Heat shock transcription factor

Overview
NameHeat shock transcription factor
Smed IDSMED30019262
Length (bp)2088
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Heat shock transcription factor (SMED30019262) t-SNE clustered cells

Violin plots show distribution of expression levels for Heat shock transcription factor (SMED30019262) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Heat shock transcription factor (SMED30019262) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Heat shock transcription factor (SMED30019262) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Heat shock transcription factor vs. Ensembl Human
Match: HSF1 (heat shock transcription factor 1 [Source:HGNC Symbol;Acc:HGNC:5224])

HSP 1 Score: 143.28 bits (360), Expect = 7.811e-36
Identity = 73/196 (37.24%), Postives = 115/196 (58.67%), Query Frame = 2
Query:   47 SNSLPFPVKLKKIVDIPETDHLIFWDEDGLSFHIVDQNQFAHDIIPHYFKHNNISSFIRQLNMYGFHKINRIENGLAVIGNGTEDSQWSHPQFIRDKPELVANITRKVTNPSFNNSLVPRKAIGNIDNDNISYESVKNDLAHLVKAVQQLKQRDEETTEKLKTLQDENHQLYSVLMYLRDEHEKQSKLIDILIKFF 634
            SN   F  KL  +V  P+TD LI W   G SFH+ DQ QFA +++P YFKHNN++SF+RQLNMYGF K+  IE G  ++    +D+++ HP F+R + +L+ NI RKVT+            +  + +++I     ++ +  L+  VQ +K + E    KL  ++ EN  L+  +  LR +H +Q K+++ LI+F 
Sbjct:   13 SNVPAFLTKLWTLVSDPDTDALICWSPSGNSFHVFDQGQFAKEVLPKYFKHNNMASFVRQLNMYGFRKVVHIEQG-GLVKPERDDTEFQHPCFLRGQEQLLENIKRKVTS------------VSTLKSEDIKIR--QDSVTKLLTDVQLMKGKQECMDSKLLAMKHENEALWREVASLRQKHAQQQKVVNKLIQFL 193          
BLAST of Heat shock transcription factor vs. Ensembl Human
Match: HSF1 (heat shock transcription factor 1 [Source:HGNC Symbol;Acc:HGNC:5224])

HSP 1 Score: 143.28 bits (360), Expect = 7.811e-36
Identity = 73/196 (37.24%), Postives = 115/196 (58.67%), Query Frame = 2
Query:   47 SNSLPFPVKLKKIVDIPETDHLIFWDEDGLSFHIVDQNQFAHDIIPHYFKHNNISSFIRQLNMYGFHKINRIENGLAVIGNGTEDSQWSHPQFIRDKPELVANITRKVTNPSFNNSLVPRKAIGNIDNDNISYESVKNDLAHLVKAVQQLKQRDEETTEKLKTLQDENHQLYSVLMYLRDEHEKQSKLIDILIKFF 634
            SN   F  KL  +V  P+TD LI W   G SFH+ DQ QFA +++P YFKHNN++SF+RQLNMYGF K+  IE G  ++    +D+++ HP F+R + +L+ NI RKVT+            +  + +++I     ++ +  L+  VQ +K + E    KL  ++ EN  L+  +  LR +H +Q K+++ LI+F 
Sbjct:   13 SNVPAFLTKLWTLVSDPDTDALICWSPSGNSFHVFDQGQFAKEVLPKYFKHNNMASFVRQLNMYGFRKVVHIEQG-GLVKPERDDTEFQHPCFLRGQEQLLENIKRKVTS------------VSTLKSEDIKIR--QDSVTKLLTDVQLMKGKQECMDSKLLAMKHENEALWREVASLRQKHAQQQKVVNKLIQFL 193          
BLAST of Heat shock transcription factor vs. Ensembl Human
Match: HSF1 (heat shock transcription factor 1 [Source:HGNC Symbol;Acc:HGNC:5224])

HSP 1 Score: 142.51 bits (358), Expect = 2.223e-35
Identity = 73/196 (37.24%), Postives = 115/196 (58.67%), Query Frame = 2
Query:   47 SNSLPFPVKLKKIVDIPETDHLIFWDEDGLSFHIVDQNQFAHDIIPHYFKHNNISSFIRQLNMYGFHKINRIENGLAVIGNGTEDSQWSHPQFIRDKPELVANITRKVTNPSFNNSLVPRKAIGNIDNDNISYESVKNDLAHLVKAVQQLKQRDEETTEKLKTLQDENHQLYSVLMYLRDEHEKQSKLIDILIKFF 634
            SN   F  KL  +V  P+TD LI W   G SFH+ DQ QFA +++P YFKHNN++SF+RQLNMYGF K+  IE G  ++    +D+++ HP F+R + +L+ NI RKVT            ++  + +++I     ++ +  L+  VQ +K + E    KL  ++ EN  L+  +  LR +H +Q K+++ LI+F 
Sbjct:   13 SNVPAFLTKLWTLVSDPDTDALICWSPSGNSFHVFDQGQFAKEVLPKYFKHNNMASFVRQLNMYGFRKVVHIEQG-GLVKPERDDTEFQHPCFLRGQEQLLENIKRKVT------------SVSTLKSEDIKIR--QDSVTKLLTDVQLMKGKQECMDSKLLAMKHENEALWREVASLRQKHAQQQKVVNKLIQFL 193          
BLAST of Heat shock transcription factor vs. Ensembl Human
Match: HSF1 (heat shock transcription factor 1 [Source:HGNC Symbol;Acc:HGNC:5224])

HSP 1 Score: 142.51 bits (358), Expect = 2.223e-35
Identity = 73/196 (37.24%), Postives = 115/196 (58.67%), Query Frame = 2
Query:   47 SNSLPFPVKLKKIVDIPETDHLIFWDEDGLSFHIVDQNQFAHDIIPHYFKHNNISSFIRQLNMYGFHKINRIENGLAVIGNGTEDSQWSHPQFIRDKPELVANITRKVTNPSFNNSLVPRKAIGNIDNDNISYESVKNDLAHLVKAVQQLKQRDEETTEKLKTLQDENHQLYSVLMYLRDEHEKQSKLIDILIKFF 634
            SN   F  KL  +V  P+TD LI W   G SFH+ DQ QFA +++P YFKHNN++SF+RQLNMYGF K+  IE G  ++    +D+++ HP F+R + +L+ NI RKVT            ++  + +++I     ++ +  L+  VQ +K + E    KL  ++ EN  L+  +  LR +H +Q K+++ LI+F 
Sbjct:   13 SNVPAFLTKLWTLVSDPDTDALICWSPSGNSFHVFDQGQFAKEVLPKYFKHNNMASFVRQLNMYGFRKVVHIEQG-GLVKPERDDTEFQHPCFLRGQEQLLENIKRKVT------------SVSTLKSEDIKIR--QDSVTKLLTDVQLMKGKQECMDSKLLAMKHENEALWREVASLRQKHAQQQKVVNKLIQFL 193          
BLAST of Heat shock transcription factor vs. Ensembl Human
Match: HSF4 (heat shock transcription factor 4 [Source:HGNC Symbol;Acc:HGNC:5227])

HSP 1 Score: 131.339 bits (329), Expect = 4.292e-33
Identity = 82/258 (31.78%), Postives = 127/258 (49.22%), Query Frame = 2
Query:   41 SESNSLPFPV---KLKKIVDIPETDHLIFWDEDGLSFHIVDQNQFAHDIIPHYFKHNNISSFIRQLNMYGFHKINRIENGLAVIGNGTEDSQWSHPQFIRDKPELVANITRKVTNPSFNNSLVPRKAIGNIDNDNISYESVKNDLAHLVKAVQQLKQRDEETTEKLKTLQDENHQLYSVLMYLRDEHEKQSKLIDILIK-FFSIYANNPQENRLKSKRVLALEMPQSES------------PLMNLNEPPAKYFVASP 766
            +E    P P    KL  +V  P TDHLI W   G SF + DQ++FA +++P YFKH+N++SF+RQLNMYGF K+  IE G  ++    +  ++ HP F+R + +L+  + RKV                 +  D+  +     DL  L+  VQ L+   E T  +L+ L+ +N  L+  ++ LR  H +Q ++I  LI+  F      P  +    KR L+L + +  S            P   L +P   YF+ SP
Sbjct:   10 TEPGPSPVPAFLGKLWALVGDPGTDHLIRWSPSGTSFLVSDQSRFAKEVLPQYFKHSNMASFVRQLNMYGFRKVVSIEQG-GLLRPERDHVEFQHPSFVRGREQLLERVRRKVP---------------ALRGDDGRWRP--EDLGRLLGEVQALRGVQESTEARLRELRQQNEILWREVVTLRQSHGQQHRVIGKLIQCLFGPLQAGP--SNAGGKRKLSLMLDEGSSCPTPAKFNTCPLPGALLQDP---YFIQSP 244          
BLAST of Heat shock transcription factor vs. Ensembl Celegans
Match: hsf-1 (Heat Shock Factor; Heat shock transcription factor 1 [Source:UniProtKB/TrEMBL;Acc:G5EFT5])

HSP 1 Score: 118.627 bits (296), Expect = 1.488e-27
Identity = 65/238 (27.31%), Postives = 123/238 (51.68%), Query Frame = 2
Query:   62 FPVKLKKIVDIPETDHLIFWDEDGLSFHIVDQNQFAHDIIPHYFKHNNISSFIRQLNMYGFHKINRI-ENGLAVIGNGTEDSQWSHPQFIRDKPELVANITRKVTNPSFNNSLVPRKAIGNIDNDNISYESVKNDLAHLVKAVQQLKQRDEETTEKLKTLQDENHQLYSVLMYLRDEHEKQSKLIDILIKFFSIYANNPQENRLKSKRVLALEM--------PQSESPLMNLNEPPAK 748
            F +KL  IV+ P    ++ WD+ G SFHI D   F  +++PH+FKHNN++S +RQLNMYGF K+  + + GL    +  +  ++SHP F++ +PEL++ I RK             ++   +++  ++ E  + +L  ++  ++ ++++ +   +K+  L  EN  +++ +  +R +H +Q +    L+ F           R+  + VL ++         P S+   MN  E P K
Sbjct:   92 FLIKLWNIVEDPNLQSIVHWDDSGASFHISDPYLFGRNVLPHFFKHNNMNSMVRQLNMYGFRKMTPLSQGGLTRTESDQDHLEFSHPCFVQGRPELLSQIKRK-------------QSARTVEDKQVN-EQTQQNLEVVMAEMRAMREKAKNMEDKMNKLTKENRDMWTQMGSMRQQHARQQQYFKKLLHFLVSVMQPGLSKRVAKRGVLEIDFCAANGTAGPNSKRARMNSEEGPYK 315          
BLAST of Heat shock transcription factor vs. Ensembl Fly
Match: Hsf (gene:FBgn0001222 transcript:FBtr0110966)

HSP 1 Score: 119.783 bits (299), Expect = 9.989e-28
Identity = 72/211 (34.12%), Postives = 115/211 (54.50%), Query Frame = 2
Query:   62 FPVKLKKIVDIPETDHLIFWDEDGLSFHIVDQNQFAHDIIPHYFKHNNISSFIRQLNMYGFHKINRIENGLAVIGNGTEDSQWSHPQFIRDKPELVANITRKVTNPSFNNSLVPRKAIGNIDNDNISYESVKNDLAHLVKAVQQLKQRDEETTEKLKTLQDENHQLYSVLMYLRDEHEKQSKLIDILIKFFSIYANNPQENRLKSKRVLAL 694
            F  KL ++VD  +T+ LI W +DG SF I +Q QFA +++P  +KHNN++SFIRQLNMYGFHKI  I+NG        ++ ++SHP F R+ P L+  I RK++N              N D+  +        ++ ++  V+ ++ R +    +   ++ EN  L+  +  LR +H KQ ++++ LI+F  I    P  N    KR + L
Sbjct:   49 FLAKLWRLVDDADTNRLICWTKDGQSFVIQNQAQFAKELLPLNYKHNNMASFIRQLNMYGFHKITSIDNGGLRFDR--DEIEFSHPFFKRNSPFLLDQIKRKISNNK------------NGDDKGVLKPEA---MSKILTDVKVMRGRQDNLDSRFSAMKQENEVLWREIASLRQKHAKQQQIVNKLIQFL-ITIVQPSRNMSGVKRHVQL 241          
BLAST of Heat shock transcription factor vs. Ensembl Fly
Match: Hsf (gene:FBgn0001222 transcript:FBtr0110964)

HSP 1 Score: 119.783 bits (299), Expect = 1.049e-27
Identity = 72/211 (34.12%), Postives = 115/211 (54.50%), Query Frame = 2
Query:   62 FPVKLKKIVDIPETDHLIFWDEDGLSFHIVDQNQFAHDIIPHYFKHNNISSFIRQLNMYGFHKINRIENGLAVIGNGTEDSQWSHPQFIRDKPELVANITRKVTNPSFNNSLVPRKAIGNIDNDNISYESVKNDLAHLVKAVQQLKQRDEETTEKLKTLQDENHQLYSVLMYLRDEHEKQSKLIDILIKFFSIYANNPQENRLKSKRVLAL 694
            F  KL ++VD  +T+ LI W +DG SF I +Q QFA +++P  +KHNN++SFIRQLNMYGFHKI  I+NG        ++ ++SHP F R+ P L+  I RK++N              N D+  +        ++ ++  V+ ++ R +    +   ++ EN  L+  +  LR +H KQ ++++ LI+F  I    P  N    KR + L
Sbjct:   49 FLAKLWRLVDDADTNRLICWTKDGQSFVIQNQAQFAKELLPLNYKHNNMASFIRQLNMYGFHKITSIDNGGLRFDR--DEIEFSHPFFKRNSPFLLDQIKRKISNNK------------NGDDKGVLKPEA---MSKILTDVKVMRGRQDNLDSRFSAMKQENEVLWREIASLRQKHAKQQQIVNKLIQFL-ITIVQPSRNMSGVKRHVQL 241          
BLAST of Heat shock transcription factor vs. Ensembl Fly
Match: Hsf (gene:FBgn0001222 transcript:FBtr0086782)

