Cytosolic carboxypeptidase 2

Overview
NameCytosolic carboxypeptidase 2
Smed IDSMED30019258
Length (bp)2932
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cytosolic carboxypeptidase 2 (SMED30019258) t-SNE clustered cells

Violin plots show distribution of expression levels for Cytosolic carboxypeptidase 2 (SMED30019258) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cytosolic carboxypeptidase 2 (SMED30019258) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cytosolic carboxypeptidase 2 (SMED30019258) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019258

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30019258h1SMcG0013802 SmedASXL_015507SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30019258h1SMcG0013802 SmedASXL_015506SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30019258h1SMcG0013802 Contig45404uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019258h1SMcG0013802 Contig45404newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30019258h1SMcG0013802 dd_Smed_v4_13450_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30019258h1SMcG0013802 dd_Smed_v4_13450_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30019258h1SMcG0013802 dd_Smed_v4_13450_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30019258h1SMcG0013802 dd_Smed_v4_13450_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30019258h1SMcG0013802 dd_Smed_v4_13450_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30019258h1SMcG0013802 dd_Smed_v4_13450_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30019258h1SMcG0013802 dd_Smed_v6_13450_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Human
Match: AGBL2 (ATP/GTP binding protein like 2 [Source:HGNC Symbol;Acc:HGNC:26296])

HSP 1 Score: 564.688 bits (1454), Expect = 0.000e+0
Identity = 293/662 (44.26%), Postives = 407/662 (61.48%), Query Frame = 2
Query:  131 FMKKHLQHYGYYKGNKLIMRELEGYEKTHEHSQSDE-------STSESEN--------------------------AIKCNQKTGTSPSLRTTQLIYDYFEDGSYVRKLKAPHNYVLNLQ-----QAPRWPIEMQVLPERIHHITALPQQREFIYIPSNSELKPQPRGEENGRLIFEYKTC--SGPYFTKSKTISKEIGNLLPVTAEFESESDETLCFESRFESGNLEKVYKISPFEYELHLRPDLYTSKHTQWYYFRVSNTRENKMYRFTIVNFYKAESLYNEGLKPLLYSEKDARLSNKGWRRWGSNIAYYRNNLKYETKKGENYYYSLTWNCLFPHDNDTVYFSHCYPYTYSNLMKYVETVSKDPVKSKICRIKLLTKSLAENISLLLTITNSFTEQERKNYKKIILITGRVHPGETNASWMMEGVLDFLLSDKPDAMLLRDLFIFKIVPMLNPDGVIVGNYRCSLTGRDLNRNYKSKLKDYYPIICSVKNLAEKLLKDHEILFYCDFHGHSRKNNIFMYGCNDQKSENEFLLERAFPYILAKNASDKFDYKSCKFKMQKSKSGTSRIVFRNFGIPHSFTLEASFCGTDLISNTNSNRNEQFYHFNTDDLKKMGEAFCYSLLDFSDPDQTQMNIILDNIKEDLTKRYTNKLETRGINID 1996
            FM +HLQ+YGY+K  +  +        TH+H + +        S  E ++                          AI  +    + P LR+ QL+YD  ++ +   +L+ P      L      QAPRWPIE +V+ E IHHI   P Q E+ Y P  +E  P+  GE+ G ++++  +    G YFT S+   K  G +  +    +   D TL FESRFESGNL+K  ++  +EYEL LR DLYT+KHTQW+YFRV NTR++  YRFTIVN  K +SLY  G+KPLLYS+ DA   N GWRR G+ I YY+NN    T  G+  +Y LTW   FP+D DT +F+H YPYTY++L  Y+ +V+ +P++S+ C+++ L +SLA N   LLTITN     +    KK ++++ RVHPGE+N SW+M+G LDF+LS+ PDA LLRD+F+FK++PMLNPDGVIVGNYRCSL GRDLNR+YK+ LK+ +P I   +N+ ++LL++ E+L YCDFHGHSRKNNIF+YGCN+  +   +L ER FP +L KNA DKF + SC FK+QK K GT R+V    GI +S+T+E++F G+ L        N++  HF  +DLK +G   C +LLDF DPDQ +    L  +KE L +    K    G ++D
Sbjct:   20 FMYRHLQYYGYFKAQRGSLPN----SATHQHVRKNNPQCLLNGSLGEKDDLIPDTLQKEKLLWPISLSSAVHRQIEAINRDSHMLSLPHLRSRQLLYDELDEVN--PRLREPQELFSILSTKRPLQAPRWPIECEVIKENIHHIEWAPPQPEYFYQPKGNEKVPEIVGEKKGTVVYQLDSVPIEGSYFTSSRVGGKR-GIVKELAVTLQGPEDNTLLFESRFESGNLQKAVRVDTYEYELTLRTDLYTNKHTQWFYFRVQNTRKDATYRFTIVNLLKPKSLYTVGMKPLLYSQLDANTRNIGWRREGNEIKYYKNN----TDDGQQPFYCLTWTIQFPYDQDTCFFAHFYPYTYTDLQCYLLSVANNPIQSQFCKLQTLCRSLAGNTVYLLTITNPSQTPQEAAAKKAVVLSARVHPGESNGSWVMKGFLDFILSNSPDAQLLRDIFVFKVLPMLNPDGVIVGNYRCSLAGRDLNRHYKTILKESFPCIWYTRNMIKRLLEEREVLLYCDFHGHSRKNNIFLYGCNN-NNRKYWLHERVFPLMLCKNAPDKFSFHSCNFKVQKCKEGTGRVVMWRMGILNSYTMESTFGGSTL-------GNKRDTHFTIEDLKSLGYHVCDTLLDFCDPDQMKFTQCLAELKELLRQEIHKKFHELGQDVD 662          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Human
Match: AGBL2 (ATP/GTP binding protein like 2 [Source:HGNC Symbol;Acc:HGNC:26296])

HSP 1 Score: 564.688 bits (1454), Expect = 0.000e+0
Identity = 293/662 (44.26%), Postives = 407/662 (61.48%), Query Frame = 2
Query:  131 FMKKHLQHYGYYKGNKLIMRELEGYEKTHEHSQSDE-------STSESEN--------------------------AIKCNQKTGTSPSLRTTQLIYDYFEDGSYVRKLKAPHNYVLNLQ-----QAPRWPIEMQVLPERIHHITALPQQREFIYIPSNSELKPQPRGEENGRLIFEYKTC--SGPYFTKSKTISKEIGNLLPVTAEFESESDETLCFESRFESGNLEKVYKISPFEYELHLRPDLYTSKHTQWYYFRVSNTRENKMYRFTIVNFYKAESLYNEGLKPLLYSEKDARLSNKGWRRWGSNIAYYRNNLKYETKKGENYYYSLTWNCLFPHDNDTVYFSHCYPYTYSNLMKYVETVSKDPVKSKICRIKLLTKSLAENISLLLTITNSFTEQERKNYKKIILITGRVHPGETNASWMMEGVLDFLLSDKPDAMLLRDLFIFKIVPMLNPDGVIVGNYRCSLTGRDLNRNYKSKLKDYYPIICSVKNLAEKLLKDHEILFYCDFHGHSRKNNIFMYGCNDQKSENEFLLERAFPYILAKNASDKFDYKSCKFKMQKSKSGTSRIVFRNFGIPHSFTLEASFCGTDLISNTNSNRNEQFYHFNTDDLKKMGEAFCYSLLDFSDPDQTQMNIILDNIKEDLTKRYTNKLETRGINID 1996
            FM +HLQ+YGY+K  +  +        TH+H + +        S  E ++                          AI  +    + P LR+ QL+YD  ++ +   +L+ P      L      QAPRWPIE +V+ E IHHI   P Q E+ Y P  +E  P+  GE+ G ++++  +    G YFT S+   K  G +  +    +   D TL FESRFESGNL+K  ++  +EYEL LR DLYT+KHTQW+YFRV NTR++  YRFTIVN  K +SLY  G+KPLLYS+ DA   N GWRR G+ I YY+NN    T  G+  +Y LTW   FP+D DT +F+H YPYTY++L  Y+ +V+ +P++S+ C+++ L +SLA N   LLTITN     +    KK ++++ RVHPGE+N SW+M+G LDF+LS+ PDA LLRD+F+FK++PMLNPDGVIVGNYRCSL GRDLNR+YK+ LK+ +P I   +N+ ++LL++ E+L YCDFHGHSRKNNIF+YGCN+  +   +L ER FP +L KNA DKF + SC FK+QK K GT R+V    GI +S+T+E++F G+ L        N++  HF  +DLK +G   C +LLDF DPDQ +    L  +KE L +    K    G ++D
Sbjct:   20 FMYRHLQYYGYFKAQRGSLPN----SATHQHVRKNNPQCLLNGSLGEKDDLIPDTLQKEKLLWPISLSSAVHRQIEAINRDSHMLSLPHLRSRQLLYDELDEVN--PRLREPQELFSILSTKRPLQAPRWPIECEVIKENIHHIEWAPPQPEYFYQPKGNEKVPEIVGEKKGTVVYQLDSVPIEGSYFTSSRVGGKR-GIVKELAVTLQGPEDNTLLFESRFESGNLQKAVRVDTYEYELTLRTDLYTNKHTQWFYFRVQNTRKDATYRFTIVNLLKPKSLYTVGMKPLLYSQLDANTRNIGWRREGNEIKYYKNN----TDDGQQPFYCLTWTIQFPYDQDTCFFAHFYPYTYTDLQCYLLSVANNPIQSQFCKLQTLCRSLAGNTVYLLTITNPSQTPQEAAAKKAVVLSARVHPGESNGSWVMKGFLDFILSNSPDAQLLRDIFVFKVLPMLNPDGVIVGNYRCSLAGRDLNRHYKTILKESFPCIWYTRNMIKRLLEEREVLLYCDFHGHSRKNNIFLYGCNN-NNRKYWLHERVFPLMLCKNAPDKFSFHSCNFKVQKCKEGTGRVVMWRMGILNSYTMESTFGGSTL-------GNKRDTHFTIEDLKSLGYHVCDTLLDFCDPDQMKFTQCLAELKELLRQEIHKKFHELGQDVD 662          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Human
Match: AGBL2 (ATP/GTP binding protein like 2 [Source:HGNC Symbol;Acc:HGNC:26296])

HSP 1 Score: 559.681 bits (1441), Expect = 0.000e+0
Identity = 277/575 (48.17%), Postives = 379/575 (65.91%), Query Frame = 2
Query:  293 PSLRTTQLIYDYFEDGSYVRKLKAPHNYVLNLQ-----QAPRWPIEMQVLPERIHHITALPQQREFIYIPSNSELKPQPRGEENGRLIFEYKTC--SGPYFTKSKTISKEIGNLLPVTAEFESESDETLCFESRFESGNLEKVYKISPFEYELHLRPDLYTSKHTQWYYFRVSNTRENKMYRFTIVNFYKAESLYNEGLKPLLYSEKDARLSNKGWRRWGSNIAYYRNNLKYETKKGENYYYSLTWNCLFPHDNDTVYFSHCYPYTYSNLMKYVETVSKDPVKSKICRIKLLTKSLAENISLLLTITNSFTEQERKNYKKIILITGRVHPGETNASWMMEGVLDFLLSDKPDAMLLRDLFIFKIVPMLNPDGVIVGNYRCSLTGRDLNRNYKSKLKDYYPIICSVKNLAEKLLKDHEILFYCDFHGHSRKNNIFMYGCNDQKSENEFLLERAFPYILAKNASDKFDYKSCKFKMQKSKSGTSRIVFRNFGIPHSFTLEASFCGTDLISNTNSNRNEQFYHFNTDDLKKMGEAFCYSLLDFSDPDQTQMNIILDNIKEDLTKRYTNKLETRGINID 1996
            P LR+ QL+YD  ++ +   +L+ P      L      QAPRWPIE +V+ E IHHI   P Q E+ Y P  +E  P+  GE+ G ++++  +    G YFT S+   K  G +  +    +   D TL FESRFESGNL+K  ++  +EYEL LR DLYT+KHTQW+YFRV NTR++  YRFTIVN  K +SLY  G+KPLLYS+ DA   N GWRR G+ I YY+NN    T  G+  +Y LTW   FP+D DT +F+H YPYTY++L  Y+ +V+ +P++S+ C+++ L +SLA N   LLTITN     +    KK ++++ RVHPGE+N SW+M+G LDF+LS+ PDA LLRD+F+FK++PMLNPDGVIVGNYRCSL GRDLNR+YK+ LK+ +P I   +N+ ++LL++ E+L YCDFHGHSRKNNIF+YGCN+  +   +L ER FP +L KNA DKF + SC FK+QK K GT R+V    GI +S+T+E++F G+ L        N++  HF  +DLK +G   C +LLDF DPDQ +    L  +KE L +    K    G ++D
Sbjct:  141 PHLRSRQLLYDELDEVN--PRLREPQELFSILSTKRPLQAPRWPIECEVIKENIHHIEWAPPQPEYFYQPKGNEKVPEIVGEKKGTVVYQLDSVPIEGSYFTSSRVGGKR-GIVKELAVTLQGPEDNTLLFESRFESGNLQKAVRVDTYEYELTLRTDLYTNKHTQWFYFRVQNTRKDATYRFTIVNLLKPKSLYTVGMKPLLYSQLDANTRNIGWRREGNEIKYYKNN----TDDGQQPFYCLTWTIQFPYDQDTCFFAHFYPYTYTDLQCYLLSVANNPIQSQFCKLQTLCRSLAGNTVYLLTITNPSQTPQEAAAKKAVVLSARVHPGESNGSWVMKGFLDFILSNSPDAQLLRDIFVFKVLPMLNPDGVIVGNYRCSLAGRDLNRHYKTILKESFPCIWYTRNMIKRLLEEREVLLYCDFHGHSRKNNIFLYGCNN-NNRKYWLHERVFPLMLCKNAPDKFSFHSCNFKVQKCKEGTGRVVMWRMGILNSYTMESTFGGSTL-------GNKRDTHFTIEDLKSLGYHVCDTLLDFCDPDQMKFTQCLAELKELLRQEIHKKFHELGQDVD 700          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Human
Match: AGBL2 (ATP/GTP binding protein like 2 [Source:HGNC Symbol;Acc:HGNC:26296])

HSP 1 Score: 559.681 bits (1441), Expect = 0.000e+0
Identity = 277/575 (48.17%), Postives = 379/575 (65.91%), Query Frame = 2
Query:  293 PSLRTTQLIYDYFEDGSYVRKLKAPHNYVLNLQ-----QAPRWPIEMQVLPERIHHITALPQQREFIYIPSNSELKPQPRGEENGRLIFEYKTC--SGPYFTKSKTISKEIGNLLPVTAEFESESDETLCFESRFESGNLEKVYKISPFEYELHLRPDLYTSKHTQWYYFRVSNTRENKMYRFTIVNFYKAESLYNEGLKPLLYSEKDARLSNKGWRRWGSNIAYYRNNLKYETKKGENYYYSLTWNCLFPHDNDTVYFSHCYPYTYSNLMKYVETVSKDPVKSKICRIKLLTKSLAENISLLLTITNSFTEQERKNYKKIILITGRVHPGETNASWMMEGVLDFLLSDKPDAMLLRDLFIFKIVPMLNPDGVIVGNYRCSLTGRDLNRNYKSKLKDYYPIICSVKNLAEKLLKDHEILFYCDFHGHSRKNNIFMYGCNDQKSENEFLLERAFPYILAKNASDKFDYKSCKFKMQKSKSGTSRIVFRNFGIPHSFTLEASFCGTDLISNTNSNRNEQFYHFNTDDLKKMGEAFCYSLLDFSDPDQTQMNIILDNIKEDLTKRYTNKLETRGINID 1996
            P LR+ QL+YD  ++ +   +L+ P      L      QAPRWPIE +V+ E IHHI   P Q E+ Y P  +E  P+  GE+ G ++++  +    G YFT S+   K  G +  +    +   D TL FESRFESGNL+K  ++  +EYEL LR DLYT+KHTQW+YFRV NTR++  YRFTIVN  K +SLY  G+KPLLYS+ DA   N GWRR G+ I YY+NN    T  G+  +Y LTW   FP+D DT +F+H YPYTY++L  Y+ +V+ +P++S+ C+++ L +SLA N   LLTITN     +    KK ++++ RVHPGE+N SW+M+G LDF+LS+ PDA LLRD+F+FK++PMLNPDGVIVGNYRCSL GRDLNR+YK+ LK+ +P I   +N+ ++LL++ E+L YCDFHGHSRKNNIF+YGCN+  +   +L ER FP +L KNA DKF + SC FK+QK K GT R+V    GI +S+T+E++F G+ L        N++  HF  +DLK +G   C +LLDF DPDQ +    L  +KE L +    K    G ++D
Sbjct:  141 PHLRSRQLLYDELDEVN--PRLREPQELFSILSTKRPLQAPRWPIECEVIKENIHHIEWAPPQPEYFYQPKGNEKVPEIVGEKKGTVVYQLDSVPIEGSYFTSSRVGGKR-GIVKELAVTLQGPEDNTLLFESRFESGNLQKAVRVDTYEYELTLRTDLYTNKHTQWFYFRVQNTRKDATYRFTIVNLLKPKSLYTVGMKPLLYSQLDANTRNIGWRREGNEIKYYKNN----TDDGQQPFYCLTWTIQFPYDQDTCFFAHFYPYTYTDLQCYLLSVANNPIQSQFCKLQTLCRSLAGNTVYLLTITNPSQTPQEAAAKKAVVLSARVHPGESNGSWVMKGFLDFILSNSPDAQLLRDIFVFKVLPMLNPDGVIVGNYRCSLAGRDLNRHYKTILKESFPCIWYTRNMIKRLLEEREVLLYCDFHGHSRKNNIFLYGCNN-NNRKYWLHERVFPLMLCKNAPDKFSFHSCNFKVQKCKEGTGRVVMWRMGILNSYTMESTFGGSTL-------GNKRDTHFTIEDLKSLGYHVCDTLLDFCDPDQMKFTQCLAELKELLRQEIHKKFHELGQDVD 700          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Human
Match: AGBL2 (ATP/GTP binding protein like 2 [Source:HGNC Symbol;Acc:HGNC:26296])

HSP 1 Score: 559.296 bits (1440), Expect = 0.000e+0
Identity = 277/575 (48.17%), Postives = 379/575 (65.91%), Query Frame = 2
Query:  293 PSLRTTQLIYDYFEDGSYVRKLKAPHNYVLNLQ-----QAPRWPIEMQVLPERIHHITALPQQREFIYIPSNSELKPQPRGEENGRLIFEYKTC--SGPYFTKSKTISKEIGNLLPVTAEFESESDETLCFESRFESGNLEKVYKISPFEYELHLRPDLYTSKHTQWYYFRVSNTRENKMYRFTIVNFYKAESLYNEGLKPLLYSEKDARLSNKGWRRWGSNIAYYRNNLKYETKKGENYYYSLTWNCLFPHDNDTVYFSHCYPYTYSNLMKYVETVSKDPVKSKICRIKLLTKSLAENISLLLTITNSFTEQERKNYKKIILITGRVHPGETNASWMMEGVLDFLLSDKPDAMLLRDLFIFKIVPMLNPDGVIVGNYRCSLTGRDLNRNYKSKLKDYYPIICSVKNLAEKLLKDHEILFYCDFHGHSRKNNIFMYGCNDQKSENEFLLERAFPYILAKNASDKFDYKSCKFKMQKSKSGTSRIVFRNFGIPHSFTLEASFCGTDLISNTNSNRNEQFYHFNTDDLKKMGEAFCYSLLDFSDPDQTQMNIILDNIKEDLTKRYTNKLETRGINID 1996
            P LR+ QL+YD  ++ +   +L+ P      L      QAPRWPIE +V+ E IHHI   P Q E+ Y P  +E  P+  GE+ G ++++  +    G YFT S+   K  G +  +    +   D TL FESRFESGNL+K  ++  +EYEL LR DLYT+KHTQW+YFRV NTR++  YRFTIVN  K +SLY  G+KPLLYS+ DA   N GWRR G+ I YY+NN    T  G+  +Y LTW   FP+D DT +F+H YPYTY++L  Y+ +V+ +P++S+ C+++ L +SLA N   LLTITN     +    KK ++++ RVHPGE+N SW+M+G LDF+LS+ PDA LLRD+F+FK++PMLNPDGVIVGNYRCSL GRDLNR+YK+ LK+ +P I   +N+ ++LL++ E+L YCDFHGHSRKNNIF+YGCN+  +   +L ER FP +L KNA DKF + SC FK+QK K GT R+V    GI +S+T+E++F G+ L        N++  HF  +DLK +G   C +LLDF DPDQ +    L  +KE L +    K    G ++D
Sbjct:  141 PHLRSRQLLYDELDEVN--PRLREPQELFSILSTKRPLQAPRWPIECEVIKENIHHIEWAPPQPEYFYQPKGNEKVPEIVGEKKGTVVYQLDSVPIEGSYFTSSRVGGKR-GIVKELAVTLQGPEDNTLLFESRFESGNLQKAVRVDTYEYELTLRTDLYTNKHTQWFYFRVQNTRKDATYRFTIVNLLKPKSLYTVGMKPLLYSQLDANTRNIGWRREGNEIKYYKNN----TDDGQQPFYCLTWTIQFPYDQDTCFFAHFYPYTYTDLQCYLLSVANNPIQSQFCKLQTLCRSLAGNTVYLLTITNPSQTPQEAAAKKAVVLSARVHPGESNGSWVMKGFLDFILSNSPDAQLLRDIFVFKVLPMLNPDGVIVGNYRCSLAGRDLNRHYKTILKESFPCIWYTRNMIKRLLEEREVLLYCDFHGHSRKNNIFLYGCNN-NNRKYWLHERVFPLMLCKNAPDKFSFHSCNFKVQKCKEGTGRVVMWRMGILNSYTMESTFGGSTL-------GNKRDTHFTIEDLKSLGYHVCDTLLDFCDPDQMKFTQCLAELKELLRQEIHKKFHELGQDVD 700          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Celegans
Match: ccpp-1 (Cytosolic carboxypeptidase 1 [Source:UniProtKB/Swiss-Prot;Acc:O76373])

