Nucleoside diphosphate kinase

Overview
NameNucleoside diphosphate kinase
Smed IDSMED30019263
Length (bp)746
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Nucleoside diphosphate kinase (SMED30019263) t-SNE clustered cells

Violin plots show distribution of expression levels for Nucleoside diphosphate kinase (SMED30019263) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Nucleoside diphosphate kinase (SMED30019263) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Nucleoside diphosphate kinase (SMED30019263) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019263

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30019263h1SMcG0006350 SmedASXL_007039SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30019263h1SMcG0006350 Contig50839uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019263h1SMcG0006350 Contig50839newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30019263h1SMcG0006350 dd_Smed_v4_856_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30019263h1SMcG0006350 dd_Smed_v4_856_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30019263h1SMcG0006350 dd_Smed_v4_856_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30019263h1SMcG0006350 dd_Smed_v4_856_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30019263h1SMcG0006350 dd_Smed_v4_856_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30019263h1SMcG0006350 dd_Smed_v4_856_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30019263h1SMcG0006350 dd_Smed_v4_856_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30019263h1SMcG0006350 dd_Smed_v4_856_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Nucleoside diphosphate kinase vs. Ensembl Human
Match: NME2 (NME/NM23 nucleoside diphosphate kinase 2 [Source:HGNC Symbol;Acc:HGNC:7850])

HSP 1 Score: 204.527 bits (519), Expect = 1.427e-66
Identity = 94/153 (61.44%), Postives = 116/153 (75.82%), Query Frame = 3
Query:  156 MANYNEQSYIMIKPDGVQRGLVGKIISRFEERGFKLAAMKMMTPDRAMLEKHYEDLKEKSFFPGLINYMLSGPVVCMVWQGYEAVKIGRALLGATRPIDSLPGTIRGDFCQVAGRNVIHGSDGVESAMKEIALWFNPDEIAEYKLCTEEWVQE 614
            MAN  E+++I IKPDGVQRGLVG+II RFE++GF+L AMK +      L++HY DLK++ FFPGL+ YM SGPVV MVW+G   VK GR +LG T P DS PGTIRGDFC   GRN+IHGSD V+SA KEI+LWF P+E+ +YK C  +WV E
Sbjct:    1 MANL-ERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE 152          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Human
Match: NME2 (NME/NM23 nucleoside diphosphate kinase 2 [Source:HGNC Symbol;Acc:HGNC:7850])

HSP 1 Score: 204.527 bits (519), Expect = 1.427e-66
Identity = 94/153 (61.44%), Postives = 116/153 (75.82%), Query Frame = 3
Query:  156 MANYNEQSYIMIKPDGVQRGLVGKIISRFEERGFKLAAMKMMTPDRAMLEKHYEDLKEKSFFPGLINYMLSGPVVCMVWQGYEAVKIGRALLGATRPIDSLPGTIRGDFCQVAGRNVIHGSDGVESAMKEIALWFNPDEIAEYKLCTEEWVQE 614
            MAN  E+++I IKPDGVQRGLVG+II RFE++GF+L AMK +      L++HY DLK++ FFPGL+ YM SGPVV MVW+G   VK GR +LG T P DS PGTIRGDFC   GRN+IHGSD V+SA KEI+LWF P+E+ +YK C  +WV E
Sbjct:    1 MANL-ERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE 152          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Human
Match: NME2 (NME/NM23 nucleoside diphosphate kinase 2 [Source:HGNC Symbol;Acc:HGNC:7850])

HSP 1 Score: 204.527 bits (519), Expect = 1.427e-66
Identity = 94/153 (61.44%), Postives = 116/153 (75.82%), Query Frame = 3
Query:  156 MANYNEQSYIMIKPDGVQRGLVGKIISRFEERGFKLAAMKMMTPDRAMLEKHYEDLKEKSFFPGLINYMLSGPVVCMVWQGYEAVKIGRALLGATRPIDSLPGTIRGDFCQVAGRNVIHGSDGVESAMKEIALWFNPDEIAEYKLCTEEWVQE 614
            MAN  E+++I IKPDGVQRGLVG+II RFE++GF+L AMK +      L++HY DLK++ FFPGL+ YM SGPVV MVW+G   VK GR +LG T P DS PGTIRGDFC   GRN+IHGSD V+SA KEI+LWF P+E+ +YK C  +WV E
Sbjct:    1 MANL-ERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE 152          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Human
Match: NME2 (NME/NM23 nucleoside diphosphate kinase 2 [Source:HGNC Symbol;Acc:HGNC:7850])

HSP 1 Score: 204.527 bits (519), Expect = 1.427e-66
Identity = 94/153 (61.44%), Postives = 116/153 (75.82%), Query Frame = 3
Query:  156 MANYNEQSYIMIKPDGVQRGLVGKIISRFEERGFKLAAMKMMTPDRAMLEKHYEDLKEKSFFPGLINYMLSGPVVCMVWQGYEAVKIGRALLGATRPIDSLPGTIRGDFCQVAGRNVIHGSDGVESAMKEIALWFNPDEIAEYKLCTEEWVQE 614
            MAN  E+++I IKPDGVQRGLVG+II RFE++GF+L AMK +      L++HY DLK++ FFPGL+ YM SGPVV MVW+G   VK GR +LG T P DS PGTIRGDFC   GRN+IHGSD V+SA KEI+LWF P+E+ +YK C  +WV E
Sbjct:    1 MANL-ERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE 152          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Human
Match: NME2 (NME/NM23 nucleoside diphosphate kinase 2 [Source:HGNC Symbol;Acc:HGNC:7850])

HSP 1 Score: 204.527 bits (519), Expect = 1.427e-66
Identity = 94/153 (61.44%), Postives = 116/153 (75.82%), Query Frame = 3
Query:  156 MANYNEQSYIMIKPDGVQRGLVGKIISRFEERGFKLAAMKMMTPDRAMLEKHYEDLKEKSFFPGLINYMLSGPVVCMVWQGYEAVKIGRALLGATRPIDSLPGTIRGDFCQVAGRNVIHGSDGVESAMKEIALWFNPDEIAEYKLCTEEWVQE 614
            MAN  E+++I IKPDGVQRGLVG+II RFE++GF+L AMK +      L++HY DLK++ FFPGL+ YM SGPVV MVW+G   VK GR +LG T P DS PGTIRGDFC   GRN+IHGSD V+SA KEI+LWF P+E+ +YK C  +WV E
Sbjct:    1 MANL-ERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE 152          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Celegans
Match: ndk-1 (Nucleoside diphosphate kinase [Source:UniProtKB/TrEMBL;Acc:Q93576])

HSP 1 Score: 198.364 bits (503), Expect = 1.388e-64
Identity = 96/154 (62.34%), Postives = 115/154 (74.68%), Query Frame = 3
Query:  156 MANYNEQSYIMIKPDGVQRGLVGKIISRFEERGFKLAAMKMMTPDRAMLEKHYEDLKEKSFFPGLINYMLSGPVVCMVWQGYEAVKIGRALLGATRPIDSLPGTIRGDFCQVAGRNVIHGSDGVESAMKEIALWFNPDEIAEY-KLCTEEWVQE 614
            M+N  E+++I IKPDGV RGLVGKII+RFEERG+KL A+K MT  +A LE HY+DLK+K FFP LI YM SGPVV MVWQG + VK GR++LGAT P+ S PGTIRGDFC   GRN+ HGSD V+SA +EIA WF  +EI +Y       WV E
Sbjct:    1 MSN-TERTFIAIKPDGVHRGLVGKIIARFEERGYKLVALKQMTASKAHLEVHYQDLKDKPFFPSLIEYMSSGPVVAMVWQGLDVVKQGRSMLGATNPLASAPGTIRGDFCIQTGRNICHGSDAVDSANREIAHWFKQEEINDYASPFINSWVYE 153          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Celegans
Match: ndk-1 (Nucleoside diphosphate kinase [Source:UniProtKB/TrEMBL;Acc:Q93576])

HSP 1 Score: 198.364 bits (503), Expect = 1.388e-64
Identity = 96/154 (62.34%), Postives = 115/154 (74.68%), Query Frame = 3
Query:  156 MANYNEQSYIMIKPDGVQRGLVGKIISRFEERGFKLAAMKMMTPDRAMLEKHYEDLKEKSFFPGLINYMLSGPVVCMVWQGYEAVKIGRALLGATRPIDSLPGTIRGDFCQVAGRNVIHGSDGVESAMKEIALWFNPDEIAEY-KLCTEEWVQE 614
            M+N  E+++I IKPDGV RGLVGKII+RFEERG+KL A+K MT  +A LE HY+DLK+K FFP LI YM SGPVV MVWQG + VK GR++LGAT P+ S PGTIRGDFC   GRN+ HGSD V+SA +EIA WF  +EI +Y       WV E
Sbjct:    1 MSN-TERTFIAIKPDGVHRGLVGKIIARFEERGYKLVALKQMTASKAHLEVHYQDLKDKPFFPSLIEYMSSGPVVAMVWQGLDVVKQGRSMLGATNPLASAPGTIRGDFCIQTGRNICHGSDAVDSANREIAHWFKQEEINDYASPFINSWVYE 153          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Celegans
Match: ndk-1 (Nucleoside diphosphate kinase [Source:UniProtKB/TrEMBL;Acc:Q93576])

HSP 1 Score: 198.364 bits (503), Expect = 1.388e-64
Identity = 96/154 (62.34%), Postives = 115/154 (74.68%), Query Frame = 3
Query:  156 MANYNEQSYIMIKPDGVQRGLVGKIISRFEERGFKLAAMKMMTPDRAMLEKHYEDLKEKSFFPGLINYMLSGPVVCMVWQGYEAVKIGRALLGATRPIDSLPGTIRGDFCQVAGRNVIHGSDGVESAMKEIALWFNPDEIAEY-KLCTEEWVQE 614
            M+N  E+++I IKPDGV RGLVGKII+RFEERG+KL A+K MT  +A LE HY+DLK+K FFP LI YM SGPVV MVWQG + VK GR++LGAT P+ S PGTIRGDFC   GRN+ HGSD V+SA +EIA WF  +EI +Y       WV E
Sbjct:    1 MSN-TERTFIAIKPDGVHRGLVGKIIARFEERGYKLVALKQMTASKAHLEVHYQDLKDKPFFPSLIEYMSSGPVVAMVWQGLDVVKQGRSMLGATNPLASAPGTIRGDFCIQTGRNICHGSDAVDSANREIAHWFKQEEINDYASPFINSWVYE 153          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Celegans
Match: ndk-1 (Nucleoside diphosphate kinase [Source:UniProtKB/TrEMBL;Acc:Q93576])

HSP 1 Score: 198.364 bits (503), Expect = 1.388e-64
Identity = 96/154 (62.34%), Postives = 115/154 (74.68%), Query Frame = 3
Query:  156 MANYNEQSYIMIKPDGVQRGLVGKIISRFEERGFKLAAMKMMTPDRAMLEKHYEDLKEKSFFPGLINYMLSGPVVCMVWQGYEAVKIGRALLGATRPIDSLPGTIRGDFCQVAGRNVIHGSDGVESAMKEIALWFNPDEIAEY-KLCTEEWVQE 614
            M+N  E+++I IKPDGV RGLVGKII+RFEERG+KL A+K MT  +A LE HY+DLK+K FFP LI YM SGPVV MVWQG + VK GR++LGAT P+ S PGTIRGDFC   GRN+ HGSD V+SA +EIA WF  +EI +Y       WV E
Sbjct:    1 MSN-TERTFIAIKPDGVHRGLVGKIIARFEERGYKLVALKQMTASKAHLEVHYQDLKDKPFFPSLIEYMSSGPVVAMVWQGLDVVKQGRSMLGATNPLASAPGTIRGDFCIQTGRNICHGSDAVDSANREIAHWFKQEEINDYASPFINSWVYE 153          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Fly
Match: awd (gene:FBgn0000150 transcript:FBtr0346150)