HSP 1 Score: 119.398 bits (298), Expect = 1.208e-27
Identity = 72/211 (34.12%), Postives = 115/211 (54.50%), Query Frame = 2
Query:   62 FPVKLKKIVDIPETDHLIFWDEDGLSFHIVDQNQFAHDIIPHYFKHNNISSFIRQLNMYGFHKINRIENGLAVIGNGTEDSQWSHPQFIRDKPELVANITRKVTNPSFNNSLVPRKAIGNIDNDNISYESVKNDLAHLVKAVQQLKQRDEETTEKLKTLQDENHQLYSVLMYLRDEHEKQSKLIDILIKFFSIYANNPQENRLKSKRVLAL 694
            F  KL ++VD  +T+ LI W +DG SF I +Q QFA +++P  +KHNN++SFIRQLNMYGFHKI  I+NG        ++ ++SHP F R+ P L+  I RK++N              N D+  +        ++ ++  V+ ++ R +    +   ++ EN  L+  +  LR +H KQ ++++ LI+F  I    P  N    KR + L
Sbjct:   49 FLAKLWRLVDDADTNRLICWTKDGQSFVIQNQAQFAKELLPLNYKHNNMASFIRQLNMYGFHKITSIDNGGLRFDR--DEIEFSHPFFKRNSPFLLDQIKRKISNNK------------NGDDKGVLKPEA---MSKILTDVKVMRGRQDNLDSRFSAMKQENEVLWREIASLRQKHAKQQQIVNKLIQFL-ITIVQPSRNMSGVKRHVQL 241          
BLAST of Heat shock transcription factor vs. Ensembl Fly
Match: Hsf (gene:FBgn0001222 transcript:FBtr0110965)

HSP 1 Score: 119.398 bits (298), Expect = 1.231e-27
Identity = 72/211 (34.12%), Postives = 115/211 (54.50%), Query Frame = 2
Query:   62 FPVKLKKIVDIPETDHLIFWDEDGLSFHIVDQNQFAHDIIPHYFKHNNISSFIRQLNMYGFHKINRIENGLAVIGNGTEDSQWSHPQFIRDKPELVANITRKVTNPSFNNSLVPRKAIGNIDNDNISYESVKNDLAHLVKAVQQLKQRDEETTEKLKTLQDENHQLYSVLMYLRDEHEKQSKLIDILIKFFSIYANNPQENRLKSKRVLAL 694
            F  KL ++VD  +T+ LI W +DG SF I +Q QFA +++P  +KHNN++SFIRQLNMYGFHKI  I+NG        ++ ++SHP F R+ P L+  I RK++N              N D+  +        ++ ++  V+ ++ R +    +   ++ EN  L+  +  LR +H KQ ++++ LI+F  I    P  N    KR + L
Sbjct:   49 FLAKLWRLVDDADTNRLICWTKDGQSFVIQNQAQFAKELLPLNYKHNNMASFIRQLNMYGFHKITSIDNGGLRFDR--DEIEFSHPFFKRNSPFLLDQIKRKISNNK------------NGDDKGVLKPEA---MSKILTDVKVMRGRQDNLDSRFSAMKQENEVLWREIASLRQKHAKQQQIVNKLIQFL-ITIVQPSRNMSGVKRHVQL 241          
BLAST of Heat shock transcription factor vs. Ensembl Zebrafish
Match: hsf1 (heat shock transcription factor 1 [Source:ZFIN;Acc:ZDB-GENE-000616-16])

HSP 1 Score: 151.754 bits (382), Expect = 6.063e-39
Identity = 81/221 (36.65%), Postives = 130/221 (58.82%), Query Frame = 2
Query:   62 FPVKLKKIVDIPETDHLIFWDEDGLSFHIVDQNQFAHDIIPHYFKHNNISSFIRQLNMYGFHKINRIENGLAVIGNGTEDSQWSHPQFIRDKPELVANITRKVTNPSFNNSLVPRKAIGNIDNDNISYESVKNDLAHLVKAVQQLKQRDEETTEKLKTLQDENHQLYSVLMYLRDEHEKQSKLIDILIKFFSIYANNPQENRLKSKRVLALEMPQSESPLM 724
            F  KL  +V+ P+TD LI W  +G SFH+ DQ +F+ +++P YFKHNN++SF+RQLNMYGF K+  IE G  ++    +D+++ HP FIR + +L+ NI RKVT             + NI +++  Y+   +D++ ++  VQ +K + E    K+ TL+ EN  L+  +  LR +H +Q K+++ LI+F    A        +S RVL +   + + PLM
Sbjct:   21 FLTKLWTLVEDPDTDPLICWSPNGTSFHVFDQGRFSKEVLPKYFKHNNMASFVRQLNMYGFRKVVHIEQG-GLVKPEKDDTEFQHPYFIRGQEQLLENIKRKVTT------------VSNIKHED--YKFSTDDVSKMISDVQHMKGKQESMDSKISTLKHENEMLWREVATLRQKHSQQQKVVNKLIQFLITLA--------RSNRVLGV---KRKMPLM 215          
BLAST of Heat shock transcription factor vs. Ensembl Zebrafish
Match: hsf1 (heat shock transcription factor 1 [Source:ZFIN;Acc:ZDB-GENE-000616-16])

HSP 1 Score: 151.754 bits (382), Expect = 8.851e-39
Identity = 81/221 (36.65%), Postives = 130/221 (58.82%), Query Frame = 2
Query:   62 FPVKLKKIVDIPETDHLIFWDEDGLSFHIVDQNQFAHDIIPHYFKHNNISSFIRQLNMYGFHKINRIENGLAVIGNGTEDSQWSHPQFIRDKPELVANITRKVTNPSFNNSLVPRKAIGNIDNDNISYESVKNDLAHLVKAVQQLKQRDEETTEKLKTLQDENHQLYSVLMYLRDEHEKQSKLIDILIKFFSIYANNPQENRLKSKRVLALEMPQSESPLM 724
            F  KL  +V+ P+TD LI W  +G SFH+ DQ +F+ +++P YFKHNN++SF+RQLNMYGF K+  IE G  ++    +D+++ HP FIR + +L+ NI RKVT             + NI +++  Y+   +D++ ++  VQ +K + E    K+ TL+ EN  L+  +  LR +H +Q K+++ LI+F    A        +S RVL +   + + PLM
Sbjct:   21 FLTKLWTLVEDPDTDPLICWSPNGTSFHVFDQGRFSKEVLPKYFKHNNMASFVRQLNMYGFRKVVHIEQG-GLVKPEKDDTEFQHPYFIRGQEQLLENIKRKVTT------------VSNIKHED--YKFSTDDVSKMISDVQHMKGKQESMDSKISTLKHENEMLWREVATLRQKHSQQQKVVNKLIQFLITLA--------RSNRVLGV---KRKMPLM 215          
BLAST of Heat shock transcription factor vs. Ensembl Zebrafish
Match: hsf4 (heat shock transcription factor 4 [Source:ZFIN;Acc:ZDB-GENE-050306-18])

HSP 1 Score: 131.339 bits (329), Expect = 1.208e-33
Identity = 86/285 (30.18%), Postives = 148/285 (51.93%), Query Frame = 2
Query:   35 NGSESNSLPFPVKLKKIVDIPETDHLIFWDEDGLSFHIVDQNQFAHDIIPHYFKHNNISSFIRQLNMYGFHKINRIENGLAVIGNGTEDSQWSHPQFIRDKPELVANITRKVTNPSFNNSLVPRKAIGNIDNDNISYESVKNDLAHLVKAVQQLKQRDEETTEKLKTLQDENHQLYSVLMYLRDEHEKQSKLIDILIKFF--SIYANNPQENRLKSKRVLALEMPQSESPL------MNLNEPPAKYFVASPKNCPQVTVSTNNTSNLYKGKKLIKITNVSNTPQ 865
             G  SN   F  KL  +V+ PET+HLI W   G SFH+ DQ +FA +++P YFKHNN++SF+RQLNMYGF K+  IE    ++    +D+++ H  F++    L+ +I RKV             +I   +   +  E    DL+ L+  VQ L+ + E    +++ ++ +N  L+  ++ LR  H +Q K+++ LI+F    + +N+P    +K K  L L+   S  P        ++      +++ SP        ++ +TS++  G  +  I++V+  PQ
Sbjct:   12 GGYASNVPAFLTKLWTLVEDPETNHLICWSATGTSFHVFDQGRFAKEVLPKYFKHNNMASFVRQLNMYGFRKVVNIEQS-GLVKPERDDTEFQHLYFLQGHEHLLEHIKRKV-------------SIVKSEETKVRQE----DLSKLLYEVQVLRSQQENMEMQMQDMKQQNDVLWREVVSLRQNHTQQQKVMNKLIQFLFSQMQSNSPSTVGMKRKLPLMLDDGCSTPPASKFSHNHSMESLQESFYIQSPST----ESASCSTSSVMTGGPI--ISDVTEIPQ 272          
BLAST of Heat shock transcription factor vs. Ensembl Zebrafish
Match: hsf4 (heat shock transcription factor 4 [Source:ZFIN;Acc:ZDB-GENE-050306-18])

HSP 1 Score: 132.109 bits (331), Expect = 1.597e-32
Identity = 88/288 (30.56%), Postives = 150/288 (52.08%), Query Frame = 2
Query:   35 NGSESNSLPFPVKLKKIVDIPETDHLIFWDEDGLSFHIVDQNQFAHDIIPHYFKHNNISSFIRQLNMYGFHKINRIENGLAVIGNGTEDSQWSHPQFIRDKPELVANITRKVTNPSFNNSLVPRKAIGNIDNDNISYESVKNDLAHLVKAVQQLKQRDEETTEKLKTLQDENHQLYSVLMYLRDEHEKQSKLIDILIKFF--SIYANNPQENRLKSKRVLALEMPQSESP---------LMNLNEPPAKYFVASPKNCPQVTVSTNNTSNLYKGKKLIKITNVSNTPQ 865
             G  SN   F  KL  +V+ PET+HLI W   G SFH+ DQ +FA +++P YFKHNN++SF+RQLNMYGF K+  IE    ++    +D+++ H  F++    L+ +I RKV+             I   +   +  E    DL+ L+  VQ L+ + E    +++ ++ +N  L+  ++ LR  H +Q K+++ LI+F    + +N+P    +K K  L L+   S  P         + +L E    +++ SP        ++ +TS++  G  +  I++V+  PQ
Sbjct:   12 GGYASNVPAFLTKLWTLVEDPETNHLICWSATGTSFHVFDQGRFAKEVLPKYFKHNNMASFVRQLNMYGFRKVVNIEQS-GLVKPERDDTEFQHLYFLQGHEHLLEHIKRKVS-------------IVKSEETKVRQE----DLSKLLYEVQVLRSQQENMEMQMQDMKQQNDVLWREVVSLRQNHTQQQKVMNKLIQFLFSQMQSNSPSTVGMKRKLPLMLDDGCSTPPASKFSHNHSMESLQE---SFYIQSPST----ESASCSTSSVMTGGPI--ISDVTEIPQ 272          
BLAST of Heat shock transcription factor vs. Ensembl Zebrafish
Match: hsf2 (heat shock transcription factor 2 [Source:ZFIN;Acc:ZDB-GENE-011128-1])

HSP 1 Score: 127.102 bits (318), Expect = 1.592e-30
Identity = 77/217 (35.48%), Postives = 124/217 (57.14%), Query Frame = 2
Query:   47 SNSLPFPVKLKKIVDIPETDHLIFWDEDGLSFHIVDQNQFAHDIIPHYFKHNNISSFIRQLNMYGFHKINRIENGLAVIGNGTEDSQWSHPQFIRDKPELVANITRKVTNPSFNNSLVPRKAIGNIDNDNISYESVKNDLAHLVKAVQQLKQRDEETTEKLKTLQDENHQLYSVLMYLRDEHEKQSKLIDILIKF-FSIYANNPQENRLKSKRVLAL 694
            SN   F  KL  +V+  +T+  I W ++G SF ++D+ +FA +I+P +FKHNN++SF+RQLNMYGF K+  I++G+ V        ++ HP F   + +L+ NI RKV+N     S +                  ++DL+ ++ +VQ + ++ E    +L TL+ EN  L++ L  LR  H +Q ++I  L++F F++  NN   N LK KR LAL
Sbjct:    5 SNVPAFLTKLWTLVEDSDTNEFICWSQEGNSFLVLDEQRFAKEILPKFFKHNNMASFVRQLNMYGFRKVMHIDSGI-VKQERDGPVEFQHPYFKHGQDDLLENIKRKVSNARPEESKI-----------------RQDDLSKILTSVQSVHEQQENMDARLATLKRENEALWTELSDLRKVHVQQQQVIKELVQFIFTLVQNNRLLN-LKRKRPLAL 202          
BLAST of Heat shock transcription factor vs. Ensembl Xenopus
Match: phlda1 (pleckstrin homology-like domain, family A, member 1 [Source:Xenbase;Acc:XB-GENE-946941])