HSP 1 Score: 295.819 bits (756), Expect = 5.931e-85
Identity = 185/524 (35.31%), Postives = 286/524 (54.58%), Query Frame = 2
Query:  407 PIEMQVLPERIHHITALPQ--QREFIYIPSNSELKPQPRGEENGRLIFEYKTCSGPYFTKSKTISKEIGNLLP-VTAEFESESDETLCFESRFESGNLEKVYKISPFEYELHLRPDLYTSK-HTQWYYFRVSNTRENKMYRFTIVNFYKAESLYNEGLKPLLYSEKDARLSNKGWRRWGSNIAYYRN--------NLKYETKKGENYYYSLTWNCLFPHDNDTVYFSHCYPYTYSNLMKYVETVSKDPVKSKICRIKLLTKSLAENISLLLTITNSFTEQERKNYKKIILITGRVHPGETNASWMMEGVLDFLLSDKPDAML-LRDLFIFKIVPMLNPDGVIVGNYRCSLTGRDLNRNYKSKLKDYYPIICSVKNLAEKL--LKDHEILFYCDFHGHSRKNNIFMYGCNDQKS------------ENEFLLERAFPYILAKNASDKFDYKSCKFKMQKSKSGTSRI-VFRNFGIPHSFTLEASFCGTDLISNTNSNRNEQFYHFNTDDLKKMGEAFCYSLLDFS 1894
            PIEM   P RI   TA      ++ I      EL    R   + ++I++  T +       +         LP VT   + ++ + L F+SRFESGNL  V +++P  YEL L PD+   + H QW++F+VSN R++  Y F IVN  K+ SLY++G++P++YS  +   S  GWRR G N+ Y+RN            E +K + YYYS+ +N  F +  D  Y ++ YPYTYS L   +  + K   ++  CR  ++  SLA N   +LTIT   +  E    +++I+++ RVHPGETNASW+M+G+L+ LL  + + M  LR+ FIFKIVPM+NPDGV  G++RCSL G DLNR +    +  +P + + K + + L  + + +   Y D HGHS+K + F+YG N  +S            + E  L  A P  L      +F+   C+F + ++K  ++R+ V+R FG+  ++TLE++FCG     N+        Y  NT DLK++G    +S L+ +
Sbjct:  514 PIEMFNTPTRIREKTAKTSNNMKKMII----EELDKPERSATSNQVIYDLDTAAFDGLPSPE---------LPFVTGGGKLDTSKDLQFDSRFESGNLRMVIQVAPTHYELFLSPDVNQLRDHYQWFFFQVSNMRKSVKYTFEIVNCLKSTSLYSQGMQPVMYSMME---SANGWRRVGENVCYFRNLYINENEEKKNVEEQKKKKYYYSIRFNVTFQNTGDICYIAYHYPYTYSFLNSSLSMLKKRKQENVYCREDVIGHSLAGNPIKMLTITTPASAAEIAA-REVIVLSARVHPGETNASWIMQGILENLLCRQSNEMYRLRESFIFKIVPMINPDGVTNGSHRCSLAGIDLNRMWDRPNEALHPEVFATKAIIQYLCEVANKKPFAYVDIHGHSKKWDYFVYGNNASESWRADDVLDVGAAQLEEELHLALPKALEATCPSRFNASECRFNITRAKESSARVNVWRQFGVSTAYTLESTFCGFHKGQNSG-------YQINTSDLKEIGRDLLHSFLEMT 1013          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Celegans
Match: ccpp-6 (Cytosolic carboxypeptidase 6 [Source:UniProtKB/Swiss-Prot;Acc:Q09296])

HSP 1 Score: 217.238 bits (552), Expect = 1.631e-61
Identity = 145/431 (33.64%), Postives = 229/431 (53.13%), Query Frame = 2
Query:  656 LCFESRFESGNLEKVYKISPFEYELHLRPDLYTSKHTQWYYFRVSNTRENKMYRFTIVNFYKAESLYNEGLK-PLLYSEKDARLSNKGWRRWGS-NIAYYRNNLKYETKKGENYYYSLTWNCLFPHDNDTVYFSHCYPYTYSNLMKYVETVSKDPVKSKICRIKLLTKSLAENISLLLTITNSFTEQERKNYKKIILITGRVHPGETNASWMMEGVLDFLLSDKPDAMLLRDLFIFKIVPMLNPDGVIVGNYRCSLTGRDLNRNYKSKLKDYYPIICSVKNLAEKLLKD--HEILFYCDFHGHSRKNNIFMYGCNDQKS--ENEFLLERAFPYILAKNASDKFDYKSCKFKMQKSKSGTSRIVFRNFGIPHSFTLEASFCGTDLISNTNSNRNEQFYHFNTDDLKKMGEAFCYSLLDFSDPDQTQMNIILD 1930
            L FE+ FESGNL +V K+S  EY+L +RPD   +K+  W+YF   N  EN+   F IVNF K  +L+  G+  P++ S      +   W R  S +I YYR++         N  + L++  +F    D V F++C PYTY  +  ++  +     K       LL +++ +    L+TI    T    +  KK+I +T RVHPGE+ +S +M G+++FL+S    A  LR ++ FKI+PMLNPDGV +GNYRCSL G DLNR +++     +P I +VKNL  +   +   + + Y D H HS+K N F+YG  +  +  E     +   P++LA + S+ +  +  +F     K+GT R    +      +TLE SF      ++++ N  +    +     + +GEAFC +LL+F + D     I+L+
Sbjct:   19 LVFEASFESGNLGRVDKVSCSEYDLFIRPDTLNNKYRVWFYFECKNASENQRAIFNIVNFSKQRTLFEMGIAAPVVKSN-----AQNSWARIPSRHIYYYRSS-------QHNDRWILSFAFIF-ESPDPVQFAYCIPYTYGQMQIWLNELESR--KYPFFHRDLLVQTVQKRRVDLITIDA--TPDTFQGSKKMIFLTARVHPGESPSSHVMHGIIEFLVSKDDRAQKLRKVYCFKIIPMLNPDGVFLGNYRCSLMGHDLNRMWRTPSDWAHPSIYAVKNLLTQYDNNPQAQTVIYVDLHAHSQKPNCFLYGNVNMSAVEEKSTFRQLWLPHLLA-DLSEDYSLEFTQFNTDVEKAGTGRRTMGDLLSCLCYTLEVSFFSYRH-TDSSGNGIQHCTPYLQYKYEALGEAFCRALLNFYEADCGLREIVLE 430          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Fly
Match: Nna1 (gene:FBgn0265726 transcript:FBtr0340677)

HSP 1 Score: 502.671 bits (1293), Expect = 4.531e-165
Identity = 258/552 (46.74%), Postives = 360/552 (65.22%), Query Frame = 2
Query:  290 SPSLRTTQLIYDYFEDG-SYVRKLKAPHNYVL--------NLQQAPRWPIEMQVLPERIHHITALPQQREFIYIPSNSELKPQPRGEENGRLIFEYKTCSGP-YFTKSKTI-SKEIGNLLPVTAEFESESDETLCFESRFESGNLEKVYKISPFEYELHLRPDLYTSKHTQWYYFRVSNTRENKMYRFTIVNFYKAESLYNEGLKPLLYSEKDARLSNKGWRRWGSNIAYYRNNLKYETKKG-----ENYYYSLTWNCLFPHDNDTVYFSHCYPYTYSNLMKYVETVSKDPVKSKICRIKLLTKSLAENISLLLTITNSFTEQERKNYKKIILITGRVHPGETNASWMMEGVLDFLLSDKPDAMLLRDLFIFKIVPMLNPDGVIVGNYRCSLTGRDLNRNYKSKLKDYYPIICSVKNLAEKLLKDHEILFYCDFHGHSRKNNIFMYGCNDQKSENEFLLERAFPYILAKNASDKFDYKSCKFKMQKSKSGTSRIVFRNFGIPHSFTLEASFCGTDLISNTNSNRNEQFYHFNTDDLKKMGEAFCYSLLDFSD 1897
            S  L+T QL+ +  E     V +LK P +             QQAPRWP+E QV+ ERI HI  +P   E +  P+ +ELKP+P GEENG ++F Y   S   YF++S    ++ + N  P+  E   E D  L FESRFESGNL K  +I+P  YEL+LRPDLYTS+  QW+YFRV  TR   +YRF+IVN  K++SLYN+G++P++YS   A+  ++GWRR G NI YYRN+ +  +        +N  Y+LT+   F HD+DTV+F+H YPYTYS+L  Y+  + + PVKSK C+++LL ++LA N    LT+T   + +E    KK I+++ RVHP ET ASWMM+G++DF+  D   A  LR  FIFK+VPMLNPDGVIVGN R SLTG+DLNR Y++ +++ YP I   K +  +L+++  +  YCD H HSRK+NIF+YGC ++++  + L E+ FP +L KN++D+F ++SCKFK+Q+SK GT RIV    GI +S+T+EASF G+ L S   +       HFNT D + MG AFC +LLD+ D
Sbjct:  151 SKGLKTNQLVVNTDEKTLRPVARLKEPRDLFALPKDKDNDCSQQAPRWPVECQVIEERIIHIPYVPAVPEPLNAPTGNELKPRPVGEENGIVVFSYSPISAVNYFSRSAVGGARFMTNCHPMNPE---EYD-GLEFESRFESGNLAKAVQITPTYYELYLRPDLYTSRSKQWFYFRVRRTRRKMLYRFSIVNLVKSDSLYNDGMQPVMYSTLGAKEKSEGWRRCGDNICYYRNDDESASSSANEDDEDNSTYTLTFTIEFEHDDDTVFFAHSYPYTYSDLQDYLMEIQRHPVKSKFCKLRLLCRTLAGNNVYYLTVTAPSSNEENMRRKKSIVVSARVHPSETPASWMMKGLMDFITGDTTVAKRLRHKFIFKLVPMLNPDGVIVGNTRNSLTGKDLNRQYRTVIRETYPSIWYTKAMIRRLIEECGVAMYCDMHAHSRKHNIFIYGCENKRNPEKKLTEQVFPLMLHKNSADRFSFESCKFKIQRSKEGTGRIVVWMLGITNSYTIEASFGGSSLGSRKGT-------HFNTQDYEHMGRAFCETLLDYCD 691          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Fly
Match: Nna1 (gene:FBgn0265726 transcript:FBtr0340676)

HSP 1 Score: 443.736 bits (1140), Expect = 1.489e-140
Identity = 209/421 (49.64%), Postives = 292/421 (69.36%), Query Frame = 2
Query:  650 ETLCFESRFESGNLEKVYKISPFEYELHLRPDLYTSKHTQWYYFRVSNTRENKMYRFTIVNFYKAESLYNEGLKPLLYSEKDARLSNKGWRRWGSNIAYYRNNLKYETKKG-----ENYYYSLTWNCLFPHDNDTVYFSHCYPYTYSNLMKYVETVSKDPVKSKICRIKLLTKSLAENISLLLTITNSFTEQERKNYKKIILITGRVHPGETNASWMMEGVLDFLLSDKPDAMLLRDLFIFKIVPMLNPDGVIVGNYRCSLTGRDLNRNYKSKLKDYYPIICSVKNLAEKLLKDHEILFYCDFHGHSRKNNIFMYGCNDQKSENEFLLERAFPYILAKNASDKFDYKSCKFKMQKSKSGTSRIVFRNFGIPHSFTLEASFCGTDLISNTNSNRNEQFYHFNTDDLKKMGEAFCYSLLDFSD 1897
            + L FESRFESGNL K  +I+P  YEL+LRPDLYTS+  QW+YFRV  TR   +YRF+IVN  K++SLYN+G++P++YS   A+  ++GWRR G NI YYRN+ +  +        +N  Y+LT+   F HD+DTV+F+H YPYTYS+L  Y+  + + PVKSK C+++LL ++LA N    LT+T   + +E    KK I+++ RVHP ET ASWMM+G++DF+  D   A  LR  FIFK+VPMLNPDGVIVGN R SLTG+DLNR Y++ +++ YP I   K +  +L+++  +  YCD H HSRK+NIF+YGC ++++  + L E+ FP +L KN++D+F ++SCKFK+Q+SK GT RIV    GI +S+T+EASF G+ L S   +       HFNT D + MG AFC +LLD+ D
Sbjct:  443 DGLEFESRFESGNLAKAVQITPTYYELYLRPDLYTSRSKQWFYFRVRRTRRKMLYRFSIVNLVKSDSLYNDGMQPVMYSTLGAKEKSEGWRRCGDNICYYRNDDESASSSANEDDEDNSTYTLTFTIEFEHDDDTVFFAHSYPYTYSDLQDYLMEIQRHPVKSKFCKLRLLCRTLAGNNVYYLTVTAPSSNEENMRRKKSIVVSARVHPSETPASWMMKGLMDFITGDTTVAKRLRHKFIFKLVPMLNPDGVIVGNTRNSLTGKDLNRQYRTVIRETYPSIWYTKAMIRRLIEECGVAMYCDMHAHSRKHNIFIYGCENKRNPEKKLTEQVFPLMLHKNSADRFSFESCKFKIQRSKEGTGRIVVWMLGITNSYTIEASFGGSSLGSRKGT-------HFNTQDYEHMGRAFCETLLDYCD 856          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Fly
Match: Nna1 (gene:FBgn0265726 transcript:FBtr0340673)

HSP 1 Score: 443.736 bits (1140), Expect = 1.489e-140
Identity = 209/421 (49.64%), Postives = 292/421 (69.36%), Query Frame = 2
Query:  650 ETLCFESRFESGNLEKVYKISPFEYELHLRPDLYTSKHTQWYYFRVSNTRENKMYRFTIVNFYKAESLYNEGLKPLLYSEKDARLSNKGWRRWGSNIAYYRNNLKYETKKG-----ENYYYSLTWNCLFPHDNDTVYFSHCYPYTYSNLMKYVETVSKDPVKSKICRIKLLTKSLAENISLLLTITNSFTEQERKNYKKIILITGRVHPGETNASWMMEGVLDFLLSDKPDAMLLRDLFIFKIVPMLNPDGVIVGNYRCSLTGRDLNRNYKSKLKDYYPIICSVKNLAEKLLKDHEILFYCDFHGHSRKNNIFMYGCNDQKSENEFLLERAFPYILAKNASDKFDYKSCKFKMQKSKSGTSRIVFRNFGIPHSFTLEASFCGTDLISNTNSNRNEQFYHFNTDDLKKMGEAFCYSLLDFSD 1897
            + L FESRFESGNL K  +I+P  YEL+LRPDLYTS+  QW+YFRV  TR   +YRF+IVN  K++SLYN+G++P++YS   A+  ++GWRR G NI YYRN+ +  +        +N  Y+LT+   F HD+DTV+F+H YPYTYS+L  Y+  + + PVKSK C+++LL ++LA N    LT+T   + +E    KK I+++ RVHP ET ASWMM+G++DF+  D   A  LR  FIFK+VPMLNPDGVIVGN R SLTG+DLNR Y++ +++ YP I   K +  +L+++  +  YCD H HSRK+NIF+YGC ++++  + L E+ FP +L KN++D+F ++SCKFK+Q+SK GT RIV    GI +S+T+EASF G+ L S   +       HFNT D + MG AFC +LLD+ D
Sbjct:  443 DGLEFESRFESGNLAKAVQITPTYYELYLRPDLYTSRSKQWFYFRVRRTRRKMLYRFSIVNLVKSDSLYNDGMQPVMYSTLGAKEKSEGWRRCGDNICYYRNDDESASSSANEDDEDNSTYTLTFTIEFEHDDDTVFFAHSYPYTYSDLQDYLMEIQRHPVKSKFCKLRLLCRTLAGNNVYYLTVTAPSSNEENMRRKKSIVVSARVHPSETPASWMMKGLMDFITGDTTVAKRLRHKFIFKLVPMLNPDGVIVGNTRNSLTGKDLNRQYRTVIRETYPSIWYTKAMIRRLIEECGVAMYCDMHAHSRKHNIFIYGCENKRNPEKKLTEQVFPLMLHKNSADRFSFESCKFKIQRSKEGTGRIVVWMLGITNSYTIEASFGGSSLGSRKGT-------HFNTQDYEHMGRAFCETLLDYCD 856          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Fly
Match: Nna1 (gene:FBgn0265726 transcript:FBtr0340672)

HSP 1 Score: 442.965 bits (1138), Expect = 5.230e-140
Identity = 209/421 (49.64%), Postives = 292/421 (69.36%), Query Frame = 2
Query:  650 ETLCFESRFESGNLEKVYKISPFEYELHLRPDLYTSKHTQWYYFRVSNTRENKMYRFTIVNFYKAESLYNEGLKPLLYSEKDARLSNKGWRRWGSNIAYYRNNLKYETKKG-----ENYYYSLTWNCLFPHDNDTVYFSHCYPYTYSNLMKYVETVSKDPVKSKICRIKLLTKSLAENISLLLTITNSFTEQERKNYKKIILITGRVHPGETNASWMMEGVLDFLLSDKPDAMLLRDLFIFKIVPMLNPDGVIVGNYRCSLTGRDLNRNYKSKLKDYYPIICSVKNLAEKLLKDHEILFYCDFHGHSRKNNIFMYGCNDQKSENEFLLERAFPYILAKNASDKFDYKSCKFKMQKSKSGTSRIVFRNFGIPHSFTLEASFCGTDLISNTNSNRNEQFYHFNTDDLKKMGEAFCYSLLDFSD 1897
            + L FESRFESGNL K  +I+P  YEL+LRPDLYTS+  QW+YFRV  TR   +YRF+IVN  K++SLYN+G++P++YS   A+  ++GWRR G NI YYRN+ +  +        +N  Y+LT+   F HD+DTV+F+H YPYTYS+L  Y+  + + PVKSK C+++LL ++LA N    LT+T   + +E    KK I+++ RVHP ET ASWMM+G++DF+  D   A  LR  FIFK+VPMLNPDGVIVGN R SLTG+DLNR Y++ +++ YP I   K +  +L+++  +  YCD H HSRK+NIF+YGC ++++  + L E+ FP +L KN++D+F ++SCKFK+Q+SK GT RIV    GI +S+T+EASF G+ L S   +       HFNT D + MG AFC +LLD+ D
Sbjct:  467 DGLEFESRFESGNLAKAVQITPTYYELYLRPDLYTSRSKQWFYFRVRRTRRKMLYRFSIVNLVKSDSLYNDGMQPVMYSTLGAKEKSEGWRRCGDNICYYRNDDESASSSANEDDEDNSTYTLTFTIEFEHDDDTVFFAHSYPYTYSDLQDYLMEIQRHPVKSKFCKLRLLCRTLAGNNVYYLTVTAPSSNEENMRRKKSIVVSARVHPSETPASWMMKGLMDFITGDTTVAKRLRHKFIFKLVPMLNPDGVIVGNTRNSLTGKDLNRQYRTVIRETYPSIWYTKAMIRRLIEECGVAMYCDMHAHSRKHNIFIYGCENKRNPEKKLTEQVFPLMLHKNSADRFSFESCKFKIQRSKEGTGRIVVWMLGITNSYTIEASFGGSSLGSRKGT-------HFNTQDYEHMGRAFCETLLDYCD 880          

HSP 2 Score: 73.559 bits (179), Expect = 7.615e-13
Identity = 44/109 (40.37%), Postives = 60/109 (55.05%), Query Frame = 2
Query:  290 SPSLRTTQLIYDYFEDG-SYVRKLKAPHN-YVLN-------LQQAPRWPIEMQVLPERIHHITALPQQREFIYIPSNSELKPQPRGEENGRLIFEYKTCSGPYFTKSKT 589
            S  L+T QL+ +  E     V +LK P + + L         QQAPRWP+E QV+ ERI HI  +P   E +  P+ +ELKP+P GEENG ++F Y   S   + K K 
Sbjct:  151 SKGLKTNQLVVNTDEKTLRPVARLKEPRDLFALPKDKDNDCSQQAPRWPVECQVIEERIIHIPYVPAVPEPLNAPTGNELKPRPVGEENGIVVFSYSPISAVNYEKPKA 259          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Fly
Match: Nna1 (gene:FBgn0265726 transcript:FBtr0340675)