HSP 1 Score: 210.305 bits (534), Expect = 6.845e-69
Identity = 96/153 (62.75%), Postives = 115/153 (75.16%), Query Frame = 3
Query:  156 MANYNEQSYIMIKPDGVQRGLVGKIISRFEERGFKLAAMKMMTPDRAMLEKHYEDLKEKSFFPGLINYMLSGPVVCMVWQGYEAVKIGRALLGATRPIDSLPGTIRGDFCQVAGRNVIHGSDGVESAMKEIALWFNPDEIAEYKLCTEEWVQE 614
            MA   E+++IM+KPDGVQRGLVGKII RFE++GFKL A+K     + +LEKHY DL  + FFPGL+NYM SGPVV MVW+G   VK GR +LGAT P DSLPGTIRGDFC   GRN+IHGSD VESA KEIALWFN  E+  +    ++W+ E
Sbjct:   16 MAANKERTFIMVKPDGVQRGLVGKIIERFEQKGFKLVALKFTWASKELLEKHYADLSARPFFPGLVNYMNSGPVVPMVWEGLNVVKTGRQMLGATNPADSLPGTIRGDFCIQVGRNIIHGSDAVESAEKEIALWFNEKELVTWTPAAKDWIYE 168          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Fly
Match: awd (gene:FBgn0000150 transcript:FBtr0339146)

HSP 1 Score: 210.305 bits (534), Expect = 6.845e-69
Identity = 96/153 (62.75%), Postives = 115/153 (75.16%), Query Frame = 3
Query:  156 MANYNEQSYIMIKPDGVQRGLVGKIISRFEERGFKLAAMKMMTPDRAMLEKHYEDLKEKSFFPGLINYMLSGPVVCMVWQGYEAVKIGRALLGATRPIDSLPGTIRGDFCQVAGRNVIHGSDGVESAMKEIALWFNPDEIAEYKLCTEEWVQE 614
            MA   E+++IM+KPDGVQRGLVGKII RFE++GFKL A+K     + +LEKHY DL  + FFPGL+NYM SGPVV MVW+G   VK GR +LGAT P DSLPGTIRGDFC   GRN+IHGSD VESA KEIALWFN  E+  +    ++W+ E
Sbjct:   16 MAANKERTFIMVKPDGVQRGLVGKIIERFEQKGFKLVALKFTWASKELLEKHYADLSARPFFPGLVNYMNSGPVVPMVWEGLNVVKTGRQMLGATNPADSLPGTIRGDFCIQVGRNIIHGSDAVESAEKEIALWFNEKELVTWTPAAKDWIYE 168          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Fly
Match: awd (gene:FBgn0000150 transcript:FBtr0346611)

HSP 1 Score: 209.534 bits (532), Expect = 7.301e-69
Identity = 96/153 (62.75%), Postives = 115/153 (75.16%), Query Frame = 3
Query:  156 MANYNEQSYIMIKPDGVQRGLVGKIISRFEERGFKLAAMKMMTPDRAMLEKHYEDLKEKSFFPGLINYMLSGPVVCMVWQGYEAVKIGRALLGATRPIDSLPGTIRGDFCQVAGRNVIHGSDGVESAMKEIALWFNPDEIAEYKLCTEEWVQE 614
            MA   E+++IM+KPDGVQRGLVGKII RFE++GFKL A+K     + +LEKHY DL  + FFPGL+NYM SGPVV MVW+G   VK GR +LGAT P DSLPGTIRGDFC   GRN+IHGSD VESA KEIALWFN  E+  +    ++W+ E
Sbjct:    1 MAANKERTFIMVKPDGVQRGLVGKIIERFEQKGFKLVALKFTWASKELLEKHYADLSARPFFPGLVNYMNSGPVVPMVWEGLNVVKTGRQMLGATNPADSLPGTIRGDFCIQVGRNIIHGSDAVESAEKEIALWFNEKELVTWTPAAKDWIYE 153          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Fly
Match: nmdyn-D6 (gene:FBgn0030573 transcript:FBtr0073933)

HSP 1 Score: 63.5438 bits (153), Expect = 2.287e-12
Identity = 39/133 (29.32%), Postives = 65/133 (48.87%), Query Frame = 3
Query:  171 EQSYIMIKPDGVQRGLVGKIISRFEERGFKLAAMKMMTPDRAMLEKHYEDLKEKSFFPGLINYMLSGPVVCMVWQGYEAVKIGRALLGAT---RPIDSLPGTIRGDFCQVAGRNVIHGSDGVESAMKEIALWF 560
            E +  +IKP  ++     + I     + F +   K +   + + E+ Y + K K F+  L ++M SGP   ++ Q    ++  R+LLG T   R + S P  IR  +     RN  HGSD   SA++EI++ F
Sbjct:    2 EITLALIKPHVLRNTYAMQQIRALISQNFTILDQKEVCITKELSERFYAEHKGKFFYHRLTSFMNSGPSYALILQSETCIQKWRSLLGPTKVFRAVYSDPNCIRALYGISDTRNACHGSDSEASALREISILF 134          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Fly
Match: nmdyn-D7 (gene:FBgn0028997 transcript:FBtr0082083)

HSP 1 Score: 50.8322 bits (120), Expect = 4.272e-7
Identity = 38/146 (26.03%), Postives = 65/146 (44.52%), Query Frame = 3
Query:  150 LKMANYNEQSYIMIKPDGVQRGLVGKIISRFEERGFKLAAMKMMTPDRAMLEKHYEDLK--EKSFFPGLINYMLSGPVVCM-VWQGYEAVKIGRALLGATRPIDS------LPGTIRGDFCQVAGRNVIHGSDGVESAMKEIALWF 560
            +K   +   +  +IKP  ++ GL+G IIS     GF+L AM+M+   R   E+ YE  +     + P ++  + SG  +CM +       K  R       P+D        P T+R  F +   +N +H +D  + +  E+   F
Sbjct:  239 IKECVFKNTTLAIIKPHSIKDGLLGDIISEILSNGFRLTAMRMILMARINCEEFYEVYRGVVPEYIP-MVAQLASGVCMCMEIACADPEKKTDREFRNFCGPMDPEIAKLLRPHTLRAKFGKSKVQNAVHCTDLPDDSNLELQYMF 383          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Zebrafish
Match: nme2a (NME/NM23 nucleoside diphosphate kinase 2a [Source:ZFIN;Acc:ZDB-GENE-030131-7656])

HSP 1 Score: 213.001 bits (541), Expect = 4.715e-70
Identity = 93/152 (61.18%), Postives = 116/152 (76.32%), Query Frame = 3
Query:  156 MANYNEQSYIMIKPDGVQRGLVGKIISRFEERGFKLAAMKMMTPDRAMLEKHYEDLKEKSFFPGLINYMLSGPVVCMVWQGYEAVKIGRALLGATRPIDSLPGTIRGDFCQVAGRNVIHGSDGVESAMKEIALWFNPDEIAEYKLCTEEWVQ 611
            M+   E+++I IKPDGVQRGLVG+II RFE++GFKL AMK++  D  +L +HY DLK++ FFPGL++YM +GPVV MVW+G+  +K GR +LG T PIDS PGTIRGDFC   GRN+IHGSD VESA  EI LWF PDEI +Y  C E W+ 
Sbjct:    1 MSGNEERTFIAIKPDGVQRGLVGEIIKRFEQKGFKLVAMKLIQADEDLLRQHYSDLKDRPFFPGLVSYMSAGPVVAMVWEGFNVIKTGRVMLGETNPIDSKPGTIRGDFCVQVGRNIIHGSDSVESANTEINLWFKPDEICDYTKCQESWIN 152          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Zebrafish
Match: nme2a (NME/NM23 nucleoside diphosphate kinase 2a [Source:ZFIN;Acc:ZDB-GENE-030131-7656])

HSP 1 Score: 213.001 bits (541), Expect = 4.715e-70
Identity = 93/152 (61.18%), Postives = 116/152 (76.32%), Query Frame = 3
Query:  156 MANYNEQSYIMIKPDGVQRGLVGKIISRFEERGFKLAAMKMMTPDRAMLEKHYEDLKEKSFFPGLINYMLSGPVVCMVWQGYEAVKIGRALLGATRPIDSLPGTIRGDFCQVAGRNVIHGSDGVESAMKEIALWFNPDEIAEYKLCTEEWVQ 611
            M+   E+++I IKPDGVQRGLVG+II RFE++GFKL AMK++  D  +L +HY DLK++ FFPGL++YM +GPVV MVW+G+  +K GR +LG T PIDS PGTIRGDFC   GRN+IHGSD VESA  EI LWF PDEI +Y  C E W+ 
Sbjct:    1 MSGNEERTFIAIKPDGVQRGLVGEIIKRFEQKGFKLVAMKLIQADEDLLRQHYSDLKDRPFFPGLVSYMSAGPVVAMVWEGFNVIKTGRVMLGETNPIDSKPGTIRGDFCVQVGRNIIHGSDSVESANTEINLWFKPDEICDYTKCQESWIN 152          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Zebrafish
Match: nme2a (NME/NM23 nucleoside diphosphate kinase 2a [Source:ZFIN;Acc:ZDB-GENE-030131-7656])

HSP 1 Score: 213.001 bits (541), Expect = 4.715e-70
Identity = 93/152 (61.18%), Postives = 116/152 (76.32%), Query Frame = 3
Query:  156 MANYNEQSYIMIKPDGVQRGLVGKIISRFEERGFKLAAMKMMTPDRAMLEKHYEDLKEKSFFPGLINYMLSGPVVCMVWQGYEAVKIGRALLGATRPIDSLPGTIRGDFCQVAGRNVIHGSDGVESAMKEIALWFNPDEIAEYKLCTEEWVQ 611
            M+   E+++I IKPDGVQRGLVG+II RFE++GFKL AMK++  D  +L +HY DLK++ FFPGL++YM +GPVV MVW+G+  +K GR +LG T PIDS PGTIRGDFC   GRN+IHGSD VESA  EI LWF PDEI +Y  C E W+ 
Sbjct:    1 MSGNEERTFIAIKPDGVQRGLVGEIIKRFEQKGFKLVAMKLIQADEDLLRQHYSDLKDRPFFPGLVSYMSAGPVVAMVWEGFNVIKTGRVMLGETNPIDSKPGTIRGDFCVQVGRNIIHGSDSVESANTEINLWFKPDEICDYTKCQESWIN 152          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Zebrafish
Match: nme2a (NME/NM23 nucleoside diphosphate kinase 2a [Source:ZFIN;Acc:ZDB-GENE-030131-7656])

HSP 1 Score: 213.001 bits (541), Expect = 4.715e-70
Identity = 93/152 (61.18%), Postives = 116/152 (76.32%), Query Frame = 3
Query:  156 MANYNEQSYIMIKPDGVQRGLVGKIISRFEERGFKLAAMKMMTPDRAMLEKHYEDLKEKSFFPGLINYMLSGPVVCMVWQGYEAVKIGRALLGATRPIDSLPGTIRGDFCQVAGRNVIHGSDGVESAMKEIALWFNPDEIAEYKLCTEEWVQ 611
            M+   E+++I IKPDGVQRGLVG+II RFE++GFKL AMK++  D  +L +HY DLK++ FFPGL++YM +GPVV MVW+G+  +K GR +LG T PIDS PGTIRGDFC   GRN+IHGSD VESA  EI LWF PDEI +Y  C E W+ 
Sbjct:    1 MSGNEERTFIAIKPDGVQRGLVGEIIKRFEQKGFKLVAMKLIQADEDLLRQHYSDLKDRPFFPGLVSYMSAGPVVAMVWEGFNVIKTGRVMLGETNPIDSKPGTIRGDFCVQVGRNIIHGSDSVESANTEINLWFKPDEICDYTKCQESWIN 152          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Zebrafish
Match: nme2b.1 (NME/NM23 nucleoside diphosphate kinase 2b, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-000210-32])