HSP 1 Score: 135.576 bits (340), Expect = 3.052e-33
Identity = 83/253 (32.81%), Postives = 141/253 (55.73%), Query Frame = 2
Query:   26 LKMNGSESNSLPFPVKLKKIVDIPETDHLIFWDEDGLSFHIVDQNQFAHDIIPHYFKHNNISSFIRQLNMYGFHKINRIENGLAVIGNGTEDSQWSHPQFIRDKPELVANITRKVTNPSFNNSLVPRKAIGNIDNDNISYESVKNDLAHLVKAVQQLKQRDEETTEKLKTLQDENHQLYSVLMYLRDEHEKQSKLIDILIKF-FSIYANNPQENRLKSKRVLALE-----MPQSE-SPLMNLNEPPAKYFVAS 763
            L M+G  +N   F  KL  +V+ PET+HLI W  +G SFH+ DQ +FA +++P YFKHNN++SF+RQLNMYGF K+  IE G  ++    +D+++ H  F++    L+ +I RKV+             + N +   + +E    D+  L+  +Q L+ + E +  +++ ++ +N  L+  ++ LR  H +Q K+I+ LI+F F      P    +K K  L L+     +PQS+ S  + ++  P  Y++ S
Sbjct:    8 LAMDGYCNNVPAFLTKLWTLVEDPETNHLICWSVNGTSFHVFDQGRFAKEVLPKYFKHNNMASFVRQLNMYGFRKVVNIEQG-GLVKPERDDTEFQHLYFLQGHEHLLEHIKRKVS------------VVKN-EETKLRHE----DVNRLLYELQTLRGQQESSECQMQDMKQQNEVLWREVVSLRQNHLQQQKIINKLIQFLFGQLPPGPTSAGIKRKMPLMLDDGNSTLPQSKFSRHLPVDALPDPYYIQS 242          
BLAST of Heat shock transcription factor vs. Ensembl Xenopus
Match: phlda1 (pleckstrin homology-like domain, family A, member 1 [Source:Xenbase;Acc:XB-GENE-946941])

HSP 1 Score: 135.576 bits (340), Expect = 4.928e-33
Identity = 83/253 (32.81%), Postives = 141/253 (55.73%), Query Frame = 2
Query:   26 LKMNGSESNSLPFPVKLKKIVDIPETDHLIFWDEDGLSFHIVDQNQFAHDIIPHYFKHNNISSFIRQLNMYGFHKINRIENGLAVIGNGTEDSQWSHPQFIRDKPELVANITRKVTNPSFNNSLVPRKAIGNIDNDNISYESVKNDLAHLVKAVQQLKQRDEETTEKLKTLQDENHQLYSVLMYLRDEHEKQSKLIDILIKF-FSIYANNPQENRLKSKRVLALE-----MPQSE-SPLMNLNEPPAKYFVAS 763
            L M+G  +N   F  KL  +V+ PET+HLI W  +G SFH+ DQ +FA +++P YFKHNN++SF+RQLNMYGF K+  IE G  ++    +D+++ H  F++    L+ +I RKV+             + N +   + +E    D+  L+  +Q L+ + E +  +++ ++ +N  L+  ++ LR  H +Q K+I+ LI+F F      P    +K K  L L+     +PQS+ S  + ++  P  Y++ S
Sbjct:    8 LAMDGYCNNVPAFLTKLWTLVEDPETNHLICWSVNGTSFHVFDQGRFAKEVLPKYFKHNNMASFVRQLNMYGFRKVVNIEQG-GLVKPERDDTEFQHLYFLQGHEHLLEHIKRKVS------------VVKN-EETKLRHE----DVNRLLYELQTLRGQQESSECQMQDMKQQNEVLWREVVSLRQNHLQQQKIINKLIQFLFGQLPPGPTSAGIKRKMPLMLDDGNSTLPQSKFSRHLPVDALPDPYYIQS 242          
BLAST of Heat shock transcription factor vs. Ensembl Xenopus
Match: ENSXETT00000012423.1 (heat shock transcription factor 1 [Source:NCBI gene;Acc:100489822])

HSP 1 Score: 123.635 bits (309), Expect = 2.277e-29
Identity = 77/214 (35.98%), Postives = 119/214 (55.61%), Query Frame = 2
Query:  122 DEDGLSFHIVDQNQFAHDIIPHYFKHNNISSFIRQLNMYGFHKINRIENGLAVIGNGTEDSQWSHPQFIRDKPELVANITRKVTNPSFNNSLVPRKAIGNIDNDNISYESVK---NDLAHLVKAVQQLKQRDEETTEKLKTLQDENHQLYSVLMYLRDEHEKQSKLIDILIKFFSIYANNPQENR-LKSKRVLALEMPQSESPLMNLNEPPAKY 751
            + +G SFH+ DQ QFA +++P YFKHNN++SF+RQLNMYGF K+  IE G  ++    +D+++ HP FIR + +L+ NI RKV      N+L   K+           E VK   + ++ L+  VQ +K + E    +L +++ EN  L+  +  LR +H +Q K+++ LI+F        Q NR L  KR + L +  S +       PP KY
Sbjct:   62 EPEGNSFHVFDQGQFAKEVLPKYFKHNNMASFVRQLNMYGFRKVVHIEQG-GLVKPERDDTEFQHPYFIRGQEQLLENIKRKV------NTLSATKS-----------EEVKGRQDSVSKLLTDVQSMKGKQETIDCRLLSMKHENEALWREVASLRQKHNQQQKVVNKLIQFLISLV---QSNRILGVKRKIPLMLNDSST-----AHPPPKY 249          
BLAST of Heat shock transcription factor vs. Ensembl Xenopus
Match: ENSXETT00000012455.1 (heat shock transcription factor 1 [Source:NCBI gene;Acc:100489822])

HSP 1 Score: 123.25 bits (308), Expect = 5.230e-29
Identity = 77/218 (35.32%), Postives = 124/218 (56.88%), Query Frame = 2
Query:  122 DEDGLSFHIVDQNQFAHDIIPHYFKHNNISSFIRQLNMYGFHKINRIENGLAVIGNGTEDSQWSHPQFIRDKPELVANITRKVTNPSFNNSLVPRKAIGNIDNDNISYESVK---NDLAHLVKAVQQLKQRDEETTEKLKTLQDENHQLYSVLMYLRDEHEKQSKLIDILIKFFSIYANNPQENRLKSKRVLALEMPQSESPLMNLNE-----PPAKY 751
            + +G SFH+ DQ QFA +++P YFKHNN++SF+RQLNMYGF K+  IE G  ++    +D+++ HP FIR + +L+ NI RKV      N+L   K+           E VK   + ++ L+  VQ +K + E    +L +++ EN  L+  +  LR +H +Q K+++ LI+F          + ++S R+L +   + + PLM LN+     PP KY
Sbjct:   62 EPEGNSFHVFDQGQFAKEVLPKYFKHNNMASFVRQLNMYGFRKVVHIEQG-GLVKPERDDTEFQHPYFIRGQEQLLENIKRKV------NTLSATKS-----------EEVKGRQDSVSKLLTDVQSMKGKQETIDCRLLSMKHENEALWREVASLRQKHNQQQKVVNKLIQFLI--------SLVQSNRILGV---KRKIPLM-LNDSSTAHPPPKY 249          
BLAST of Heat shock transcription factor vs. Ensembl Xenopus
Match: ENSXETT00000028726.1 (heat shock transcription factor 1 [Source:NCBI gene;Acc:100489822])

HSP 1 Score: 120.939 bits (302), Expect = 3.543e-28
Identity = 65/172 (37.79%), Postives = 103/172 (59.88%), Query Frame = 2
Query:  128 DGLSFHIVDQNQFAHDIIPHYFKHNNISSFIRQLNMYGFHKINRIENGLAVIGNGTEDSQWSHPQFIRDKPELVANITRKVTNPSFNNSLVPRKAIGNIDNDNISYESVK---NDLAHLVKAVQQLKQRDEETTEKLKTLQDENHQLYSVLMYLRDEHEKQSKLIDILIKFF 634
            +G SFH+ DQ QFA +++P YFKHNN++SF+RQLNMYGF K+  IE G  ++    +D+++ HP FIR + +L+ NI RKV      N+L   K+           E VK   + ++ L+  VQ +K + E    +L +++ EN  L+  +  LR +H +Q K+++ LI+F 
Sbjct:  102 EGNSFHVFDQGQFAKEVLPKYFKHNNMASFVRQLNMYGFRKVVHIEQG-GLVKPERDDTEFQHPYFIRGQEQLLENIKRKV------NTLSATKS-----------EEVKGRQDSVSKLLTDVQSMKGKQETIDCRLLSMKHENEALWREVASLRQKHNQQQKVVNKLIQFL 255          
BLAST of Heat shock transcription factor vs. Ensembl Mouse
Match: Hsf1 (heat shock factor 1 [Source:MGI Symbol;Acc:MGI:96238])

HSP 1 Score: 144.05 bits (362), Expect = 1.140e-36
Identity = 82/224 (36.61%), Postives = 126/224 (56.25%), Query Frame = 2
Query:   47 SNSLPFPVKLKKIVDIPETDHLIFWDEDGLSFHIVDQNQFAHDIIPHYFKHNNISSFIRQLNMYGFHKINRIENGLAVIGNGTEDSQWSHPQFIRDKPELVANITRKVTNPSFNNSLVPRKAIGNIDNDNISYESVKNDLAHLVKAVQQLKQRDEETTEKLKTLQDENHQLYSVLMYLRDEHEKQSKLIDILIKFFSIYANNPQENR-LKSKRVLALEMPQSES 715
            SN   F  KL  +V  P+TD LI W   G SFH+ DQ QFA +++P YFKHNN++SF+RQLNMYGF K+  IE G  ++    +D+++ HP F+R + +L+ NI RKVT            ++  + +++I     ++ +  L+  VQ +K + E    KL  ++ EN  L+  +  LR +H +Q K+++ LI+F        Q NR L  KR + L +  S S
Sbjct:   13 SNVPAFLTKLWTLVSDPDTDALICWSPSGNSFHVFDQGQFAKEVLPKYFKHNNMASFVRQLNMYGFRKVVHIEQG-GLVKPERDDTEFQHPCFLRGQEQLLENIKRKVT------------SVSTLKSEDIKIR--QDSVTRLLTDVQLMKGKQECMDSKLLAMKHENEALWREVASLRQKHAQQQKVVNKLIQFLISLV---QSNRILGVKRKIPLMLSDSNS 218          
BLAST of Heat shock transcription factor vs. Ensembl Mouse
Match: Hsf1 (heat shock factor 1 [Source:MGI Symbol;Acc:MGI:96238])

HSP 1 Score: 144.436 bits (363), Expect = 1.646e-36
Identity = 82/224 (36.61%), Postives = 126/224 (56.25%), Query Frame = 2
Query:   47 SNSLPFPVKLKKIVDIPETDHLIFWDEDGLSFHIVDQNQFAHDIIPHYFKHNNISSFIRQLNMYGFHKINRIENGLAVIGNGTEDSQWSHPQFIRDKPELVANITRKVTNPSFNNSLVPRKAIGNIDNDNISYESVKNDLAHLVKAVQQLKQRDEETTEKLKTLQDENHQLYSVLMYLRDEHEKQSKLIDILIKFFSIYANNPQENR-LKSKRVLALEMPQSES 715
            SN   F  KL  +V  P+TD LI W   G SFH+ DQ QFA +++P YFKHNN++SF+RQLNMYGF K+  IE G  ++    +D+++ HP F+R + +L+ NI RKVT            ++  + +++I     ++ +  L+  VQ +K + E    KL  ++ EN  L+  +  LR +H +Q K+++ LI+F        Q NR L  KR + L +  S S
Sbjct:   13 SNVPAFLTKLWTLVSDPDTDALICWSPSGNSFHVFDQGQFAKEVLPKYFKHNNMASFVRQLNMYGFRKVVHIEQG-GLVKPERDDTEFQHPCFLRGQEQLLENIKRKVT------------SVSTLKSEDIKIR--QDSVTRLLTDVQLMKGKQECMDSKLLAMKHENEALWREVASLRQKHAQQQKVVNKLIQFLISLV---QSNRILGVKRKIPLMLSDSNS 218          
BLAST of Heat shock transcription factor vs. Ensembl Mouse
Match: Hsf1 (heat shock factor 1 [Source:MGI Symbol;Acc:MGI:96238])

HSP 1 Score: 143.665 bits (361), Expect = 5.195e-36
Identity = 82/224 (36.61%), Postives = 126/224 (56.25%), Query Frame = 2
Query:   47 SNSLPFPVKLKKIVDIPETDHLIFWDEDGLSFHIVDQNQFAHDIIPHYFKHNNISSFIRQLNMYGFHKINRIENGLAVIGNGTEDSQWSHPQFIRDKPELVANITRKVTNPSFNNSLVPRKAIGNIDNDNISYESVKNDLAHLVKAVQQLKQRDEETTEKLKTLQDENHQLYSVLMYLRDEHEKQSKLIDILIKFFSIYANNPQENR-LKSKRVLALEMPQSES 715
            SN   F  KL  +V  P+TD LI W   G SFH+ DQ QFA +++P YFKHNN++SF+RQLNMYGF K+  IE G  ++    +D+++ HP F+R + +L+ NI RKVT            ++  + +++I     ++ +  L+  VQ +K + E    KL  ++ EN  L+  +  LR +H +Q K+++ LI+F        Q NR L  KR + L +  S S
Sbjct:   13 SNVPAFLTKLWTLVSDPDTDALICWSPSGNSFHVFDQGQFAKEVLPKYFKHNNMASFVRQLNMYGFRKVVHIEQG-GLVKPERDDTEFQHPCFLRGQEQLLENIKRKVT------------SVSTLKSEDIKIR--QDSVTRLLTDVQLMKGKQECMDSKLLAMKHENEALWREVASLRQKHAQQQKVVNKLIQFLISLV---QSNRILGVKRKIPLMLSDSNS 218          
BLAST of Heat shock transcription factor vs. Ensembl Mouse
Match: Hsf1 (heat shock factor 1 [Source:MGI Symbol;Acc:MGI:96238])