HSP 1 Score: 444.121 bits (1141), Expect = 7.398e-139
Identity = 209/421 (49.64%), Postives = 292/421 (69.36%), Query Frame = 2
Query:  650 ETLCFESRFESGNLEKVYKISPFEYELHLRPDLYTSKHTQWYYFRVSNTRENKMYRFTIVNFYKAESLYNEGLKPLLYSEKDARLSNKGWRRWGSNIAYYRNNLKYETKKG-----ENYYYSLTWNCLFPHDNDTVYFSHCYPYTYSNLMKYVETVSKDPVKSKICRIKLLTKSLAENISLLLTITNSFTEQERKNYKKIILITGRVHPGETNASWMMEGVLDFLLSDKPDAMLLRDLFIFKIVPMLNPDGVIVGNYRCSLTGRDLNRNYKSKLKDYYPIICSVKNLAEKLLKDHEILFYCDFHGHSRKNNIFMYGCNDQKSENEFLLERAFPYILAKNASDKFDYKSCKFKMQKSKSGTSRIVFRNFGIPHSFTLEASFCGTDLISNTNSNRNEQFYHFNTDDLKKMGEAFCYSLLDFSD 1897
            + L FESRFESGNL K  +I+P  YEL+LRPDLYTS+  QW+YFRV  TR   +YRF+IVN  K++SLYN+G++P++YS   A+  ++GWRR G NI YYRN+ +  +        +N  Y+LT+   F HD+DTV+F+H YPYTYS+L  Y+  + + PVKSK C+++LL ++LA N    LT+T   + +E    KK I+++ RVHP ET ASWMM+G++DF+  D   A  LR  FIFK+VPMLNPDGVIVGN R SLTG+DLNR Y++ +++ YP I   K +  +L+++  +  YCD H HSRK+NIF+YGC ++++  + L E+ FP +L KN++D+F ++SCKFK+Q+SK GT RIV    GI +S+T+EASF G+ L S   +       HFNT D + MG AFC +LLD+ D
Sbjct:  619 DGLEFESRFESGNLAKAVQITPTYYELYLRPDLYTSRSKQWFYFRVRRTRRKMLYRFSIVNLVKSDSLYNDGMQPVMYSTLGAKEKSEGWRRCGDNICYYRNDDESASSSANEDDEDNSTYTLTFTIEFEHDDDTVFFAHSYPYTYSDLQDYLMEIQRHPVKSKFCKLRLLCRTLAGNNVYYLTVTAPSSNEENMRRKKSIVVSARVHPSETPASWMMKGLMDFITGDTTVAKRLRHKFIFKLVPMLNPDGVIVGNTRNSLTGKDLNRQYRTVIRETYPSIWYTKAMIRRLIEECGVAMYCDMHAHSRKHNIFIYGCENKRNPEKKLTEQVFPLMLHKNSADRFSFESCKFKIQRSKEGTGRIVVWMLGITNSYTIEASFGGSSLGSRKGT-------HFNTQDYEHMGRAFCETLLDYCD 1032          

HSP 2 Score: 73.1738 bits (178), Expect = 1.031e-12
Identity = 44/109 (40.37%), Postives = 60/109 (55.05%), Query Frame = 2
Query:  290 SPSLRTTQLIYDYFEDG-SYVRKLKAPHN-YVLN-------LQQAPRWPIEMQVLPERIHHITALPQQREFIYIPSNSELKPQPRGEENGRLIFEYKTCSGPYFTKSKT 589
            S  L+T QL+ +  E     V +LK P + + L         QQAPRWP+E QV+ ERI HI  +P   E +  P+ +ELKP+P GEENG ++F Y   S   + K K 
Sbjct:   39 SKGLKTNQLVVNTDEKTLRPVARLKEPRDLFALPKDKDNDCSQQAPRWPVECQVIEERIIHIPYVPAVPEPLNAPTGNELKPRPVGEENGIVVFSYSPISAVNYEKPKA 147          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Zebrafish
Match: agbl2 (ATP/GTP binding protein-like 2 [Source:NCBI gene;Acc:568152])

HSP 1 Score: 571.237 bits (1471), Expect = 0.000e+0
Identity = 292/638 (45.77%), Postives = 398/638 (62.38%), Query Frame = 2
Query:  128 RFMKKHLQHYGYYKGNKL---IMRELEGYEKTHEHSQSDESTS----------ESENAIKCNQKTGTSPSLRTTQLIYDYFEDGSYVRKLKAPHN-YVLNLQQAP----RWPIEMQVLPERIHHITALPQQREFIYIPSNSELKPQPRGEENGRLIFEYKTCSGP-----YFTKSKTISKEIGNLLPVTAEFESESDETLCFESRFESGNLEKVYKISPFEYELHLRPDLYTSKHTQWYYFRVSNTRENKMYRFTIVNFYKAESLYNEGLKPLLYSEKDARLSNKGWRRWGSNIAYYRNNLKYETKKGENYYYSLTWNCLFPHDNDTVYFSHCYPYTYSNLMKYVETVSKDPVKSKICRIKLLTKSLAENISLLLTITNSFTEQERKNYKKIILITGRVHPGETNASWMMEGVLDFLLSDKPDAMLLRDLFIFKIVPMLNPDGVIVGNYRCSLTGRDLNRNYKSKLKDYYPIICSVKNLAEKLLKDHEILFYCDFHGHSRKNNIFMYGCNDQKSENEFLLERAFPYILAKNASDKFDYKSCKFKMQKSKSGTSRIVFRNFGIPHSFTLEASFCGTDLISNTNSNRNEQFYHFNTDDLKKMGEAFCYSLLDFSDPDQTQMNIILDNIKEDLTKRYTNKL 1972
            R +  HLQHYG+   N     I RE EG + +      + S+           E E +  C+     + +LRT QL++D F+    + +L+ P + + +     P    RWPIE  V+ ++I HI   P + E  Y P+ +E  P P GE  G  ++    C  P     YFT S+ +    G +   T+   ++ + TL FESRFE GNL+K  ++  ++YEL LR DLYT+KHTQW+YFRV N RE   YRFTI+N  K+ SLY  G+ PLLYSEK A L  +GW+R GS+I YYRNN++ + K      YSLTW   FP+D DT Y +HCYPYTYS L  Y+  V  DPV++  C++++L +SLA N   +LTIT   +    +  K+ +++T RVHPGETN SWMM+G L+FLLSD PDA LLR+ FIFK++PMLNPDGV+VGNYRCSL GRDLNRNY+S L+D +P I   +N+ ++LL + E++ YCDFHGHSRKNN+FMYGCN++K  ++ L ER FP +++KNA DKF ++SCKFKM KSK GT RIV    GI +S+T+E++F G+ L     +       HF+T DLK MG  FC +LLDF DPD  +M   L+ +   L +    KL
Sbjct:   10 RLLLLHLQHYGFLSDNSSGIPIKREWEGIQDSTASDMINSSSPSESSDSNLEEEQEESKPCSNFFSLNKALRTRQLVFD-FDGERPIPRLRDPLDLFTIPSTSCPFQGVRWPIECDVICDKIQHIEWDPSEPETFYQPTGNEQTPMPVGEVRGNTVY----CIDPATKASYFTYSR-VGGSRGPIKSATSCANNQKEPTLAFESRFECGNLQKAVQVGQYDYELTLRTDLYTTKHTQWFYFRVRNMREGVTYRFTIINLMKSSSLYGAGMCPLLYSEKTAWLKGEGWKRTGSSIRYYRNNIEQDGKA----LYSLTWTLEFPYDGDTCYLAHCYPYTYSKLQHYLREVISDPVRAAYCKLRVLCRSLAGNAVYVLTITAPSSSLAERKAKRAVVVTARVHPGETNGSWMMQGFLEFLLSDLPDAHLLRETFIFKVIPMLNPDGVVVGNYRCSLAGRDLNRNYRSMLRDSFPCIWYTRNMVKRLLAEREVVVYCDFHGHSRKNNVFMYGCNERKDASQCLQERVFPLMMSKNAKDKFSFRSCKFKMHKSKEGTGRIVMWRLGIRNSYTMESTFGGSTLGDRKGT-------HFSTLDLKSMGYCFCDTLLDFCDPDPAKMTRCLEELGVLLKQEIRRKL 630          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Zebrafish
Match: agbl2 (ATP/GTP binding protein-like 2 [Source:NCBI gene;Acc:568152])

HSP 1 Score: 571.237 bits (1471), Expect = 0.000e+0
Identity = 292/638 (45.77%), Postives = 398/638 (62.38%), Query Frame = 2
Query:  128 RFMKKHLQHYGYYKGNKL---IMRELEGYEKTHEHSQSDESTS----------ESENAIKCNQKTGTSPSLRTTQLIYDYFEDGSYVRKLKAPHN-YVLNLQQAP----RWPIEMQVLPERIHHITALPQQREFIYIPSNSELKPQPRGEENGRLIFEYKTCSGP-----YFTKSKTISKEIGNLLPVTAEFESESDETLCFESRFESGNLEKVYKISPFEYELHLRPDLYTSKHTQWYYFRVSNTRENKMYRFTIVNFYKAESLYNEGLKPLLYSEKDARLSNKGWRRWGSNIAYYRNNLKYETKKGENYYYSLTWNCLFPHDNDTVYFSHCYPYTYSNLMKYVETVSKDPVKSKICRIKLLTKSLAENISLLLTITNSFTEQERKNYKKIILITGRVHPGETNASWMMEGVLDFLLSDKPDAMLLRDLFIFKIVPMLNPDGVIVGNYRCSLTGRDLNRNYKSKLKDYYPIICSVKNLAEKLLKDHEILFYCDFHGHSRKNNIFMYGCNDQKSENEFLLERAFPYILAKNASDKFDYKSCKFKMQKSKSGTSRIVFRNFGIPHSFTLEASFCGTDLISNTNSNRNEQFYHFNTDDLKKMGEAFCYSLLDFSDPDQTQMNIILDNIKEDLTKRYTNKL 1972
            R +  HLQHYG+   N     I RE EG + +      + S+           E E +  C+     + +LRT QL++D F+    + +L+ P + + +     P    RWPIE  V+ ++I HI   P + E  Y P+ +E  P P GE  G  ++    C  P     YFT S+ +    G +   T+   ++ + TL FESRFE GNL+K  ++  ++YEL LR DLYT+KHTQW+YFRV N RE   YRFTI+N  K+ SLY  G+ PLLYSEK A L  +GW+R GS+I YYRNN++ + K      YSLTW   FP+D DT Y +HCYPYTYS L  Y+  V  DPV++  C++++L +SLA N   +LTIT   +    +  K+ +++T RVHPGETN SWMM+G L+FLLSD PDA LLR+ FIFK++PMLNPDGV+VGNYRCSL GRDLNRNY+S L+D +P I   +N+ ++LL + E++ YCDFHGHSRKNN+FMYGCN++K  ++ L ER FP +++KNA DKF ++SCKFKM KSK GT RIV    GI +S+T+E++F G+ L     +       HF+T DLK MG  FC +LLDF DPD  +M   L+ +   L +    KL
Sbjct:   11 RLLLLHLQHYGFLSDNSSGIPIKREWEGIQDSTASDMINSSSPSESSDSNLEEEQEESKPCSNFFSLNKALRTRQLVFD-FDGERPIPRLRDPLDLFTIPSTSCPFQGVRWPIECDVICDKIQHIEWDPSEPETFYQPTGNEQTPMPVGEVRGNTVY----CIDPATKASYFTYSR-VGGSRGPIKSATSCANNQKEPTLAFESRFECGNLQKAVQVGQYDYELTLRTDLYTTKHTQWFYFRVRNMREGVTYRFTIINLMKSSSLYGAGMCPLLYSEKTAWLKGEGWKRTGSSIRYYRNNIEQDGKA----LYSLTWTLEFPYDGDTCYLAHCYPYTYSKLQHYLREVISDPVRAAYCKLRVLCRSLAGNAVYVLTITAPSSSLAERKAKRAVVVTARVHPGETNGSWMMQGFLEFLLSDLPDAHLLRETFIFKVIPMLNPDGVVVGNYRCSLAGRDLNRNYRSMLRDSFPCIWYTRNMVKRLLAEREVVVYCDFHGHSRKNNVFMYGCNERKDASQCLQERVFPLMMSKNAKDKFSFRSCKFKMHKSKEGTGRIVMWRLGIRNSYTMESTFGGSTLGDRKGT-------HFSTLDLKSMGYCFCDTLLDFCDPDPAKMTRCLEELGVLLKQEIRRKL 631          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Zebrafish
Match: agbl2 (ATP/GTP binding protein-like 2 [Source:NCBI gene;Acc:568152])

HSP 1 Score: 570.852 bits (1470), Expect = 0.000e+0
Identity = 289/635 (45.51%), Postives = 397/635 (62.52%), Query Frame = 2
Query:  128 RFMKKHLQHYGYYKGNKL----IMRELEGYEKTHEHSQSDESTS----------ESENAIKCNQKTGTSPSLRTTQLIYDYFEDGSYVRKLKAPHN-YVLNLQQAP----RWPIEMQVLPERIHHITALPQQREFIYIPSNSELKPQPRGEENGRLIFEYKTCS-GPYFTKSKTISKEIGNLLPVTAEFESESDETLCFESRFESGNLEKVYKISPFEYELHLRPDLYTSKHTQWYYFRVSNTRENKMYRFTIVNFYKAESLYNEGLKPLLYSEKDARLSNKGWRRWGSNIAYYRNNLKYETKKGENYYYSLTWNCLFPHDNDTVYFSHCYPYTYSNLMKYVETVSKDPVKSKICRIKLLTKSLAENISLLLTITNSFTEQERKNYKKIILITGRVHPGETNASWMMEGVLDFLLSDKPDAMLLRDLFIFKIVPMLNPDGVIVGNYRCSLTGRDLNRNYKSKLKDYYPIICSVKNLAEKLLKDHEILFYCDFHGHSRKNNIFMYGCNDQKSENEFLLERAFPYILAKNASDKFDYKSCKFKMQKSKSGTSRIVFRNFGIPHSFTLEASFCGTDLISNTNSNRNEQFYHFNTDDLKKMGEAFCYSLLDFSDPDQTQMNIILDNIKEDLTKRYTNKL 1972
            R +  HLQHYG+   +      I RE EG + +      + S+           E E +  C+     + +LRT QL++D F+    + +L+ P + + +     P    RWPIE  V+ ++I HI   P + E  Y P+ +E  P P GE  G  ++     +   YFT S+ +    G +   T+   ++ + TL FESRFE GNL+K  ++  ++YEL LR DLYT+KHTQW+YFRV N RE   YRFTI+N  K+ SLY  G+ PLLYSEK A L  +GW+R GS+I YYRNN++ + K      YSLTW   FP+D DT Y +HCYPYTYS L  Y+  V  DPV++  C++++L +SLA N   +LTIT   +    +  K+ +++T RVHPGETN SWMM+G L+FLLSD PDA LLR+ FIFK++PMLNPDGV+VGNYRCSL GRDLNRNY+S L+D +P I   +N+ ++LL + E++ YCDFHGHSRKNN+FMYGCN++K  ++ L ER FP +++KNA DKF ++SCKFKM KSK GT RIV    GI +S+T+E++F G+ L     +       HF+T DLK MG  FC +LLDF DPD  +M   L+ +   L +    KL
Sbjct:   11 RLLLLHLQHYGFLSADNSSGIPIKREWEGIQDSTASDMINSSSPSESSDSNLEEEQEESKPCSNFFSLNKALRTRQLVFD-FDGERPIPRLRDPLDLFTIPSTSCPFQGVRWPIECDVICDKIQHIEWDPSEPETFYQPTGNEQTPMPVGEVRGNTVYCIDPATKASYFTYSR-VGGSRGPIKSATSCANNQKEPTLAFESRFECGNLQKAVQVGQYDYELTLRTDLYTTKHTQWFYFRVRNMREGVTYRFTIINLMKSSSLYGAGMCPLLYSEKTAWLKGEGWKRTGSSIRYYRNNIEQDGKA----LYSLTWTLEFPYDGDTCYLAHCYPYTYSKLQHYLREVISDPVRAAYCKLRVLCRSLAGNAVYVLTITAPSSSLAERKAKRAVVVTARVHPGETNGSWMMQGFLEFLLSDLPDAHLLRETFIFKVIPMLNPDGVVVGNYRCSLAGRDLNRNYRSMLRDSFPCIWYTRNMVKRLLAEREVVVYCDFHGHSRKNNVFMYGCNERKDASQCLQERVFPLMMSKNAKDKFSFRSCKFKMHKSKEGTGRIVMWRLGIRNSYTMESTFGGSTLGDRKGT-------HFSTLDLKSMGYCFCDTLLDFCDPDPAKMTRCLEELGVLLKQEIRRKL 632          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Zebrafish
Match: agtpbp1 (ATP/GTP binding protein 1 [Source:NCBI gene;Acc:554164])

HSP 1 Score: 305.834 bits (782), Expect = 1.076e-90
Identity = 168/440 (38.18%), Postives = 262/440 (59.55%), Query Frame = 2
Query:  638 SESDETLCFESRFESGNLEKVYKISPFEYELHLRPDLYTSKHTQWYYFRVSNTRENKMYRFTIVNFYKAESLYNEGLKPLLYSEKDARLSNKGWRRWGSNIAYYRNNLKYET-----KKGENYYYSLTWNCLFPHDNDTVYFSHCYPYTYSNLMKYVETVSKDPVKSKICRIKLLTKSLAENISLLLTIT---NSFTEQERKNYKK--IILITGRVHPGETNASWMMEGVLDFLLSDKPDAMLLRDLFIFKIVPMLNPDGVIVGNYRCSLTGRDLNRNYKSKLKDYYPIICSVKNLAEKLLKDHEI-LFYCDFHGHSRKNNIFMYGCNDQKSE------------NEFLLERAFPYILAKNASDKFDYKSCKFKMQKSKSGTSR-IVFRNFGIPHSFTLEASFCGTDLISNTNSNRNEQFYHFNTDDLKKMGEAFCYSLL 1885
            +++ E+L F S+FESGNL K  ++  FEY+L L  D+ ++ + QW+YF V N R    YRF I+N  K+ S +N G++ ++YS ++A   +  W R GS+I YY+N+    +     +KG++Y+ ++T+   F H +D  YF++ YPYTYS L  +++ +S         R + L ++L  N   LLTIT    S +++    ++   +I ++ RVHPGETN+SW+M+G L+FL+S  P A  LR  +IFKI+PMLNPDGVI GN+RCSL+G DLNR +++   + +P I   K+L + L       L +CD+HGHSRK N+FMYGC+ +++             NE L  R  P +L++ A   F   SC F +++SK  T+R +V+R  G+  S+T+E++ CG D           +     T +L++MG  FC +LL
Sbjct:  199 TDNGESLKFNSKFESGNLRKAIQVRKFEYDLILNSDINSNHYHQWFYFEVGNMRPGVRYRFNIINCEKSNSQFNYGMQVIMYSVQEAINGSPHWVRTGSDICYYKNHFARSSIAAGGQKGKSYF-TMTFTVTFQHKDDVCYFAYHYPYTYSMLKMHLQKLSALCTPEIYYRQEDLCETLGGNGCPLLTITAMPESSSDEHISQFRSRPVIFLSARVHPGETNSSWVMKGSLEFLMSCSPQAQSLRQSYIFKIMPMLNPDGVINGNHRCSLSGEDLNRQWQNPNAELHPTIYHAKSLLQYLRATGRTPLVFCDYHGHSRKKNVFMYGCSIKETMWQSSVNTSTCDLNEDLGYRTLPKLLSQMAP-AFSLSSCSFVVERSKEATARVVVWREIGVQRSYTMESTLCGCD-------QGKYKGLQIGTSELEEMGSQFCLALL 629          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Zebrafish
Match: agtpbp1 (ATP/GTP binding protein 1 [Source:NCBI gene;Acc:554164])

HSP 1 Score: 306.605 bits (784), Expect = 7.371e-88
Identity = 168/440 (38.18%), Postives = 262/440 (59.55%), Query Frame = 2
Query:  638 SESDETLCFESRFESGNLEKVYKISPFEYELHLRPDLYTSKHTQWYYFRVSNTRENKMYRFTIVNFYKAESLYNEGLKPLLYSEKDARLSNKGWRRWGSNIAYYRNNLKYET-----KKGENYYYSLTWNCLFPHDNDTVYFSHCYPYTYSNLMKYVETVSKDPVKSKICRIKLLTKSLAENISLLLTIT---NSFTEQERKNYKK--IILITGRVHPGETNASWMMEGVLDFLLSDKPDAMLLRDLFIFKIVPMLNPDGVIVGNYRCSLTGRDLNRNYKSKLKDYYPIICSVKNLAEKLLKDHEI-LFYCDFHGHSRKNNIFMYGCNDQKSE------------NEFLLERAFPYILAKNASDKFDYKSCKFKMQKSKSGTSR-IVFRNFGIPHSFTLEASFCGTDLISNTNSNRNEQFYHFNTDDLKKMGEAFCYSLL 1885
            +++ E+L F S+FESGNL K  ++  FEY+L L  D+ ++ + QW+YF V N R    YRF I+N  K+ S +N G++ ++YS ++A   +  W R GS+I YY+N+    +     +KG++Y+ ++T+   F H +D  YF++ YPYTYS L  +++ +S         R + L ++L  N   LLTIT    S +++    ++   +I ++ RVHPGETN+SW+M+G L+FL+S  P A  LR  +IFKI+PMLNPDGVI GN+RCSL+G DLNR +++   + +P I   K+L + L       L +CD+HGHSRK N+FMYGC+ +++             NE L  R  P +L++ A   F   SC F +++SK  T+R +V+R  G+  S+T+E++ CG D           +     T +L++MG  FC +LL
Sbjct:  630 TDNGESLKFNSKFESGNLRKAIQVRKFEYDLILNSDINSNHYHQWFYFEVGNMRPGVRYRFNIINCEKSNSQFNYGMQVIMYSVQEAINGSPHWVRTGSDICYYKNHFARSSIAAGGQKGKSYF-TMTFTVTFQHKDDVCYFAYHYPYTYSMLKMHLQKLSALCTPEIYYRQEDLCETLGGNGCPLLTITAMPESSSDEHISQFRSRPVIFLSARVHPGETNSSWVMKGSLEFLMSCSPQAQSLRQSYIFKIMPMLNPDGVINGNHRCSLSGEDLNRQWQNPNAELHPTIYHAKSLLQYLRATGRTPLVFCDYHGHSRKKNVFMYGCSIKETMWQSSVNTSTCDLNEDLGYRTLPKLLSQMAP-AFSLSSCSFVVERSKEATARVVVWREIGVQRSYTMESTLCGCD-------QGKYKGLQIGTSELEEMGSQFCLALL 1060          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Xenopus
Match: fgfr1 (fibroblast growth factor receptor 1 [Source:Xenbase;Acc:XB-GENE-1018554])