HSP 1 Score: 199.134 bits (505), Expect = 1.139e-64
Identity = 85/153 (55.56%), Postives = 115/153 (75.16%), Query Frame = 3
Query:  156 MANYNEQSYIMIKPDGVQRGLVGKIISRFEERGFKLAAMKMMTPDRAMLEKHYEDLKEKSFFPGLINYMLSGPVVCMVWQGYEAVKIGRALLGATRPIDSLPGTIRGDFCQVAGRNVIHGSDGVESAMKEIALWFNPDEIAEYKLCTEEWVQE 614
            M+   E+++I +KPDGVQRGL+G+II RFE++GF+L AMK +     +L++HY DLK++ F+PGL+ YM SGPV+ MVW+G   VK GR +LG T P DS PGTIRGDFC   GRN+IHGSD V+SA  EI+LWF P+E+  +K C ++W+ E
Sbjct:    1 MSAKTERTFIAVKPDGVQRGLMGEIIKRFEQKGFRLVAMKFLQASEDLLKQHYIDLKDRPFYPGLVKYMSSGPVLAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIEVGRNIIHGSDSVDSANTEISLWFKPEELVSFKSCAQQWIYE 153          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Xenopus
Match: c1orf112 (chromosome 1 open reading frame 112 [Source:Xenbase;Acc:XB-GENE-5952633])

HSP 1 Score: 204.142 bits (518), Expect = 2.232e-66
Identity = 93/153 (60.78%), Postives = 115/153 (75.16%), Query Frame = 3
Query:  156 MANYNEQSYIMIKPDGVQRGLVGKIISRFEERGFKLAAMKMMTPDRAMLEKHYEDLKEKSFFPGLINYMLSGPVVCMVWQGYEAVKIGRALLGATRPIDSLPGTIRGDFCQVAGRNVIHGSDGVESAMKEIALWFNPDEIAEYKLCTEEWVQE 614
            MA   E+++I IKPDGVQRGL+G+II RFE++GF L AMK +   + +L++HY DLK++ F+PGL++YM SGPV+ MVW+G   VK GR +LG T P DS PGTIRGDFC   GRN+IHGSD VESA KEIALWF   E+ EYK C  EWV E
Sbjct:    1 MAANKERTFIAIKPDGVQRGLMGEIIKRFEQKGFYLVAMKFVQASKDLLKQHYIDLKDRPFYPGLVDYMSSGPVLAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESANKEIALWFEDKELVEYKCCAHEWVYE 153          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Xenopus
Match: c1orf112 (chromosome 1 open reading frame 112 [Source:Xenbase;Acc:XB-GENE-5952633])

HSP 1 Score: 205.297 bits (521), Expect = 3.441e-66
Identity = 93/153 (60.78%), Postives = 115/153 (75.16%), Query Frame = 3
Query:  156 MANYNEQSYIMIKPDGVQRGLVGKIISRFEERGFKLAAMKMMTPDRAMLEKHYEDLKEKSFFPGLINYMLSGPVVCMVWQGYEAVKIGRALLGATRPIDSLPGTIRGDFCQVAGRNVIHGSDGVESAMKEIALWFNPDEIAEYKLCTEEWVQE 614
            MA   E+++I IKPDGVQRGL+G+II RFE++GF L AMK +   + +L++HY DLK++ F+PGL++YM SGPV+ MVW+G   VK GR +LG T P DS PGTIRGDFC   GRN+IHGSD VESA KEIALWF   E+ EYK C  EWV E
Sbjct:   51 MAANKERTFIAIKPDGVQRGLMGEIIKRFEQKGFYLVAMKFVQASKDLLKQHYIDLKDRPFYPGLVDYMSSGPVLAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESANKEIALWFEDKELVEYKCCAHEWVYE 203          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Xenopus
Match: sox8 (SRY-box 8 [Source:Xenbase;Acc:XB-GENE-480865])

HSP 1 Score: 183.726 bits (465), Expect = 3.643e-58
Identity = 84/149 (56.38%), Postives = 108/149 (72.48%), Query Frame = 3
Query:  168 NEQSYIMIKPDGVQRGLVGKIISRFEERGFKLAAMKMMTPDRAMLEKHYEDLKEKSFFPGLINYMLSGPVVCMVWQGYEAVKIGRALLGATRPIDSLPGTIRGDFCQVAGRNVIHGSDGVESAMKEIALWFNPDEIAEYKLCTEEWVQE 614
            NE++++ IKPDG QR L+G+II RFE++GF L AMK+M     +L++HY  L++K F+  L+ YM SGPVV MVWQG + VK  R ++G T P  SLPGTIRGDFC   GRNVIHGSD  ESA +EIALWF PDE+  ++  TE W+ E
Sbjct:   21 NERTFLAIKPDGYQRRLIGEIIRRFEKKGFHLVAMKIMQASEQLLKQHYIALQDKPFYDRLVKYMGSGPVVAMVWQGLDVVKTARLMIGETNPAHSLPGTIRGDFCVDVGRNVIHGSDSRESAQREIALWFQPDELVCWQDSTESWIYE 169          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Xenopus
Match: sox8 (SRY-box 8 [Source:Xenbase;Acc:XB-GENE-480865])

HSP 1 Score: 183.341 bits (464), Expect = 1.016e-57
Identity = 84/149 (56.38%), Postives = 108/149 (72.48%), Query Frame = 3
Query:  168 NEQSYIMIKPDGVQRGLVGKIISRFEERGFKLAAMKMMTPDRAMLEKHYEDLKEKSFFPGLINYMLSGPVVCMVWQGYEAVKIGRALLGATRPIDSLPGTIRGDFCQVAGRNVIHGSDGVESAMKEIALWFNPDEIAEYKLCTEEWVQE 614
            NE++++ IKPDG QR L+G+II RFE++GF L AMK+M     +L++HY  L++K F+  L+ YM SGPVV MVWQG + VK  R ++G T P  SLPGTIRGDFC   GRNVIHGSD  ESA +EIALWF PDE+  ++  TE W+ E
Sbjct:   40 NERTFLAIKPDGYQRRLIGEIIRRFEKKGFHLVAMKIMQASEQLLKQHYIALQDKPFYDRLVKYMGSGPVVAMVWQGLDVVKTARLMIGETNPAHSLPGTIRGDFCVDVGRNVIHGSDSRESAQREIALWFQPDELVCWQDSTESWIYE 188          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Xenopus
Match: man1c1 (mannosidase, alpha, class 1C, member 1 [Source:Xenbase;Acc:XB-GENE-6076350])

HSP 1 Score: 162.155 bits (409), Expect = 1.464e-49
Identity = 72/153 (47.06%), Postives = 101/153 (66.01%), Query Frame = 3
Query:  144 YFLKMANYNEQSYIMIKPDGVQRGLVGKIISRFEERGFKLAAMKMMTPDRAMLEKHYEDLKEKSFFPGLINYMLSGPVVCMVWQGYEAVKIGRALLGATRPIDSLPGTIRGDFCQVAGRNVIHGSDGVESAMKEIALWFNPDEIAEYKLCTEE 602
            ++  +A   E++ I +KPDGVQR LVG+II RFE+RGF L  +K++     +L +HY DL+ K F+P L+ YM SGPVV MVW+G+  V+  RA++G T    + PGTIRGDF     RNVIH SD VE A +EI+LWF+  E+  ++   + 
Sbjct:   29 FYSSVAGVCERTLIAVKPDGVQRKLVGEIIKRFEQRGFTLVGLKLLQASEGILAEHYHDLRRKPFYPALLRYMASGPVVAMVWEGHNVVRTSRAMVGDTDSSQAKPGTIRGDFSVHISRNVIHASDSVEVAEREISLWFHSGELISWETSDQS 181          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Mouse
Match: Nme2 (NME/NM23 nucleoside diphosphate kinase 2 [Source:MGI Symbol;Acc:MGI:97356])

HSP 1 Score: 204.527 bits (519), Expect = 9.378e-67
Identity = 95/153 (62.09%), Postives = 115/153 (75.16%), Query Frame = 3
Query:  156 MANYNEQSYIMIKPDGVQRGLVGKIISRFEERGFKLAAMKMMTPDRAMLEKHYEDLKEKSFFPGLINYMLSGPVVCMVWQGYEAVKIGRALLGATRPIDSLPGTIRGDFCQVAGRNVIHGSDGVESAMKEIALWFNPDEIAEYKLCTEEWVQE 614
            MAN  E+++I IKPDGVQRGLVG+II RFE++GF+L AMK +      L++HY DLK++ FFPGL+ YM SGPVV MVW+G   VK GR +LG T P DS PGTIRGDFC   GRN+IHGSD VESA KEI LWF P+E+ +YK C  +WV E
Sbjct:    1 MANL-ERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIHLWFKPEELIDYKSCAHDWVYE 152          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Mouse
Match: Nme2 (NME/NM23 nucleoside diphosphate kinase 2 [Source:MGI Symbol;Acc:MGI:97356])

HSP 1 Score: 204.527 bits (519), Expect = 9.378e-67
Identity = 95/153 (62.09%), Postives = 115/153 (75.16%), Query Frame = 3
Query:  156 MANYNEQSYIMIKPDGVQRGLVGKIISRFEERGFKLAAMKMMTPDRAMLEKHYEDLKEKSFFPGLINYMLSGPVVCMVWQGYEAVKIGRALLGATRPIDSLPGTIRGDFCQVAGRNVIHGSDGVESAMKEIALWFNPDEIAEYKLCTEEWVQE 614
            MAN  E+++I IKPDGVQRGLVG+II RFE++GF+L AMK +      L++HY DLK++ FFPGL+ YM SGPVV MVW+G   VK GR +LG T P DS PGTIRGDFC   GRN+IHGSD VESA KEI LWF P+E+ +YK C  +WV E
Sbjct:    1 MANL-ERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIHLWFKPEELIDYKSCAHDWVYE 152          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Mouse
Match: Nme1 (NME/NM23 nucleoside diphosphate kinase 1 [Source:MGI Symbol;Acc:MGI:97355])

HSP 1 Score: 202.986 bits (515), Expect = 4.414e-66
Identity = 91/153 (59.48%), Postives = 116/153 (75.82%), Query Frame = 3
Query:  156 MANYNEQSYIMIKPDGVQRGLVGKIISRFEERGFKLAAMKMMTPDRAMLEKHYEDLKEKSFFPGLINYMLSGPVVCMVWQGYEAVKIGRALLGATRPIDSLPGTIRGDFCQVAGRNVIHGSDGVESAMKEIALWFNPDEIAEYKLCTEEWVQE 614
            MAN +E+++I IKPDGVQRGLVG+II RFE++GF+L  +K +     +L++HY DLK++ FF GL+ YM SGPVV MVW+G   VK GR +LG T P DS PGTIRGDFC   GRN+IHGSD V+SA KEI+LWF P+E+ EYK C + W+ E
Sbjct:    1 MAN-SERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFLQASEDLLKEHYTDLKDRPFFTGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFQPEELVEYKSCAQNWIYE 152          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Mouse
Match: Gm20390 (predicted gene 20390 [Source:MGI Symbol;Acc:MGI:5141855])

HSP 1 Score: 204.912 bits (520), Expect = 2.726e-65
Identity = 95/153 (62.09%), Postives = 115/153 (75.16%), Query Frame = 3
Query:  156 MANYNEQSYIMIKPDGVQRGLVGKIISRFEERGFKLAAMKMMTPDRAMLEKHYEDLKEKSFFPGLINYMLSGPVVCMVWQGYEAVKIGRALLGATRPIDSLPGTIRGDFCQVAGRNVIHGSDGVESAMKEIALWFNPDEIAEYKLCTEEWVQE 614
            MAN  E+++I IKPDGVQRGLVG+II RFE++GF+L AMK +      L++HY DLK++ FFPGL+ YM SGPVV MVW+G   VK GR +LG T P DS PGTIRGDFC   GRN+IHGSD VESA KEI LWF P+E+ +YK C  +WV E
Sbjct:  116 MANL-ERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIHLWFKPEELIDYKSCAHDWVYE 267          