HSP 1 Score: 143.665 bits (361), Expect = 5.266e-36
Identity = 82/224 (36.61%), Postives = 126/224 (56.25%), Query Frame = 2
Query:   47 SNSLPFPVKLKKIVDIPETDHLIFWDEDGLSFHIVDQNQFAHDIIPHYFKHNNISSFIRQLNMYGFHKINRIENGLAVIGNGTEDSQWSHPQFIRDKPELVANITRKVTNPSFNNSLVPRKAIGNIDNDNISYESVKNDLAHLVKAVQQLKQRDEETTEKLKTLQDENHQLYSVLMYLRDEHEKQSKLIDILIKFFSIYANNPQENR-LKSKRVLALEMPQSES 715
            SN   F  KL  +V  P+TD LI W   G SFH+ DQ QFA +++P YFKHNN++SF+RQLNMYGF K+  IE G  ++    +D+++ HP F+R + +L+ NI RKVT            ++  + +++I     ++ +  L+  VQ +K + E    KL  ++ EN  L+  +  LR +H +Q K+++ LI+F        Q NR L  KR + L +  S S
Sbjct:   13 SNVPAFLTKLWTLVSDPDTDALICWSPSGNSFHVFDQGQFAKEVLPKYFKHNNMASFVRQLNMYGFRKVVHIEQG-GLVKPERDDTEFQHPCFLRGQEQLLENIKRKVT------------SVSTLKSEDIKIR--QDSVTRLLTDVQLMKGKQECMDSKLLAMKHENEALWREVASLRQKHAQQQKVVNKLIQFLISLV---QSNRILGVKRKIPLMLSDSNS 218          
BLAST of Heat shock transcription factor vs. Ensembl Mouse
Match: Hsf1 (heat shock factor 1 [Source:MGI Symbol;Acc:MGI:96238])

HSP 1 Score: 143.665 bits (361), Expect = 6.349e-36
Identity = 82/224 (36.61%), Postives = 126/224 (56.25%), Query Frame = 2
Query:   47 SNSLPFPVKLKKIVDIPETDHLIFWDEDGLSFHIVDQNQFAHDIIPHYFKHNNISSFIRQLNMYGFHKINRIENGLAVIGNGTEDSQWSHPQFIRDKPELVANITRKVTNPSFNNSLVPRKAIGNIDNDNISYESVKNDLAHLVKAVQQLKQRDEETTEKLKTLQDENHQLYSVLMYLRDEHEKQSKLIDILIKFFSIYANNPQENR-LKSKRVLALEMPQSES 715
            SN   F  KL  +V  P+TD LI W   G SFH+ DQ QFA +++P YFKHNN++SF+RQLNMYGF K+  IE G  ++    +D+++ HP F+R + +L+ NI RKVT            ++  + +++I     ++ +  L+  VQ +K + E    KL  ++ EN  L+  +  LR +H +Q K+++ LI+F        Q NR L  KR + L +  S S
Sbjct:   13 SNVPAFLTKLWTLVSDPDTDALICWSPSGNSFHVFDQGQFAKEVLPKYFKHNNMASFVRQLNMYGFRKVVHIEQG-GLVKPERDDTEFQHPCFLRGQEQLLENIKRKVT------------SVSTLKSEDIKIR--QDSVTRLLTDVQLMKGKQECMDSKLLAMKHENEALWREVASLRQKHAQQQKVVNKLIQFLISLV---QSNRILGVKRKIPLMLSDSNS 218          
BLAST of Heat shock transcription factor vs. UniProt/SwissProt
Match: sp|P38529|HSF1_CHICK (Heat shock factor protein 1 OS=Gallus gallus OX=9031 GN=HSF1 PE=1 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 1.365e-36
Identity = 76/196 (38.78%), Postives = 117/196 (59.69%), Query Frame = 2
Query:   47 SNSLPFPVKLKKIVDIPETDHLIFWDEDGLSFHIVDQNQFAHDIIPHYFKHNNISSFIRQLNMYGFHKINRIENGLAVIGNGTEDSQWSHPQFIRDKPELVANITRKVTNPSFNNSLVPRKAIGNIDNDNISYESVKNDLAHLVKAVQQLKQRDEETTEKLKTLQDENHQLYSVLMYLRDEHEKQSKLIDILIKFF 634
            SN   F  KL  +V+ PETD LI W   G SFH+ DQ QFA +++P YFKHNN++SF+RQLNMYGF K+  IE G  ++    +D+++ HP FIR +  L+ NI RKVT            ++ +I N++I     ++++  L+  +Q +K + E    KL  ++ EN  L+  +  LR +H +Q K+++ LI+F 
Sbjct:   18 SNVSAFLTKLWTLVEDPETDPLICWSPSGNSFHVFDQGQFAKEVLPKYFKHNNMASFVRQLNMYGFRKVVHIEQG-GLVKPEKDDTEFQHPYFIRGQEHLLENIKRKVT------------SVSSIKNEDIKVR--QDNVTKLLTDIQVMKGKQESMDSKLIAMKHENEALWREVASLRQKHAQQQKVVNKLIQFL 198          
BLAST of Heat shock transcription factor vs. UniProt/SwissProt
Match: sp|P41154|HSF_XENLA (Heat shock factor protein OS=Xenopus laevis OX=8355 GN=hsf1 PE=2 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 6.693e-36
Identity = 83/219 (37.90%), Postives = 123/219 (56.16%), Query Frame = 2
Query:   47 SNSLPFPVKLKKIVDIPETDHLIFWDEDGLSFHIVDQNQFAHDIIPHYFKHNNISSFIRQLNMYGFHKINRIENGLAVIGNGTEDSQWSHPQFIRDKPELVANITRKVTNPSFNNSLVPRKAIGNIDNDNISYESVKNDLAHLVKAVQQLKQRDEETTEKLKTLQDENHQLYSVLMYLRDEHEKQSKLIDILIKFFSIYANNPQENR-LKSKRVLALEM 700
            SN   F  KL  +V+ P+TD LI W  +G SFH+ DQ QFA +++P YFKHNN++SF+RQLNMYGF K+  IE G  ++    +D+++ HP FIR + +L+ NI RKV   S   S          D   +  +SV      L+  VQ +K + E    +L +++ EN  L+  +  LR +H +Q K+++ LI+F        Q NR L  KR + L +
Sbjct:   10 SNVPAFLAKLWTLVEDPDTDPLICWSPEGNSFHVFDQGQFAKEVLPKYFKHNNMASFVRQLNMYGFRKVVHIEQG-GLVKPERDDTEFQHPYFIRGQEQLLENIKRKVNTMSATKS----------DEVKVRQDSV----GKLISDVQSMKGKQESIDGRLLSMKHENEALWREVASLRQKHTQQQKVVNKLIQFLVSLV---QSNRILGVKRKIPLML 210          
BLAST of Heat shock transcription factor vs. UniProt/SwissProt
Match: sp|P38532|HSF1_MOUSE (Heat shock factor protein 1 OS=Mus musculus OX=10090 GN=Hsf1 PE=1 SV=2)

HSP 1 Score: 143.665 bits (361), Expect = 3.684e-35
Identity = 82/224 (36.61%), Postives = 126/224 (56.25%), Query Frame = 2
Query:   47 SNSLPFPVKLKKIVDIPETDHLIFWDEDGLSFHIVDQNQFAHDIIPHYFKHNNISSFIRQLNMYGFHKINRIENGLAVIGNGTEDSQWSHPQFIRDKPELVANITRKVTNPSFNNSLVPRKAIGNIDNDNISYESVKNDLAHLVKAVQQLKQRDEETTEKLKTLQDENHQLYSVLMYLRDEHEKQSKLIDILIKFFSIYANNPQENR-LKSKRVLALEMPQSES 715
            SN   F  KL  +V  P+TD LI W   G SFH+ DQ QFA +++P YFKHNN++SF+RQLNMYGF K+  IE G  ++    +D+++ HP F+R + +L+ NI RKVT            ++  + +++I     ++ +  L+  VQ +K + E    KL  ++ EN  L+  +  LR +H +Q K+++ LI+F        Q NR L  KR + L +  S S
Sbjct:   13 SNVPAFLTKLWTLVSDPDTDALICWSPSGNSFHVFDQGQFAKEVLPKYFKHNNMASFVRQLNMYGFRKVVHIEQG-GLVKPERDDTEFQHPCFLRGQEQLLENIKRKVT------------SVSTLKSEDIKIR--QDSVTRLLTDVQLMKGKQECMDSKLLAMKHENEALWREVASLRQKHAQQQKVVNKLIQFLISLV---QSNRILGVKRKIPLMLSDSNS 218          
BLAST of Heat shock transcription factor vs. UniProt/SwissProt
Match: sp|Q00613|HSF1_HUMAN (Heat shock factor protein 1 OS=Homo sapiens OX=9606 GN=HSF1 PE=1 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 1.068e-34
Identity = 73/196 (37.24%), Postives = 115/196 (58.67%), Query Frame = 2
Query:   47 SNSLPFPVKLKKIVDIPETDHLIFWDEDGLSFHIVDQNQFAHDIIPHYFKHNNISSFIRQLNMYGFHKINRIENGLAVIGNGTEDSQWSHPQFIRDKPELVANITRKVTNPSFNNSLVPRKAIGNIDNDNISYESVKNDLAHLVKAVQQLKQRDEETTEKLKTLQDENHQLYSVLMYLRDEHEKQSKLIDILIKFF 634
            SN   F  KL  +V  P+TD LI W   G SFH+ DQ QFA +++P YFKHNN++SF+RQLNMYGF K+  IE G  ++    +D+++ HP F+R + +L+ NI RKVT            ++  + +++I     ++ +  L+  VQ +K + E    KL  ++ EN  L+  +  LR +H +Q K+++ LI+F 
Sbjct:   13 SNVPAFLTKLWTLVSDPDTDALICWSPSGNSFHVFDQGQFAKEVLPKYFKHNNMASFVRQLNMYGFRKVVHIEQG-GLVKPERDDTEFQHPCFLRGQEQLLENIKRKVT------------SVSTLKSEDIKIR--QDSVTKLLTDVQLMKGKQECMDSKLLAMKHENEALWREVASLRQKHAQQQKVVNKLIQFL 193          
BLAST of Heat shock transcription factor vs. UniProt/SwissProt
Match: sp|Q08DJ8|HSF1_BOVIN (Heat shock factor protein 1 OS=Bos taurus OX=9913 GN=HSF1 PE=2 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 2.502e-34
Identity = 72/196 (36.73%), Postives = 116/196 (59.18%), Query Frame = 2
Query:   47 SNSLPFPVKLKKIVDIPETDHLIFWDEDGLSFHIVDQNQFAHDIIPHYFKHNNISSFIRQLNMYGFHKINRIENGLAVIGNGTEDSQWSHPQFIRDKPELVANITRKVTNPSFNNSLVPRKAIGNIDNDNISYESVKNDLAHLVKAVQQLKQRDEETTEKLKTLQDENHQLYSVLMYLRDEHEKQSKLIDILIKFF 634
            SN   F  KL  +V  P+TD LI W   G SFH++DQ QFA +++P YFKH+N++SF+RQLNMYGF K+  IE G  ++    +D+++ HP F+R + +L+ NI RKVT            ++  + +++I     ++ +  L+  VQ +K + E    KL  ++ EN  L+  +  LR +H +Q K+++ LI+F 
Sbjct:   13 SNVPAFLTKLWTLVSDPDTDALICWSPSGNSFHVLDQGQFAKEVLPKYFKHSNMASFVRQLNMYGFRKVVHIEQG-GLVKPERDDTEFQHPCFLRGQEQLLENIKRKVT------------SVSTLRSEDIKIR--QDSVTKLLTDVQLMKGKQESMDSKLLAMKHENEALWREVASLRQKHAQQQKVVNKLIQFL 193          
BLAST of Heat shock transcription factor vs. TrEMBL
Match: A0A0V0J6X3 (Heat shock factor protein OS=Schistocephalus solidus OX=70667 GN=HSF PE=3 SV=1)

HSP 1 Score: 167.162 bits (422), Expect = 1.146e-39
Identity = 98/229 (42.79%), Postives = 133/229 (58.08%), Query Frame = 2
Query:   62 FPVKLKKIVDIPETDHLIFWDEDGLSFHIVDQNQFAHDIIPHYFKHNNISSFIRQLNMYGFHKINRIENGLAVIGNGTEDSQWSHPQFIRDKPELVANITRKVTNPSFNNSLV---------PRKAIGNIDNDNISYES---VKNDLAHLVKAVQQLKQRDEETTEKLKTLQDENHQLYSVLMYLRDEHEKQSKLIDILIKFFSIYA--NNPQENRLKS-KRVLALEMP 703
            F  KLK +VD  ETD LI+WD  G SFHI D N+ A +I+P +FKHNN+SSF+RQLNMYGF KINR +  L   G+G ED ++SHP FIR    L+  I RK  + +F+N+L+         P  + G   N   +  +   +  +   L   V+Q++ R E TT +L  ++ EN  LY  L  LR +HE+QS+LI  L  FFS  A  + P   R+ + KR LAL  P
Sbjct:   11 FLTKLKLLVDDNETDELIYWDPSGKSFHIRDGNRLAKEILPLFFKHNNLSSFVRQLNMYGFRKINRADVYLGTSGDG-EDMEFSHPFFIRGNDALLTRIHRKPPSYTFSNNLLSNQLLTGSPPVPSTGLNQNTAAARANRVILGGEFNRLADIVKQMRARQEWTTHQLHLVRSENQLLYRELALLRSQHEQQSQLIQTLFNFFSAIATESRPSNIRIGAVKRKLALPEP 238          
BLAST of Heat shock transcription factor vs. TrEMBL
Match: A0A504YWU8 (Heat shock transcription factor isoform 3 OS=Fasciola gigantica OX=46835 GN=FGIG_06892 PE=3 SV=1)