HSP 1 Score: 563.148 bits (1450), Expect = 0.000e+0
Identity = 298/635 (46.93%), Postives = 398/635 (62.68%), Query Frame = 2
Query:  131 FMKKHLQHYGYYKGNKLIMRE-----LEGYEKTHEHSQSDESTSESENAIKCNQKTGTSPSLRTTQLIYDYFEDGSYVRKLKAPHN-YVLNLQ----QAPRWPIEMQVLPERIHHITALPQQREFIYIPSNSELKPQPRGEENGRLIFEYKTC-SGPYFTKSKTISKEIGNLLPVTAEFESESDETLCFESRFESGNLEKVYKISPFEYELHLRPDLYTSKHTQWYYFRVSNTRENKMYRFTIVNFYKAESLYNEGLKPLLYSEKDARLSNKGWRRWGSNIAYYRNNLKYETKKGENYYYSLTWNCLFPHDNDTVYFSHCYPYTYSNLMKYVETVSKDPVKSKICRIKLLTKSLAENISLLLTITNSFTEQERKNYKKIILITGRVHPGETNASWMMEGVLDFLLSDKPDAMLLRDLFIFKIVPMLNPDGVIVGNYRCSLTGRDLNRNYKSKLKDYYPIICSVKNLAEKLLKDHEILFYCDFHGHSRKNNIFMYGCNDQKSENEFLLERAFPYILAKNASDKFDYKSCKFKMQKSKSGTSRIVFRNFGIPHSFTLEASFCGTDLISNTNSNRNEQFYHFNTDDLKKMGEAFCYSLLDFSDPDQTQMNIILDNIKEDLTKRYTNKLETRGINIDGN 2002
            FM  HLQ+YGY++G  L  RE     ++   K    S SD  +S+ +           SP  ++ QL+++  ++G  + +L+ P + Y  + Q    Q  RWP E +V+ + I HI   P  RE  Y P+ +E KP    E  G +++E      G YF  S+T  ++  +        + + +  L FESRFESGNL+K  K+  +EYEL LR DLYTSKHTQW+YF+V NTR+   YRFTI N  K  SLYNEGLKPLLYS++DA L   GWRR G +I YY+N    + +      YSLTW   FPHD+D  YF+HCYPYTYS+L + +++   DP  S  C+++ L +SLA N   LLTIT+  T       KK I++T RVHPGETN SWMM+G LDF+LSD PDA LLRD FIFK+VPMLNPDGVIVGNYRCSL+GRDLNRNYKS LKD +P I   +++ ++LL + E++ YCDFHGHSRKNN+FMYGCN +      L ER FP +L+KNA DKF +K CKFK+QKSK GT RI     GI +S+T+EA+F G+ L      NR +   HF T DLK MG  FC +LLD+ DPD ++  + L  ++  + +    K++  G ++D +
Sbjct:   21 FMHHHLQYYGYFRG--LEPREQFKLPVQRCRKVVTDSDSDMPSSQEDQKKLVYSLLLDSPVFKSRQLVFED-QEGKIIPRLREPKDLYGSSSQDGCWQQARWPSECEVIKQDISHIEWDPTDREIFYKPTGNEPKPPVVSEGTGAVVYEISPAHKGSYFKGSRTGGRKCSH----RKNQKVQCNNDLQFESRFESGNLQKAMKVGMYEYELTLRTDLYTSKHTQWFYFQVKNTRKGVPYRFTITNLMKTNSLYNEGLKPLLYSQQDAALKGIGWRREGKDIKYYKNTRSLDGRS----LYSLTWTFEFPHDDDICYFAHCYPYTYSDLQRDLKSKISDPACSHYCKLRTLCRSLAGNSIYLLTITSPSTNLTTGAKKKAIVVTARVHPGETNGSWMMKGFLDFILSDSPDAQLLRDTFIFKVVPMLNPDGVIVGNYRCSLSGRDLNRNYKSMLKDAFPCIWHTRSMVKRLLTEREVILYCDFHGHSRKNNVFMYGCNSKGHPLTKLHERIFPLMLSKNAPDKFLFKGCKFKVQKSKEGTGRIDMWKQGIQNSYTMEATFGGSTL-----GNRKDT--HFTTQDLKSMGHHFCDTLLDYCDPDSSKFKLCLSELQRLVEEDIREKMKQLGRDMDSD 637          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Xenopus
Match: AGBL3 (ATP/GTP binding protein like 3 [Source:HGNC Symbol;Acc:HGNC:27981])

HSP 1 Score: 513.842 bits (1322), Expect = 3.541e-170
Identity = 262/562 (46.62%), Postives = 363/562 (64.59%), Query Frame = 2
Query:  296 SLRTTQLIYDYFEDGSYVRKLKAPHNYV----LNLQQAPRWPIEMQVLPERIHHITALPQQREFIYIPS--NSELKPQPRGEE-NGRLIFEYKTCSGPYFTKSKTISKEIGNLLPVTAEFE----SESDETLCFESRFESGNLEKVYKISPFEYELHLRPDLYTSKHTQWYYFRVSNTRENKMYRFTIVNFYKAESLYNEGLKPLLYSEKDARLSNKGWRRWGSNIAYYRNNLKYETKKGENYYYSLTWNCLFPHDNDTVYFSHCYPYTYSNLMKYVETVSKDPVKSKICRIKLLTKSLAENISLLLTITNSFTEQERKNYKKIILITGRVHPGETNASWMMEGVLDFLLSDKPDAMLLRDLFIFKIVPMLNPDGVIVGNYRCSLTGRDLNRNYKSKLKDYYPIICSVKNLAEKLLKDHEILFYCDFHGHSRKNNIFMYGC----NDQKSENEFLLERAFPYILAKNASDKFDYKSCKFKMQKSKSGTSRIVFRNFGIPHSFTLEASFCGTDLISNTNSNRNEQFYHFNTDDLKKMGEAFCYSLLDFSDPDQTQMNIILDNI 1936
            S R+TQ++++Y   G  + +L+AP +       +    PRWP E +VL E++ HI   P   E +Y P+   ++  P  R    +  L F      GPYF  S+     +G     T +       ESD TL FE+RFESGNL+K  ++  ++Y+L LR DLYT++HTQW+YFRV NTR    YRFTI N  K  SLY+ G++PL+YSE +A+    GW R G NI YYRNNL  + +      +SL+W   FPH  DT YF+HCYPYTYSNL  Y+  ++ DP +S+ C+I++L  SLA N   +LTITN     +R   KK +++T RVHPGETN+SW+M+G LDFLLS   DA +LRD  +FK+VPMLNPDGVIVGNYRCSLTGRDLNRNYKS+LKD +P I   +N+  +++++ EIL YCD HGHSRK N+FMYGC     + +++ E+L ER FP++L+KNA +KF + SCKFKM+KSK GT R+V    GI +S+TLEA++CG+ L     +       HF+T DL+ +G  FC +LL + +P+Q ++  ++  +
Sbjct:   62 SQRSTQIVFEY-RSGRKIARLRAPRDLYGVSPASFLHLPRWPYECEVLKEKVEHIEWNPPTPEPMYRPTVLCNDWPPVERWIYCDVSLSFFISGNKGPYFMYSR-----VGGCHSPTPQVPPHGWEESDNTLEFEARFESGNLQKAVRVGEYDYQLTLRTDLYTARHTQWFYFRVRNTRAGVPYRFTITNLRKPASLYSRGMRPLIYSELEAKSRGIGWHRTGENIKYYRNNLDQDGQS----LFSLSWTFCFPHSMDTCYFAHCYPYTYSNLQDYLAGITSDPERSRYCKIRVLCHSLAGNRVYVLTITNPSPATDRPIRKKAVIVTARVHPGETNSSWVMKGFLDFLLSPSNDARVLRDSLVFKVVPMLNPDGVIVGNYRCSLTGRDLNRNYKSRLKDSFPSIWFTRNMI-RVMQEREILLYCDLHGHSRKQNVFMYGCKKSSREYQAKQEYLYERMFPFMLSKNAPEKFSFSSCKFKMRKSKEGTGRVVMWKMGIQNSYTLEATYCGSTLGPRCGT-------HFSTKDLESVGHHFCDTLLYYCNPEQPKVKPVIQKV 605          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Xenopus
Match: AGBL3 (ATP/GTP binding protein like 3 [Source:HGNC Symbol;Acc:HGNC:27981])

HSP 1 Score: 383.259 bits (983), Expect = 3.630e-123
Identity = 196/411 (47.69%), Postives = 263/411 (63.99%), Query Frame = 2
Query:  296 SLRTTQLIYDYFEDGSYVRKLKAPHNY----VLNLQQAPRWPIEMQVLPERIHHITALPQQREFIYIPSNSELKPQPRGEENGRLIFEYKTCSGPYFTKSKTISKEIGNLLPVTAEFES----ESDETLCFESRFESGNLEKVYKISPFEYELHLRPDLYTSKHTQWYYFRVSNTRENKMYRFTIVNFYKAESLYNEGLKPLLYSEKDARLSNKGWRRWGSNIAYYRNNLKYETKKGENYYYSLTWNCLFPHDNDTVYFSHCYPYTYSNLMKYVETVSKDPVKSKICRIKLLTKSLAENISLLLTITNSFTEQERKNYKKIILITGRVHPGETNASWMMEGVLDFLLSDKPDAMLLRDLFIFKIVPMLNPDGVIVGNYRCSLTGRDLNRNYKSKLKDYYPIICSVKNLAEK 1504
            S R+TQ++++Y   G  + +L+AP +       +    PRWP E +VL E++ HI   P   E +Y P+    +        G +++E  T  GPYF  S+     +G     T +       ESD TL FE+RFESGNL+K  ++  ++Y+L LR DLYT++HTQW+YFRV NTR    YRFTI N  K  SLY+ G++PL+YSE +A+    GW R G NI YYRNNL  + +      +SL+W   FPH  DT YF+HCYPYTYSNL  Y+  ++ DP +S+ C+I++L  SLA N   +LTITN     +R   KK +++T RVHPGETN+SW+M+G LDFLLS   DA +LRD  +FK+VPMLNPDGVIVGNYRCSLTGRDLNRNYKS+LKD +P I   +N+  +
Sbjct:   40 SQRSTQIVFEY-RSGRKIARLRAPRDLYGVSPASFLHLPRWPYECEVLKEKVEHIEWNPPTPEPMYRPTALAKEAVHVEPTEGNVVYE--TNEGPYFMYSR-----VGGCHSPTPQVPPHGWEESDNTLEFEARFESGNLQKAVRVGEYDYQLTLRTDLYTARHTQWFYFRVRNTRAGVPYRFTITNLRKPASLYSRGMRPLIYSELEAKSRGIGWHRTGENIKYYRNNLDQDGQS----LFSLSWTFCFPHSMDTCYFAHCYPYTYSNLQDYLAGITSDPERSRYCKIRVLCHSLAGNRVYVLTITNPSPATDRPIRKKAVIVTARVHPGETNSSWVMKGFLDFLLSPSNDARVLRDSLVFKVVPMLNPDGVIVGNYRCSLTGRDLNRNYKSRLKDSFPSIWFTRNMIRR 438          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Xenopus
Match: agtpbp1 (ATP/GTP binding protein 1 [Source:NCBI gene;Acc:100135097])

HSP 1 Score: 301.982 bits (772), Expect = 1.604e-86
Identity = 178/473 (37.63%), Postives = 266/473 (56.24%), Query Frame = 2
Query:  641 ESDETLCFESRFESGNLEKVYKISPFEYELHLRPDLYTSKHTQWYYFRVSNTRENKMYRFTIVNFYKAESLYNEGLKPLLYSEKDARLSNKGWRRWGSNIAYYRNNLKYET-----KKGENYYYSLTWNCLFPHDNDTVYFSHCYPYTYSNLMKYVETVSKDPVKSKI-CRIKLLTKSLAENISLLLTIT-----NSFTEQERKNYKKIILITGRVHPGETNASWMMEGVLDFLLSDKPDAMLLRDLFIFKIVPMLNPDGVIVGNYRCSLTGRDLNRNYKSKLKDYYPIICSVKNLAEKLLKDHEI-LFYCDFHGHSRKNNIFMYGC---------NDQKSENEFLLE---RAFPYILAKNASDKFDYKSCKFKMQKSKSGTSR-IVFRNFGIPHSFTLEASFCGTDLISNTNSNRNEQFYHFNTDDLKKMGEAFCYSLL---DFSDPDQTQMNIILDNIKEDLTKRYTNKLE 1975
            +  E L F S+FESGNL KV +I   EY+L L  D+ ++ + QW+YF VS  R    YRF I+N  K+ S +N G++PL+YS ++A  S   W R G +I YY+N+    +     +KG++YY ++T+   FPH +D  YF++ YPYTYS L  +++ +       ++  R ++L ++L  N   ++TIT     N +    +   +  I ++ RVHPGETNASW+M+G L+FL+     A  LR+ +IFKIVPMLNPDGVI GN+RCSL+G DLNR +++   D +P I   K L + L       L YCD+HGHSRK N+FMYGC         N   +  + + +   R  P +L + A   F   SC F ++KSK  T+R +V+R  G+  S+T+E++ CG D           +     T +L++MG  FC  LL     + P +  +   L +I+ +L    T  LE
Sbjct:  583 DESEVLKFNSKFESGNLRKVIQIRKNEYDLILNSDINSNHYHQWFYFEVSGMRTGVAYRFNIINCEKSNSQFNYGMQPLMYSVQEALASRPWWYRVGMDICYYKNHFSRSSIATGGQKGKSYY-TITFTVTFPHRDDVCYFAYHYPYTYSTLKMHLKKLESLHNPQQVYFRQEVLCETLGGNGCPVITITAMPESNYYEHVYQFRNRPYIFLSSRVHPGETNASWVMKGTLEFLMGSSTSAQSLRESYIFKIVPMLNPDGVINGNHRCSLSGEDLNRQWQNPNVDLHPTIYHTKGLLQYLAAIRRTPLVYCDYHGHSRKKNVFMYGCSIKETVWHTNANAASCDMVEDSGYRTLPKVLNQLAP-AFSMSSCSFVVEKSKESTARVVVWREIGVQRSYTMESTLCGCD-------QGKYKDLQIGTKELEEMGAKFCVGLLRLKRLTSPMELTLPPSLIDIENELIDPTTYVLE 1046          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Xenopus
Match: agtpbp1 (ATP/GTP binding protein 1 [Source:NCBI gene;Acc:100135097])

HSP 1 Score: 301.597 bits (771), Expect = 3.405e-86
Identity = 171/437 (39.13%), Postives = 252/437 (57.67%), Query Frame = 2
Query:  650 ETLCFESRFESGNLEKVYKISPFEYELHLRPDLYTSKHTQWYYFRVSNTRENKMYRFTIVNFYKAESLYNEGLKPLLYSEKDARLSNKGWRRWGSNIAYYRNNLKYET-----KKGENYYYSLTWNCLFPHDNDTVYFSHCYPYTYSNLMKYVETVSKDPVKSKI-CRIKLLTKSLAENISLLLTIT-----NSFTEQERKNYKKIILITGRVHPGETNASWMMEGVLDFLLSDKPDAMLLRDLFIFKIVPMLNPDGVIVGNYRCSLTGRDLNRNYKSKLKDYYPIICSVKNLAEKLLKDHEI-LFYCDFHGHSRKNNIFMYGC---------NDQKSENEFLLE---RAFPYILAKNASDKFDYKSCKFKMQKSKSGTSR-IVFRNFGIPHSFTLEASFCGTDLISNTNSNRNEQFYHFNTDDLKKMGEAFCYSLL 1885
            E L F S+FESGNL KV +I   EY+L L  D+ ++ + QW+YF VS  R    YRF I+N  K+ S +N G++PL+YS ++A  S   W R G +I YY+N+    +     +KG++YY ++T+   FPH +D  YF++ YPYTYS L  +++ +       ++  R ++L ++L  N   ++TIT     N +    +   +  I ++ RVHPGETNASW+M+G L+FL+     A  LR+ +IFKIVPMLNPDGVI GN+RCSL+G DLNR +++   D +P I   K L + L       L YCD+HGHSRK N+FMYGC         N   +  + + +   R  P +L + A   F   SC F ++KSK  T+R +V+R  G+  S+T+E++ CG D           +     T +L++MG  FC  LL
Sbjct:  562 EVLKFNSKFESGNLRKVIQIRKNEYDLILNSDINSNHYHQWFYFEVSGMRTGVAYRFNIINCEKSNSQFNYGMQPLMYSVQEALASRPWWYRVGMDICYYKNHFSRSSIATGGQKGKSYY-TITFTVTFPHRDDVCYFAYHYPYTYSTLKMHLKKLESLHNPQQVYFRQEVLCETLGGNGCPVITITAMPESNYYEHVYQFRNRPYIFLSSRVHPGETNASWVMKGTLEFLMGSSTSAQSLRESYIFKIVPMLNPDGVINGNHRCSLSGEDLNRQWQNPNVDLHPTIYHTKGLLQYLAAIRRTPLVYCDYHGHSRKKNVFMYGCSIKETVWHTNANAASCDMVEDSGYRTLPKVLNQLAP-AFSMSSCSFVVEKSKESTARVVVWREIGVQRSYTMESTLCGCD-------QGKYKDLQIGTKELEEMGAKFCVGLL 989          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Mouse
Match: Agbl2 (ATP/GTP binding protein-like 2 [Source:MGI Symbol;Acc:MGI:2443254])

HSP 1 Score: 574.704 bits (1480), Expect = 0.000e+0
Identity = 298/658 (45.29%), Postives = 409/658 (62.16%), Query Frame = 2
Query:  131 FMKKHLQHYGYYKGNK----------LIMRELEGYEKTHEHSQSDESTSESE-------------------NAIKCNQKTGTSPSLRTTQLIYDYFEDGSYVRKLKAPHNYVLNLQ-----QAPRWPIEMQVLPERIHHITALPQQREFIYIPSNSELKPQPRGEENGRLIFEYKT--CSGPYFTKSKTISKEIGNLLPVTAEFESESDETLCFESRFESGNLEKVYKISPFEYELHLRPDLYTSKHTQWYYFRVSNTRENKMYRFTIVNFYKAESLYNEGLKPLLYSEKDARLSNKGWRRWGSNIAYYRNNLKYETKKGENYYYSLTWNCLFPHDNDTVYFSHCYPYTYSNLMKYVETVSKDPVKSKICRIKLLTKSLAENISLLLTITNSFTEQERKNYKKIILITGRVHPGETNASWMMEGVLDFLLSDKPDAMLLRDLFIFKIVPMLNPDGVIVGNYRCSLTGRDLNRNYKSKLKDYYPIICSVKNLAEKLLKDHEILFYCDFHGHSRKNNIFMYGCNDQKSENEFLLERAFPYILAKNASDKFDYKSCKFKMQKSKSGTSRIVFRNFGIPHSFTLEASFCGTDLISNTNSNRNEQFYHFNTDDLKKMGEAFCYSLLDFSDPDQTQMNIILDNIKEDLTKRYTNKLETRGINID 1996
            F+  HLQ+YGY+K  K           + R    Y       + D+  S+S                    +A+  +    +SP LRT QLI+D  ++ S   +L+ P             QAPRWPIE +V+ E IHHI  +P Q E+ Y P+ SE  P+  GEE G ++++  +    G YFT S+ I  + G +  +    +   D TL FESRFESGNL+K  ++  +EYEL LR DLYT KHTQW+YFRV NTR++  YRFTIVN  K +SLY  G+KPL+YS+ DA + N GWRR G  I YY+NN+      G+   Y LTW   FPHD DT +F+H YPYTY++L  Y+ +V+ +P++S+ C+++ L +SLA N   LLTITN     +    KK ++++ RVHPGE+N+SW+M G LDF+LS+ PDA LLRD+F+FK++PMLNPDGVIVGNYRCSL GRDLNR+YK+ LKD +P I   KN+ ++LL++ E+L YCDFHGHSRKNNIF+YGC+    ++ +L ER FP +L+KNA DKF + SC FK+QK K GT R+V    GI +S+T+E++F G+ L S  ++       HF  +DLK +G   C +LLDF DPDQT+    L  +KE L +    KL   G ++D
Sbjct:   21 FIHHHLQYYGYFKAQKSSLPNSGTHQRVWRNSPRYMLNGSFGERDDFISDSLEKEMLLWPTCLSSTGHAHIDAVNRDSLLLSSPLLRTRQLIFDELDEAS--PRLREPRELFSCFSSRGPLQAPRWPIECEVIKENIHHIEWVPHQPEYFYQPTGSEKVPEIVGEEQGTVVYQLDSVPAEGTYFTSSR-IGGKRGTIKELAVTLQGPDDNTLLFESRFESGNLQKAVRVGIYEYELTLRTDLYTDKHTQWFYFRVQNTRKDATYRFTIVNLLKPKSLYAVGMKPLMYSQLDATIYNIGWRREGREIKYYKNNVD----DGQQPLYCLTWTTQFPHDQDTCFFAHFYPYTYTDLQCYLLSVANNPIQSQFCKLRALCRSLAGNTVYLLTITNPSRTPQEAAAKKAVVLSARVHPGESNSSWIMNGFLDFILSNSPDAQLLRDIFVFKVIPMLNPDGVIVGNYRCSLAGRDLNRHYKTVLKDSFPCIWYTKNMIKRLLEEREVLLYCDFHGHSRKNNIFLYGCHSNNRKH-WLHERVFPLMLSKNAPDKFSFDSCNFKVQKCKEGTGRVVMWRMGIINSYTMESTFGGSTLGSKRDT-------HFTIEDLKSLGYHVCDTLLDFCDPDQTKYTQCLQELKELLQQEINKKLNNFGQDMD 663          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Mouse
Match: Agbl2 (ATP/GTP binding protein-like 2 [Source:MGI Symbol;Acc:MGI:2443254])