HSP 2 Score: 148.288 bits (373), Expect = 3.497e-43
Identity = 68/117 (58.12%), Postives = 87/117 (74.36%), Query Frame = 3
Query:  156 MANYNEQSYIMIKPDGVQRGLVGKIISRFEERGFKLAAMKMMTPDRAMLEKHYEDLKEKSFFPGLINYMLSGPVVCMVWQGYEAVKIGRALLGATRPIDSLPGTIRGDFCQVAGRNV 506
            MAN +E+++I IKPDGVQRGLVG+II RFE++GF+L  +K +     +L++HY DLK++ FF GL+ YM SGPVV MVW+G   VK GR +LG T P DS PGTIRGDFC   GR +
Sbjct:    1 MAN-SERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFLQASEDLLKEHYTDLKDRPFFTGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRTM 116          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Mouse
Match: Nme3 (NME/NM23 nucleoside diphosphate kinase 3 [Source:MGI Symbol;Acc:MGI:1930182])

HSP 1 Score: 178.718 bits (452), Expect = 2.750e-56
Identity = 81/152 (53.29%), Postives = 109/152 (71.71%), Query Frame = 3
Query:  159 ANYNEQSYIMIKPDGVQRGLVGKIISRFEERGFKLAAMKMMTPDRAMLEKHYEDLKEKSFFPGLINYMLSGPVVCMVWQGYEAVKIGRALLGATRPIDSLPGTIRGDFCQVAGRNVIHGSDGVESAMKEIALWFNPDEIAEYKLCTEEWVQE 614
            +  NE++++ +KPDGVQR LVG+I+ RFE +GFKL A+K++     +L +HY +L+EK F+  L+ YM SGPVV MVWQG + V   RAL+GAT P D++PGTIRGDFC   G+NVIHGSD VESA +EIALWF   E+  ++     W+ E
Sbjct:   18 SGVNERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQASEELLREHYVELREKPFYSRLVKYMSSGPVVAMVWQGLDVVHASRALIGATDPGDAMPGTIRGDFCMEVGKNVIHGSDSVESAHREIALWFREAELLCWEDSAGHWLYE 169          
BLAST of Nucleoside diphosphate kinase vs. UniProt/SwissProt
Match: sp|Q8TFN0|NDK_EMENI (Nucleoside diphosphate kinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=swoH PE=3 SV=1)

HSP 1 Score: 219.55 bits (558), Expect = 9.896e-72
Identity = 101/149 (67.79%), Postives = 117/149 (78.52%), Query Frame = 3
Query:  168 NEQSYIMIKPDGVQRGLVGKIISRFEERGFKLAAMKMMTPDRAMLEKHYEDLKEKSFFPGLINYMLSGPVVCMVWQGYEAVKIGRALLGATRPIDSLPGTIRGDFCQVAGRNVIHGSDGVESAMKEIALWFNPDEIAEYKLCTEEWVQE 614
            +EQ++I IKPDGVQRGLVG IISRFE RGFKLAAMK+ +P R++LE+HY DLKEK FFPGL+ YMLSGP+V MVW+G + VK GR +LGAT P+ S PGTIRGDF    GRNV HGSD VESA KEI LWF P+EI  YKL    W+ E
Sbjct:    3 SEQTFIAIKPDGVQRGLVGPIISRFENRGFKLAAMKLTSPSRSLLEQHYSDLKEKPFFPGLVTYMLSGPIVAMVWEGKDVVKTGRTILGATNPLASAPGTIRGDFAIDVGRNVCHGSDSVESAKKEIGLWFTPEEIQNYKLNAFGWIYE 151          
BLAST of Nucleoside diphosphate kinase vs. UniProt/SwissProt
Match: sp|P08879|NDKA_DROME (Nucleoside diphosphate kinase OS=Drosophila melanogaster OX=7227 GN=awd PE=1 SV=3)

HSP 1 Score: 209.534 bits (532), Expect = 7.318e-68
Identity = 96/153 (62.75%), Postives = 115/153 (75.16%), Query Frame = 3
Query:  156 MANYNEQSYIMIKPDGVQRGLVGKIISRFEERGFKLAAMKMMTPDRAMLEKHYEDLKEKSFFPGLINYMLSGPVVCMVWQGYEAVKIGRALLGATRPIDSLPGTIRGDFCQVAGRNVIHGSDGVESAMKEIALWFNPDEIAEYKLCTEEWVQE 614
            MA   E+++IM+KPDGVQRGLVGKII RFE++GFKL A+K     + +LEKHY DL  + FFPGL+NYM SGPVV MVW+G   VK GR +LGAT P DSLPGTIRGDFC   GRN+IHGSD VESA KEIALWFN  E+  +    ++W+ E
Sbjct:    1 MAANKERTFIMVKPDGVQRGLVGKIIERFEQKGFKLVALKFTWASKELLEKHYADLSARPFFPGLVNYMNSGPVVPMVWEGLNVVKTGRQMLGATNPADSLPGTIRGDFCIQVGRNIIHGSDAVESAEKEIALWFNEKELVTWTPAAKDWIYE 153          
BLAST of Nucleoside diphosphate kinase vs. UniProt/SwissProt
Match: sp|Q6XI71|NDKA_DROYA (Nucleoside diphosphate kinase (Fragment) OS=Drosophila yakuba OX=7245 GN=awd PE=2 SV=1)

HSP 1 Score: 206.838 bits (525), Expect = 8.251e-67
Identity = 94/148 (63.51%), Postives = 113/148 (76.35%), Query Frame = 3
Query:  171 EQSYIMIKPDGVQRGLVGKIISRFEERGFKLAAMKMMTPDRAMLEKHYEDLKEKSFFPGLINYMLSGPVVCMVWQGYEAVKIGRALLGATRPIDSLPGTIRGDFCQVAGRNVIHGSDGVESAMKEIALWFNPDEIAEYKLCTEEWVQE 614
            E+++IM+KPDGVQRGLVGKII RFE++GFKL A+K     + +LEKHY DL  + FFPGL+NYM SGPVV MVW+G   VK GR +LGAT P DSLPGTIRGDFC   GRN+IHGSD VESA KEIALWFN  E+  +    ++W+ E
Sbjct:    3 ERTFIMVKPDGVQRGLVGKIIERFEQKGFKLVALKFTWASKELLEKHYADLSARPFFPGLVNYMNSGPVVPMVWEGLNVVKTGRQMLGATNPADSLPGTIRGDFCIQVGRNIIHGSDAVESAEKEIALWFNEKELVTWTPAAKDWIYE 150          
BLAST of Nucleoside diphosphate kinase vs. UniProt/SwissProt
Match: sp|Q7Z8P9|NDK_ASPFU (Nucleoside diphosphate kinase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=ndk1 PE=1 SV=1)

HSP 1 Score: 206.838 bits (525), Expect = 9.406e-67
Identity = 94/149 (63.09%), Postives = 116/149 (77.85%), Query Frame = 3
Query:  168 NEQSYIMIKPDGVQRGLVGKIISRFEERGFKLAAMKMMTPDRAMLEKHYEDLKEKSFFPGLINYMLSGPVVCMVWQGYEAVKIGRALLGATRPIDSLPGTIRGDFCQVAGRNVIHGSDGVESAMKEIALWFNPDEIAEYKLCTEEWVQE 614
            NEQ++I IKPDGVQRGL+G IISRFE RGFKL AMK+++P ++ LE+HY DL +K FF GL++YMLSGP+  MVW+G + VK GR +LGAT P+ S PGTIRGDF    GRNV HGSD VE+A KEIALWF P+E+  +K  T +WV E
Sbjct:    3 NEQTFIAIKPDGVQRGLIGPIISRFENRGFKLVAMKLVSPPQSQLEQHYADLSDKPFFKGLVSYMLSGPICAMVWEGRDVVKTGRTILGATNPLASAPGTIRGDFAIDVGRNVCHGSDSVENAKKEIALWFKPEELISWKSATFDWVYE 151          
BLAST of Nucleoside diphosphate kinase vs. UniProt/SwissProt
Match: sp|P52174|NDKA1_BOVIN (Nucleoside diphosphate kinase A 1 OS=Bos taurus OX=9913 GN=NME1-1 PE=1 SV=3)

HSP 1 Score: 206.068 bits (523), Expect = 1.954e-66
Identity = 94/153 (61.44%), Postives = 117/153 (76.47%), Query Frame = 3
Query:  156 MANYNEQSYIMIKPDGVQRGLVGKIISRFEERGFKLAAMKMMTPDRAMLEKHYEDLKEKSFFPGLINYMLSGPVVCMVWQGYEAVKIGRALLGATRPIDSLPGTIRGDFCQVAGRNVIHGSDGVESAMKEIALWFNPDEIAEYKLCTEEWVQE 614
            MAN +E+++I IKPDGVQRGL+G+II RFE++GF+L AMK M     +L++HY DLK++ FF GL+ YM SGPVV MVW+G   VK GR +LG T P DS PGTIRGDFC   GRN+IHGSD VESA KEIALWF+P+E+  YK C + W+ E
Sbjct:    1 MAN-SERTFIAIKPDGVQRGLIGEIIKRFEQKGFRLVAMKFMRASEDLLKEHYIDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIALWFHPEELVNYKSCAQNWIYE 152          
BLAST of Nucleoside diphosphate kinase vs. TrEMBL
Match: A0A0F7CYH3 (Nucleoside diphosphate kinase (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 258.84 bits (660), Expect = 1.673e-84
Identity = 117/153 (76.47%), Postives = 133/153 (86.93%), Query Frame = 3
Query:  156 MANYNEQSYIMIKPDGVQRGLVGKIISRFEERGFKLAAMKMMTPDRAMLEKHYEDLKEKSFFPGLINYMLSGPVVCMVWQGYEAVKIGRALLGATRPIDSLPGTIRGDFCQVAGRNVIHGSDGVESAMKEIALWFNPDEIAEYKLCTEEWVQE 614
            M  Y E+SYIM+KPDGVQRGLVG II RFE+RGFKL A+KMM PD+ +LE HY+DLK+K FF  LI YMLSGPVVCM+WQG+EAVKIGRALLGATRPIDSLPGTIRGDFCQVAGRN++HGSD V+ A +EI+LWFNP EI +YKLC E WVQE
Sbjct:   23 MDVYQEKSYIMVKPDGVQRGLVGTIIMRFEQRGFKLIALKMMKPDKKLLETHYQDLKDKPFFSKLIEYMLSGPVVCMIWQGFEAVKIGRALLGATRPIDSLPGTIRGDFCQVAGRNIVHGSDSVDGAKREISLWFNPKEIGDYKLCNEVWVQE 175          
BLAST of Nucleoside diphosphate kinase vs. TrEMBL
Match: A0A267FLE0 (Nucleoside diphosphate kinase OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig008873g3 PE=3 SV=1)

