL 182          
BLAST of DUF3421 domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000043153.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000027.1:7684441:7688885:-1 gene:ENSAMXG00000043142.1 transcript:ENSAMXT00000043153.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.9878 bits (123), Expect = 1.193e-7
Identity = 48/146 (32.88%), Postives = 66/146 (45.21%), Query Frame = 3
Query:  204 ISLSWQKASNGHIPNDSVNAGNSYIARAVY-------NGEYIPGKIVRGENCAYICYDGKEISCSEYEVLVDTHNFGGQAYEWKSTRGSVITKGSVIGGSDEGRPLYIGRARVANKLLAGKFQPEHGCTYIPYDSQENRKEDYDVL 620
            +SL W    NG +PN +VN  N Y  R  Y        G Y P K   G  C Y  Y   E   S++EVLV+   F  +  EW+S     +   SV   S     +Y+G+    NK   GK  P H   ++P++ +E   + YDVL
Sbjct:   87 VSLKWV-TWNGSLPNGAVNIYNGYTKRTDYICKYNCEAGFYTPSK---GPYC-YYPYADSEYPASKFEVLVNEDYF--EFLEWRSGSYGSVPPNSVRTCSRGD--IYVGK----NKYGLGKVVPRHEAFFLPWEGKEYWYKKYDVL 219          
BLAST of DUF3421 domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000045654.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000027.1:7684441:7697076:-1 gene:ENSAMXG00000043142.1 transcript:ENSAMXT00000045654.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.9878 bits (123), Expect = 1.420e-7
Identity = 48/146 (32.88%), Postives = 66/146 (45.21%), Query Frame = 3
Query:  204 ISLSWQKASNGHIPNDSVNAGNSYIARAVY-------NGEYIPGKIVRGENCAYICYDGKEISCSEYEVLVDTHNFGGQAYEWKSTRGSVITKGSVIGGSDEGRPLYIGRARVANKLLAGKFQPEHGCTYIPYDSQENRKEDYDVL 620
            +SL W    NG +PN +VN  N Y  R  Y        G Y P K   G  C Y  Y   E   S++EVLV+   F  +  EW+S     +   SV   S     +Y+G+    NK   GK  P H   ++P++ +E   + YDVL
Sbjct:   78 VSLKWV-TWNGSLPNGAVNIYNGYTKRTDYICKYNCEAGFYTPSK---GPYC-YYPYADSEYPASKFEVLVNEDYF--EFLEWRSGSYGSVPPNSVRTCSRGD--IYVGK----NKYGLGKVVPRHEAFFLPWEGKEYWYKKYDVL 210          
BLAST of DUF3421 domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000027077.2 (natterin-3-like [Source:NCBI gene;Acc:103027322])

HSP 1 Score: 49.6766 bits (117), Expect = 8.212e-7
Identity = 48/154 (31.17%), Postives = 71/154 (46.10%), Query Frame = 3
Query:  195 GIEISLSWQKASNGHIPNDSVNAGNSYIARAVY-------NGEYIPGKIVRGENCAYICYDGKEISCSEYEVLVDTHNFGGQAYEWKS-TRGSVITKGSVIGGSDEGRPLYIGRARVANKLLAGKFQPEHGCTYIPYDSQENRKEDYDVLCFLK 632
            G  ++L+W  + +G +PN +V   N Y  R  Y        G Y P K   G  C Y  +  KE    E+EVLV+  NF  +  EWK+ + GSV        G   G  +++G+    NK   GK  P+    ++P++  E   + YDVL   K
Sbjct:   80 GDNVNLNWT-SWDGSLPNGAVGIYNGYTKRTDYICKYNCEAGFYTPSK---GPYCNY-AWGNKEYHAPEFEVLVNVDNF--EFLEWKAGSYGSVPNYAVRTCG---GIGIFVGK----NKYGLGKVVPQFEAFFLPWEGDEYWYKKYDVLAINK 219          
BLAST of DUF3421 domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000034725.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000027.1:7691520:7695470:-1 gene:ENSAMXG00000032799.1 transcript:ENSAMXT00000034725.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 49.2914 bits (116), Expect = 8.995e-7
Identity = 47/156 (30.13%), Postives = 64/156 (41.03%), Query Frame = 3
Query:  174 VKSAAGKGIEISLSWQKASNGHIPNDSVNAGNSYIARAVY-------NGEYIPGKIVRGENCAYICYDGKEISCSEYEVLVDTHNFGGQAYEWKSTRGSVITKGSVIGGSDEGRPLYIGRARVANKLLAGKFQPEHGCTYIPYDSQENRKEDYDVL 620
            V +   K   ++L W    NG +PN +V   NSY  R  Y        G Y P K   G  C Y  Y   E    ++EVLV+   F  +  EWKS     +   SV               R  NK   GK  P+H   ++P++ +E   + YDVL
Sbjct:   16 VSAPRRKSDNVNLKWV-TWNGLLPNGAVKIYNSYTERTEYICKSDCEAGFYTPSK---GPYC-YYPYGDSEYLALKFEVLVNEDYF--EFLEWKSGSWGSVPPNSV---------------RTCNKYGLGKVHPKHEAFFLPWEGKEYWYKWYDVL 149          
BLAST of DUF3421 domain-containing protein vs. Planmine SMEST
Match: SMESG000029906.1 (SMESG000029906.1)