HSP 1 Score: 574.704 bits (1480), Expect = 0.000e+0
Identity = 298/658 (45.29%), Postives = 409/658 (62.16%), Query Frame = 2
Query:  131 FMKKHLQHYGYYKGNK----------LIMRELEGYEKTHEHSQSDESTSESE-------------------NAIKCNQKTGTSPSLRTTQLIYDYFEDGSYVRKLKAPHNYVLNLQ-----QAPRWPIEMQVLPERIHHITALPQQREFIYIPSNSELKPQPRGEENGRLIFEYKT--CSGPYFTKSKTISKEIGNLLPVTAEFESESDETLCFESRFESGNLEKVYKISPFEYELHLRPDLYTSKHTQWYYFRVSNTRENKMYRFTIVNFYKAESLYNEGLKPLLYSEKDARLSNKGWRRWGSNIAYYRNNLKYETKKGENYYYSLTWNCLFPHDNDTVYFSHCYPYTYSNLMKYVETVSKDPVKSKICRIKLLTKSLAENISLLLTITNSFTEQERKNYKKIILITGRVHPGETNASWMMEGVLDFLLSDKPDAMLLRDLFIFKIVPMLNPDGVIVGNYRCSLTGRDLNRNYKSKLKDYYPIICSVKNLAEKLLKDHEILFYCDFHGHSRKNNIFMYGCNDQKSENEFLLERAFPYILAKNASDKFDYKSCKFKMQKSKSGTSRIVFRNFGIPHSFTLEASFCGTDLISNTNSNRNEQFYHFNTDDLKKMGEAFCYSLLDFSDPDQTQMNIILDNIKEDLTKRYTNKLETRGINID 1996
            F+  HLQ+YGY+K  K           + R    Y       + D+  S+S                    +A+  +    +SP LRT QLI+D  ++ S   +L+ P             QAPRWPIE +V+ E IHHI  +P Q E+ Y P+ SE  P+  GEE G ++++  +    G YFT S+ I  + G +  +    +   D TL FESRFESGNL+K  ++  +EYEL LR DLYT KHTQW+YFRV NTR++  YRFTIVN  K +SLY  G+KPL+YS+ DA + N GWRR G  I YY+NN+      G+   Y LTW   FPHD DT +F+H YPYTY++L  Y+ +V+ +P++S+ C+++ L +SLA N   LLTITN     +    KK ++++ RVHPGE+N+SW+M G LDF+LS+ PDA LLRD+F+FK++PMLNPDGVIVGNYRCSL GRDLNR+YK+ LKD +P I   KN+ ++LL++ E+L YCDFHGHSRKNNIF+YGC+    ++ +L ER FP +L+KNA DKF + SC FK+QK K GT R+V    GI +S+T+E++F G+ L S  ++       HF  +DLK +G   C +LLDF DPDQT+    L  +KE L +    KL   G ++D
Sbjct:   21 FIHHHLQYYGYFKAQKSSLPNSGTHQRVWRNSPRYMLNGSFGERDDFISDSLEKEMLLWPTCLSSTGHAHIDAVNRDSLLLSSPLLRTRQLIFDELDEAS--PRLREPRELFSCFSSRGPLQAPRWPIECEVIKENIHHIEWVPHQPEYFYQPTGSEKVPEIVGEEQGTVVYQLDSVPAEGTYFTSSR-IGGKRGTIKELAVTLQGPDDNTLLFESRFESGNLQKAVRVGIYEYELTLRTDLYTDKHTQWFYFRVQNTRKDATYRFTIVNLLKPKSLYAVGMKPLMYSQLDATIYNIGWRREGREIKYYKNNVD----DGQQPLYCLTWTTQFPHDQDTCFFAHFYPYTYTDLQCYLLSVANNPIQSQFCKLRALCRSLAGNTVYLLTITNPSRTPQEAAAKKAVVLSARVHPGESNSSWIMNGFLDFILSNSPDAQLLRDIFVFKVIPMLNPDGVIVGNYRCSLAGRDLNRHYKTVLKDSFPCIWYTKNMIKRLLEEREVLLYCDFHGHSRKNNIFLYGCHSNNRKH-WLHERVFPLMLSKNAPDKFSFDSCNFKVQKCKEGTGRVVMWRMGIINSYTMESTFGGSTLGSKRDT-------HFTIEDLKSLGYHVCDTLLDFCDPDQTKYTQCLQELKELLQQEINKKLNNFGQDMD 663          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Mouse
Match: Agbl2 (ATP/GTP binding protein-like 2 [Source:MGI Symbol;Acc:MGI:2443254])

HSP 1 Score: 574.704 bits (1480), Expect = 0.000e+0
Identity = 298/658 (45.29%), Postives = 409/658 (62.16%), Query Frame = 2
Query:  131 FMKKHLQHYGYYKGNK----------LIMRELEGYEKTHEHSQSDESTSESE-------------------NAIKCNQKTGTSPSLRTTQLIYDYFEDGSYVRKLKAPHNYVLNLQ-----QAPRWPIEMQVLPERIHHITALPQQREFIYIPSNSELKPQPRGEENGRLIFEYKT--CSGPYFTKSKTISKEIGNLLPVTAEFESESDETLCFESRFESGNLEKVYKISPFEYELHLRPDLYTSKHTQWYYFRVSNTRENKMYRFTIVNFYKAESLYNEGLKPLLYSEKDARLSNKGWRRWGSNIAYYRNNLKYETKKGENYYYSLTWNCLFPHDNDTVYFSHCYPYTYSNLMKYVETVSKDPVKSKICRIKLLTKSLAENISLLLTITNSFTEQERKNYKKIILITGRVHPGETNASWMMEGVLDFLLSDKPDAMLLRDLFIFKIVPMLNPDGVIVGNYRCSLTGRDLNRNYKSKLKDYYPIICSVKNLAEKLLKDHEILFYCDFHGHSRKNNIFMYGCNDQKSENEFLLERAFPYILAKNASDKFDYKSCKFKMQKSKSGTSRIVFRNFGIPHSFTLEASFCGTDLISNTNSNRNEQFYHFNTDDLKKMGEAFCYSLLDFSDPDQTQMNIILDNIKEDLTKRYTNKLETRGINID 1996
            F+  HLQ+YGY+K  K           + R    Y       + D+  S+S                    +A+  +    +SP LRT QLI+D  ++ S   +L+ P             QAPRWPIE +V+ E IHHI  +P Q E+ Y P+ SE  P+  GEE G ++++  +    G YFT S+ I  + G +  +    +   D TL FESRFESGNL+K  ++  +EYEL LR DLYT KHTQW+YFRV NTR++  YRFTIVN  K +SLY  G+KPL+YS+ DA + N GWRR G  I YY+NN+      G+   Y LTW   FPHD DT +F+H YPYTY++L  Y+ +V+ +P++S+ C+++ L +SLA N   LLTITN     +    KK ++++ RVHPGE+N+SW+M G LDF+LS+ PDA LLRD+F+FK++PMLNPDGVIVGNYRCSL GRDLNR+YK+ LKD +P I   KN+ ++LL++ E+L YCDFHGHSRKNNIF+YGC+    ++ +L ER FP +L+KNA DKF + SC FK+QK K GT R+V    GI +S+T+E++F G+ L S  ++       HF  +DLK +G   C +LLDF DPDQT+    L  +KE L +    KL   G ++D
Sbjct:   21 FIHHHLQYYGYFKAQKSSLPNSGTHQRVWRNSPRYMLNGSFGERDDFISDSLEKEMLLWPTCLSSTGHAHIDAVNRDSLLLSSPLLRTRQLIFDELDEAS--PRLREPRELFSCFSSRGPLQAPRWPIECEVIKENIHHIEWVPHQPEYFYQPTGSEKVPEIVGEEQGTVVYQLDSVPAEGTYFTSSR-IGGKRGTIKELAVTLQGPDDNTLLFESRFESGNLQKAVRVGIYEYELTLRTDLYTDKHTQWFYFRVQNTRKDATYRFTIVNLLKPKSLYAVGMKPLMYSQLDATIYNIGWRREGREIKYYKNNVD----DGQQPLYCLTWTTQFPHDQDTCFFAHFYPYTYTDLQCYLLSVANNPIQSQFCKLRALCRSLAGNTVYLLTITNPSRTPQEAAAKKAVVLSARVHPGESNSSWIMNGFLDFILSNSPDAQLLRDIFVFKVIPMLNPDGVIVGNYRCSLAGRDLNRHYKTVLKDSFPCIWYTKNMIKRLLEEREVLLYCDFHGHSRKNNIFLYGCHSNNRKH-WLHERVFPLMLSKNAPDKFSFDSCNFKVQKCKEGTGRVVMWRMGIINSYTMESTFGGSTLGSKRDT-------HFTIEDLKSLGYHVCDTLLDFCDPDQTKYTQCLQELKELLQQEINKKLNNFGQDMD 663          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Mouse
Match: Agbl2 (ATP/GTP binding protein-like 2 [Source:MGI Symbol;Acc:MGI:2443254])

HSP 1 Score: 574.704 bits (1480), Expect = 0.000e+0
Identity = 298/658 (45.29%), Postives = 409/658 (62.16%), Query Frame = 2
Query:  131 FMKKHLQHYGYYKGNK----------LIMRELEGYEKTHEHSQSDESTSESE-------------------NAIKCNQKTGTSPSLRTTQLIYDYFEDGSYVRKLKAPHNYVLNLQ-----QAPRWPIEMQVLPERIHHITALPQQREFIYIPSNSELKPQPRGEENGRLIFEYKT--CSGPYFTKSKTISKEIGNLLPVTAEFESESDETLCFESRFESGNLEKVYKISPFEYELHLRPDLYTSKHTQWYYFRVSNTRENKMYRFTIVNFYKAESLYNEGLKPLLYSEKDARLSNKGWRRWGSNIAYYRNNLKYETKKGENYYYSLTWNCLFPHDNDTVYFSHCYPYTYSNLMKYVETVSKDPVKSKICRIKLLTKSLAENISLLLTITNSFTEQERKNYKKIILITGRVHPGETNASWMMEGVLDFLLSDKPDAMLLRDLFIFKIVPMLNPDGVIVGNYRCSLTGRDLNRNYKSKLKDYYPIICSVKNLAEKLLKDHEILFYCDFHGHSRKNNIFMYGCNDQKSENEFLLERAFPYILAKNASDKFDYKSCKFKMQKSKSGTSRIVFRNFGIPHSFTLEASFCGTDLISNTNSNRNEQFYHFNTDDLKKMGEAFCYSLLDFSDPDQTQMNIILDNIKEDLTKRYTNKLETRGINID 1996
            F+  HLQ+YGY+K  K           + R    Y       + D+  S+S                    +A+  +    +SP LRT QLI+D  ++ S   +L+ P             QAPRWPIE +V+ E IHHI  +P Q E+ Y P+ SE  P+  GEE G ++++  +    G YFT S+ I  + G +  +    +   D TL FESRFESGNL+K  ++  +EYEL LR DLYT KHTQW+YFRV NTR++  YRFTIVN  K +SLY  G+KPL+YS+ DA + N GWRR G  I YY+NN+      G+   Y LTW   FPHD DT +F+H YPYTY++L  Y+ +V+ +P++S+ C+++ L +SLA N   LLTITN     +    KK ++++ RVHPGE+N+SW+M G LDF+LS+ PDA LLRD+F+FK++PMLNPDGVIVGNYRCSL GRDLNR+YK+ LKD +P I   KN+ ++LL++ E+L YCDFHGHSRKNNIF+YGC+    ++ +L ER FP +L+KNA DKF + SC FK+QK K GT R+V    GI +S+T+E++F G+ L S  ++       HF  +DLK +G   C +LLDF DPDQT+    L  +KE L +    KL   G ++D
Sbjct:   21 FIHHHLQYYGYFKAQKSSLPNSGTHQRVWRNSPRYMLNGSFGERDDFISDSLEKEMLLWPTCLSSTGHAHIDAVNRDSLLLSSPLLRTRQLIFDELDEAS--PRLREPRELFSCFSSRGPLQAPRWPIECEVIKENIHHIEWVPHQPEYFYQPTGSEKVPEIVGEEQGTVVYQLDSVPAEGTYFTSSR-IGGKRGTIKELAVTLQGPDDNTLLFESRFESGNLQKAVRVGIYEYELTLRTDLYTDKHTQWFYFRVQNTRKDATYRFTIVNLLKPKSLYAVGMKPLMYSQLDATIYNIGWRREGREIKYYKNNVD----DGQQPLYCLTWTTQFPHDQDTCFFAHFYPYTYTDLQCYLLSVANNPIQSQFCKLRALCRSLAGNTVYLLTITNPSRTPQEAAAKKAVVLSARVHPGESNSSWIMNGFLDFILSNSPDAQLLRDIFVFKVIPMLNPDGVIVGNYRCSLAGRDLNRHYKTVLKDSFPCIWYTKNMIKRLLEEREVLLYCDFHGHSRKNNIFLYGCHSNNRKH-WLHERVFPLMLSKNAPDKFSFDSCNFKVQKCKEGTGRVVMWRMGIINSYTMESTFGGSTLGSKRDT-------HFTIEDLKSLGYHVCDTLLDFCDPDQTKYTQCLQELKELLQQEINKKLNNFGQDMD 663          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Mouse
Match: Agbl2 (ATP/GTP binding protein-like 2 [Source:MGI Symbol;Acc:MGI:2443254])

HSP 1 Score: 574.318 bits (1479), Expect = 0.000e+0
Identity = 298/658 (45.29%), Postives = 409/658 (62.16%), Query Frame = 2
Query:  131 FMKKHLQHYGYYKGNK----------LIMRELEGYEKTHEHSQSDESTSESE-------------------NAIKCNQKTGTSPSLRTTQLIYDYFEDGSYVRKLKAPHNYVLNLQ-----QAPRWPIEMQVLPERIHHITALPQQREFIYIPSNSELKPQPRGEENGRLIFEYKT--CSGPYFTKSKTISKEIGNLLPVTAEFESESDETLCFESRFESGNLEKVYKISPFEYELHLRPDLYTSKHTQWYYFRVSNTRENKMYRFTIVNFYKAESLYNEGLKPLLYSEKDARLSNKGWRRWGSNIAYYRNNLKYETKKGENYYYSLTWNCLFPHDNDTVYFSHCYPYTYSNLMKYVETVSKDPVKSKICRIKLLTKSLAENISLLLTITNSFTEQERKNYKKIILITGRVHPGETNASWMMEGVLDFLLSDKPDAMLLRDLFIFKIVPMLNPDGVIVGNYRCSLTGRDLNRNYKSKLKDYYPIICSVKNLAEKLLKDHEILFYCDFHGHSRKNNIFMYGCNDQKSENEFLLERAFPYILAKNASDKFDYKSCKFKMQKSKSGTSRIVFRNFGIPHSFTLEASFCGTDLISNTNSNRNEQFYHFNTDDLKKMGEAFCYSLLDFSDPDQTQMNIILDNIKEDLTKRYTNKLETRGINID 1996
            F+  HLQ+YGY+K  K           + R    Y       + D+  S+S                    +A+  +    +SP LRT QLI+D  ++ S   +L+ P             QAPRWPIE +V+ E IHHI  +P Q E+ Y P+ SE  P+  GEE G ++++  +    G YFT S+ I  + G +  +    +   D TL FESRFESGNL+K  ++  +EYEL LR DLYT KHTQW+YFRV NTR++  YRFTIVN  K +SLY  G+KPL+YS+ DA + N GWRR G  I YY+NN+      G+   Y LTW   FPHD DT +F+H YPYTY++L  Y+ +V+ +P++S+ C+++ L +SLA N   LLTITN     +    KK ++++ RVHPGE+N+SW+M G LDF+LS+ PDA LLRD+F+FK++PMLNPDGVIVGNYRCSL GRDLNR+YK+ LKD +P I   KN+ ++LL++ E+L YCDFHGHSRKNNIF+YGC+    ++ +L ER FP +L+KNA DKF + SC FK+QK K GT R+V    GI +S+T+E++F G+ L S  ++       HF  +DLK +G   C +LLDF DPDQT+    L  +KE L +    KL   G ++D
Sbjct:   21 FIHHHLQYYGYFKAQKSSLPNSGTHQRVWRNSPRYMLNGSFGERDDFISDSLEKEMLLWPTCLSSTGHAHIDAVNRDSLLLSSPLLRTRQLIFDELDEAS--PRLREPRELFSCFSSRGPLQAPRWPIECEVIKENIHHIEWVPHQPEYFYQPTGSEKVPEIVGEEQGTVVYQLDSVPAEGTYFTSSR-IGGKRGTIKELAVTLQGPDDNTLLFESRFESGNLQKAVRVGIYEYELTLRTDLYTDKHTQWFYFRVQNTRKDATYRFTIVNLLKPKSLYAVGMKPLMYSQLDATIYNIGWRREGREIKYYKNNVD----DGQQPLYCLTWTTQFPHDQDTCFFAHFYPYTYTDLQCYLLSVANNPIQSQFCKLRALCRSLAGNTVYLLTITNPSRTPQEAAAKKAVVLSARVHPGESNSSWIMNGFLDFILSNSPDAQLLRDIFVFKVIPMLNPDGVIVGNYRCSLAGRDLNRHYKTVLKDSFPCIWYTKNMIKRLLEEREVLLYCDFHGHSRKNNIFLYGCHSNNRKH-WLHERVFPLMLSKNAPDKFSFDSCNFKVQKCKEGTGRVVMWRMGIINSYTMESTFGGSTLGSKRDT-------HFTIEDLKSLGYHVCDTLLDFCDPDQTKYTQCLQELKELLQQEINKKLNNFGQDMD 663          
BLAST of Cytosolic carboxypeptidase 2 vs. UniProt/SwissProt
Match: sp|Q8CDK2|CBPC2_MOUSE (Cytosolic carboxypeptidase 2 OS=Mus musculus OX=10090 GN=Agbl2 PE=1 SV=1)

HSP 1 Score: 574.704 bits (1480), Expect = 0.000e+0
Identity = 298/658 (45.29%), Postives = 409/658 (62.16%), Query Frame = 2
Query:  131 FMKKHLQHYGYYKGNK----------LIMRELEGYEKTHEHSQSDESTSESE-------------------NAIKCNQKTGTSPSLRTTQLIYDYFEDGSYVRKLKAPHNYVLNLQ-----QAPRWPIEMQVLPERIHHITALPQQREFIYIPSNSELKPQPRGEENGRLIFEYKT--CSGPYFTKSKTISKEIGNLLPVTAEFESESDETLCFESRFESGNLEKVYKISPFEYELHLRPDLYTSKHTQWYYFRVSNTRENKMYRFTIVNFYKAESLYNEGLKPLLYSEKDARLSNKGWRRWGSNIAYYRNNLKYETKKGENYYYSLTWNCLFPHDNDTVYFSHCYPYTYSNLMKYVETVSKDPVKSKICRIKLLTKSLAENISLLLTITNSFTEQERKNYKKIILITGRVHPGETNASWMMEGVLDFLLSDKPDAMLLRDLFIFKIVPMLNPDGVIVGNYRCSLTGRDLNRNYKSKLKDYYPIICSVKNLAEKLLKDHEILFYCDFHGHSRKNNIFMYGCNDQKSENEFLLERAFPYILAKNASDKFDYKSCKFKMQKSKSGTSRIVFRNFGIPHSFTLEASFCGTDLISNTNSNRNEQFYHFNTDDLKKMGEAFCYSLLDFSDPDQTQMNIILDNIKEDLTKRYTNKLETRGINID 1996
            F+  HLQ+YGY+K  K           + R    Y       + D+  S+S                    +A+  +    +SP LRT QLI+D  ++ S   +L+ P             QAPRWPIE +V+ E IHHI  +P Q E+ Y P+ SE  P+  GEE G ++++  +    G YFT S+ I  + G +  +    +   D TL FESRFESGNL+K  ++  +EYEL LR DLYT KHTQW+YFRV NTR++  YRFTIVN  K +SLY  G+KPL+YS+ DA + N GWRR G  I YY+NN+      G+   Y LTW   FPHD DT +F+H YPYTY++L  Y+ +V+ +P++S+ C+++ L +SLA N   LLTITN     +    KK ++++ RVHPGE+N+SW+M G LDF+LS+ PDA LLRD+F+FK++PMLNPDGVIVGNYRCSL GRDLNR+YK+ LKD +P I   KN+ ++LL++ E+L YCDFHGHSRKNNIF+YGC+    ++ +L ER FP +L+KNA DKF + SC FK+QK K GT R+V    GI +S+T+E++F G+ L S  ++       HF  +DLK +G   C +LLDF DPDQT+    L  +KE L +    KL   G ++D
Sbjct:   21 FIHHHLQYYGYFKAQKSSLPNSGTHQRVWRNSPRYMLNGSFGERDDFISDSLEKEMLLWPTCLSSTGHAHIDAVNRDSLLLSSPLLRTRQLIFDELDEAS--PRLREPRELFSCFSSRGPLQAPRWPIECEVIKENIHHIEWVPHQPEYFYQPTGSEKVPEIVGEEQGTVVYQLDSVPAEGTYFTSSR-IGGKRGTIKELAVTLQGPDDNTLLFESRFESGNLQKAVRVGIYEYELTLRTDLYTDKHTQWFYFRVQNTRKDATYRFTIVNLLKPKSLYAVGMKPLMYSQLDATIYNIGWRREGREIKYYKNNVD----DGQQPLYCLTWTTQFPHDQDTCFFAHFYPYTYTDLQCYLLSVANNPIQSQFCKLRALCRSLAGNTVYLLTITNPSRTPQEAAAKKAVVLSARVHPGESNSSWIMNGFLDFILSNSPDAQLLRDIFVFKVIPMLNPDGVIVGNYRCSLAGRDLNRHYKTVLKDSFPCIWYTKNMIKRLLEEREVLLYCDFHGHSRKNNIFLYGCHSNNRKH-WLHERVFPLMLSKNAPDKFSFDSCNFKVQKCKEGTGRVVMWRMGIINSYTMESTFGGSTLGSKRDT-------HFTIEDLKSLGYHVCDTLLDFCDPDQTKYTQCLQELKELLQQEINKKLNNFGQDMD 663          
BLAST of Cytosolic carboxypeptidase 2 vs. UniProt/SwissProt
Match: sp|A6H8T7|CBPC2_DANRE (Cytosolic carboxypeptidase 2 OS=Danio rerio OX=7955 GN=zte25 PE=2 SV=1)