HSP 1 Score: 237.269 bits (604), Expect = 2.883e-76
Identity = 108/148 (72.97%), Postives = 125/148 (84.46%), Query Frame = 3
Query:  171 EQSYIMIKPDGVQRGLVGKIISRFEERGFKLAAMKMMTPDRAMLEKHYEDLKEKSFFPGLINYMLSGPVVCMVWQGYEAVKIGRALLGATRPIDSLPGTIRGDFCQVAGRNVIHGSDGVESAMKEIALWFNPDEIAEYKLCTEEWVQE 614
            E++YIMIKPDGVQRGLVGKII RFE+RGF+L AMKMM P R +LE+HY DLK K FFPGLI+YMLSGPVVCMVW+G E VKIGR +LGAT+PIDSLPGTIRGD+C V GRN++HGSD V SA KEIALWF P+E+ +YKL    W+ E
Sbjct:   10 ERTYIMIKPDGVQRGLVGKIIKRFEQRGFRLVAMKMMQPGRPLLEEHYGDLKAKPFFPGLIDYMLSGPVVCMVWEGEEVVKIGRMMLGATKPIDSLPGTIRGDYCIVTGRNIVHGSDAVASAQKEIALWFKPEELVDYKLANHGWIYE 157          
BLAST of Nucleoside diphosphate kinase vs. TrEMBL
Match: A0A267FR79 (Nucleoside diphosphate kinase (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig008873g2 PE=3 SV=1)

HSP 1 Score: 237.269 bits (604), Expect = 3.110e-76
Identity = 108/148 (72.97%), Postives = 125/148 (84.46%), Query Frame = 3
Query:  171 EQSYIMIKPDGVQRGLVGKIISRFEERGFKLAAMKMMTPDRAMLEKHYEDLKEKSFFPGLINYMLSGPVVCMVWQGYEAVKIGRALLGATRPIDSLPGTIRGDFCQVAGRNVIHGSDGVESAMKEIALWFNPDEIAEYKLCTEEWVQE 614
            E++YIMIKPDGVQRGLVGKII RFE+RGF+L AMKMM P R +LE+HY DLK K FFPGLI+YMLSGPVVCMVW+G E VKIGR +LGAT+PIDSLPGTIRGD+C V GRN++HGSD V SA KEIALWF P+E+ +YKL    W+ E
Sbjct:    9 ERTYIMIKPDGVQRGLVGKIIKRFEQRGFRLVAMKMMQPGRPLLEEHYGDLKAKPFFPGLIDYMLSGPVVCMVWEGEEVVKIGRMMLGATKPIDSLPGTIRGDYCIVTGRNIVHGSDAVASAQKEIALWFKPEELVDYKLANHGWIYE 156          
BLAST of Nucleoside diphosphate kinase vs. TrEMBL
Match: A0A0U5CN81 (Nucleoside diphosphate kinase OS=Aspergillus calidoustus OX=454130 GN=ASPCAL02699 PE=3 SV=1)

HSP 1 Score: 223.016 bits (567), Expect = 1.026e-70
Identity = 103/149 (69.13%), Postives = 119/149 (79.87%), Query Frame = 3
Query:  168 NEQSYIMIKPDGVQRGLVGKIISRFEERGFKLAAMKMMTPDRAMLEKHYEDLKEKSFFPGLINYMLSGPVVCMVWQGYEAVKIGRALLGATRPIDSLPGTIRGDFCQVAGRNVIHGSDGVESAMKEIALWFNPDEIAEYKLCTEEWVQE 614
            NEQ++I IKPDGVQRGLVG IISRFE RGFKLAAMK+ +P RA+LE+HY DLKEK FFPGL+ YMLSGP+V MVW+G +AVK GR +LGAT P+ S PGTIRGDF    GRNV HGSD VE+A KEIALWF P+E+  YKL    W+ E
Sbjct:    3 NEQTFIAIKPDGVQRGLVGPIISRFENRGFKLAAMKLTSPPRALLEQHYADLKEKPFFPGLVTYMLSGPIVAMVWEGRDAVKTGRTILGATNPLASAPGTIRGDFAIDVGRNVCHGSDSVENAKKEIALWFTPEEVQNYKLNAFGWIYE 151          
BLAST of Nucleoside diphosphate kinase vs. TrEMBL
Match: A0A167Y6I5 (Nucleoside diphosphate kinase OS=Sporothrix insectorum RCEF 264 OX=1081102 GN=SPI_02692 PE=3 SV=1)

HSP 1 Score: 219.935 bits (559), Expect = 1.608e-69
Identity = 100/149 (67.11%), Postives = 119/149 (79.87%), Query Frame = 3
Query:  168 NEQSYIMIKPDGVQRGLVGKIISRFEERGFKLAAMKMMTPDRAMLEKHYEDLKEKSFFPGLINYMLSGPVVCMVWQGYEAVKIGRALLGATRPIDSLPGTIRGDFCQVAGRNVIHGSDGVESAMKEIALWFNPDEIAEYKLCTEEWVQE 614
             EQ++I IKPDGVQRGLVG IISRFE+RG+KL A+K+++P +A LE HY DLKEK FFP LI YMLSGP+V MVW+G +AVK GRALLGAT P++SLPGTIRGD+    GRNV HGSD VE+A KEIALWF  D++ EYK    +WV E
Sbjct:    3 TEQTFIAIKPDGVQRGLVGPIISRFEQRGYKLVALKLVSPTKAHLEAHYADLKEKPFFPSLITYMLSGPIVAMVWEGLDAVKTGRALLGATNPLNSLPGTIRGDYAIATGRNVCHGSDSVENAKKEIALWFGKDDLIEYKAAQHDWVYE 151          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Cavefish
Match: NME2 (nucleoside diphosphate kinase A2 [Source:NCBI gene;Acc:103034272])

HSP 1 Score: 200.29 bits (508), Expect = 3.778e-65
Identity = 87/153 (56.86%), Postives = 114/153 (74.51%), Query Frame = 3
Query:  156 MANYNEQSYIMIKPDGVQRGLVGKIISRFEERGFKLAAMKMMTPDRAMLEKHYEDLKEKSFFPGLINYMLSGPVVCMVWQGYEAVKIGRALLGATRPIDSLPGTIRGDFCQVAGRNVIHGSDGVESAMKEIALWFNPDEIAEYKLCTEEWVQE 614
            MA   E+++I IKPDGVQRGL+G+I+ RFE++GF+L AMK +     +L++HY DLK++ F+PGL+ YM SGPV+ MVW+G   VK GR +LG T P DS PGTIRGD C   GRN+IHGSD V+SA KEI+LWF P+E+  +K C  EW+ E
Sbjct:    1 MAAKTERTFIAIKPDGVQRGLMGEIVKRFEQKGFRLVAMKFLQASEDLLKQHYIDLKDRPFYPGLVKYMSSGPVLAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDLCIEVGRNIIHGSDSVDSANKEISLWFKPEELVSFKSCAHEWIYE 153          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Cavefish
Match: ENSAMXT00000008173.2 (nucleoside diphosphate kinase A-like [Source:NCBI gene;Acc:103046328])

HSP 1 Score: 197.978 bits (502), Expect = 6.194e-64
Identity = 85/153 (55.56%), Postives = 114/153 (74.51%), Query Frame = 3
Query:  150 LKMANYNEQSYIMIKPDGVQRGLVGKIISRFEERGFKLAAMKMMTPDRAMLEKHYEDLKEKSFFPGLINYMLSGPVVCMVWQGYEAVKIGRALLGATRPIDSLPGTIRGDFCQVAGRNVIHGSDGVESAMKEIALWFNPDEIAEYKLCTEEWV 608
            L MA+  E+++I IKPDGVQRGL+G+II RFE +GFKL  +K++     +L++HY DLK++ FFPGL++YM SGPVV MVW+G   +K GR +LG T P DS PGTIRGD+C   GRN+IHGSD ++SA  EI+LWF P+E+  Y  C + W+
Sbjct:   21 LPMASNQERTFIAIKPDGVQRGLIGEIIKRFELKGFKLVGLKILHASEDLLKQHYSDLKDRPFFPGLVSYMSSGPVVAMVWEGCNVIKTGRVMLGETNPADSKPGTIRGDYCIQVGRNIIHGSDSLDSASTEISLWFTPEELCNYSKCHDTWI 173          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Cavefish
Match: ENSAMXT00000034489.1 (nucleoside diphosphate kinase A2-like [Source:NCBI gene;Acc:103034806])

HSP 1 Score: 190.274 bits (482), Expect = 3.284e-61
Identity = 84/153 (54.90%), Postives = 112/153 (73.20%), Query Frame = 3
Query:  156 MANYNEQSYIMIKPDGVQRGLVGKIISRFEERGFKLAAMKMMTPDRAMLEKHYEDLKEKSFFPGLINYMLSGPVVCMVWQGYEAVKIGRALLGATRPIDSLPGTIRGDFCQVAGRNVIHGSDGVESAMKEIALWFNPDEIAEYKLCTEEWVQE 614
            MA+  E++++ IKPDGVQRGL+G+I+ RFE++GF+L AMK +     +L++HY DLK+  F+ GL+ YM SGPV+ MVW+G   VK GR +LG T P DS PGTIRGD C   GRN+IHGSD V+SA KEI LWF P+E+  +K C  E++ E
Sbjct:    1 MASKTERTFVAIKPDGVQRGLMGEIVKRFEQKGFRLVAMKFLQASEDLLKQHYIDLKDLPFYAGLVKYMSSGPVLAMVWEGANVVKTGRVMLGETNPADSKPGTIRGDLCIDIGRNLIHGSDSVDSANKEINLWFKPEEMVSFKCCAHEYIYE 153          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Cavefish
Match: nme3 (NME/NM23 nucleoside diphosphate kinase 3 [Source:NCBI gene;Acc:111193103])

HSP 1 Score: 183.726 bits (465), Expect = 2.029e-58
Identity = 82/147 (55.78%), Postives = 107/147 (72.79%), Query Frame = 3
Query:  168 NEQSYIMIKPDGVQRGLVGKIISRFEERGFKLAAMKMMTPDRAMLEKHYEDLKEKSFFPGLINYMLSGPVVCMVWQGYEAVKIGRALLGATRPIDSLPGTIRGDFCQVAGRNVIHGSDGVESAMKEIALWFNPDEIAEYKLCTEEWV 608
            NE++++ +KPDGVQR LVG+II RFE +GFKL  MK++      L +HY DL+E+ F+ GL+ YM SGP+V MVWQG + V++ R +LG T P DSLPGTIRGDFC   GRNVIHGSD VESA +EI+LWF   E+  +   T+ W+
Sbjct:   21 NERTFLAVKPDGVQRKLVGEIIRRFERKGFKLVGMKLLQASEEQLMEHYWDLRERPFYKGLVKYMSSGPIVAMVWQGLDVVRMSRRMLGETNPADSLPGTIRGDFCVEVGRNVIHGSDSVESAQREISLWFKDYELFCWDESTDHWI 167          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Cavefish
Match: nme3 (NME/NM23 nucleoside diphosphate kinase 3 [Source:NCBI gene;Acc:111193103])

HSP 1 Score: 183.726 bits (465), Expect = 2.392e-58
Identity = 82/147 (55.78%), Postives = 107/147 (72.79%), Query Frame = 3
Query:  168 NEQSYIMIKPDGVQRGLVGKIISRFEERGFKLAAMKMMTPDRAMLEKHYEDLKEKSFFPGLINYMLSGPVVCMVWQGYEAVKIGRALLGATRPIDSLPGTIRGDFCQVAGRNVIHGSDGVESAMKEIALWFNPDEIAEYKLCTEEWV 608
            NE++++ +KPDGVQR LVG+II RFE +GFKL  MK++      L +HY DL+E+ F+ GL+ YM SGP+V MVWQG + V++ R +LG T P DSLPGTIRGDFC   GRNVIHGSD VESA +EI+LWF   E+  +   T+ W+
Sbjct:   32 NERTFLAVKPDGVQRKLVGEIIRRFERKGFKLVGMKLLQASEEQLMEHYWDLRERPFYKGLVKYMSSGPIVAMVWQGLDVVRMSRRMLGETNPADSLPGTIRGDFCVEVGRNVIHGSDSVESAQREISLWFKDYELFCWDESTDHWI 178          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Sea Lamprey
Match: nme3 (NME/NM23 nucleoside diphosphate kinase 3 [Source:ZFIN;Acc:ZDB-GENE-000210-34])