HSP 1 Score: 153.68 bits (387), Expect = 2.182e-38
Identity = 90/231 (38.96%), Postives = 126/231 (54.55%), Query Frame = 2
Query:   62 FPVKLKKIVDIPETDHLIFWDEDGLSFHIVDQNQFAHDIIPHYFKHNNISSFIRQLNMYGFHKINRIENGLAVIGNGTEDSQWSHPQFIRDKPELVANITRK----VTNPSFNN---------SLVPRKAIGNIDNDNISYES---VKNDLAHLVKAVQQLKQRDEETTEKLKTLQDENHQLYSVLMYLRDEHEKQSKLIDILIKFFSIYANNPQENRLK----SKRVLAL 694
            F  KL+ +VD  ET+ LI+WD DG SFHI D N+ A +I+P +FKHNN+SSFIRQLNMYGF K+NR++  +A+     ED ++ HP F+R KP L++ I RK    + N    N         S +    +G      IS+ S      D+  L   ++ L+   E  T +L  +Q EN  LY  L  LR+ HE+QS+LI  L  F S +A + Q    +     +R LA 
Sbjct:   16 FLTKLRLLVDDGETNDLIYWDPDGASFHICDGNRLAKEILPLFFKHNNLSSFIRQLNMYGFRKVNRVDPTVALKIE-LEDMEFKHPYFVRSKPHLMSKIQRKPHANIPNSLLFNGRGGSASLSSYLGGSCMGPSSFTGISHPSRPATVADVERLYTMIRGLRSNQETMTNQLTLVQSENQLLYRELTELRERHEQQSQLIQTLFTFLSAFAKDSQSPNFRFGSGKRRALAF 245          
BLAST of Heat shock transcription factor vs. TrEMBL
Match: A0A2H1BT28 (HSF-type DNA-binding domain protein OS=Fasciola hepatica OX=6192 GN=D915_14985 PE=3 SV=1)

HSP 1 Score: 153.68 bits (387), Expect = 2.397e-38
Identity = 90/231 (38.96%), Postives = 126/231 (54.55%), Query Frame = 2
Query:   62 FPVKLKKIVDIPETDHLIFWDEDGLSFHIVDQNQFAHDIIPHYFKHNNISSFIRQLNMYGFHKINRIENGLAVIGNGTEDSQWSHPQFIRDKPELVANITRK----VTNPSFNN---------SLVPRKAIGNIDNDNISYES---VKNDLAHLVKAVQQLKQRDEETTEKLKTLQDENHQLYSVLMYLRDEHEKQSKLIDILIKFFSIYANNPQENRLK----SKRVLAL 694
            F  KL+ +VD  ET+ LI+WD DG SFHI D N+ A +I+P +FKHNN+SSFIRQLNMYGF K+NR++  +A +    ED ++ HP F+R KP L++ I RK    + N    N         S +    +G      IS+ S      D+  L   ++ L+   E  T +L  +Q EN  LY  L  LR+ HE+QS+LI  L  F S +A + Q    +     +R LA 
Sbjct:   16 FLTKLRLLVDDGETNDLIYWDPDGASFHICDGNRLAKEILPLFFKHNNLSSFIRQLNMYGFRKVNRVDPTVA-LKIELEDMEFKHPYFVRSKPHLMSKIQRKPHANIPNSLLFNGRGGGASLSSYLGGSCMGPSSFTGISHPSRPATVADVERLYTMIRGLRSNQETMTNQLTLVQSENQLLYRELTELRERHEQQSQLIQTLFTFLSAFAKDSQSPNFRFGSGKRRALAF 245          
BLAST of Heat shock transcription factor vs. TrEMBL
Match: A0A4E0RBF7 (Heat shock transcription factor isoform 3 OS=Fasciola hepatica OX=6192 GN=D915_010496 PE=3 SV=1)

HSP 1 Score: 153.68 bits (387), Expect = 2.533e-38
Identity = 90/231 (38.96%), Postives = 126/231 (54.55%), Query Frame = 2
Query:   62 FPVKLKKIVDIPETDHLIFWDEDGLSFHIVDQNQFAHDIIPHYFKHNNISSFIRQLNMYGFHKINRIENGLAVIGNGTEDSQWSHPQFIRDKPELVANITRK----VTNPSFNN---------SLVPRKAIGNIDNDNISYES---VKNDLAHLVKAVQQLKQRDEETTEKLKTLQDENHQLYSVLMYLRDEHEKQSKLIDILIKFFSIYANNPQENRLK----SKRVLAL 694
            F  KL+ +VD  ET+ LI+WD DG SFHI D N+ A +I+P +FKHNN+SSFIRQLNMYGF K+NR++  +A+     ED ++ HP F+R KP L++ I RK    + N    N         S +    +G      IS+ S      D+  L   ++ L+   E  T +L  +Q EN  LY  L  LR+ HE+QS+LI  L  F S +A + Q    +     +R LA 
Sbjct:   16 FLTKLRLLVDDGETNDLIYWDPDGASFHICDGNRLAKEILPLFFKHNNLSSFIRQLNMYGFRKVNRVDPTVALKIE-LEDMEFKHPYFVRSKPHLMSKIQRKPHANIPNSLLFNGRGGGASLSSYLGGSCMGPSSFTGISHPSRPATVADVERLYTMIRGLRSNQETMTNQLTLVQSENQLLYRELTELRERHEQQSQLIQTLFTFLSAFAKDSQSPNFRFGSGKRRALAF 245          
BLAST of Heat shock transcription factor vs. TrEMBL
Match: V4AT62 (HSF_DOMAIN domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_214431 PE=3 SV=1)

HSP 1 Score: 148.288 bits (373), Expect = 1.513e-36
Identity = 82/226 (36.28%), Postives = 132/226 (58.41%), Query Frame = 2
Query:   41 SESNSLP-FPVKLKKIVDIPETDHLIFWDEDGLSFHIVDQNQFAHDIIPHYFKHNNISSFIRQLNMYGFHKINRIENGLAVIGNGTEDSQWSHPQFIRDKPELVANITRKVTNPSFNNSLVPRKAIGNIDNDNISYESVKNDLAHLVKAVQQLKQRDEETTEKLKTLQDENHQLYSVLMYLRDEHEKQSKLIDILIKFF-SIYANNPQENRLKSKRVLALEMPQSE 712
            S S ++P F +KL  +V+ P  + LI WD  G SFH+ DQ +FA +++PHYFKHNNISSFIRQLNMYGF K+  +E G   I    +D ++ H  F R + +L+ NI R+ +NP                +D++ Y  + +D++ L+  V  +K + +  T KL+ L++EN  L+  +  LR +H KQ ++++ LI+F  ++   N   + +K +  L +E P S+
Sbjct:   10 SNSGNVPAFLLKLWTLVEDPTCNDLICWDSSGKSFHVTDQTRFAKEVLPHYFKHNNISSFIRQLNMYGFRKVGAVEQGALKIEK--DDVEFHHSYFQRGEQKLLENIKRRTSNPK---------------SDSMKY--LHDDVSELLADVHTIKGKQDTVTSKLEQLRNENEVLWREVASLRQKHSKQQQIVNKLIQFLVTLAGGNRGLSGMKRRMQLMIEEPGSQ 216          
BLAST of Heat shock transcription factor vs. Ensembl Cavefish
Match: HSF1 (heat shock transcription factor 1 [Source:HGNC Symbol;Acc:HGNC:5224])

HSP 1 Score: 146.362 bits (368), Expect = 3.879e-37
Identity = 79/216 (36.57%), Postives = 123/216 (56.94%), Query Frame = 2
Query:   47 SNSLPFPVKLKKIVDIPETDHLIFWDEDGLSFHIVDQNQFAHDIIPHYFKHNNISSFIRQLNMYGFHKINRIENGLAVIGNGTEDSQWSHPQFIRDKPELVANITRKVTNPSFNNSLVPRKAIGNIDNDNISYESVKNDLAHLVKAVQQLKQRDEETTEKLKTLQDENHQLYSVLMYLRDEHEKQSKLIDILIKFFSIYANNPQENRLKSKRVLAL 694
            SN   F  KL  +V+ PETD LI W   G SFH+ DQ +F+ +++P YFKHNN++SF+RQLNMYGF K+  IE+G  ++    +D+++ HP F+R +  L+ NI RKVT            A+ NI ++++       D+  ++  V  +K + E    K+ TL+ EN  L+  +  LR +H +Q K+++ LI+F    A   +   +K K  L L
Sbjct:   16 SNVPAFLTKLWTLVEDPETDPLICWSPHGNSFHVFDQGRFSKEVLPKYFKHNNMASFVRQLNMYGFRKVVHIEHG-GLVKPEKDDTEFQHPFFVRGQEHLLENIKRKVT------------AVSNIKHEDLKLS--PEDVTKMITDVHHMKGKQESMDSKISTLKHENEALWREVASLRQKHAQQQKVVNKLIQFLITLARTNRVLGVKRKMPLML 216          
BLAST of Heat shock transcription factor vs. Ensembl Cavefish
Match: HSF1 (heat shock transcription factor 1 [Source:HGNC Symbol;Acc:HGNC:5224])

HSP 1 Score: 145.591 bits (366), Expect = 1.910e-36
Identity = 81/226 (35.84%), Postives = 128/226 (56.64%), Query Frame = 2
Query:   47 SNSLPFPVKLKKIVDIPETDHLIFWDEDGLSFHIVDQNQFAHDIIPHYFKHNNISSFIRQLNMYGFHKINRIENGLAVIGNGTEDSQWSHPQFIRDKPELVANITRKVTNPSFNNSLVPRKAIGNIDNDNISYESVKNDLAHLVKAVQQLKQRDEETTEKLKTLQDENHQLYSVLMYLRDEHEKQSKLIDILIKFFSIYANNPQENRLKSKRVLALEMPQSESPLM 724
            SN   F  KL  +V+ PETD LI W   G SFH+ DQ +F+ +++P YFKHNN++SF+RQLNMYGF K+  IE+G  ++    +D+++ HP F+R +  L+ NI RKVT            A+ NI ++++       D+  ++  V  +K + E    K+ TL+ EN  L+  +  LR +H +Q K+++ LI+F    A        ++ RVL +   + + PLM
Sbjct:   16 SNVPAFLTKLWTLVEDPETDPLICWSPHGNSFHVFDQGRFSKEVLPKYFKHNNMASFVRQLNMYGFRKVVHIEHG-GLVKPEKDDTEFQHPFFVRGQEHLLENIKRKVT------------AVSNIKHEDLKLSP--EDVTKMITDVHHMKGKQESMDSKISTLKHENEALWREVASLRQKHAQQQKVVNKLIQFLITLA--------RTNRVLGV---KRKMPLM 215          
BLAST of Heat shock transcription factor vs. Ensembl Cavefish
Match: hsf2 (heat shock transcription factor 2 [Source:NCBI gene;Acc:103045780])

HSP 1 Score: 123.25 bits (308), Expect = 2.771e-29
Identity = 76/217 (35.02%), Postives = 122/217 (56.22%), Query Frame = 2
Query:   47 SNSLPFPVKLKKIVDIPETDHLIFWDEDGLSFHIVDQNQFAHDIIPHYFKHNNISSFIRQLNMYGFHKINRIENGLAVIGNGTEDSQWSHPQFIRDKPELVANITRKVTNPSFNNSLVPRKAIGNIDNDNISYESVKNDLAHLVKAVQQLKQRDEETTEKLKTLQDENHQLYSVLMYLRDEHEKQSKLIDILIKF-FSIYANNPQENRLKSKRVLAL 694
            SN   F  KL  +V+  +T+ LI W ++G SF ++D+ +FA +I+P +FKHNN++SF+RQLNMYGF K+  I+ G+ V        ++ HP F   + +L+ +I RKV+N             G  +++ +  E    DL+ ++ +VQ +  + E    +L TL+ EN  L+  +  LR +H +Q   I  L++F F++  NN   N LK KR L L
Sbjct:    5 SNVPAFLTKLWTLVEDSDTNELICWSQEGNSFLVLDEQRFAKEILPKFFKHNNMASFVRQLNMYGFRKVMHIDTGI-VKQERDGPVEFQHPYFKHGQDDLLEHIKRKVSN-------------GRPEDNKLRQE----DLSKILSSVQNVHDKQENMDARLATLKRENEALWREMSDLRQKHAQQQHAIKELVQFIFTLVQNNRLLN-LKRKRPLLL 202          
BLAST of Heat shock transcription factor vs. Ensembl Cavefish
Match: hsf4 (heat shock transcription factor 4 [Source:ZFIN;Acc:ZDB-GENE-050306-18])