HSP 1 Score: 566.614 bits (1459), Expect = 0.000e+0
Identity = 291/637 (45.68%), Postives = 397/637 (62.32%), Query Frame = 2
Query:  128 RFMKKHLQHYGYYKGNKL---IMRELEGYEKTHEHSQSDESTS----------ESENAIKCNQKTGTSPSLRTTQLIYDYFEDGSYVRKLKAPHN-YVLNLQQAP----RWPIEMQVLPERIHHITALPQQREFIYIPSNSELKPQPRGEENGRLIFEYKTCSGPYFTKSK-TISKEIGNLLPV---TAEFESESDETLCFESRFESGNLEKVYKISPFEYELHLRPDLYTSKHTQWYYFRVSNTRENKMYRFTIVNFYKAESLYNEGLKPLLYSEKDARLSNKGWRRWGSNIAYYRNNLKYETKKGENYYYSLTWNCLFPHDNDTVYFSHCYPYTYSNLMKYVETVSKDPVKSKICRIKLLTKSLAENISLLLTITNSFTEQERKNYKKIILITGRVHPGETNASWMMEGVLDFLLSDKPDAMLLRDLFIFKIVPMLNPDGVIVGNYRCSLTGRDLNRNYKSKLKDYYPIICSVKNLAEKLLKDHEILFYCDFHGHSRKNNIFMYGCNDQKSENEFLLERAFPYILAKNASDKFDYKSCKFKMQKSKSGTSRIVFRNFGIPHSFTLEASFCGTDLISNTNSNRNEQFYHFNTDDLKKMGEAFCYSLLDFSDPDQTQMNIILDNIKEDLTKRYTNKL 1972
            R +  HLQHYG+   N     I RE EG + +      + S+           E E +  C+     + +LRT QL++D F+    + +L+ P + + +     P    RWPIE  V+ ++I HI   P + E  Y P+ +E  P P GE  G  ++    C  P    S  T S+  G+  P+   T+   ++ + TL FESRFE GNL+K  ++  ++Y L LR DLYT+KHTQW+YFRV N RE   YRFTI+N  K+ SLY  G+ PLLYSEK A L  +GW+R GS+I YYRNN++ + K      YSLTW   FP+D DT Y +HCYPYTYS L  Y+  V  DPV++  C++++L +SLA N   +LTIT   +    +  K+ +++T RVHPGETN SWMM+G L+FLLSD PDA LLR+ FIFK++PMLNPDGV+VGNYRCSL GRDLNRNY+S L+D +P I   +N+ ++LL + E++ YCDFHGHSRKNN+FMYGCN++K  ++ L ER FP +++KNA DKF ++SCKFKM KSK GT RIV    GI +S+T+E++F G+ L     +       HF+T DLK MG  FC +LLDF DPD  +M   L+ +   L +    KL
Sbjct:   11 RLLLLHLQHYGFLSDNSSGIPIKREWEGIQDSTASDMINSSSPSESSDSNLEEEQEESKPCSNFFSLNKALRTRQLVFD-FDGERPIPRLRDPLDLFTIPSTSCPFQGVRWPIECDVICDKIQHIEWDPSEPETFYQPTGNEQTPMPVGEVRGNTVY----CIDPATKASSFTYSRVGGSRGPIKSATSCANNQKEPTLAFESRFECGNLQKAVQVGQYDYGLTLRTDLYTTKHTQWFYFRVRNMREGVTYRFTIINLMKSSSLYGAGMCPLLYSEKTAWLKGEGWKRTGSSIRYYRNNIEQDGKA----LYSLTWTLEFPYDGDTCYLAHCYPYTYSKLQHYLREVISDPVRAAYCKLRVLCRSLAGNAVYVLTITAPSSSLAERKAKRAVVVTARVHPGETNGSWMMQGFLEFLLSDLPDAHLLRETFIFKVIPMLNPDGVVVGNYRCSLAGRDLNRNYRSMLRDSFPCIWYTRNMVKRLLAEREVVVYCDFHGHSRKNNVFMYGCNERKDASQCLQERVFPLMMSKNAKDKFSFRSCKFKMHKSKEGTGRIVMWRLGIRNSYTMESTFGGSTLGDRKGT-------HFSTLDLKSMGYCFCDTLLDFCDPDPAKMTRCLEELGVLLKQEIRRKL 631          
BLAST of Cytosolic carboxypeptidase 2 vs. UniProt/SwissProt
Match: sp|Q0P4M4|CBPC2_XENTR (Cytosolic carboxypeptidase 2 OS=Xenopus tropicalis OX=8364 GN=agbl2 PE=2 SV=1)

HSP 1 Score: 563.148 bits (1450), Expect = 0.000e+0
Identity = 298/635 (46.93%), Postives = 398/635 (62.68%), Query Frame = 2
Query:  131 FMKKHLQHYGYYKGNKLIMRE-----LEGYEKTHEHSQSDESTSESENAIKCNQKTGTSPSLRTTQLIYDYFEDGSYVRKLKAPHN-YVLNLQ----QAPRWPIEMQVLPERIHHITALPQQREFIYIPSNSELKPQPRGEENGRLIFEYKTC-SGPYFTKSKTISKEIGNLLPVTAEFESESDETLCFESRFESGNLEKVYKISPFEYELHLRPDLYTSKHTQWYYFRVSNTRENKMYRFTIVNFYKAESLYNEGLKPLLYSEKDARLSNKGWRRWGSNIAYYRNNLKYETKKGENYYYSLTWNCLFPHDNDTVYFSHCYPYTYSNLMKYVETVSKDPVKSKICRIKLLTKSLAENISLLLTITNSFTEQERKNYKKIILITGRVHPGETNASWMMEGVLDFLLSDKPDAMLLRDLFIFKIVPMLNPDGVIVGNYRCSLTGRDLNRNYKSKLKDYYPIICSVKNLAEKLLKDHEILFYCDFHGHSRKNNIFMYGCNDQKSENEFLLERAFPYILAKNASDKFDYKSCKFKMQKSKSGTSRIVFRNFGIPHSFTLEASFCGTDLISNTNSNRNEQFYHFNTDDLKKMGEAFCYSLLDFSDPDQTQMNIILDNIKEDLTKRYTNKLETRGINIDGN 2002
            FM  HLQ+YGY++G  L  RE     ++   K    S SD  +S+ +           SP  ++ QL+++  ++G  + +L+ P + Y  + Q    Q  RWP E +V+ + I HI   P  RE  Y P+ +E KP    E  G +++E      G YF  S+T  ++  +        + + +  L FESRFESGNL+K  K+  +EYEL LR DLYTSKHTQW+YF+V NTR+   YRFTI N  K  SLYNEGLKPLLYS++DA L   GWRR G +I YY+N    + +      YSLTW   FPHD+D  YF+HCYPYTYS+L + +++   DP  S  C+++ L +SLA N   LLTIT+  T       KK I++T RVHPGETN SWMM+G LDF+LSD PDA LLRD FIFK+VPMLNPDGVIVGNYRCSL+GRDLNRNYKS LKD +P I   +++ ++LL + E++ YCDFHGHSRKNN+FMYGCN +      L ER FP +L+KNA DKF +K CKFK+QKSK GT RI     GI +S+T+EA+F G+ L      NR +   HF T DLK MG  FC +LLD+ DPD ++  + L  ++  + +    K++  G ++D +
Sbjct:   21 FMHHHLQYYGYFRG--LEPREQFKLPVQRCRKVVTDSDSDMPSSQEDQKKLVYSLLLDSPVFKSRQLVFED-QEGKIIPRLREPKDLYGSSSQDGCWQQARWPSECEVIKQDISHIEWDPTDREIFYKPTGNEPKPPVVSEGTGAVVYEISPAHKGSYFKGSRTGGRKCSH----RKNQKVQCNNDLQFESRFESGNLQKAMKVGMYEYELTLRTDLYTSKHTQWFYFQVKNTRKGVPYRFTITNLMKTNSLYNEGLKPLLYSQQDAALKGIGWRREGKDIKYYKNTRSLDGRS----LYSLTWTFEFPHDDDICYFAHCYPYTYSDLQRDLKSKISDPACSHYCKLRTLCRSLAGNSIYLLTITSPSTNLTTGAKKKAIVVTARVHPGETNGSWMMKGFLDFILSDSPDAQLLRDTFIFKVVPMLNPDGVIVGNYRCSLSGRDLNRNYKSMLKDAFPCIWHTRSMVKRLLTEREVILYCDFHGHSRKNNVFMYGCNSKGHPLTKLHERIFPLMLSKNAPDKFLFKGCKFKVQKSKEGTGRIDMWKQGIQNSYTMEATFGGSTL-----GNRKDT--HFTTQDLKSMGHHFCDTLLDYCDPDSSKFKLCLSELQRLVEEDIREKMKQLGRDMDSD 637          
BLAST of Cytosolic carboxypeptidase 2 vs. UniProt/SwissProt
Match: sp|Q5U5Z8|CBPC2_HUMAN (Cytosolic carboxypeptidase 2 OS=Homo sapiens OX=9606 GN=AGBL2 PE=1 SV=2)

HSP 1 Score: 559.296 bits (1440), Expect = 0.000e+0
Identity = 277/575 (48.17%), Postives = 379/575 (65.91%), Query Frame = 2
Query:  293 PSLRTTQLIYDYFEDGSYVRKLKAPHNYVLNLQ-----QAPRWPIEMQVLPERIHHITALPQQREFIYIPSNSELKPQPRGEENGRLIFEYKTC--SGPYFTKSKTISKEIGNLLPVTAEFESESDETLCFESRFESGNLEKVYKISPFEYELHLRPDLYTSKHTQWYYFRVSNTRENKMYRFTIVNFYKAESLYNEGLKPLLYSEKDARLSNKGWRRWGSNIAYYRNNLKYETKKGENYYYSLTWNCLFPHDNDTVYFSHCYPYTYSNLMKYVETVSKDPVKSKICRIKLLTKSLAENISLLLTITNSFTEQERKNYKKIILITGRVHPGETNASWMMEGVLDFLLSDKPDAMLLRDLFIFKIVPMLNPDGVIVGNYRCSLTGRDLNRNYKSKLKDYYPIICSVKNLAEKLLKDHEILFYCDFHGHSRKNNIFMYGCNDQKSENEFLLERAFPYILAKNASDKFDYKSCKFKMQKSKSGTSRIVFRNFGIPHSFTLEASFCGTDLISNTNSNRNEQFYHFNTDDLKKMGEAFCYSLLDFSDPDQTQMNIILDNIKEDLTKRYTNKLETRGINID 1996
            P LR+ QL+YD  ++ +   +L+ P      L      QAPRWPIE +V+ E IHHI   P Q E+ Y P  +E  P+  GE+ G ++++  +    G YFT S+   K  G +  +    +   D TL FESRFESGNL+K  ++  +EYEL LR DLYT+KHTQW+YFRV NTR++  YRFTIVN  K +SLY  G+KPLLYS+ DA   N GWRR G+ I YY+NN    T  G+  +Y LTW   FP+D DT +F+H YPYTY++L  Y+ +V+ +P++S+ C+++ L +SLA N   LLTITN     +    KK ++++ RVHPGE+N SW+M+G LDF+LS+ PDA LLRD+F+FK++PMLNPDGVIVGNYRCSL GRDLNR+YK+ LK+ +P I   +N+ ++LL++ E+L YCDFHGHSRKNNIF+YGCN+  +   +L ER FP +L KNA DKF + SC FK+QK K GT R+V    GI +S+T+E++F G+ L        N++  HF  +DLK +G   C +LLDF DPDQ +    L  +KE L +    K    G ++D
Sbjct:  141 PHLRSRQLLYDELDEVN--PRLREPQELFSILSTKRPLQAPRWPIECEVIKENIHHIEWAPPQPEYFYQPKGNEKVPEIVGEKKGTVVYQLDSVPIEGSYFTSSRVGGKR-GIVKELAVTLQGPEDNTLLFESRFESGNLQKAVRVDTYEYELTLRTDLYTNKHTQWFYFRVQNTRKDATYRFTIVNLLKPKSLYTVGMKPLLYSQLDANTRNIGWRREGNEIKYYKNN----TDDGQQPFYCLTWTIQFPYDQDTCFFAHFYPYTYTDLQCYLLSVANNPIQSQFCKLQTLCRSLAGNTVYLLTITNPSQTPQEAAAKKAVVLSARVHPGESNGSWVMKGFLDFILSNSPDAQLLRDIFVFKVLPMLNPDGVIVGNYRCSLAGRDLNRHYKTILKESFPCIWYTRNMIKRLLEEREVLLYCDFHGHSRKNNIFLYGCNN-NNRKYWLHERVFPLMLCKNAPDKFSFHSCNFKVQKCKEGTGRVVMWRMGILNSYTMESTFGGSTL-------GNKRDTHFTIEDLKSLGYHVCDTLLDFCDPDQMKFTQCLAELKELLRQEIHKKFHELGQDVD 700          
BLAST of Cytosolic carboxypeptidase 2 vs. UniProt/SwissProt
Match: sp|Q4R632|CBPC2_MACFA (Cytosolic carboxypeptidase 2 OS=Macaca fascicularis OX=9541 GN=AGBL2 PE=2 SV=1)

HSP 1 Score: 558.14 bits (1437), Expect = 0.000e+0
Identity = 287/658 (43.62%), Postives = 407/658 (61.85%), Query Frame = 2
Query:  131 FMKKHLQHYGYYKGNK-------------------LIMRELEGY----------EKTHEHSQSDESTSESENAIKCNQKTGTSPSLRTTQLIYDYFEDGSYVRKLKAPHNY--VLNLQQ---APRWPIEMQVLPERIHHITALPQQREFIYIPSNSELKPQPRGEENGRLIFEYKTC--SGPYFTKSKTISKEIGNLLPVTAEFESESDETLCFESRFESGNLEKVYKISPFEYELHLRPDLYTSKHTQWYYFRVSNTRENKMYRFTIVNFYKAESLYNEGLKPLLYSEKDARLSNKGWRRWGSNIAYYRNNLKYETKKGENYYYSLTWNCLFPHDNDTVYFSHCYPYTYSNLMKYVETVSKDPVKSKICRIKLLTKSLAENISLLLTITNSFTEQERKNYKKIILITGRVHPGETNASWMMEGVLDFLLSDKPDAMLLRDLFIFKIVPMLNPDGVIVGNYRCSLTGRDLNRNYKSKLKDYYPIICSVKNLAEKLLKDHEILFYCDFHGHSRKNNIFMYGCNDQKSENEFLLERAFPYILAKNASDKFDYKSCKFKMQKSKSGTSRIVFRNFGIPHSFTLEASFCGTDLISNTNSNRNEQFYHFNTDDLKKMGEAFCYSLLDFSDPDQTQMNIILDNIKEDLTKRYTNKLETRGINID 1996
            FM +HLQ+YGY+K  +                   L+   L G           EK    +    +      AI  +    + P LR+ QL+YD  ++ +   +L+ P     +L+ ++   APRWPIE +V+ E IHHI   P Q E+ Y P  +E  P+  GE+ G ++++  +    G YFT S+   K+ G +  +    +   D TL FESRFE GNL+K  ++  +EYEL LR DLYT++HTQW+YFRV NTR++  YRFTIVN  K +SLY  G+KPLLYS+ DA   N GWRR G+ I Y +NN+      G+  +Y LTW   FP+D DT +F+H YPYTY++L  Y+ +V+ +P++S+ C+++ L +SLA N   LLTITN     +    KK ++++ RVHPGE+N SW+M+G LDF+LS+ PDA LLRD+F+FK++PMLNPDGVIVGNYRCSL GRDLNR+YK+ LK+ +P I   +N+ ++LL++ E+L YCDFHGHSRKNN F+YGCN+  +   +L ER FP +L+KNA D+F + SC FK+QK K GT R+V    GI +S+T+E++F G+ L S  ++       HF  +DLK +G   C +LLDF DPDQT+    L  +KE L +    K    G ++D
Sbjct:   20 FMYRHLQYYGYFKAQRGSLPNSATHQHVRKNNPQYLLHGSLGGKDDLIPDTLQKEKLLWPTSLSSAVHRQIEAINRDSHMLSLPHLRSRQLLYDELDEVN--PRLREPQELFSILSTKRPLLAPRWPIECEVIKESIHHIEWAPPQPEYFYQPKGNEKVPEIVGEKKGTVVYQLDSVPTEGSYFTSSRVGGKQ-GIIKELAVTLQGPEDNTLLFESRFECGNLQKAVRVDTYEYELTLRTDLYTNRHTQWFYFRVQNTRKDATYRFTIVNLLKPKSLYTVGMKPLLYSQMDANTRNIGWRREGNEIKYCKNNMD----DGQQPFYCLTWTIQFPYDQDTCFFAHFYPYTYTDLQCYLLSVANNPIQSQFCKLQTLCRSLAGNTVYLLTITNPSQTPQEAAAKKAVVLSARVHPGESNGSWVMKGFLDFILSNSPDAQLLRDIFVFKVLPMLNPDGVIVGNYRCSLAGRDLNRHYKTILKESFPCIWYTRNMIKRLLEEREVLLYCDFHGHSRKNNTFLYGCNN-NNRKYWLHERVFPLMLSKNAPDRFSFHSCNFKVQKCKEGTGRVVMWRMGILNSYTMESTFGGSTLGSKRDT-------HFTIEDLKSLGYHVCDTLLDFCDPDQTKFTQCLAELKELLRQEIHKKFHELGQDVD 662          
BLAST of Cytosolic carboxypeptidase 2 vs. TrEMBL
Match: A0A2C9JRG1 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106064887 PE=4 SV=1)

HSP 1 Score: 615.92 bits (1587), Expect = 0.000e+0
Identity = 316/636 (49.69%), Postives = 425/636 (66.82%), Query Frame = 2
Query:  131 FMKKHLQHYGYYKGN----KLIMRELEGYEKTHEHSQSDESTSESENAI----KCNQKTGTSPSLRTTQLIYDYFEDGSYVRKLKAPHN-YVLNL----QQAPRWPIEMQVLPERIHHITALPQQREFIYIPSNSELKPQPRGEENG-RLIFEYKTCSGPYFTKSKTISKEIGNLLPVTAEFESESDETLCFESRFESGNLEKVYKISPFEYELHLRPDLYTSKHTQWYYFRVSNTRENKMYRFTIVNFYKAESLYNEGLKPLLYSEKDARLSNKGWRRWGSNIAYYRNNLKYETKKGENYYYSLTWNCLFPHDNDTVYFSHCYPYTYSNLMKYVETVSKDPVKSKICRIKLLTKSLAENISLLLTITNSFTEQERKNYKKIILITGRVHPGETNASWMMEGVLDFLLSDKPDAMLLRDLFIFKIVPMLNPDGVIVGNYRCSLTGRDLNRNYKSKLKDYYPIICSVKNLAEKLLKDHEILFYCDFHGHSRKNNIFMYGCNDQKSENEFLLERAFPYILAKNASDKFDYKSCKFKMQKSKSGTSRIVFRNFGIPHSFTLEASFCGTDLISNTNSNRNEQFYHFNTDDLKKMGEAFCYSLLDFSDPDQTQMNIILDNIKEDLTKRYTNKLETRGINID 1996
            FMKKHLQHYGYY G     K   +  E +EK + ++ S ES+ +S++       C+ K      L+TTQLIY   E G  V +L+ P + Y LN     QQA RWP ++QV+ ERI HI  +P + E  Y  +  E  P  RGE NG +++F Y+  S  +F KS+      G     +   ESE+D TL FESRFESGNL K  ++   +YEL LR DLYT+KHTQW+YFRVSNTR +  YRFTIVNF K++SLYN+G+KP++YSEK+A L+  GW R G+NI YY+NNL+YE  KGE YYYS+TW   F HD DTVYFSHCYPYTY++L  Y+  ++ DP+KS+IC+ ++L ++LA N+  ++TIT++    E   +KK +++T RVHPGE+N+SWM++G LDF+ S  PDA LLRD FIFK+VPMLNPDGVIVGNYRCSLTGRDLNRNYK+ LKD YP +   K +  KLL + +++ YCD HGHSR+ N+F+YGC      N+   ER FP +L +N  +KF Y SCKFK+QKSK GT R+V  N GI +S+T+EA+FCG+ L         ++ +HFN  D + MG  FC +LLD+ DPD T+ + IL  +K+        K+  +G+ ++
Sbjct:   21 FMKKHLQHYGYYTGRNQNYKHHFKHYEEWEKNYGYTMSSESSEDSDSDTDDDKACDSKL-QEDLLKTTQLIYSCGESGKMVPRLREPRSLYALNKELGPQQAARWPADLQVINERIKHIQTIPTEPEPFYKQTGFEKCPMVRGEANGGKVVFSYEANSS-FFMKSRVGGSRNG-CDQCSISLESENDTTLIFESRFESGNLGKAVQVGERDYELWLRHDLYTNKHTQWFYFRVSNTRADVEYRFTIVNFMKSDSLYNDGMKPVMYSEKEAELNKVGWIRAGNNIKYYKNNLRYEMGKGERYYYSMTWTIQFKHDRDTVYFSHCYPYTYTDLQNYLLDLTNDPIKSRICKQRVLCRTLAGNLVYVITITSASQNPEDMKHKKAVVVTSRVHPGESNSSWMLKGFLDFVTSSSPDAKLLRDSFIFKVVPMLNPDGVIVGNYRCSLTGRDLNRNYKTALKDAYPSVFHTKQMIRKLLLERDVIVYCDLHGHSRRQNVFIYGCEQPHRSNKRFNERIFPSMLNRNTPEKFCYDSCKFKVQKSKEGTGRVVMWNMGIMNSYTMEATFCGSSL-------GKKKGFHFNQRDFEMMGYHFCDTLLDYCDPDMTKCDQILFELKQKHHMMVLAKMAEKGLQVE 646          
BLAST of Cytosolic carboxypeptidase 2 vs. TrEMBL
Match: A0A1S3J969 (cytosolic carboxypeptidase 2 isoform X5 OS=Lingula unguis OX=7574 GN=LOC106171188 PE=4 SV=1)