HSP 1 Score: 322.398 bits (825), Expect = 8.170e-114
Identity = 156/159 (98.11%), Postives = 158/159 (99.37%), Query Frame = 3
Query:  165 MSKVKSAAGKGIEISLSWQKASNGHIPNDSVNAGNSYIARAVYNGEYIPGKIVRGENCAYICYDGKEISCSEYEVLVDTHNFGGQAYEWKSTRGSVITKGSVIGGSDEGRPLYIGRARVANKLLAGKFQPEHGCTYIPYDSQENRKEDYDVLCFLKRRV 641
            MSKVKSAAGKGIEISLSWQKASNGHIPNDSVNAGNSYIARAVYNGEYIPGKIVRGENCAYICYDGKEISCSEYEVLVDTHNFGGQAYEWKS+RGSVI KGSVIGGSDEGRPLYIGRARVA+KLLAGKFQPEHGCTYIPYDSQENRKEDYDVLCFLKRRV
Sbjct:    1 MSKVKSAAGKGIEISLSWQKASNGHIPNDSVNAGNSYIARAVYNGEYIPGKIVRGENCAYICYDGKEISCSEYEVLVDTHNFGGQAYEWKSSRGSVIPKGSVIGGSDEGRPLYIGRARVADKLLAGKFQPEHGCTYIPYDSQENRKEDYDVLCFLKRRV 159          
BLAST of DUF3421 domain-containing protein vs. Planmine SMEST
Match: SMESG000029910.1 (SMESG000029910.1)

HSP 1 Score: 163.696 bits (413), Expect = 3.887e-51
Identity = 74/160 (46.25%), Postives = 111/160 (69.38%), Query Frame = 3
Query:  165 MSKVKSAAGKGIEISLSWQKASNGHIPNDSVNA-GNSYIARAVYNGEYIPGKIVRGENCAYICYDGKEISCSEYEVLVDTHNFGGQAYEWKSTRGSVITKGSVIGGSDEGRPLYIGRARVANKLLAGKFQPEHGCTYIPYDSQENRKEDYDVLCFLKRRV 641
            MSKV +  G+ +EIS+SWQ+A +G IP  +V A G+ ++ARA +NGEYIPGK+V G +  ++CYDGKEI+ S Y+VLVDT       YEWK +    I   ++IGG+D G+PL+I ++ V  + + GKF P+HGC ++PY+  E  K ++++LC LK+ +
Sbjct:    1 MSKVITQYGRAVEISVSWQEAHDGSIPLHAVKADGSCFVARAKHNGEYIPGKLVTGHSHVFVCYDGKEITKSHYQVLVDTSILPTTGYEWKWSEDLEIPPNAIIGGTDNGQPLFIVKSIVEGETVVGKFHPDHGCAHVPYEGLEFEKNEFEILCSLKKHL 160          
BLAST of DUF3421 domain-containing protein vs. Planmine SMEST
Match: SMESG000074396.1 (SMESG000074396.1)