HSP 1 Score: 116.316 bits (290), Expect = 2.354e-27
Identity = 68/200 (34.00%), Postives = 111/200 (55.50%), Query Frame = 2
Query:   35 NGSESNSLPFPVKLKKIVDIPETDHLIFWDEDGLSFHIVDQNQFAHDIIPHYFKHNNISSFIRQLNMYGFHKINRIENGLAVIGNGTEDSQWSHPQFIRDKPELVANITRKVTNPSFNNSLVPRKAIGNIDNDNISYESVKNDLAHLVKAVQQLKQRDEETTEKLKTLQDENHQLYSVLMYLRDEHEKQSKLIDILIKFF 634
             G  SN   F  KL  +V+ PET+HLI W   G SFH+ DQ +FA +++P YFKHNN++SF+RQLNM GF K+  IE    ++    +D+++ H  F++    L+ +I RKV+             I   +   +  E    DL+ L+  VQ L+ + E    +++ ++ +N  L+  ++ LR  H +Q K+++ LI+F 
Sbjct:   12 GGYASNVPAFLTKLWTLVEDPETNHLICWSTTGTSFHVFDQGRFAKEVLPKYFKHNNMASFVRQLNM-GFRKVVNIEQS-GLVKPERDDTEFQHLYFLQGHEHLLEHIKRKVS-------------IVKSEETKVRQE----DLSKLLYEVQVLRNQQENMECQMQDMK-QNEVLWREVVSLRQNHTQQQKVMNKLIQFL 191          
BLAST of Heat shock transcription factor vs. Ensembl Cavefish
Match: si:dkey-18a10.3 (heat shock factor protein 1-like [Source:NCBI gene;Acc:103033364])

HSP 1 Score: 104.76 bits (260), Expect = 6.711e-25
Identity = 61/191 (31.94%), Postives = 108/191 (56.54%), Query Frame = 2
Query:   62 FPVKLKKIVDIPETDHLIFWDEDGLSFHIVDQNQFAHDIIPHYFKHNNISSFIRQLNMYGFHKINRIENGLAVIGNGTEDS-QWSHPQFIRDKPELVANITRKVTNPSFNNSLVPRKAIGNIDNDNISYESVKNDLAHLVKAVQQLKQRDEETTEKLKTLQDENHQLYSVLMYLRDEHEKQSKLIDILIKF 631
            F  KL  +VD   T+ L+ W E+G SF ++D+ +F+ +++P Y+KH N++SFIRQLNMYGFHK+  +++GL +  +G  DS ++ H  F +D+P L+  I RKV+        V R     +D+           ++ ++  + Q +   +    KL  L  +N  L+  L  L+ +H++Q ++I  +++F
Sbjct:   10 FLTKLWTLVDDSCTNELVCWSEEGCSFIVLDEQRFSKEVLPLYYKHCNMTSFIRQLNMYGFHKVVPLDSGL-LKEDGRGDSVEFQHEHFRKDQPHLLTLIHRKVS--------VSR----GVDD--------AGQISQILVEISQARGWQDSFDFKLMALCRDNESLWRELNSLQQKHQQQHRIICKIMQF 179          
BLAST of Heat shock transcription factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005090.1 (pep scaffold:Pmarinus_7.0:GL478218:1279:19532:1 gene:ENSPMAG00000004630.1 transcript:ENSPMAT00000005090.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 119.013 bits (297), Expect = 2.259e-31
Identity = 62/170 (36.47%), Postives = 100/170 (58.82%), Query Frame = 2
Query:  125 EDGLSFHIVDQNQFAHDIIPHYFKHNNISSFIRQLNMYGFHKINRIENGLAVIGNGTEDSQWSHPQFIRDKPELVANITRKVTNPSFNNSLVPRKAIGNIDNDNISYESVKNDLAHLVKAVQQLKQRDEETTEKLKTLQDENHQLYSVLMYLRDEHEKQSKLIDILIKFF 634
            ++GLSFH+ DQ  FA +++P YFKHNN++SF+RQLNMYGF K+  IE G  ++    +++++ HP FIR +  L+ +I RKV+     +  V +  +G I +D                 VQQ++ R E    +L T++ EN  L+  +  LR +H +Q K+++ LI+F 
Sbjct:    1 QNGLSFHVFDQGHFAKEVLPKYFKHNNMASFVRQLNMYGFRKVVNIEQG-GLLKPEKDETEFQHPYFIRGQENLLEHIKRKVSAVKPEDMRVQQGDMGRIISD-----------------VQQIRGRQENMDNRLNTMKMENEALWREVASLRQKHAQQQKVVNKLIQFL 152          
BLAST of Heat shock transcription factor vs. Ensembl Yeast
Match: HSF1 (Trimeric heat shock transcription factor; activates multiple genes in response to highly diverse stresses; recognizes variable heat shock elements (HSEs) consisting of inverted NGAAN repeats; monitors translational status of cell through an RQC (Ribosomal Quality Control)-mediated translation-stress signal; involved in diauxic shift; posttranslationally regulated; human homolog HSF1 with linker region mutations can complement yeast hsf1 mutant [Source:SGD;Acc:S000003041])

HSP 1 Score: 87.8113 bits (216), Expect = 2.051e-18
Identity = 58/230 (25.22%), Postives = 105/230 (45.65%), Query Frame = 2
Query:   62 FPVKLKKIVDIPETDHLIFWDEDGLSFHIVDQNQFAHDIIPHYFKHNNISSFIRQLNMYGFHKINRIENGLAVIGNGTEDSQWSHPQFIRDKPELVANITRKVTNPSFNNSLVPRKAIGNIDNDNISYESV--------------------------------------KNDLAHLVKAVQQLKQRDEETTEKLKTLQDENHQLYSVLMYLRDEHEKQSKLIDILIKFFS 637
            F  KL  +++      LI W EDG SF + ++ +F H I+P YFKH+N +SF+RQLNMYG+HK+  +++G ++  +  +  Q+ +  FIR + +L+  I R+    S NN   P       +  NI  ++                                       KND+  ++  ++Q+K      ++ L  +  +N  L+   M  R+ H  Q + ++ + +F +
Sbjct:  175 FVNKLWSMLNDDSNTKLIQWAEDGKSFIVTNREEFVHQILPKYFKHSNFASFVRQLNMYGWHKVQDVKSG-SIQSSSDDKWQFENENFIRGREDLLEKIIRQKG--SSNNHNSPSGNGNPANGSNIPLDNAAGSNNSNNNISSSNSFFNNGHLLQGKTLRLMNEANLGDKNDVTAILGELEQIKYNQIAISKDLLRINKDNELLWQENMMARERHRTQQQALEKMFRFLT 401          
BLAST of Heat shock transcription factor vs. Ensembl Yeast
Match: SKN7 (Nuclear response regulator and transcription factor; physically interacts with the Tup1-Cyc8 complex and recruits Tup1p to its targets; part of a branched two-component signaling system; required for optimal induction of heat-shock genes in response to oxidative stress; involved in osmoregulation; relocalizes to the cytosol in response to hypoxia; SKN7 has a paralog, HMS2, that arose from the whole genome duplication [Source:SGD;Acc:S000001249])

HSP 1 Score: 79.337 bits (194), Expect = 7.775e-16
Identity = 38/111 (34.23%), Postives = 65/111 (58.56%), Query Frame = 2
Query:   38 GSESNSLPFPVKLKKIVDIPETDHLIFWDEDGLSFHIVDQNQFAHDIIPHYFKHNNISSFIRQLNMYGFHKINRIENGLAVIGNGTEDSQWSHPQFIRDKPELVANITRKV 370
            G+++ +  F  KL +I++  E   ++ W E+G SF ++D  +F   I+P++FKH+N +SF+RQLN Y FHK+ R          G +  ++ HP+F     + + NI RK+
Sbjct:   79 GAKAPANEFVRKLFRILENNEYPDIVTWTENGKSFVVLDTGKFTTHILPNHFKHSNFASFVRQLNKYDFHKVKRSPEERQRCKYGEQSWEFQHPEFRVHYGKGLDNIKRKI 189          
BLAST of Heat shock transcription factor vs. Ensembl Yeast
Match: SFL1 (Transcriptional repressor and activator; involved in repression of flocculation-related genes, and activation of stress responsive genes; has direct role in INO1 transcriptional memory; negatively regulated by cAMP-dependent protein kinase A subunit Tpk2p; premature stop codon (C1430T, Q477-stop) in SK1 background is linked to the aggressively invasive phenotype of SK1 relative to BY4741 (S288C) [Source:SGD;Acc:S000005666])

HSP 1 Score: 61.2326 bits (147), Expect = 3.755e-10
Identity = 29/62 (46.77%), Postives = 41/62 (66.13%), Query Frame = 2
Query:   71 KLKKIVDIPETDHLIFWDEDGLSFHIVDQNQFAHDIIPHYFKHNNISSFIRQLNMYGFHKIN 256
            KL +I++      LI+W   GLSF I    +F+  +   YFKH NI+SF+RQLN+YGFHK++
Sbjct:   68 KLYQILEDESLHDLIWWTPSGLSFMIKPVERFSKALA-TYFKHTNITSFVRQLNIYGFHKVS 128          
BLAST of Heat shock transcription factor vs. Ensembl Yeast
Match: MGA1 (Protein similar to heat shock transcription factor; multicopy suppressor of pseudohyphal growth defects of ammonium permease mutants [Source:SGD;Acc:S000003481])

HSP 1 Score: 55.8398 bits (133), Expect = 1.252e-8
Identity = 40/112 (35.71%), Postives = 60/112 (53.57%), Query Frame = 2
Query:   71 KLKKIVDIPETDHLIFWD-EDGLSFHI--VDQNQFAHDIIPHYFKHNNISSFIRQLNMYGFHKINR--IENGLAVIGNGTEDSQW--SHPQ--FIRDKPELVAN-ITRKVTN 376
            +L  I+  PE +  I+W   D   F +   D N F+  ++  YFKH N++SF+RQL+MYGFHK++    +   A  GN  E  +W  +HP   F ++    + N I RK T 
Sbjct:    9 QLHAILLEPEVNKWIYWSPTDNTVFFLKPYDPN-FSTHVLKRYFKHGNVNSFVRQLHMYGFHKLSHPSPDQSSANNGNVKELVEWKFTHPSGFFFKEANAGILNKIQRKSTG 119          
BLAST of Heat shock transcription factor vs. Ensembl Nematostella
Match: EDO47342 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMH2])

HSP 1 Score: 108.612 bits (270), Expect = 3.539e-27
Identity = 68/193 (35.23%), Postives = 104/193 (53.89%), Query Frame = 2
Query:   47 SNSLPFPVKLKKIVDIPETDHLIFWDEDGLSFHIVDQNQFAHDIIPHYFKHNNISSFIRQLNMYGFHKINRIENGLAVIGNGTEDSQWS--HPQFIRDKPELVANITRKVTNPSFNNSLVPRKAIGNIDNDNISYESVKN-DLAHLVKAVQQLKQRDEETTEKLKTLQDENHQLYSVLMYLRDEHEKQSKLID 616
            SN   F VKL K+V+ P+ D  I W+  G  F + DQ  FA +I+P YFKHNN +SF+RQLNMYGF K+   E G    G  +++  W   +P F   +P+L+ N+ RK           P +            + +KN D+A ++  VQ +K + +E T KL  ++ EN  L+  L+ LR +H +Q  +++
Sbjct:   13 SNVPAFLVKLWKLVEDPQYDMHISWNRIGSGFLVHDQATFAREILPKYFKHNNFASFVRQLNMYGFRKVIGAEQG----GLRSDNDVWEFHNPNFQCGQPQLLENVKRKAA---------PEE------------KKMKNEDVAKVLNEVQDMKGKQDEMTAKLDQMKRENETLWRELVDLRSKHTRQQTIVN 180          
BLAST of Heat shock transcription factor vs. Ensembl Nematostella
Match: EDO33068 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST87])

HSP 1 Score: 67.3958 bits (163), Expect = 6.258e-12
Identity = 45/122 (36.89%), Postives = 70/122 (57.38%), Query Frame = 2
Query:   35 NGSESNSLPFPVKLKKIVDIPETDHLIFWDEDGLSFHIVDQNQFAHDIIPH----YFKHNNISSFIRQLNMYGFHKI--NRIENGLAVIGNGTEDSQWSHPQFIRDKPELVANITRKVTNPS 382
            N  E++ L FP KL  +V  P+ +  I W++DG S  I + + F   I+       FK NN +SF+RQLN+YGF K+  +R +N    +  G + S++ HP F R++ +L+    R+ TNPS
Sbjct:    3 NSIEASLLSFPEKLWFLVSDPKCEE-ITWNDDGTSILIPNHHSFTSTILNSQSIVLFKTNNFASFVRQLNLYGFRKVTEHRRKNQTMQLVAGMK-SEFKHPCFKRERKDLL-QFVRRQTNPS 121          
BLAST of Heat shock transcription factor vs. Ensembl Nematostella
Match: EDO41001 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5M2])

HSP 1 Score: 57.3806 bits (137), Expect = 5.379e-9
Identity = 37/109 (33.94%), Postives = 54/109 (49.54%), Query Frame = 2
Query:   59 PFPVKLKKIVDIPETDHLIFWDEDGLSFHIVDQNQFAH---DIIPHYFKHNNISSFIRQLNMYGFHKINRIENGLAVIGNG--TEDSQWSHPQFIRDKPELVANITRKV 370
            PF  KLK +++  +    I W E+G +  I D   F     D     FK  N +SF+RQLN+YGF K         V G G  +++ ++ HP F R+KPE +  + R  
Sbjct:   22 PFISKLKLLLNDEKFRRAIKWSENGCAVVISDGETFKKVVLDRSEEMFKTRNFTSFVRQLNLYGFRKT-------PVNGKGDPSKNMKFEHPDFQREKPEKMHLVKRTC 123          
BLAST of Heat shock transcription factor vs. Ensembl Medaka
Match: HSF1 (heat shock transcription factor 1 [Source:NCBI gene;Acc:101165985])