HSP 1 Score: 608.216 bits (1567), Expect = 0.000e+0
Identity = 321/637 (50.39%), Postives = 425/637 (66.72%), Query Frame = 2
Query:  131 FMKKHLQHYGYYKG-------NKLIMRELEGYEKTHEHSQSDESTSESENAIKCNQKTGTSPSLRTTQLIYDYFEDGSYVRKLKAPHN-YVLNL--QQAPRWPIEMQVLPERIHHITALPQQREFIYIPSNSELKPQPRGEENGRLIFEYKTCSGPYFTKSKTISKEIGNLLPVTA---EFESESDETLCFESRFESGNLEKVYKISPFEYELHLRPDLYTSKHTQWYYFRVSNTRENKMYRFTIVNFYKAESLYNEGLKPLLYSEKDARLSNKGWRRWGSNIAYYRNNLKYE-TKKGENYYYSLTWNCLFPHDNDTVYFSHCYPYTYSNLMKYVETVSKDPVKSKICRIKLLTKSLAENISLLLTITNSFT-----EQERKNYKKIILITGRVHPGETNASWMMEGVLDFLLSDKPDAMLLRDLFIFKIVPMLNPDGVIVGNYRCSLTGRDLNRNYKSKLKDYYPIICSVKNLAEKLLKDHEILFYCDFHGHSRKNNIFMYGCNDQKSENEFLLERAFPYILAKNASDKFDYKSCKFKMQKSKSGTSRIVFRNFGIPHSFTLEASFCGTDLISNTNSNRNEQFYHFNTDDLKKMGEAFCYSLLDFSDPDQTQMNIILDNIKEDLTKRYTNKLETRG 1984
            FM+KHL+HYGYY G       N L  RE   ++KT+ +  S   +S+SE+  +           RTTQL+Y Y + G  V +L+ P   Y +    QQA RWP E++VL E I HI+ +P + E  Y P+ SEL+P  +GE+ G  ++ Y    GP+F KS+     + N L  TA   + +S  D TL FESRFESGNL KVYK+  +EYEL LR DLYT+KHTQW+YFR+SNTR N  YRFTIVNF K +SLYN G+KP +YS+K+A  +  GW R GS I YYRNNLKY   K GE  YYSLTW     + +DT YF+HCYPYTYS+L +Y+  ++ DP+KS+IC+ ++L ++LA N+  +LTIT+  +     + + +  KK +++T RVHPGETNASWMM+G LDFL    PDA LLRD FIFK+VPMLNPDGVIVGNYRCSL+GRDLNRNYK+ LKD +P I   K +  KL  +HEI+ YCD HGHSRK N+F+YGC ++ + ++   ER FP +L+KNASDKF Y+ CKFK+QKSK GT RIV  N GI +S+T+EA+F G+ L          + YHF+T D + MG  FC +LLD+ DPD+T+ + IL  +++ L +    KL+  G
Sbjct:   15 FMRKHLEHYGYYTGRNERYSSNLLTFRE---WDKTYSYDVSSSDSSDSEDEAENKDNLFRDDFTRTTQLVYSY-QAGKMVPRLREPRQLYAMEFGPQQAARWPSEIEVLDELIKHISYVPPEPEEFYRPTGSELRPLAKGEDEGLCVYYYDPQPGPFFMKSRVGG--LRNPLSSTAYAHKPQSPDDTTLVFESRFESGNLFKVYKVGDYEYELWLRNDLYTNKHTQWFYFRLSNTRPNVKYRFTIVNFMKPDSLYNNGMKPCMYSDKNAANNKIGWVRAGSEIKYYRNNLKYNFGKGGERNYYSLTWTWQAQYKDDTCYFAHCYPYTYSDLQEYLMNIANDPIKSRICKQRVLCRTLAGNLVYVLTITSPVSATQGHDSKARKLKKAVVLTSRVHPGETNASWMMKGFLDFLTGTSPDAKLLRDTFIFKVVPMLNPDGVIVGNYRCSLSGRDLNRNYKTILKDSFPSIWHTKAMIRKLKDEHEIVTYCDLHGHSRKMNVFIYGCENKYNPDKRFRERVFPVMLSKNASDKFSYEYCKFKVQKSKEGTGRIVIWNMGIMNSYTMEATFAGSTL-------GKMKGYHFSTADFEAMGYHFCDTLLDYCDPDKTKCDNILLELEDRLKQEVMKKLQKDG 638          
BLAST of Cytosolic carboxypeptidase 2 vs. TrEMBL
Match: A0A2G8K9R7 (Putative cytosolic carboxypeptidase 2-like OS=Stichopus japonicus OX=307972 GN=BSL78_18430 PE=4 SV=1)

HSP 1 Score: 605.905 bits (1561), Expect = 0.000e+0
Identity = 305/609 (50.08%), Postives = 403/609 (66.17%), Query Frame = 2
Query:  194 LEGYEKTHEHSQSDESTSESE------NAIKCNQKTG-TSPSLRTTQLIYDYFEDGSYVRKLKAPHN-YVLN----LQQAPRWPIEMQVLPERIHHITALPQQREFIYIPSNSELKPQPRGEENGRLIFEYKTCSGPYFTKSKTISKEIGNLLPVTAEFESESDETLCFESRFESGNLEKVYKISPFEYELHLRPDLYTSKHTQWYYFRVSNTRENKMYRFTIVNFYKAESLYNEGLKPLLYSEKDARLSNKGWRRWGSNIAYYRNNLKYETKKGENYYYSLTWNCLFPHDNDTVYFSHCYPYTYSNLMKYVETVSKDPVKSKICRIKLLTKSLAENISLLLTITNSFTEQERKNYKKIILITGRVHPGETNASWMMEGVLDFLLSDKPDAMLLRDLFIFKIVPMLNPDGVIVGNYRCSLTGRDLNRNYKSKLKDYYPIICSVKNLAEKLLKDHEILFYCDFHGHSRKNNIFMYGCNDQKSENEFLLERAFPYILAKNASDKFDYKSCKFKMQKSKSGTSRIVFRNFGIPHSFTLEASFCGTDLISNTNSNRNEQFYHFNTDDLKKMGEAFCYSLLDFSDPDQTQMNIILDNIKEDLTKRYTNKLETRG 1984
            L  +E++   S SD   S++E      N  K +     T    RTTQL++ +   G  V KLK P N Y L+     QQAPRWP +M+VLPE +  I+ +P++RE  Y P+  E  P    E +GR ++        YF +S+      G  LP + + +   D TL FESRFESGNL KV + S FEY++ LR DLYT KHTQW+YFRV N R+N  YRFTI NF K  SLYN G+KPL+YS+ +A+    GWRR G  I YY+N+++    KG+  YYSLTW C FPHD DT YF+HCYPYTYS+L +Y+  +S DPV+SK C+ ++L +SLA N+  +LTIT++    E    KK +++T RVHPGETNASWMM+G LD+L SD  DA LLRD F+FKIVPMLNPDGVIVGNYRCSL GRDLNRNY+S LKD +P + + K++ +KLL++ E+  YCD HGHSRK N+FMYGC ++KS+ + L ER FP IL KNA++KF   +CK+K+QK+K GT R+V    GI +S+T+EA+FCG+ L        + +FYHF T D + MG  FC SLLD+ DPDQT+ ++I   ++E L +   N LE  G
Sbjct:   22 LADWERSRSFSLSDHIVSDTEYENQALNETKLDDDNRFTDGHKRTTQLVFSH-SAGKLVPKLKEPRNLYALSKEAGPQQAPRWPADMEVLPEPVQQISYIPKEREPFYQPTGFEKMPMTLAEGDGRTVYYNPASKDAYFLRSRVGGSRKG-CLPRSWKTKGPEDTTLIFESRFESGNLMKVTQRSEFEYDIQLRYDLYTEKHTQWFYFRVQNMRKNIKYRFTITNFMKPGSLYNCGMKPLMYSDTEAKTKKIGWRRLGDEIKYYKNDMRRTDVKGDRSYYSLTWICQFPHDGDTCYFAHCYPYTYSDLQEYLLRLSNDPVRSKYCKQRVLCRSLAGNLIYILTITSAARNPEDAKRKKAVVLTARVHPGETNASWMMKGFLDYLTSDSIDAKLLRDTFVFKIVPMLNPDGVIVGNYRCSLAGRDLNRNYRSVLKDSFPSVSNTKSMIKKLLEEREVAVYCDLHGHSRKQNVFMYGCENKKSKKDRLKERIFPIILGKNAAEKFSVSNCKYKVQKNKEGTGRVVMWQMGIMNSYTMEATFCGSTL-------GDCRFYHFRTVDYEAMGYHFCDSLLDYCDPDQTKSDLIYKELEEKLREDILNHLERMG 621          
BLAST of Cytosolic carboxypeptidase 2 vs. TrEMBL
Match: K1QKD8 (Cytosolic carboxypeptidase 2 OS=Crassostrea gigas OX=29159 GN=CGI_10002647 PE=4 SV=1)

HSP 1 Score: 605.52 bits (1560), Expect = 0.000e+0
Identity = 298/565 (52.74%), Postives = 390/565 (69.03%), Query Frame = 2
Query:  299 LRTTQLIYDYFEDGSYVRKLKAPHNYV-----LNLQQAPRWPIEMQVLPERIHHITALPQQREFIYIPSNSELKPQPRGEENG-RLIFEYKTCSGPYFTKSKTISKEIGNLLPVTAEFESESDETLCFESRFESGNLEKVYKISPFEYELHLRPDLYTSKHTQWYYFRVSNTRENKMYRFTIVNFYKAESLYNEGLKPLLYSEKDARLSNKGWRRWGSNIAYYRNNLKYETKKGENYYYSLTWNCLFPHDNDTVYFSHCYPYTYSNLMKYVETVSKDPVKSKICRIKLLTKSLAENISLLLTITNSFTEQERKNYKKIILITGRVHPGETNASWMMEGVLDFLLSDKPDAMLLRDLFIFKIVPMLNPDGVIVGNYRCSLTGRDLNRNYKSKLKDYYPIICSVKNLAEKLLKDHEILFYCDFHGHSRKNNIFMYGCNDQKSENEFLLERAFPYILAKNASDKFDYKSCKFKMQKSKSGTSRIVFRNFGIPHSFTLEASFCGTDLISNTNSNRNEQFYHFNTDDLKKMGEAFCYSLLDFSDPDQTQMNIILDNIKEDLTKRYTNKLE 1975
            LRTTQL+Y Y +    V KL+ P N       L  QQA RWP ++QVL E++ HI  +P   E  Y P+  E  P  RGEENG RL++ Y+  S  +F +S+      G       E +SE D+TL FESRFESGNL K  +++  +YEL LR DLYT+KHTQW+YFRVSNTR NK YRFTIVNF K++SLYN+G+KPL+YSEK+A+    GW R GS+I YY+NNL+Y T K +  +YSLTW     H++DTVYF+HC+PYTY++L  Y+  +S DPVK+KIC+ ++L ++LA N+  LL+IT+     E   +KK ++IT RVHPGE N+SWMM+G LD+L  +  DA LLRD FIFKIVPMLNPDGVIVGNYRCSL GRDLNRNYK+ LKD YP +   KN+  KLL++ EI+ YCD HGHSRK N+F+YGC ++ +  + L ER FP +L KNA DKF ++SCKFK+QKSK GT RIV  N GI +S+T+EA+FCG+ +         ++ YHF+  D + +G  FC +LLD+ DPD T+   IL  I+E L +    KL+
Sbjct:  209 LRTTQLVYSYKDGKGMVPKLREPRNLYALAKELGPQQAARWPADIQVLDEKVKHIRYIPPDPELFYKPTGCEKTPMVRGEENGGRLVYMYEPRST-FFVRSRVGGLRSGPQ-KCNIELQSEEDDTLIFESRFESGNLAKAVQVNSTDYELWLRYDLYTNKHTQWFYFRVSNTRANKTYRFTIVNFMKSDSLYNDGMKPLIYSEKNAQQKKVGWVRGGSDIKYYKNNLRYSTSKSDKSFYSLTWTVKLEHNHDTVYFAHCFPYTYTDLQDYLLDLSNDPVKNKICKQRVLCRTLAGNLVYLLSITSPTQNSEDMKHKKAVVITSRVHPGECNSSWMMKGFLDYLTGNSADAKLLRDTFIFKIVPMLNPDGVIVGNYRCSLAGRDLNRNYKTVLKDSYPSVWHTKNMIRKLLQEREIIVYCDLHGHSRKQNVFIYGCENRHNPEKRLKERVFPLMLNKNAPDKFKFESCKFKVQKSKEGTGRIVMWNMGIMNSYTMEATFCGSTM-------GKKKGYHFSMADFEALGYHFCDTLLDYCDPDNTKSCNILLEIEERLKREIMVKLQ 764          
BLAST of Cytosolic carboxypeptidase 2 vs. TrEMBL
Match: A0A3M7R2N7 (Cytosolic carboxypeptidase 2 OS=Brachionus plicatilis OX=10195 GN=BpHYR1_002190 PE=4 SV=1)

HSP 1 Score: 599.356 bits (1544), Expect = 0.000e+0
Identity = 303/637 (47.57%), Postives = 421/637 (66.09%), Query Frame = 2
Query:  131 FMKKHLQHYGYYKGNKLIMRELEGYE-------------KTHEHSQSDESTSESENAIKCNQKTGTSPSLRTTQLIYDYFEDGSYVRKLKAPHNYVLNLQQAPRWPIEMQVLPERIHHITALPQQREFIYIPSNSELKPQPRGEENGRLIFEYKTCSGPYFTKSKTISKEIGNLLPVTAEF-ESESDETLCFESRFESGNLEKVYKISPFEYELHLRPDLYTSKHTQWYYFRVSNTRENKMYRFTIVNFYKAESLYNEGLKPLLYSEKDARLSNKGWRRWGSNIAYYRNNLKYETKKGE-NYYYSLTWNCLFPHDNDTVYFSHCYPYTYSNLMKYVETVSKDPVKSKICRIKLLTKSLAENISLLLTITNSFTEQERKNYKKIILITGRVHPGETNASWMMEGVLDFLLSDKPDAMLLRDLFIFKIVPMLNPDGVIVGNYRCSLTGRDLNRNYKSKLKDYYPIICSVKNLAEKLLKDHEILFYCDFHGHSRKNNIFMYGCNDQKSENEFLLERAFPYILAKNASDKFDYKSCKFKMQKSKSGTSRIVFRNFGIPHSFTLEASFCGTDLISNTNSNRNEQFYHFNTDDLKKMGEAFCYSLLDFSDPDQTQMNIILDNIKEDLTKRYTNKLETRGINID 1996
            FMKKHL+HYGY+ G  + +    GYE                     + ++++ +N I  N K       + ++    + +D  Y    +      +  Q+ PRWP EMQV+ E+IHHI A+ ++ E  Y  + +E  P  + ++  + +F Y   +  YF +S+ +     +   +T +  E E   TL FESRFESGNL K  KI+ FEYEL LR DLYT+KHTQW+YF++ N + N  YRFTI N  K +SLYN G+KPL+YSE DA+  N GWRRWG++I YY+NN + E + G     YSLTW C FP++NDT YF+HCYPYTY+NL +Y+  + +DPVK+K C++K+L ++LAEN+  LLTITN  + +E  N K+ I++T RVHPGETN+SWMM+G LDFLLS+ PDA LLRD FIFKIVPMLNPDGVI+GNYRCSLTGRDLNRNYK+ LK+ +P I   + + +KL ++ ++L YCD HGHSRKNN+F+YGC++  +  +   E  FP I++KNA D F YKSCKFK+QKSK GT RIV  N GI +SFT+EA+F G+ L   +        YHF++ DL+++   FC S+LD+ DPDQT+  +I++ I+  L ++  +KLE++GIN+D
Sbjct:   18 FMKKHLEHYGYFTGRNMAITRF-GYEPKRNPKNLNSDDSDFESDDSENSTSNKIKNKIDWNNKGS-----KKSENYKWWLKDNIYNFGQRE-----IEYQREPRWPFEMQVMSEKIHHIDAVFEEPEPFYNKTGNEEMPIYKNDQKFKSVFYYNPLNCGYFIRSR-VGGSRDSCPRLTCDLSEIELSHTLLFESRFESGNLMKAVKINEFEYELTLRCDLYTNKHTQWFYFQIKNAKPNVNYRFTITNLMKTDSLYNMGMKPLMYSELDAKNKNIGWRRWGTSIRYYKNNQRSEDQDGNLKNLYSLTWVCKFPNENDTYYFAHCYPYTYTNLQEYIADIQQDPVKNKYCKVKILCRTLAENLVHLLTITNPSSSEEEANSKRAIVLTARVHPGETNSSWMMKGFLDFLLSNSPDAKLLRDTFIFKIVPMLNPDGVIIGNYRCSLTGRDLNRNYKTVLKEAFPSIWHTREMIKKLTQERQVLLYCDLHGHSRKNNVFIYGCHNNNNPKKRFQEHIFPMIMSKNAKDLFSYKSCKFKIQKSKQGTGRIVMWNLGIMNSFTMEATFNGSTLNQKSG-------YHFSSKDLEQLAYHFCDSILDYCDPDQTKCKLIMNEIEALLREQIRSKLESQGINVD 635          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Cavefish
Match: agbl2 (cytosolic carboxypeptidase 2 [Source:NCBI gene;Acc:103041446])

HSP 1 Score: 545.043 bits (1403), Expect = 3.201e-179
Identity = 284/639 (44.44%), Postives = 394/639 (61.66%), Query Frame = 2
Query:  140 KHLQHYGYYKGNKL-------IMRELEGYEKT------HEHSQSDESTSESENAIKCNQKTGTSPSLRTTQLIYDYFEDGSYVRKLKAPHN-YVLNLQQAP----RWPIEMQVLPERIHHITALPQQREFIYIPSNSELKPQPRGEENGRLIFEYKTCS-GPYFTKSKTISKEIGNLLPVTAEFESESDETLCFESRFESGNLEKVYKISPFEYELHLRPDLYTSKHTQWYYFRVSNTRENKMYRFTIVNFYKAESLYNEGLKPLLYSEKDARLSNKGWRRWGSNIAYYRNNLKYETKKGENYYYSLTWNCLFPHDNDTVYFSHCYPYTYSNLMKYVETVSKDPVKSKICRIKLLTKSLAENISLLLTITN-SFTEQERKNYKKIILITGRVHPGETNASWMMEGVLDFLLSDKPDAMLLRDLFIFKIVPMLNPDGVIVGNYRCSLTGRDLNRNYKSKLKDYYPIICSVKNLAEKLLKDHEILFYCDFHGHSRKNNIFMYGCNDQKSENEFLLERAFPYILAKNASDKFDYKSCKFKMQKSKSGTSRIVFRNFGIPHSFTLEASFCGTDLISNTNSNRNEQFYHFNTDDLKKMGEAFCYSLLDFSDPDQTQMNIILDNIKEDLTKRYTNKLETRGINID 1996
            +HL+HYG + G +        + R  +G   +      H  S S +   E   A +          LRT QL+ D F+ G  + +LK P + + +    +P    RWP+E +V+ ++I HI   P + E  Y  +  E  P P G+E G  ++   + +  PYFT+S+            +     E+  +L FESRFESGNL+K  ++  ++YEL LR D+YT+KHTQW+YFRV N +    YRFTI+N  K+ SLY  G++PLLYSE  A L  +GW R GSNI YYRN  + E        YSLTW   FP++NDT Y +HCYPYTYS+L  Y+  V  D V++  C++++L +SLA N   +LTIT    T +ER+N K+ +++T RVHPGETN SWMM+G LDFLL D  DA LLR+ F+FK+VPMLNPDGV+VGNYRCSL G DLNRNY++ L+D +P +   +N+ +KL+ + E++ YCDFHGHSRKNN+FMYGCND K  +  L ER FP +++KNA DKF ++SCKF+MQ+SK GT RIV    GI +S+T+E++F G+ L S   +       HF+  DLK MG  FC +LLDF DPDQT+    L  ++  L ++   KL   G ++D
Sbjct:   15 QHLKHYGLFAGQRSSSQRKVSVGRTWDGTHNSLATDGIHSPSNSTDLEEEESEAHQGQFSFNAEKYLRTKQLLID-FQGGRPIPRLKEPLDLFTIPSTSSPFQGVRWPVECKVICDKIRHIEWDPPEPEPFYQQTGFERTPMPAGKERGNTVYCIDSAAEAPYFTRSRVGGGREPKRNSASCTNNQET-SSLSFESRFESGNLQKAVQVGLYDYELTLRHDMYTTKHTQWFYFRVRNMKAGVTYRFTIINLMKSSSLYEAGMRPLLYSELAAWLKGEGWCRDGSNIRYYRNLCENEG----TALYSLTWTMQFPYENDTCYLAHCYPYTYSDLQHYLRGVISDSVRAAYCKVRVLCRSLAGNAVYVLTITAPGATWKERRN-KQAVVVTARVHPGETNGSWMMQGFLDFLLGDSLDARLLRETFVFKVVPMLNPDGVVVGNYRCSLAGCDLNRNYRTLLRDSFPCVWYTRNMVKKLVAEREVVLYCDFHGHSRKNNVFMYGCNDHKDASLQLQERIFPLMMSKNAQDKFSFRSCKFRMQRSKEGTGRIVMWRLGIRNSYTMESTFGGSTLGSRKGT-------HFSMGDLKSMGYHFCDTLLDFCDPDQTKAEHCLAELEALLRQQIRQKL---GRDVD 636          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Cavefish
Match: agbl2 (cytosolic carboxypeptidase 2 [Source:NCBI gene;Acc:103041446])