HSP 1 Score: 177.563 bits (449), Expect = 9.593e-57
Identity = 83/149 (55.70%), Postives = 107/149 (71.81%), Query Frame = 3
Query:  168 NEQSYIMIKPDGVQRGLVGKIISRFEERGFKLAAMKMMTPDRAMLEKHYEDLKEKSFFPGLINYMLSGPVVCMVWQGYEAVKIGRALLGATRPIDSLPGTIRGDFCQVAGRNVIHGSDGVESAMKEIALWFNPDEIAEYKLCTEEWVQE 614
            +E++ + IKPDGVQR L+G I+ RFE +G KL AMK + P  A+L++HY DLK+K+F+  L+ +M SGPV+ MVW+G   V+  R +LG T P DS PGTIRGDFC   GRNVIHGSD  ESA KEI+LWF P+E+  +   TE WV E
Sbjct:   20 HERTLLAIKPDGVQRRLMGDIVKRFEGKGLKLVAMKFLKPPVALLQQHYIDLKDKAFYSSLVQFMNSGPVLAMVWEGNGVVRTCRRMLGETDPADSAPGTIRGDFCIDIGRNVIHGSDSEESAQKEISLWFQPEELVTWYSNTEAWVYE 168          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Sea Lamprey
Match: nme6 (NME/NM23 nucleoside diphosphate kinase 6 [Source:NCBI gene;Acc:58120])

HSP 1 Score: 68.5514 bits (166), Expect = 1.064e-14
Identity = 41/135 (30.37%), Postives = 70/135 (51.85%), Query Frame = 3
Query:  186 MIKPDGVQRGLVGKIISR-FEERGFKLAAMKMMTPDRAMLEKHYEDLKEKSFFPGLINYMLSGPVVCMVWQGYEAVKIGRALLGAT---RPIDSLPGTIRGDFCQVAGRNVIHGSDGVESAMKEIALWFNPDEIA 578
            ++KPD +  G+  + + +   +  F +   K +   R+  E+ Y   K K FF  L+ +M SGP+   V   ++AV+  R L+G T   R + + P +IR  +     RN  HGSD   SA++EI+ +F   ++A
Sbjct:   16 LLKPDALAHGIAWEAVHQDVLKNKFLIVKSKELRLKRSDSERFYAAHKGKFFFQRLVEFMASGPIRVYVLAHHDAVRGWRELMGPTKVFRAVHTAPESIRACYGLTDTRNTTHGSDSSASALQEISFFFPEFDVA 150          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008106.1 (pep scaffold:Pmarinus_7.0:GL476850:19893:22834:-1 gene:ENSPMAG00000007330.1 transcript:ENSPMAT00000008106.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 49.2914 bits (116), Expect = 3.939e-8
Identity = 28/118 (23.73%), Postives = 54/118 (45.76%), Query Frame = 3
Query:  216 LVGKIISRFEERGFKLAAMKMMTPDRAMLEKHYEDLKEKSFFPGLINYMLSGPVVCMVWQGYEAVKIGRALLGATRPI---DSLPGTIRGDFCQVAGRNVIHGSDGVESAMKEIALWF 560
            +   ++   +E GF +A  K +        + Y + + + +F  L+ +M  GP + +V    +AV+  R L+G   P     + P ++R  F +    N +HG+  +  A + I L F
Sbjct:    3 MADTVLGAIKEAGFHIAMQKEVILTEEQAREFYREHEGQDYFGTLVKHMTRGPSLMLVLNREDAVEEWRRLMGPADPDVARKTAPESLRARFARSLLENALHGASNLHHAQENIHLLF 120          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Yeast
Match: YNK1 (Nucleoside diphosphate kinase; catalyzes the transfer of gamma phosphates from nucleoside triphosphates, usually ATP, to nucleoside diphosphates by a mechanism that involves formation of an autophosphorylated enzyme intermediate; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000001550])

HSP 1 Score: 171.4 bits (433), Expect = 9.360e-55
Identity = 75/153 (49.02%), Postives = 112/153 (73.20%), Query Frame = 3
Query:  156 MANYNEQSYIMIKPDGVQRGLVGKIISRFEERGFKLAAMKMMTPDRAMLEKHYEDLKEKSFFPGLINYMLSGPVVCMVWQGYEAVKIGRALLGATRPIDSLPGTIRGDFCQVAGRNVIHGSDGVESAMKEIALWFNPDEIAEYKLCTEEWVQE 614
            M++  E+++I +KPDGVQRGLV +I+SRFE++G+KL A+K++  D  +LE+HY +   K FFP ++++M SGP++  VW+G + V+ GR +LGAT P+ S PGTIRGDF    GRNV HGSD V+SA +EI LWF  +E+ +++    +W+ E
Sbjct:    1 MSSQTERTFIAVKPDGVQRGLVSQILSRFEKKGYKLVAIKLVKADDKLLEQHYAEHVGKPFFPKMVSFMKSGPILATVWEGKDVVRQGRTILGATNPLGSAPGTIRGDFGIDLGRNVCHGSDSVDSAEREINLWFKKEELVDWESNQAKWIYE 153          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Nematostella
Match: EDO37954 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SE67])

HSP 1 Score: 189.504 bits (480), Expect = 3.356e-61
Identity = 85/143 (59.44%), Postives = 107/143 (74.83%), Query Frame = 3
Query:  156 MANYNEQSYIMIKPDGVQRGLVGKIISRFEERGFKLAAMKMMTPDRAMLEKHYEDLKEKSFFPGLINYMLSGPVVCMVWQGYEAVKIGRALLGATRPIDSLPGTIRGDFCQVAGRNVIHGSDGVESAMKEIALWFNPDEIAEY 584
            + N  E+++IM+KPDGVQRGLVG+II RFE++GFKL A+KM+      L+KHY DL    F+PGL+ +M SGPVV MVW+G   VK GR +LG T P DS PGTIRGDFC   GRN+IHGSD  +SA KEIALWF+P E+ ++
Sbjct:   12 LQNKGERTFIMVKPDGVQRGLVGEIIKRFEQKGFKLVALKMVQESEEHLKKHYADLAHLPFYPGLVKFMSSGPVVAMVWEGAGVVKTGRVMLGETNPADSKPGTIRGDFCVHIGRNIIHGSDSTDSANKEIALWFSPKELVDW 154          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Nematostella
Match: EDO37955 (Nucleoside diphosphate kinase [Source:UniProtKB/TrEMBL;Acc:A7SE68])

HSP 1 Score: 173.711 bits (439), Expect = 3.684e-55
Identity = 82/153 (53.59%), Postives = 103/153 (67.32%), Query Frame = 3
Query:  156 MANYNEQSYIMIKPDGVQRGLVGKIISRFEERGFKLAAMKMMTPDRAMLEKHYEDLKEKSFFPGLINYMLSGPVVCMVWQGYEAVKIGRALLGATRPIDSLPGTIRGDFCQVAGRNVIHGSDGVESAMKEIALWFNPDEIAEYKLCTEEWVQE 614
            M+N NE++++MIKPD V RGL+G+IISRFE++GFKL AMK +        KHYE L +  F+ GL  YM   PV  MVW+G   VK  R +LG T P  SLPGTIRGDF    GRN+IHGSD VE+A +EIALWF  DE+ ++  C   W+ E
Sbjct:    1 MSN-NERTFLMIKPDAVSRGLIGEIISRFEKKGFKLVAMKFVKKSEDHFRKHYESLAKLKFYDGLCKYMSQTPVCAMVWEGLGVVKTARVMLGETDPAKSLPGTIRGDFSIHIGRNIIHGSDAVETAKEEIALWFKDDELVDWTPCNNPWMYE 152          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Nematostella
Match: EDO50065 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFA5])

HSP 1 Score: 84.7297 bits (208), Expect = 1.910e-19
Identity = 47/140 (33.57%), Postives = 75/140 (53.57%), Query Frame = 3
Query:  153 KMANYNEQSYIMIKPDGVQRGLVGKIISRFEERGFKLAAMKMMTPDRAMLEKHYEDLKEKSFFPGLINYMLSGPVVCMVWQGYEAVKIGRALLGATRPI---DSLPGTIRGDFCQVAGRNVIHGSDGVESAMKEIALWFN 563
            ++ N NE++  MIKPD V  G +G I+   ++ GFKL   KM+  +R      Y++   + F+  L+ ++ SGPVV    +G  AV   R +LG T      +  P ++R  F     +N  HGSD  ESA +E++ +F+
Sbjct:   83 RLKNINEKTLAMIKPDAV--GCLGGIMEMIDQAGFKLCRAKMVRLNRKEASDFYQEHASQPFYDRLVEFISSGPVVAFELKGPGAVDSWRKVLGPTDSATARNQAPLSVRAKFGTDNTKNAAHGSDSTESAEREVSFFFD 220          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Nematostella
Match: EDO34502 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SP47])

HSP 1 Score: 84.7297 bits (208), Expect = 4.024e-19
Identity = 47/140 (33.57%), Postives = 75/140 (53.57%), Query Frame = 3
Query:  153 KMANYNEQSYIMIKPDGVQRGLVGKIISRFEERGFKLAAMKMMTPDRAMLEKHYEDLKEKSFFPGLINYMLSGPVVCMVWQGYEAVKIGRALLGATRPI---DSLPGTIRGDFCQVAGRNVIHGSDGVESAMKEIALWFN 563
            ++ N NE++  MIKPD V  G +G I+   ++ GFKL   KM+  +R      Y++   + F+  L+ ++ SGPVV    +G  AV   R +LG T      +  P ++R  F     +N  HGSD  ESA +E++ +F+
Sbjct:   83 RLKNINEKTLAMIKPDAV--GCLGGIMEMIDQAGFKLCRAKMVRLNRKEASDFYQEHASQPFYDRLVEFISSGPVVAFELKGPGAVDSWRKVLGPTDSATARNQAPLSVRAKFGTDNTKNAAHGSDSTESAEREVSFFFD 220          

HSP 2 Score: 58.5362 bits (140), Expect = 4.193e-10
Identity = 37/151 (24.50%), Postives = 73/151 (48.34%), Query Frame = 3
Query:  138 ISYFL-----KMANYNEQSYIMIKPDGVQRGLVGKIISRFEERGFKLAAMKMMTPDRAMLEKHYEDLK--EKSFFPGLINYMLSGPVVCMVWQGYEAVKIGRALLGATRPIDS---LPGTIRGDFCQVAGRNVIHGSDGVESAMKEIALWF 560
            +S+F        A  N  +  ++KP  V  GL G+I+   ++ GF+++A++M   +RA  E+ +E  K     +   ++  + SGP + +  +G +  K  R  +G   P  +    P ++R  F +   +N +H +D  E  + E+  +F
Sbjct:  215 VSFFFDKRRQNTAVLNNCTLCVVKPHAVADGLSGRIVLAIQDAGFEISALQMFHLERANAEEFHEVYKGVVNEYERNMVEELCSGPCLAVEVRGQDVTKTFRDFVGPADPEIARHLRPKSLRAKFGKDKIKNAVHCTDLPEDGLLEVEYFF 365          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Nematostella
Match: EDO39201 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAT1])

HSP 1 Score: 73.9442 bits (180), Expect = 4.969e-16
Identity = 50/150 (33.33%), Postives = 76/150 (50.67%), Query Frame = 3
Query:  147 FLKMANYNEQSYIMIKPDGVQRGLVGKIISRFEERGFKLAAMK--MMTPDRAMLEKHYEDLKEKSFFPGLINYMLSGPVVCMVWQGYEAVKIGRALLGAT---RPIDSLPGTIRGDFCQVAGRNVIHGSDGVESAMKEIALWFNPDEIAE 581
            F   A + E++  +IKPD V +    +I     + GF +   +   +TP++      Y +   K FFP L+ YM SGP++ +V     A+   R L+G T   +  D  P ++R  +   + RN +HGSDG  SA KEI  +F PD I E
Sbjct:   10 FPPPAIHIERTLALIKPDAVHKS--DEIEEIILQHGFTILQKRRAHLTPEQT--SDFYAEHYGKMFFPSLVAYMSSGPIMALVLARENAISYWRQLIGPTNTQKARDQAPESLRAIYGTDSTRNALHGSDGTVSADKEIHFFF-PDSIVE 154          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Medaka
Match: nme2a (nucleoside diphosphate kinase A [Source:NCBI gene;Acc:101158485])