HSP 1 Score: 158.688 bits (400), Expect = 3.107e-49
Identity = 73/161 (45.34%), Postives = 113/161 (70.19%), Query Frame = 3
Query:  165 MSKVKSAAGKGIEISLSWQKASNGHIPNDSVNAG-NSYIARAVYNGEYIPGKIVRGENCAYICYDGKEISCSEYEVLVDTHNFGG-QAYEWKSTRGSVITKGSVIGGSDEGRPLYIGRARVANKLLAGKFQPEHGCTYIPYDSQENRKEDYDVLCFLKRRV 641
            MSKV S  G G+E+SLSW KA+NG IP  +V AG  +++ARA ++G+YIPGK V G N  ++ + G E + + YE+LV++   GG + YEWK T G  + KG+++GG ++G PLY+ R+ + ++++ GK+ P+HGC Y+PY  +E+R E+ +VLCF  + V
Sbjct:    1 MSKVSSQYGAGVELSLSWVKANNGSIPPKAVRAGGQTFVARAKHDGQYIPGKFVEGYNEVFVSFGGVEHAKNYYEILVESSMLGGHKGYEWKWTNGENVPKGALVGGLNDGAPLYVARSFIEDQMVVGKYYPQHGCAYMPYGGEEHRVENAEVLCFTTKHV 161          
BLAST of DUF3421 domain-containing protein vs. Planmine SMEST
Match: SMESG000074378.1 (SMESG000074378.1)

HSP 1 Score: 158.688 bits (400), Expect = 3.107e-49
Identity = 73/161 (45.34%), Postives = 113/161 (70.19%), Query Frame = 3
Query:  165 MSKVKSAAGKGIEISLSWQKASNGHIPNDSVNAG-NSYIARAVYNGEYIPGKIVRGENCAYICYDGKEISCSEYEVLVDTHNFGG-QAYEWKSTRGSVITKGSVIGGSDEGRPLYIGRARVANKLLAGKFQPEHGCTYIPYDSQENRKEDYDVLCFLKRRV 641
            MSKV S  G G+E+SLSW KA+NG IP  +V AG  +++ARA ++G+YIPGK V G N  ++ + G E + + YE+LV++   GG + YEWK T G  + KG+++GG ++G PLY+ R+ + ++++ GK+ P+HGC Y+PY  +E+R E+ +VLCF  + V
Sbjct:    1 MSKVSSQYGAGVELSLSWVKANNGSIPPKAVRAGGQTFVARAKHDGQYIPGKFVEGYNEVFVSFGGVEHAKNYYEILVESSMLGGHKGYEWKWTNGENVPKGALVGGLNDGAPLYVARSFIEDQMVVGKYYPQHGCAYMPYGGEEHRVENAEVLCFTTKHV 161          
BLAST of DUF3421 domain-containing protein vs. Planmine SMEST
Match: SMESG000029913.1 (SMESG000029913.1)