HSP 1 Score: 147.132 bits (370), Expect = 2.743e-37
Identity = 79/219 (36.07%), Postives = 128/219 (58.45%), Query Frame = 2
Query:   62 FPVKLKKIVDIPETDHLIFWDEDGLSFHIVDQNQFAHDIIPHYFKHNNISSFIRQLNMYGFHKINRIENGLAVIGNGTEDSQWSHPQFIRDKPELVANITRKVTNPSFNNSLVPRKAIGNIDNDNISYESVKNDLAHLVKAVQQLKQRDEETTEKLKTLQDENHQLYSVLMYLRDEHEKQSKLIDILIKFFSIYANNPQENRLKS-KRVLALEMPQSES 715
            F  KL  +V+ PETDHLI W  +G SFH+ DQ +F+ +++P +FKHNN++SFIRQLNMYGF K+  IE G  ++    +D+++ HP FIR +  L+ NI RKVTN            + ++ +D++      +D++ ++  VQ +K + E    ++  ++ EN  L+  +  LR +H +Q K+++ LI+F        Q NR+   KR + L +  S S
Sbjct:   21 FLTKLWTLVEDPETDHLICWSLNGTSFHVFDQCRFSKEVLPKFFKHNNMASFIRQLNMYGFRKVVHIEQG-GLVKPEKDDTEFQHPFFIRGQEHLLENIKRKVTN------------VSSVRHDDVKL--CADDVSKILNDVQTMKGKQETIDSRIIAMKHENEALWREVASLRQKHAQQQKVVNKLIQFLVSLV---QTNRIMGVKRKIPLMLNDSSS 221          
BLAST of Heat shock transcription factor vs. Ensembl Medaka
Match: HSF1 (heat shock transcription factor 1 [Source:NCBI gene;Acc:101165985])

HSP 1 Score: 147.132 bits (370), Expect = 3.020e-37
Identity = 71/191 (37.17%), Postives = 117/191 (61.26%), Query Frame = 2
Query:   62 FPVKLKKIVDIPETDHLIFWDEDGLSFHIVDQNQFAHDIIPHYFKHNNISSFIRQLNMYGFHKINRIENGLAVIGNGTEDSQWSHPQFIRDKPELVANITRKVTNPSFNNSLVPRKAIGNIDNDNISYESVKNDLAHLVKAVQQLKQRDEETTEKLKTLQDENHQLYSVLMYLRDEHEKQSKLIDILIKFF 634
            F  KL  +V+ PETDHLI W  +G SFH+ DQ +F+ +++P +FKHNN++SFIRQLNMYGF K+  IE G  ++    +D+++ HP FIR +  L+ NI RKVTN            + ++ +D++      +D++ ++  VQ +K + E    ++  ++ EN  L+  +  LR +H +Q K+++ LI+F 
Sbjct:   21 FLTKLWTLVEDPETDHLICWSLNGTSFHVFDQCRFSKEVLPKFFKHNNMASFIRQLNMYGFRKVVHIEQG-GLVKPEKDDTEFQHPFFIRGQEHLLENIKRKVTN------------VSSVRHDDVKL--CADDVSKILNDVQTMKGKQETIDSRIIAMKHENEALWREVASLRQKHAQQQKVVNKLIQFL 196          
BLAST of Heat shock transcription factor vs. Ensembl Medaka
Match: HSF1 (heat shock transcription factor 1 [Source:NCBI gene;Acc:101165985])

HSP 1 Score: 147.132 bits (370), Expect = 4.035e-37
Identity = 79/219 (36.07%), Postives = 128/219 (58.45%), Query Frame = 2
Query:   62 FPVKLKKIVDIPETDHLIFWDEDGLSFHIVDQNQFAHDIIPHYFKHNNISSFIRQLNMYGFHKINRIENGLAVIGNGTEDSQWSHPQFIRDKPELVANITRKVTNPSFNNSLVPRKAIGNIDNDNISYESVKNDLAHLVKAVQQLKQRDEETTEKLKTLQDENHQLYSVLMYLRDEHEKQSKLIDILIKFFSIYANNPQENRLKS-KRVLALEMPQSES 715
            F  KL  +V+ PETDHLI W  +G SFH+ DQ +F+ +++P +FKHNN++SFIRQLNMYGF K+  IE G  ++    +D+++ HP FIR +  L+ NI RKVTN            + ++ +D++      +D++ ++  VQ +K + E    ++  ++ EN  L+  +  LR +H +Q K+++ LI+F        Q NR+   KR + L +  S S
Sbjct:   21 FLTKLWTLVEDPETDHLICWSLNGTSFHVFDQCRFSKEVLPKFFKHNNMASFIRQLNMYGFRKVVHIEQG-GLVKPEKDDTEFQHPFFIRGQEHLLENIKRKVTN------------VSSVRHDDVKL--CADDVSKILNDVQTMKGKQETIDSRIIAMKHENEALWREVASLRQKHAQQQKVVNKLIQFLVSLV---QTNRIMGVKRKIPLMLNDSSS 221          
BLAST of Heat shock transcription factor vs. Ensembl Medaka
Match: hsf4 (heat shock transcription factor 4 [Source:NCBI gene;Acc:101168208])

HSP 1 Score: 125.176 bits (313), Expect = 1.449e-31
Identity = 73/225 (32.44%), Postives = 128/225 (56.89%), Query Frame = 2
Query:   32 MNGSESNSLP-FPVKLKKIVDIPETDHLIFWDEDGLSFHIVDQNQFAHDIIPHYFKHNNISSFIRQLNMYGFHKINRIENGLAVIGNGTEDSQWSHPQFIRDKPELVANITRKVTNPSFNNSLVPRKAIGNIDNDNISYESVKNDLAHLVKAVQQLKQRDEETTEKLKTLQDENHQLYSVLMYLRDEHEKQSKLIDILIKFF--SIYANNPQENRLKSKRVLALE 697
            ++GS S+++P F  KL  +V+ P+T+HLI W   G SFH+ DQ +FA +++P YFKHNN++SF+RQLNMYGF K+  IE    ++    +D+++ H  F++    ++ +I RKV             +I   +   +  E    DL+ L+  VQ L+ + +    +++ ++ +N  L+  ++ LR  H +Q K+++ LI++    +  N+P    LK K  L L+
Sbjct:   10 VDGSYSSNVPAFLTKLWTLVEDPDTNHLICWSATGTSFHVFDQGRFAKEVLPKYFKHNNMASFVRQLNMYGFRKVVNIEQS-GLVKPERDDTEFQHLYFLQGHEHMLEHIKRKV-------------SIVKSEETKVRQE----DLSKLLYEVQLLRTQQDNMEFQMQDMKQQNEVLWREVVSLRQNHTQQQKVMNKLIQYLFSQMQPNSPSNVSLKRKLPLMLD 216          
BLAST of Heat shock transcription factor vs. Ensembl Medaka
Match: hsf2 (heat shock transcription factor 2 [Source:NCBI gene;Acc:101173519])

HSP 1 Score: 121.324 bits (303), Expect = 1.433e-28
Identity = 79/238 (33.19%), Postives = 124/238 (52.10%), Query Frame = 2
Query:   44 ESNSLP-FPVKLKKIVDIPETDHLIFWDEDGLSFHIVDQNQFAHDIIPHYFKHNNISSFIRQLNMYGFHKINRIENGLAVIGNGTEDSQWSHPQFIRDKPELVANITRKVTNPSFNNSLVPRKAIGNIDNDNISYESVKNDLAHLVKAVQQLKQRDEETTEKLKTLQDENHQLYSVLMYLRDEHEKQSKLIDILIKFFSIYANNPQENRLKSKRVLALEMPQSESPLMNLNEPPAKYF 754
            +S+S+P F  KL  +V+  +T+  I W ++G SF ++D+ +FA +I+P +FKHNN++SFIRQLNMYGF K+  ++ G+ V        ++ HP F   + +L+ NI RKV+N    ++ + ++                 DL  ++  VQ +  + E    +L TL+ EN  L+  +  LR +H  Q +LI  LI F      + +   LK KR          S LMN N    KYF
Sbjct:    3 QSSSVPAFLTKLWTLVEDADTNEFICWSQEGNSFLVLDEQRFAKEILPKFFKHNNMASFIRQLNMYGFRKVMHMDTGV-VKQERDGPVEFQHPYFKHGQDDLLENIKRKVSNTRPEDNKLRQE-----------------DLTKILATVQSVHSKQESIDARLTTLKRENESLWREISDLRQKHVHQQQLIKKLIHFIVTLVQSNRIINLKRKR----------SILMNGNGKKPKYF 212          
BLAST of Heat shock transcription factor vs. Planmine SMEST
Match: SMESG000028667.1 (SMESG000028667.1)

HSP 1 Score: 1228.77 bits (3178), Expect = 0.000e+0
Identity = 650/651 (99.85%), Postives = 650/651 (99.85%), Query Frame = 2
Query:   32 MNGSESNSLPFPVKLKKIVDIPETDHLIFWDEDGLSFHIVDQNQFAHDIIPHYFKHNNISSFIRQLNMYGFHKINRIENGLAVIGNGTEDSQWSHPQFIRDKPELVANITRKVTNPSFNNSLVPRKAIGNIDNDNISYESVKNDLAHLVKAVQQLKQRDEETTEKLKTLQDENHQLYSVLMYLRDEHEKQSKLIDILIKFFSIYANNPQENRLKSKRVLALEMPQSESPLMNLNEPPAKYFVASPKNCPQVTVSTNNTSNLYKGKKLIKITNVSNTPQIDVKTPKXXXXXXXXXXXXXXXXXXXXSAAISNIKSQNPNRLFMINIPKPANSVVMKSPNRAITIGNSSSAXXXXXXXXXXXXXXXXXXQRKLNPLTSIPVSSVKNLININKIAKSVTVSSMDTGADPTYDTAQNIDYSMPTTDNDIFNDNSVFDIDEYLNTQIKQEDHSDKSRINKFSLTSSMSDLEPNQSSVKFASAPVNNKSNCHINRNRIEFNSVISDIKENVSSVGQSLNQIKKCLTTENSFPTNTVTQSNVDFNLESNFDDENYISPTVDDMQYDELKMLWDDIRNRNLDEDFPNSDPSKIQGHELIPFNTQRNEWQEPVYNYQDNFSIDDLLQTPYTQPEESSLSLNGFKDSLYSPEDLFSDCAKL 1984
            MNGSESNSLPFPVKLKKIVDIPETDHLIFWDEDGLSFHIVDQNQFAHDIIPHYFKHNNISSFIRQLNMYGFHKINRIENGLAVIGNGTEDSQWSHPQFIRDKPELVANITRKVTNPSFNNSLVPRKAIGNIDNDNISYESVKNDLAHLVKAVQQLKQRDEETTEKLKTLQDENHQLYSVLMYLRDEHEKQSKLIDILIKFFSIYANNPQENRLKSKRVLALEMPQSESPLMNLNEPPAKYFVASPKNCPQVTVSTNNTSNLYKGKKLIKITNVSNTPQIDVKTPKITFSSTGINTTTNNNKFGGISAAISNIKSQNPNRLFMINIPK ANSVVMKSPNRAITIGNSSSAVNCNGTGNGNINPTIVIPQRKLNPLTSIPVSSVKNLININKIAKSVTVSSMDTGADPTYDTAQNIDYSMPTTDNDIFNDNSVFDIDEYLNTQIKQEDHSDKSRINKFSLTSSMSDLEPNQSSVKFASAPVNNKSNCHINRNRIEFNSVISDIKENVSSVGQSLNQIKKCLTTENSFPTNTVTQSNVDFNLESNFDDENYISPTVDDMQYDELKMLWDDIRNRNLDEDFPNSDPSKIQGHELIPFNTQRNEWQEPVYNYQDNFSIDDLLQTPYTQPEESSLSLNGFKDSLYSPEDLFSDCAKL
Sbjct:    1 MNGSESNSLPFPVKLKKIVDIPETDHLIFWDEDGLSFHIVDQNQFAHDIIPHYFKHNNISSFIRQLNMYGFHKINRIENGLAVIGNGTEDSQWSHPQFIRDKPELVANITRKVTNPSFNNSLVPRKAIGNIDNDNISYESVKNDLAHLVKAVQQLKQRDEETTEKLKTLQDENHQLYSVLMYLRDEHEKQSKLIDILIKFFSIYANNPQENRLKSKRVLALEMPQSESPLMNLNEPPAKYFVASPKNCPQVTVSTNNTSNLYKGKKLIKITNVSNTPQIDVKTPKITFSSTGINTTTNNNKFGGISAAISNIKSQNPNRLFMINIPKTANSVVMKSPNRAITIGNSSSAVNCNGTGNGNINPTIVIPQRKLNPLTSIPVSSVKNLININKIAKSVTVSSMDTGADPTYDTAQNIDYSMPTTDNDIFNDNSVFDIDEYLNTQIKQEDHSDKSRINKFSLTSSMSDLEPNQSSVKFASAPVNNKSNCHINRNRIEFNSVISDIKENVSSVGQSLNQIKKCLTTENSFPTNTVTQSNVDFNLESNFDDENYISPTVDDMQYDELKMLWDDIRNRNLDEDFPNSDPSKIQGHELIPFNTQRNEWQEPVYNYQDNFSIDDLLQTPYTQPEESSLSLNGFKDSLYSPEDLFSDCAKL 651          
BLAST of Heat shock transcription factor vs. Planmine SMEST
Match: SMESG000056045.1 (SMESG000056045.1)