HSP 1 Score: 194.512 bits (493), Expect = 7.436e-63
Identity = 88/151 (58.28%), Postives = 109/151 (72.19%), Query Frame = 3
Query:  156 MANYNEQSYIMIKPDGVQRGLVGKIISRFEERGFKLAAMKMMTPDRAMLEKHYEDLKEKSFFPGLINYMLSGPVVCMVWQGYEAVKIGRALLGATRPIDSLPGTIRGDFCQVAGRNVIHGSDGVESAMKEIALWFNPDEIAEYKLCTEEWV 608
            +AN  E+++I IKPDGVQRG++G+II RFE +GFKL  MKM+     +L KHY DLK++ FFP L+NYM SGPVV MVW+G   VK GR +LG T P DS PGTIRGDFC    +N+IHGSD VESA  EI+LWF P+E+  Y  C   W+
Sbjct:    1 LANGQERTFIAIKPDGVQRGIIGEIIKRFEMKGFKLVGMKMVQASEDLLMKHYIDLKDRPFFPTLVNYMSSGPVVAMVWEGKGVVKTGRVMLGETNPADSKPGTIRGDFCIDVSKNIIHGSDSVESANTEISLWFQPEELVSYTSCAFSWL 151          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Medaka
Match: nme2a (nucleoside diphosphate kinase A [Source:NCBI gene;Acc:101158485])

HSP 1 Score: 194.897 bits (494), Expect = 9.494e-63
Identity = 91/167 (54.49%), Postives = 115/167 (68.86%), Query Frame = 3
Query:  108 LACLYNYKVRISYFLKMANYNEQSYIMIKPDGVQRGLVGKIISRFEERGFKLAAMKMMTPDRAMLEKHYEDLKEKSFFPGLINYMLSGPVVCMVWQGYEAVKIGRALLGATRPIDSLPGTIRGDFCQVAGRNVIHGSDGVESAMKEIALWFNPDEIAEYKLCTEEWV 608
            L  L+ +K    +F+K     E+++I IKPDGVQRG++G+II RFE +GFKL  MKM+     +L KHY DLK++ FFP L+NYM SGPVV MVW+G   VK GR +LG T P DS PGTIRGDFC    +N+IHGSD VESA  EI+LWF P+E+  Y  C   W+
Sbjct:    6 LGTLFIHKC---HFMKDNELQERTFIAIKPDGVQRGIIGEIIKRFEMKGFKLVGMKMVQASEDLLMKHYIDLKDRPFFPTLVNYMSSGPVVAMVWEGKGVVKTGRVMLGETNPADSKPGTIRGDFCIDVSKNIIHGSDSVESANTEISLWFQPEELVSYTSCAFSWL 169          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Medaka
Match: nme2a (nucleoside diphosphate kinase A [Source:NCBI gene;Acc:101158485])

HSP 1 Score: 191.43 bits (485), Expect = 1.390e-61
Identity = 86/147 (58.50%), Postives = 106/147 (72.11%), Query Frame = 3
Query:  168 NEQSYIMIKPDGVQRGLVGKIISRFEERGFKLAAMKMMTPDRAMLEKHYEDLKEKSFFPGLINYMLSGPVVCMVWQGYEAVKIGRALLGATRPIDSLPGTIRGDFCQVAGRNVIHGSDGVESAMKEIALWFNPDEIAEYKLCTEEWV 608
             E+++I IKPDGVQRG++G+II RFE +GFKL  MKM+     +L KHY DLK++ FFP L+NYM SGPVV MVW+G   VK GR +LG T P DS PGTIRGDFC    +N+IHGSD VESA  EI+LWF P+E+  Y  C   W+
Sbjct:   15 QERTFIAIKPDGVQRGIIGEIIKRFEMKGFKLVGMKMVQASEDLLMKHYIDLKDRPFFPTLVNYMSSGPVVAMVWEGKGVVKTGRVMLGETNPADSKPGTIRGDFCIDVSKNIIHGSDSVESANTEISLWFQPEELVSYTSCAFSWL 161          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Medaka
Match: nme2a (nucleoside diphosphate kinase A [Source:NCBI gene;Acc:101158485])

HSP 1 Score: 191.045 bits (484), Expect = 1.427e-61
Identity = 86/147 (58.50%), Postives = 107/147 (72.79%), Query Frame = 3
Query:  168 NEQSYIMIKPDGVQRGLVGKIISRFEERGFKLAAMKMMTPDRAMLEKHYEDLKEKSFFPGLINYMLSGPVVCMVWQGYEAVKIGRALLGATRPIDSLPGTIRGDFCQVAGRNVIHGSDGVESAMKEIALWFNPDEIAEYKLCTEEWV 608
            +E+++I IKPDGVQRG++G+II RFE +GFKL  MKM+     +L KHY DLK++ FFP L+NYM SGPVV MVW+G   VK GR +LG T P DS PGTIRGDFC    +N+IHGSD VESA  EI+LWF P+E+  Y  C   W+
Sbjct:    3 SERTFIAIKPDGVQRGIIGEIIKRFEMKGFKLVGMKMVQASEDLLMKHYIDLKDRPFFPTLVNYMSSGPVVAMVWEGKGVVKTGRVMLGETNPADSKPGTIRGDFCIDVSKNIIHGSDSVESANTEISLWFQPEELVSYTSCAFSWL 149          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Medaka
Match: nme2a (nucleoside diphosphate kinase A [Source:NCBI gene;Acc:101158485])

HSP 1 Score: 191.045 bits (484), Expect = 1.716e-61
Identity = 86/151 (56.95%), Postives = 108/151 (71.52%), Query Frame = 3
Query:  156 MANYNEQSYIMIKPDGVQRGLVGKIISRFEERGFKLAAMKMMTPDRAMLEKHYEDLKEKSFFPGLINYMLSGPVVCMVWQGYEAVKIGRALLGATRPIDSLPGTIRGDFCQVAGRNVIHGSDGVESAMKEIALWFNPDEIAEYKLCTEEWV 608
            ++   E+++I IKPDGVQRG++G+II RFE +GFKL  MKM+     +L KHY DLK++ FFP L+NYM SGPVV MVW+G   VK GR +LG T P DS PGTIRGDFC    +N+IHGSD VESA  EI+LWF P+E+  Y  C   W+
Sbjct:    1 LSGLMERTFIAIKPDGVQRGIIGEIIKRFEMKGFKLVGMKMVQASEDLLMKHYIDLKDRPFFPTLVNYMSSGPVVAMVWEGKGVVKTGRVMLGETNPADSKPGTIRGDFCIDVSKNIIHGSDSVESANTEISLWFQPEELVSYTSCAFSWL 151          
BLAST of Nucleoside diphosphate kinase vs. Planmine SMEST
Match: SMESG000056344.1 (SMESG000056344.1)

HSP 1 Score: 319.316 bits (817), Expect = 3.395e-112
Identity = 152/153 (99.35%), Postives = 152/153 (99.35%), Query Frame = 3
Query:  156 MANYNEQSYIMIKPDGVQRGLVGKIISRFEERGFKLAAMKMMTPDRAMLEKHYEDLKEKSFFPGLINYMLSGPVVCMVWQGYEAVKIGRALLGATRPIDSLPGTIRGDFCQVAGRNVIHGSDGVESAMKEIALWFNPDEIAEYKLCTEEWVQE 614
            MANYNEQSYIMIKPDG QRGLVGKIISRFEERGFKLAAMKMMTPDRAMLEKHYEDLKEKSFFPGLINYMLSGPVVCMVWQGYEAVKIGRALLGATRPIDSLPGTIRGDFCQVAGRNVIHGSDGVESAMKEIALWFNPDEIAEYKLCTEEWVQE
Sbjct:    1 MANYNEQSYIMIKPDGAQRGLVGKIISRFEERGFKLAAMKMMTPDRAMLEKHYEDLKEKSFFPGLINYMLSGPVVCMVWQGYEAVKIGRALLGATRPIDSLPGTIRGDFCQVAGRNVIHGSDGVESAMKEIALWFNPDEIAEYKLCTEEWVQE 153          
BLAST of Nucleoside diphosphate kinase vs. Planmine SMEST
Match: SMESG000008082.1 (SMESG000008082.1)

HSP 1 Score: 258.84 bits (660), Expect = 3.788e-88
Identity = 117/153 (76.47%), Postives = 133/153 (86.93%), Query Frame = 3
Query:  156 MANYNEQSYIMIKPDGVQRGLVGKIISRFEERGFKLAAMKMMTPDRAMLEKHYEDLKEKSFFPGLINYMLSGPVVCMVWQGYEAVKIGRALLGATRPIDSLPGTIRGDFCQVAGRNVIHGSDGVESAMKEIALWFNPDEIAEYKLCTEEWVQE 614
            M  Y E+SYIM+KPDGVQRGLVG II RFE+RGFKL A+KMM PD+ +LE HY+DLK+K FF  LI YMLSGPVVCM+WQG+EAVKIGRALLGATRPIDSLPGTIRGDFCQVAGRN++HGSD V+ A +EI+LWFNP EI +YKLC E WVQE
Sbjct:   15 MDVYQEKSYIMVKPDGVQRGLVGTIIMRFEQRGFKLIALKMMKPDKKLLETHYQDLKDKPFFSKLIEYMLSGPVVCMIWQGFEAVKIGRALLGATRPIDSLPGTIRGDFCQVAGRNIVHGSDSVDGAKREISLWFNPKEIGDYKLCNEVWVQE 167          
BLAST of Nucleoside diphosphate kinase vs. Planmine SMEST
Match: SMESG000008082.1 (SMESG000008082.1)

HSP 1 Score: 258.07 bits (658), Expect = 4.748e-88
Identity = 117/153 (76.47%), Postives = 133/153 (86.93%), Query Frame = 3
Query:  156 MANYNEQSYIMIKPDGVQRGLVGKIISRFEERGFKLAAMKMMTPDRAMLEKHYEDLKEKSFFPGLINYMLSGPVVCMVWQGYEAVKIGRALLGATRPIDSLPGTIRGDFCQVAGRNVIHGSDGVESAMKEIALWFNPDEIAEYKLCTEEWVQE 614
            M  Y E+SYIM+KPDGVQRGLVG II RFE+RGFKL A+KMM PD+ +LE HY+DLK+K FF  LI YMLSGPVVCM+WQG+EAVKIGRALLGATRPIDSLPGTIRGDFCQVAGRN++HGSD V+ A +EI+LWFNP EI +YKLC E WVQE
Sbjct:    1 MDVYQEKSYIMVKPDGVQRGLVGTIIMRFEQRGFKLIALKMMKPDKKLLETHYQDLKDKPFFSKLIEYMLSGPVVCMIWQGFEAVKIGRALLGATRPIDSLPGTIRGDFCQVAGRNIVHGSDSVDGAKREISLWFNPKEIGDYKLCNEVWVQE 153          
BLAST of Nucleoside diphosphate kinase vs. Planmine SMEST
Match: SMESG000039529.1 (SMESG000039529.1)