HSP 1 Score: 153.68 bits (387), Expect = 2.988e-47
Identity = 72/160 (45.00%), Postives = 110/160 (68.75%), Query Frame = 3
Query:  165 MSKVKSAAGKGIEISLSWQKASNGHIPNDSVNAGNS-YIARAVYNGEYIPGKIVRGENCAYICYDGKEISCSEYEVLVDTHNFGGQAYEWKSTRGSVITKGSVIGGSDEGRPLYIGRARVANKLLAGKFQPEHGCTYIPYDSQENRKEDYDVLCFLKRRV 641
            MSK+ S  G+ +EIS+SW    +G+IP+ +V+AG+S Y+ARA +  EYIPGK V+G   AY+ YDGKEI+ SEY++LVD+   GG + EW  TRG+ I   S++GG+D  RPLYI ++ +  +++ GK+ PE  C + PY  +E+RK   ++LC   +++
Sbjct:    1 MSKIVSEYGRSVEISVSWIDCQDGNIPDKAVSAGDSCYVARAKHLDEYIPGKFVQGHTSAYVSYDGKEIAKSEYQILVDSSILGGPSIEWHYTRGNQIPYRSIVGGTDNERPLYIAKSAINGEVVVGKYLPEFACGFFPYGGKEHRKSMVEILCCTTKQL 160          
The following BLAST results are available for this feature:
BLAST of DUF3421 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG133211.051e-2439.42gene:FBgn0033787 transcript:FBtr0345371[more]
CG133211.051e-2439.42gene:FBgn0033787 transcript:FBtr0087792[more]
CG310867.676e-2438.46gene:FBgn0051086 transcript:FBtr0084989[more]
CG310867.676e-2438.46gene:FBgn0051086 transcript:FBtr0307341[more]
CG326331.496e-2236.24gene:FBgn0052633 transcript:FBtr0073800[more]
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q66S13|NATT4_THANI2.324e-630.56Natterin-4 OS=Thalassophryne nattereri OX=289382 P... [more]
back to top
BLAST of DUF3421 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8I9L75.618e-3440.74Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8H8B21.973e-3141.94DUF3421 domain-containing protein OS=Macrostomum l... [more]
Q5DHE44.991e-3141.06SJCHGC04453 protein OS=Schistosoma japonicum OX=61... [more]
A0A267GMN72.050e-3039.07DUF3421 domain-containing protein OS=Macrostomum l... [more]
A0A1I8H2V33.627e-3039.07DUF3421 domain-containing protein OS=Macrostomum l... [more]
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000055806.19.767e-832.88pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000043153.11.193e-732.88pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000045654.11.420e-732.88pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000027077.28.212e-731.17natterin-3-like [Source:NCBI gene;Acc:103027322][more]
ENSAMXT00000034725.18.995e-730.13pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000029906.18.170e-11498.11SMESG000029906.1[more]
SMESG000029910.13.887e-5146.25SMESG000029910.1[more]
SMESG000074396.13.107e-4945.34SMESG000074396.1[more]
SMESG000074378.13.107e-4945.34SMESG000074378.1[more]
SMESG000029913.12.988e-4745.00SMESG000029913.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019264 ID=SMED30019264|Name=DUF3421 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=675bp
GTTATCATGAAATTAGATTTGTCAAATATTAAGCTGTTTATGAAATATAC
TTAAATGTATGTGAGACCTTTGACCTCTGATGACGTCATAACCCGAATAT
CATAGATAAGAGATATATTTAAATAATCAACTGAATTAAAATTTAAAGGA
ACTCTTTGATTGAAATGAGTAAGGTAAAAAGTGCGGCAGGTAAAGGTATA
GAAATTAGTTTGTCATGGCAAAAGGCATCGAATGGACACATTCCTAATGA
TTCTGTAAATGCTGGCAATTCTTACATCGCAAGAGCAGTTTATAATGGAG
AATACATTCCTGGAAAGATTGTACGTGGTGAAAATTGCGCCTATATCTGT
TACGATGGCAAAGAAATAAGCTGTAGTGAATATGAGGTTTTAGTTGACAC
ACACAATTTTGGAGGTCAGGCTTATGAATGGAAGTCCACTAGAGGCTCTG
TAATTACTAAAGGATCAGTCATTGGAGGATCCGACGAAGGAAGACCTCTT
TACATTGGAAGGGCTAGAGTAGCAAATAAGCTATTGGCCGGTAAGTTTCA
ACCTGAACATGGATGTACTTACATACCATATGACTCTCAAGAAAATAGGA
AAGAGGATTATGACGTTTTATGCTTTTTGAAAAGACGTGTTTAAGAAAAA
TATAAGTTTTCGAGTTAAAAAAAAA
back to top

protein sequence of SMED30019264-orf-1

>SMED30019264-orf-1 ID=SMED30019264-orf-1|Name=SMED30019264-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=160bp
MSKVKSAAGKGIEISLSWQKASNGHIPNDSVNAGNSYIARAVYNGEYIPG
KIVRGENCAYICYDGKEISCSEYEVLVDTHNFGGQAYEWKSTRGSVITKG
SVIGGSDEGRPLYIGRARVANKLLAGKFQPEHGCTYIPYDSQENRKEDYD
VLCFLKRRV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR006616DM9_repeat
IPR024518DUF3421