HSP 1 Score: 134.035 bits (336), Expect = 1.246e-34
Identity = 80/204 (39.22%), Postives = 111/204 (54.41%), Query Frame = 2
Query:   32 MNGSESNSLPFPVKLKKIVDIPETDHLIFWDEDGLSFHIVDQNQFAHDIIPHYFKHNNISSFIRQLNMYGFHKINRIENGLAVIGNGTEDSQWSHPQFIRDKPELVANITRKVTNPSFNNSLVPRKAIGNIDNDNISYESVKNDLAHLVKAVQQLKQRDEETTEKLKTLQDENHQLYSVLMYLRDEHEKQSKLIDILIKFFSIY 643
            MN +      F +KL+K+VD P+TD LI+W++DG  F I D +Q A +  P  FKH N+ SFIRQLNMYGFHKINRIE G        +DS+WSHP F+R++ +L+  I RK+   S N  +   +       D   YE     L  L  A + L+ RDE    K+  L+ +N  + + L   R + E QS  I+ +    S Y
Sbjct:    1 MNNNSQKIPEFLLKLRKLVDSPKTDKLIYWNQDGKGFAITDGHQLAREYFPLLFKHQNMLSFIRQLNMYGFHKINRIELGTNSNKGSCDDSEWSHPHFVRNRHDLLFKIQRKI---SVNTDISENQG------DPFKYE-----LCLLKSAFRHLRSRDEIKMNKILDLERQNDIMRNELKDFRIQMETQSSWINEIYGSLSGY 190          
The following BLAST results are available for this feature:
BLAST of Heat shock transcription factor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HSF17.811e-3637.24heat shock transcription factor 1 [Source:HGNC Sym... [more]
HSF17.811e-3637.24heat shock transcription factor 1 [Source:HGNC Sym... [more]
HSF12.223e-3537.24heat shock transcription factor 1 [Source:HGNC Sym... [more]
HSF12.223e-3537.24heat shock transcription factor 1 [Source:HGNC Sym... [more]
HSF44.292e-3331.78heat shock transcription factor 4 [Source:HGNC Sym... [more]
back to top
BLAST of Heat shock transcription factor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
hsf-11.488e-2727.31Heat Shock Factor; Heat shock transcription factor... [more]
back to top
BLAST of Heat shock transcription factor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Hsf9.989e-2834.12gene:FBgn0001222 transcript:FBtr0110966[more]
Hsf1.049e-2734.12gene:FBgn0001222 transcript:FBtr0110964[more]
Hsf1.208e-2734.12gene:FBgn0001222 transcript:FBtr0086782[more]
Hsf1.231e-2734.12gene:FBgn0001222 transcript:FBtr0110965[more]
back to top
BLAST of Heat shock transcription factor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hsf16.063e-3936.65heat shock transcription factor 1 [Source:ZFIN;Acc... [more]
hsf18.851e-3936.65heat shock transcription factor 1 [Source:ZFIN;Acc... [more]
hsf41.208e-3330.18heat shock transcription factor 4 [Source:ZFIN;Acc... [more]
hsf41.597e-3230.56heat shock transcription factor 4 [Source:ZFIN;Acc... [more]
hsf21.592e-3035.48heat shock transcription factor 2 [Source:ZFIN;Acc... [more]
back to top
BLAST of Heat shock transcription factor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
phlda13.052e-3332.81pleckstrin homology-like domain, family A, member ... [more]
phlda14.928e-3332.81pleckstrin homology-like domain, family A, member ... [more]
ENSXETT00000012423.12.277e-2935.98heat shock transcription factor 1 [Source:NCBI gen... [more]
ENSXETT00000012455.15.230e-2935.32heat shock transcription factor 1 [Source:NCBI gen... [more]
ENSXETT00000028726.13.543e-2837.79heat shock transcription factor 1 [Source:NCBI gen... [more]
back to top
BLAST of Heat shock transcription factor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hsf11.140e-3636.61heat shock factor 1 [Source:MGI Symbol;Acc:MGI:962... [more]
Hsf11.646e-3636.61heat shock factor 1 [Source:MGI Symbol;Acc:MGI:962... [more]
Hsf15.195e-3636.61heat shock factor 1 [Source:MGI Symbol;Acc:MGI:962... [more]
Hsf15.266e-3636.61heat shock factor 1 [Source:MGI Symbol;Acc:MGI:962... [more]
Hsf16.349e-3636.61heat shock factor 1 [Source:MGI Symbol;Acc:MGI:962... [more]
back to top
BLAST of Heat shock transcription factor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P38529|HSF1_CHICK1.365e-3638.78Heat shock factor protein 1 OS=Gallus gallus OX=90... [more]
sp|P41154|HSF_XENLA6.693e-3637.90Heat shock factor protein OS=Xenopus laevis OX=835... [more]
sp|P38532|HSF1_MOUSE3.684e-3536.61Heat shock factor protein 1 OS=Mus musculus OX=100... [more]
sp|Q00613|HSF1_HUMAN1.068e-3437.24Heat shock factor protein 1 OS=Homo sapiens OX=960... [more]
sp|Q08DJ8|HSF1_BOVIN2.502e-3436.73Heat shock factor protein 1 OS=Bos taurus OX=9913 ... [more]
back to top
BLAST of Heat shock transcription factor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0V0J6X31.146e-3942.79Heat shock factor protein OS=Schistocephalus solid... [more]
A0A504YWU82.182e-3838.96Heat shock transcription factor isoform 3 OS=Fasci... [more]
A0A2H1BT282.397e-3838.96HSF-type DNA-binding domain protein OS=Fasciola he... [more]
A0A4E0RBF72.533e-3838.96Heat shock transcription factor isoform 3 OS=Fasci... [more]
V4AT621.513e-3636.28HSF_DOMAIN domain-containing protein OS=Lottia gig... [more]
back to top
BLAST of Heat shock transcription factor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HSF13.879e-3736.57heat shock transcription factor 1 [Source:HGNC Sym... [more]
HSF11.910e-3635.84heat shock transcription factor 1 [Source:HGNC Sym... [more]
hsf22.771e-2935.02heat shock transcription factor 2 [Source:NCBI gen... [more]
hsf42.354e-2734.00heat shock transcription factor 4 [Source:ZFIN;Acc... [more]
si:dkey-18a10.36.711e-2531.94heat shock factor protein 1-like [Source:NCBI gene... [more]
back to top
BLAST of Heat shock transcription factor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000005090.12.259e-3136.47pep scaffold:Pmarinus_7.0:GL478218:1279:19532:1 ge... [more]
back to top
BLAST of Heat shock transcription factor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
HSF12.051e-1825.22Trimeric heat shock transcription factor; activate... [more]
SKN77.775e-1634.23Nuclear response regulator and transcription facto... [more]
SFL13.755e-1046.77Transcriptional repressor and activator; involved ... [more]
MGA11.252e-835.71Protein similar to heat shock transcription factor... [more]
back to top
BLAST of Heat shock transcription factor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO473423.539e-2735.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO330686.258e-1236.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO410015.379e-933.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Heat shock transcription factor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HSF12.743e-3736.07heat shock transcription factor 1 [Source:NCBI gen... [more]
HSF13.020e-3737.17heat shock transcription factor 1 [Source:NCBI gen... [more]
HSF14.035e-3736.07heat shock transcription factor 1 [Source:NCBI gen... [more]
hsf41.449e-3132.44heat shock transcription factor 4 [Source:NCBI gen... [more]
hsf21.433e-2833.19heat shock transcription factor 2 [Source:NCBI gen... [more]
back to top
BLAST of Heat shock transcription factor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000028667.10.000e+099.85SMESG000028667.1[more]
SMESG000056045.11.246e-3439.22SMESG000056045.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019262 ID=SMED30019262|Name=Heat shock transcription factor|organism=Schmidtea mediterranea sexual|type=transcript|length=2088bp
TTAATTTTTAAATTTTATTTATTTTTTGAAAATGAATGGTTCAGAATCCA
ATTCATTACCTTTCCCTGTGAAATTAAAAAAGATTGTTGATATACCGGAA
ACAGATCATCTAATTTTTTGGGATGAAGATGGCTTAAGTTTTCATATCGT
GGATCAAAATCAATTTGCTCATGATATTATTCCACATTATTTCAAACATA
ATAATATATCTAGCTTCATTAGACAGTTAAATATGTATGGTTTTCATAAA
ATAAATCGAATTGAAAATGGTTTAGCAGTCATTGGAAATGGCACTGAAGA
TTCTCAATGGAGTCATCCTCAATTTATTCGTGATAAACCTGAACTAGTAG
CAAATATTACTAGAAAAGTTACAAATCCTTCTTTCAACAATTCACTAGTC
CCCAGAAAAGCAATAGGGAATATTGACAATGATAATATATCATATGAGTC
TGTTAAAAATGACCTAGCTCATTTAGTCAAAGCTGTTCAGCAACTTAAGC
AAAGGGATGAAGAAACAACAGAAAAATTGAAAACTCTACAAGATGAAAAC
CATCAACTATATTCCGTTTTAATGTATTTACGAGACGAACATGAAAAACA
ATCGAAATTAATCGATATTCTTATCAAATTCTTTTCAATCTATGCTAATA
ATCCTCAAGAAAACAGATTAAAATCTAAACGCGTTCTTGCTCTTGAAATG
CCACAATCTGAATCTCCTTTAATGAATTTGAATGAACCGCCAGCAAAATA
TTTTGTAGCATCTCCTAAAAACTGTCCACAAGTTACTGTATCGACCAATA
ACACTTCTAATTTATATAAAGGGAAAAAATTGATTAAAATCACCAATGTC
AGTAATACTCCACAAATCGATGTAAAAACACCAAAAATTACATTCAGTAG
CACCGGCATTAATACTACTACTAACAATAATAAATTTGGCGGAATTTCAG
CAGCAATAAGTAACATAAAATCCCAGAATCCAAATCGTCTTTTTATGATT
AACATACCGAAACCTGCTAACAGCGTAGTGATGAAATCCCCTAATCGTGC
TATTACCATTGGTAATAGTAGTAGTGCTGTCAATTGTAATGGCACTGGGA
ACGGTAATATAAATCCTACAATAGTTATTCCGCAAAGGAAATTAAATCCA
CTAACTTCAATTCCAGTTAGTTCTGTGAAAAATTTAATTAACATAAACAA
AATCGCGAAATCTGTAACTGTTTCTTCAATGGATACTGGCGCAGATCCCA
CATATGATACTGCTCAAAATATTGATTATTCAATGCCAACAACTGATAAT
GACATTTTTAACGATAATTCCGTCTTTGATATCGACGAATATCTCAATAC
CCAAATTAAACAAGAAGACCATTCCGATAAAAGTCGAATAAATAAATTCT
CATTAACCTCATCAATGTCTGATCTTGAACCGAATCAAAGTTCGGTAAAA
TTTGCGAGTGCACCTGTTAATAACAAAAGTAACTGTCATATAAATCGAAA
CAGAATTGAATTTAATTCAGTTATTTCTGATATCAAAGAAAATGTCAGTT
CTGTCGGTCAAAGCTTGAATCAAATAAAAAAATGTCTTACTACTGAAAAT
TCATTTCCAACTAATACTGTTACACAGTCGAATGTTGATTTCAATCTTGA
ATCGAATTTCGATGATGAAAATTATATCTCACCCACTGTCGACGATATGC
AATATGATGAATTGAAAATGTTGTGGGATGATATCAGAAATCGTAATCTG
GATGAAGATTTTCCCAATTCAGATCCTAGCAAAATTCAAGGTCACGAATT
AATTCCGTTCAACACACAACGCAATGAATGGCAGGAACCGGTTTATAATT
ACCAGGACAATTTCTCAATCGACGATCTCCTGCAAACTCCTTATACTCAA
CCAGAAGAATCATCGCTGTCGCTCAACGGATTTAAAGATTCACTATATTC
ACCAGAAGATCTTTTCAGTGATTGTGCAAAACTTTAATAAATGACAATTC
ATGAAATTATCAAATGTTATTATTGCCACTGCAGCCTAAGATTTATTGTA
GTTTTATTATGTTTATGATGTACGAATTTTTGTGAATA
back to top

protein sequence of SMED30019262-orf-1

>SMED30019262-orf-1 ID=SMED30019262-orf-1|Name=SMED30019262-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=652bp
MNGSESNSLPFPVKLKKIVDIPETDHLIFWDEDGLSFHIVDQNQFAHDII
PHYFKHNNISSFIRQLNMYGFHKINRIENGLAVIGNGTEDSQWSHPQFIR
DKPELVANITRKVTNPSFNNSLVPRKAIGNIDNDNISYESVKNDLAHLVK
AVQQLKQRDEETTEKLKTLQDENHQLYSVLMYLRDEHEKQSKLIDILIKF
FSIYANNPQENRLKSKRVLALEMPQSESPLMNLNEPPAKYFVASPKNCPQ
VTVSTNNTSNLYKGKKLIKITNVSNTPQIDVKTPKITFSSTGINTTTNNN
KFGGISAAISNIKSQNPNRLFMINIPKPANSVVMKSPNRAITIGNSSSAV
NCNGTGNGNINPTIVIPQRKLNPLTSIPVSSVKNLININKIAKSVTVSSM
DTGADPTYDTAQNIDYSMPTTDNDIFNDNSVFDIDEYLNTQIKQEDHSDK
SRINKFSLTSSMSDLEPNQSSVKFASAPVNNKSNCHINRNRIEFNSVISD
IKENVSSVGQSLNQIKKCLTTENSFPTNTVTQSNVDFNLESNFDDENYIS
PTVDDMQYDELKMLWDDIRNRNLDEDFPNSDPSKIQGHELIPFNTQRNEW
QEPVYNYQDNFSIDDLLQTPYTQPEESSLSLNGFKDSLYSPEDLFSDCAK
L*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006357regulation of transcription from RNA polymerase II promoter
GO:0006355regulation of transcription, DNA-templated
Vocabulary: cellular component
TermDefinition
GO:0042025host cell nucleus
GO:0005634nucleus
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000074oocyte
PLANA:0000099neuron
PLANA:0000231vitelline gland
Vocabulary: INTERPRO
TermDefinition
IPR000232HSF_DNA-bd
IPR011991WHTH_DNA-bd_dom
Vocabulary: molecular function
TermDefinition
GO:0043565sequence-specific DNA binding
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0003677DNA binding