HSP 1 Score: 72.0182 bits (175), Expect = 3.827e-15
Identity = 47/142 (33.10%), Postives = 73/142 (51.41%), Query Frame = 3
Query:  171 EQSYIMIKPDGVQRGLVGKIISRFEERGFKLAAMK--MMTPDRAMLEKHYEDLKEKSFFPGLINYMLSGPVVCMVWQGYEAVKIGRALLGATRPID---SLPGTIRGDFCQVAGRNVIHGSDGVESAMKEIALWFNPDEIAE 581
            E++  +IKPD + R    +I+ R  + GF +   K   +TP+ A     Y +   K FFP LI YM SGPV  +V     A+ + R ++G T  +    + P ++R  +     RN  HGSD   SA +EI  +F P+++ E
Sbjct:   17 ERTLAIIKPDAIHR--TDEIVKRILDHGFHIIQQKRVHLTPEEA--SDFYTEHFGKLFFPSLIAYMSSGPVHVIVLSHENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRFFF-PEDVIE 153          
BLAST of Nucleoside diphosphate kinase vs. Planmine SMEST
Match: SMESG000061846.1 (SMESG000061846.1)

HSP 1 Score: 69.707 bits (169), Expect = 1.073e-14
Identity = 47/138 (34.06%), Postives = 68/138 (49.28%), Query Frame = 3
Query:  171 EQSYIMIKPDGVQR-----GLVGKIISRFEERGFKLAAMKMMTPDRAMLEKHYEDLKEKSFFPGLINYMLSGPVVCMVWQGYEAVKIGRALLGAT---RPIDSLPGTIRGDFCQVAGRNVIHGSDGVESAMKEIALWF 560
            E +  + KPD VQR          IIS++     ++   K +  ++ + EK Y + K K ++  L+NYM  G +   + +G  A+   R LLG T   R I   PG++RG F     RN  HGSD  E+A  EI L F
Sbjct:    5 ELTLALFKPD-VQRFRNYVKQTENIISKY---NLEILHHKQLVINKNLAEKFYTNHKGKFYYDRLVNYMTCGLIGAYILRGENAISNWRLLLGPTKVYRAIHEQPGSLRGQFGLTDTRNGYHGSDSQENAFTEIKLIF 138          
The following BLAST results are available for this feature:
BLAST of Nucleoside diphosphate kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NME21.427e-6661.44NME/NM23 nucleoside diphosphate kinase 2 [Source:H... [more]
NME21.427e-6661.44NME/NM23 nucleoside diphosphate kinase 2 [Source:H... [more]
NME21.427e-6661.44NME/NM23 nucleoside diphosphate kinase 2 [Source:H... [more]
NME21.427e-6661.44NME/NM23 nucleoside diphosphate kinase 2 [Source:H... [more]
NME21.427e-6661.44NME/NM23 nucleoside diphosphate kinase 2 [Source:H... [more]
back to top
BLAST of Nucleoside diphosphate kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ndk-11.388e-6462.34Nucleoside diphosphate kinase [Source:UniProtKB/T... [more]
ndk-11.388e-6462.34Nucleoside diphosphate kinase [Source:UniProtKB/T... [more]
ndk-11.388e-6462.34Nucleoside diphosphate kinase [Source:UniProtKB/T... [more]
ndk-11.388e-6462.34Nucleoside diphosphate kinase [Source:UniProtKB/T... [more]
back to top
BLAST of Nucleoside diphosphate kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
awd6.845e-6962.75gene:FBgn0000150 transcript:FBtr0346150[more]
awd6.845e-6962.75gene:FBgn0000150 transcript:FBtr0339146[more]
awd7.301e-6962.75gene:FBgn0000150 transcript:FBtr0346611[more]
nmdyn-D62.287e-1229.32gene:FBgn0030573 transcript:FBtr0073933[more]
nmdyn-D74.272e-726.03gene:FBgn0028997 transcript:FBtr0082083[more]
back to top
BLAST of Nucleoside diphosphate kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nme2a4.715e-7061.18NME/NM23 nucleoside diphosphate kinase 2a [Source:... [more]
nme2a4.715e-7061.18NME/NM23 nucleoside diphosphate kinase 2a [Source:... [more]
nme2a4.715e-7061.18NME/NM23 nucleoside diphosphate kinase 2a [Source:... [more]
nme2a4.715e-7061.18NME/NM23 nucleoside diphosphate kinase 2a [Source:... [more]
nme2b.11.139e-6455.56NME/NM23 nucleoside diphosphate kinase 2b, tandem ... [more]
back to top
BLAST of Nucleoside diphosphate kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
c1orf1122.232e-6660.78chromosome 1 open reading frame 112 [Source:Xenbas... [more]
c1orf1123.441e-6660.78chromosome 1 open reading frame 112 [Source:Xenbas... [more]
sox83.643e-5856.38SRY-box 8 [Source:Xenbase;Acc:XB-GENE-480865][more]
sox81.016e-5756.38SRY-box 8 [Source:Xenbase;Acc:XB-GENE-480865][more]
man1c11.464e-4947.06mannosidase, alpha, class 1C, member 1 [Source:Xen... [more]
back to top
BLAST of Nucleoside diphosphate kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nme29.378e-6762.09NME/NM23 nucleoside diphosphate kinase 2 [Source:M... [more]
Nme29.378e-6762.09NME/NM23 nucleoside diphosphate kinase 2 [Source:M... [more]
Nme14.414e-6659.48NME/NM23 nucleoside diphosphate kinase 1 [Source:M... [more]
Gm203902.726e-6562.09predicted gene 20390 [Source:MGI Symbol;Acc:MGI:51... [more]
Nme32.750e-5653.29NME/NM23 nucleoside diphosphate kinase 3 [Source:M... [more]
back to top
BLAST of Nucleoside diphosphate kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8TFN0|NDK_EMENI9.896e-7267.79Nucleoside diphosphate kinase OS=Emericella nidula... [more]
sp|P08879|NDKA_DROME7.318e-6862.75Nucleoside diphosphate kinase OS=Drosophila melano... [more]
sp|Q6XI71|NDKA_DROYA8.251e-6763.51Nucleoside diphosphate kinase (Fragment) OS=Drosop... [more]
sp|Q7Z8P9|NDK_ASPFU9.406e-6763.09Nucleoside diphosphate kinase OS=Neosartorya fumig... [more]
sp|P52174|NDKA1_BOVIN1.954e-6661.44Nucleoside diphosphate kinase A 1 OS=Bos taurus OX... [more]
back to top
BLAST of Nucleoside diphosphate kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0F7CYH31.673e-8476.47Nucleoside diphosphate kinase (Fragment) OS=Schmid... [more]
A0A267FLE02.883e-7672.97Nucleoside diphosphate kinase OS=Macrostomum ligna... [more]
A0A267FR793.110e-7672.97Nucleoside diphosphate kinase (Fragment) OS=Macros... [more]
A0A0U5CN811.026e-7069.13Nucleoside diphosphate kinase OS=Aspergillus calid... [more]
A0A167Y6I51.608e-6967.11Nucleoside diphosphate kinase OS=Sporothrix insect... [more]
back to top
BLAST of Nucleoside diphosphate kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NME23.778e-6556.86nucleoside diphosphate kinase A2 [Source:NCBI gene... [more]
ENSAMXT00000008173.26.194e-6455.56nucleoside diphosphate kinase A-like [Source:NCBI ... [more]
ENSAMXT00000034489.13.284e-6154.90nucleoside diphosphate kinase A2-like [Source:NCBI... [more]
nme32.029e-5855.78NME/NM23 nucleoside diphosphate kinase 3 [Source:N... [more]
nme32.392e-5855.78NME/NM23 nucleoside diphosphate kinase 3 [Source:N... [more]
back to top
BLAST of Nucleoside diphosphate kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
nme39.593e-5755.70NME/NM23 nucleoside diphosphate kinase 3 [Source:Z... [more]
nme61.064e-1430.37NME/NM23 nucleoside diphosphate kinase 6 [Source:N... [more]
ENSPMAT00000008106.13.939e-823.73pep scaffold:Pmarinus_7.0:GL476850:19893:22834:-1 ... [more]
back to top
BLAST of Nucleoside diphosphate kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
YNK19.360e-5549.02Nucleoside diphosphate kinase; catalyzes the trans... [more]
back to top
BLAST of Nucleoside diphosphate kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO379543.356e-6159.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO379553.684e-5553.59Nucleoside diphosphate kinase [Source:UniProtKB/T... [more]
EDO500651.910e-1933.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO345024.024e-1933.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO392014.969e-1633.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Nucleoside diphosphate kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nme2a7.436e-6358.28nucleoside diphosphate kinase A [Source:NCBI gene;... [more]
nme2a9.494e-6354.49nucleoside diphosphate kinase A [Source:NCBI gene;... [more]
nme2a1.390e-6158.50nucleoside diphosphate kinase A [Source:NCBI gene;... [more]
nme2a1.427e-6158.50nucleoside diphosphate kinase A [Source:NCBI gene;... [more]
nme2a1.716e-6156.95nucleoside diphosphate kinase A [Source:NCBI gene;... [more]
back to top
BLAST of Nucleoside diphosphate kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000056344.13.395e-11299.35SMESG000056344.1[more]
SMESG000008082.13.788e-8876.47SMESG000008082.1[more]
SMESG000008082.14.748e-8876.47SMESG000008082.1[more]
SMESG000039529.13.827e-1533.10SMESG000039529.1[more]
SMESG000061846.11.073e-1434.06SMESG000061846.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019263 ID=SMED30019263|Name=Nucleoside diphosphate kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=746bp
CTTTAATAAAGCATGTTTAAATTATAATTTAATTTATATTATCAGCCATA
CAAGTTTTGCTAACAAAACGAAATTTATTCTAAATATTTTTAGAAATTAA
AATTAAATTAGCTTGTTTATATAATTATAAAGTACGTATAAGTTATTTCT
TAAAAATGGCAAATTATAATGAACAATCTTATATTATGATTAAGCCAGAT
GGCGTCCAACGGGGTTTGGTTGGAAAAATAATTTCCCGTTTTGAAGAACG
AGGATTCAAACTTGCAGCAATGAAAATGATGACTCCTGATAGAGCAATGC
TCGAAAAACATTATGAAGATTTGAAAGAAAAATCATTTTTTCCAGGACTT
ATTAACTATATGTTGTCTGGACCAGTTGTTTGCATGGTTTGGCAAGGATA
TGAAGCTGTTAAAATCGGACGGGCTTTGTTAGGTGCAACCAGACCAATCG
ATTCATTACCCGGCACAATTCGGGGCGATTTTTGCCAAGTTGCTGGAAGA
AATGTTATTCACGGATCTGATGGTGTTGAAAGTGCAATGAAAGAAATTGC
CTTGTGGTTTAATCCTGATGAAATTGCTGAATATAAGTTATGTACTGAGG
AATGGGTGCAAGAATAAAAAGACTTATGTCACATCCTTTGATTGTCTTAC
AAATAGTCAATAAATGTCTTTCATTGACTATTTTTATATGGATTTGTATT
GGAATTTTATATTAAATTATAAATGTTTTATGTTTCTAAAAAAAAA
back to top

protein sequence of SMED30019263-orf-1

>SMED30019263-orf-1 ID=SMED30019263-orf-1|Name=SMED30019263-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=154bp
MANYNEQSYIMIKPDGVQRGLVGKIISRFEERGFKLAAMKMMTPDRAMLE
KHYEDLKEKSFFPGLINYMLSGPVVCMVWQGYEAVKIGRALLGATRPIDS
LPGTIRGDFCQVAGRNVIHGSDGVESAMKEIALWFNPDEIAEYKLCTEEW
VQE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR001564Nucleoside_diP_kinase
IPR023005Nucleoside_diP_kinase_AS
Vocabulary: molecular function
TermDefinition
GO:0004550nucleoside diphosphate kinase activity
GO:0000166nucleotide binding
GO:0005524ATP binding
GO:0016301kinase activity
GO:0016740transferase activity
Vocabulary: biological process
TermDefinition
GO:0006241CTP biosynthetic process
GO:0006165nucleoside diphosphate phosphorylation
GO:0006183GTP biosynthetic process
GO:0006228UTP biosynthetic process
GO:0016310phosphorylation