HSP 1 Score: 545.043 bits (1403), Expect = 7.183e-179
Identity = 284/639 (44.44%), Postives = 394/639 (61.66%), Query Frame = 2
Query:  140 KHLQHYGYYKGNKL-------IMRELEGYEKT------HEHSQSDESTSESENAIKCNQKTGTSPSLRTTQLIYDYFEDGSYVRKLKAPHN-YVLNLQQAP----RWPIEMQVLPERIHHITALPQQREFIYIPSNSELKPQPRGEENGRLIFEYKTCS-GPYFTKSKTISKEIGNLLPVTAEFESESDETLCFESRFESGNLEKVYKISPFEYELHLRPDLYTSKHTQWYYFRVSNTRENKMYRFTIVNFYKAESLYNEGLKPLLYSEKDARLSNKGWRRWGSNIAYYRNNLKYETKKGENYYYSLTWNCLFPHDNDTVYFSHCYPYTYSNLMKYVETVSKDPVKSKICRIKLLTKSLAENISLLLTITN-SFTEQERKNYKKIILITGRVHPGETNASWMMEGVLDFLLSDKPDAMLLRDLFIFKIVPMLNPDGVIVGNYRCSLTGRDLNRNYKSKLKDYYPIICSVKNLAEKLLKDHEILFYCDFHGHSRKNNIFMYGCNDQKSENEFLLERAFPYILAKNASDKFDYKSCKFKMQKSKSGTSRIVFRNFGIPHSFTLEASFCGTDLISNTNSNRNEQFYHFNTDDLKKMGEAFCYSLLDFSDPDQTQMNIILDNIKEDLTKRYTNKLETRGINID 1996
            +HL+HYG + G +        + R  +G   +      H  S S +   E   A +          LRT QL+ D F+ G  + +LK P + + +    +P    RWP+E +V+ ++I HI   P + E  Y  +  E  P P G+E G  ++   + +  PYFT+S+            +     E+  +L FESRFESGNL+K  ++  ++YEL LR D+YT+KHTQW+YFRV N +    YRFTI+N  K+ SLY  G++PLLYSE  A L  +GW R GSNI YYRN  + E        YSLTW   FP++NDT Y +HCYPYTYS+L  Y+  V  D V++  C++++L +SLA N   +LTIT    T +ER+N K+ +++T RVHPGETN SWMM+G LDFLL D  DA LLR+ F+FK+VPMLNPDGV+VGNYRCSL G DLNRNY++ L+D +P +   +N+ +KL+ + E++ YCDFHGHSRKNN+FMYGCND K  +  L ER FP +++KNA DKF ++SCKF+MQ+SK GT RIV    GI +S+T+E++F G+ L S   +       HF+  DLK MG  FC +LLDF DPDQT+    L  ++  L ++   KL   G ++D
Sbjct:   15 QHLKHYGLFAGQRSSSQRKVSVGRTWDGTHNSLATDGIHSPSNSTDLEEEESEAHQGQFSFNAEKYLRTKQLLID-FQGGRPIPRLKEPLDLFTIPSTSSPFQGVRWPVECKVICDKIRHIEWDPPEPEPFYQQTGFERTPMPAGKERGNTVYCIDSAAEAPYFTRSRVGGGREPKRNSASCTNNQET-SSLSFESRFESGNLQKAVQVGLYDYELTLRHDMYTTKHTQWFYFRVRNMKAGVTYRFTIINLMKSSSLYEAGMRPLLYSELAAWLKGEGWCRDGSNIRYYRNLCENEGTA----LYSLTWTMQFPYENDTCYLAHCYPYTYSDLQHYLRGVISDSVRAAYCKVRVLCRSLAGNAVYVLTITAPGATWKERRN-KQAVVVTARVHPGETNGSWMMQGFLDFLLGDSLDARLLRETFVFKVVPMLNPDGVVVGNYRCSLAGCDLNRNYRTLLRDSFPCVWYTRNMVKKLVAEREVVLYCDFHGHSRKNNVFMYGCNDHKDASLQLQERIFPLMMSKNAQDKFSFRSCKFRMQRSKEGTGRIVMWRLGIRNSYTMESTFGGSTLGSRKGT-------HFSMGDLKSMGYHFCDTLLDFCDPDQTKAEHCLAELEALLRQQIRQKL---GRDVD 636          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Cavefish
Match: agbl2 (cytosolic carboxypeptidase 2 [Source:NCBI gene;Acc:103041446])

HSP 1 Score: 535.028 bits (1377), Expect = 1.409e-178
Identity = 271/573 (47.29%), Postives = 372/573 (64.92%), Query Frame = 2
Query:  299 LRTTQLIYDYFEDGSYVRKLKAPHN-YVLNLQQAP----RWPIEMQVLPERIHHITALPQQREFIYIPSNSELKPQPRGEENGRLIFEYKTCS-GPYFTKSKTISKEIGNLLPVTAEFESESDETLCFESRFESGNLEKVYKISPFEYELHLRPDLYTSKHTQWYYFRVSNTRENKMYRFTIVNFYKAESLYNEGLKPLLYSEKDARLSNKGWRRWGSNIAYYRNNLKYETKKGENYYYSLTWNCLFPHDNDTVYFSHCYPYTYSNLMKYVETVSKDPVKSKICRIKLLTKSLAENISLLLTITN-SFTEQERKNYKKIILITGRVHPGETNASWMMEGVLDFLLSDKPDAMLLRDLFIFKIVPMLNPDGVIVGNYRCSLTGRDLNRNYKSKLKDYYPIICSVKNLAEKLLKDHEILFYCDFHGHSRKNNIFMYGCNDQKSENEFLLERAFPYILAKNASDKFDYKSCKFKMQKSKSGTSRIVFRNFGIPHSFTLEASFCGTDLISNTNSNRNEQFYHFNTDDLKKMGEAFCYSLLDFSDPDQTQMNIILDNIKEDLTKRYTNKLETRGINID 1996
            LRT QL+ D F+ G  + +LK P + + +    +P    RWP+E +V+ ++I HI   P + E  Y  +  E  P P G+E G  ++   + +  PYFT+S+            +     E+  +L FESRFESGNL+K  ++  ++YEL LR D+YT+KHTQW+YFRV N +    YRFTI+N  K+ SLY  G++PLLYSE  A L  +GW R GSNI YYRN  + E        YSLTW   FP++NDT Y +HCYPYTYS+L  Y+  V  D V++  C++++L +SLA N   +LTIT    T +ER+N K+ +++T RVHPGETN SWMM+G LDFLL D  DA LLR+ F+FK+VPMLNPDGV+VGNYRCSL G DLNRNY++ L+D +P +   +N+ +KL+ + E++ YCDFHGHSRKNN+FMYGCND K  +  L ER FP +++KNA DKF ++SCKF+MQ+SK GT RIV    GI +S+T+E++F G+ L S   +       HF+  DLK MG  FC +LLDF DPDQT+    L  ++  L ++   KL   G ++D
Sbjct:   74 LRTKQLLID-FQGGRPIPRLKEPLDLFTIPSTSSPFQGVRWPVECKVICDKIRHIEWDPPEPEPFYQQTGFERTPMPAGKERGNTVYCIDSAAEAPYFTRSRVGGGREPKRNSASCTNNQET-SSLSFESRFESGNLQKAVQVGLYDYELTLRHDMYTTKHTQWFYFRVRNMKAGVTYRFTIINLMKSSSLYEAGMRPLLYSELAAWLKGEGWCRDGSNIRYYRNLCENEGTA----LYSLTWTMQFPYENDTCYLAHCYPYTYSDLQHYLRGVISDSVRAAYCKVRVLCRSLAGNAVYVLTITAPGATWKERRN-KQAVVVTARVHPGETNGSWMMQGFLDFLLGDSLDARLLRETFVFKVVPMLNPDGVVVGNYRCSLAGCDLNRNYRTLLRDSFPCVWYTRNMVKKLVAEREVVLYCDFHGHSRKNNVFMYGCNDHKDASLQLQERIFPLMMSKNAQDKFSFRSCKFRMQRSKEGTGRIVMWRLGIRNSYTMESTFGGSTLGSRKGT-------HFSMGDLKSMGYHFCDTLLDFCDPDQTKAEHCLAELEALLRQQIRQKL---GRDVD 629          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Cavefish
Match: agbl2 (cytosolic carboxypeptidase 2 [Source:NCBI gene;Acc:103041446])

HSP 1 Score: 545.043 bits (1403), Expect = 1.510e-178
Identity = 284/639 (44.44%), Postives = 394/639 (61.66%), Query Frame = 2
Query:  140 KHLQHYGYYKGNKL-------IMRELEGYEKT------HEHSQSDESTSESENAIKCNQKTGTSPSLRTTQLIYDYFEDGSYVRKLKAPHN-YVLNLQQAP----RWPIEMQVLPERIHHITALPQQREFIYIPSNSELKPQPRGEENGRLIFEYKTCS-GPYFTKSKTISKEIGNLLPVTAEFESESDETLCFESRFESGNLEKVYKISPFEYELHLRPDLYTSKHTQWYYFRVSNTRENKMYRFTIVNFYKAESLYNEGLKPLLYSEKDARLSNKGWRRWGSNIAYYRNNLKYETKKGENYYYSLTWNCLFPHDNDTVYFSHCYPYTYSNLMKYVETVSKDPVKSKICRIKLLTKSLAENISLLLTITN-SFTEQERKNYKKIILITGRVHPGETNASWMMEGVLDFLLSDKPDAMLLRDLFIFKIVPMLNPDGVIVGNYRCSLTGRDLNRNYKSKLKDYYPIICSVKNLAEKLLKDHEILFYCDFHGHSRKNNIFMYGCNDQKSENEFLLERAFPYILAKNASDKFDYKSCKFKMQKSKSGTSRIVFRNFGIPHSFTLEASFCGTDLISNTNSNRNEQFYHFNTDDLKKMGEAFCYSLLDFSDPDQTQMNIILDNIKEDLTKRYTNKLETRGINID 1996
            +HL+HYG + G +        + R  +G   +      H  S S +   E   A +          LRT QL+ D F+ G  + +LK P + + +    +P    RWP+E +V+ ++I HI   P + E  Y  +  E  P P G+E G  ++   + +  PYFT+S+            +     E+  +L FESRFESGNL+K  ++  ++YEL LR D+YT+KHTQW+YFRV N +    YRFTI+N  K+ SLY  G++PLLYSE  A L  +GW R GSNI YYRN  + E        YSLTW   FP++NDT Y +HCYPYTYS+L  Y+  V  D V++  C++++L +SLA N   +LTIT    T +ER+N K+ +++T RVHPGETN SWMM+G LDFLL D  DA LLR+ F+FK+VPMLNPDGV+VGNYRCSL G DLNRNY++ L+D +P +   +N+ +KL+ + E++ YCDFHGHSRKNN+FMYGCND K  +  L ER FP +++KNA DKF ++SCKF+MQ+SK GT RIV    GI +S+T+E++F G+ L S   +       HF+  DLK MG  FC +LLDF DPDQT+    L  ++  L ++   KL   G ++D
Sbjct:   15 QHLKHYGLFAGQRSSSQRKVSVGRTWDGTHNSLATDGIHSPSNSTDLEEEESEAHQGQFSFNAEKYLRTKQLLID-FQGGRPIPRLKEPLDLFTIPSTSSPFQGVRWPVECKVICDKIRHIEWDPPEPEPFYQQTGFERTPMPAGKERGNTVYCIDSAAEAPYFTRSRVGGGREPKRNSASCTNNQET-SSLSFESRFESGNLQKAVQVGLYDYELTLRHDMYTTKHTQWFYFRVRNMKAGVTYRFTIINLMKSSSLYEAGMRPLLYSELAAWLKGEGWCRDGSNIRYYRNLCENEGTA----LYSLTWTMQFPYENDTCYLAHCYPYTYSDLQHYLRGVISDSVRAAYCKVRVLCRSLAGNAVYVLTITAPGATWKERRN-KQAVVVTARVHPGETNGSWMMQGFLDFLLGDSLDARLLRETFVFKVVPMLNPDGVVVGNYRCSLAGCDLNRNYRTLLRDSFPCVWYTRNMVKKLVAEREVVLYCDFHGHSRKNNVFMYGCNDHKDASLQLQERIFPLMMSKNAQDKFSFRSCKFRMQRSKEGTGRIVMWRLGIRNSYTMESTFGGSTLGSRKGT-------HFSMGDLKSMGYHFCDTLLDFCDPDQTKAEHCLAELEALLRQQIRQKL---GRDVD 636          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Cavefish
Match: agbl2 (cytosolic carboxypeptidase 2 [Source:NCBI gene;Acc:103041446])

HSP 1 Score: 545.428 bits (1404), Expect = 3.566e-178
Identity = 284/639 (44.44%), Postives = 394/639 (61.66%), Query Frame = 2
Query:  140 KHLQHYGYYKGNKL-------IMRELEGY------EKTHEHSQSDESTSESENAIKCNQKTGTSPSLRTTQLIYDYFEDGSYVRKLKAPHN-YVLNLQQAP----RWPIEMQVLPERIHHITALPQQREFIYIPSNSELKPQPRGEENGRLIFEYKTCS-GPYFTKSKTISKEIGNLLPVTAEFESESDETLCFESRFESGNLEKVYKISPFEYELHLRPDLYTSKHTQWYYFRVSNTRENKMYRFTIVNFYKAESLYNEGLKPLLYSEKDARLSNKGWRRWGSNIAYYRNNLKYETKKGENYYYSLTWNCLFPHDNDTVYFSHCYPYTYSNLMKYVETVSKDPVKSKICRIKLLTKSLAENISLLLTITN-SFTEQERKNYKKIILITGRVHPGETNASWMMEGVLDFLLSDKPDAMLLRDLFIFKIVPMLNPDGVIVGNYRCSLTGRDLNRNYKSKLKDYYPIICSVKNLAEKLLKDHEILFYCDFHGHSRKNNIFMYGCNDQKSENEFLLERAFPYILAKNASDKFDYKSCKFKMQKSKSGTSRIVFRNFGIPHSFTLEASFCGTDLISNTNSNRNEQFYHFNTDDLKKMGEAFCYSLLDFSDPDQTQMNIILDNIKEDLTKRYTNKLETRGINID 1996
            +HL+HYG + G +        + R  +G       +  H  S S +   E   A +          LRT QL+ D F+ G  + +LK P + + +    +P    RWP+E +V+ ++I HI   P + E  Y  +  E  P P G+E G  ++   + +  PYFT+S+            +     E+  +L FESRFESGNL+K  ++  ++YEL LR D+YT+KHTQW+YFRV N +    YRFTI+N  K+ SLY  G++PLLYSE  A L  +GW R GSNI YYRN  + E        YSLTW   FP++NDT Y +HCYPYTYS+L  Y+  V  D V++  C++++L +SLA N   +LTIT    T +ER+N K+ +++T RVHPGETN SWMM+G LDFLL D  DA LLR+ F+FK+VPMLNPDGV+VGNYRCSL G DLNRNY++ L+D +P +   +N+ +KL+ + E++ YCDFHGHSRKNN+FMYGCND K  +  L ER FP +++KNA DKF ++SCKF+MQ+SK GT RIV    GI +S+T+E++F G+ L S   +       HF+  DLK MG  FC +LLDF DPDQT+    L  ++  L ++   KL   G ++D
Sbjct:   15 QHLKHYGLFAGQRSSSQRKVSVGRTWDGTHNSLATDGIHSPSNSTDLEEEESEAHQGQFSFNAEKYLRTKQLLID-FQGGRPIPRLKEPLDLFTIPSTSSPFQGVRWPVECKVICDKIRHIEWDPPEPEPFYQQTGFERTPMPAGKERGNTVYCIDSAAEAPYFTRSRVGGGREPKRNSASCTNNQET-SSLSFESRFESGNLQKAVQVGLYDYELTLRHDMYTTKHTQWFYFRVRNMKAGVTYRFTIINLMKSSSLYEAGMRPLLYSELAAWLKGEGWCRDGSNIRYYRNLCENEG----TALYSLTWTMQFPYENDTCYLAHCYPYTYSDLQHYLRGVISDSVRAAYCKVRVLCRSLAGNAVYVLTITAPGATWKERRN-KQAVVVTARVHPGETNGSWMMQGFLDFLLGDSLDARLLRETFVFKVVPMLNPDGVVVGNYRCSLAGCDLNRNYRTLLRDSFPCVWYTRNMVKKLVAEREVVLYCDFHGHSRKNNVFMYGCNDHKDASLQLQERIFPLMMSKNAQDKFSFRSCKFRMQRSKEGTGRIVMWRLGIRNSYTMESTFGGSTLGSRKGT-------HFSMGDLKSMGYHFCDTLLDFCDPDQTKAEHCLAELEALLRQQIRQKL---GRDVD 636          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Sea Lamprey
Match: agtpbp1 (ATP/GTP binding protein 1 [Source:NCBI gene;Acc:554164])

HSP 1 Score: 306.99 bits (785), Expect = 1.612e-88
Identity = 173/441 (39.23%), Postives = 259/441 (58.73%), Query Frame = 2
Query:  638 SESDETLCFESRFESGNLEKVYKISPFEYELHLRPDLYTSKHTQWYYFRVSNTRENKMYRFTIVNFYKAESLYNEGLKPLLYSEKDARLSNKGWRRWGSNIAYYRNNLKYET-----KKGENYYYSLTWNCLFPHDNDTVYFSHCYPYTYSNLMKYVETVSKDPVKSKI-CRIKLLTKSLAENISLLLTITNS-----FTEQERKNYKKIILITGRVHPGETNASWMMEGVLDFLLSDKPDAMLLRDLFIFKIVPMLNPDGVIVGNYRCSLTGRDLNRNYKSKLKDYYPIICSVKNLAEKLLK-DHEILFYCDFHGHSRKNNIFMYGCNDQK------------SENEFLLERAFPYILAKNASDKFDYKSCKFKMQKSKSGTSR-IVFRNFGIPHSFTLEASFCGTDLISNTNSNRNEQFYHFNTDDLKKMGEAFCYSLL 1885
            SE  + L F S FESGNL K   I  +EY+L L  D+ +++H QW+YF VS       YRF IVN  K  S +N G++P++YS ++A      W R G++I YY+N+    +     ++G++YY +LT+   F H +D  YF++ +PYTY++LM +++ +     + +I  + + L +S+  N   ++TIT +     + +  R   +  I +T RVHPGE+N+SW+M+G L+FL+SD P A  LR+ +IFKIVPMLN DGVI G+YRCSL G DLNR + S   + +P I   K L + L    H  L YCD+HGHSRK N+F+YGC+ ++            S  E L  R  P IL + A   F   SC F ++KSK+ T+R +V+R+ G+  S+T+E+++CG D      S    Q       +L++MG  FC +LL
Sbjct:  674 SEDGDCLKFCSEFESGNLRKAIHIRRYEYDLILDSDINSNRHHQWFYFEVSGMESGVPYRFNIVNCEKVNSQFNYGMQPVMYSVREAMAGRPHWVRAGTDICYYKNSFSRSSAAAGGQRGKSYY-TLTFTVTFFHKDDACYFAYHFPYTYTSLMAHLQGLGAACDQRQIYFKQQTLCQSMGGNGCPVVTITAAPQSTGWQDIYRLRNRPYIFLTSRVHPGESNSSWVMKGSLEFLMSDDPLAQSLRESYIFKIVPMLNADGVINGSYRCSLGGEDLNRQWSSPDPELHPTIFHTKGLLQYLASIAHTPLVYCDYHGHSRKKNVFLYGCSMKETIWQTAAEAKASSVYEDLSYRTLPRILHQIAP-AFCLSSCNFVVEKSKASTARVVVWRDIGVLRSYTMESTYCGCDQGIYKGSQMGSQ-------ELEEMGAKFCVALL 1105          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Nematostella
Match: EDO49270 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH06])

HSP 1 Score: 523.472 bits (1347), Expect = 5.114e-177
Identity = 248/467 (53.10%), Postives = 329/467 (70.45%), Query Frame = 2
Query:  632 FESESDETLCFESRFESGNLEKVYKISPFEYELHLRPDLYTSKHTQWYYFRVSNTRENKMYRFTIVNFYKAESLYNEGLKPLLYSEKDARLSNKGWRRWGSNIAYYRNNLKYETKKGENYYYSLTWNCLFPHDNDTVYFSHCYPYTYSNLMKYVETVSKDPVKSKICRIKLLTKSLAENISLLLTITNSFTEQERKNYKKIILITGRVHPGETNASWMMEGVLDFLLSDKPDAMLLRDLFIFKIVPMLNPDGVIVGNYRCSLTGRDLNRNYKSKLKDYYPIICSVKNLAEKLLKDHEILFYCDFHGHSRKNNIFMYGCNDQKSENEFLLERAFPYILAKNASDKFDYKSCKFKMQKSKSGTSRIVFRNFGIPHSFTLEASFCGTDLISNTNSNRNEQFYHFNTDDLKKMGEAFCYSLLDFSDPDQTQMNIILDNIKEDLTKRYTNKLETRG----------INIDGN 2002
             +S  D TL FESRFESGNL++  K   +EY+L +R DLYTSKHTQW+YFRV NTR    Y+FTI+NF K+ SLYN+G++PL YSE +A  +  GW R GSN+ YY+  ++ +    + YYY+LTW C F + NDT YF+HCYPYTYS+L +Y++ +  DPVKS+IC+ ++L ++LA N   +LT+TN          K+ +++T RVHPGETN+SWMM+G+LDFL S+  DA LLRD FIFKIVPM+NPDGVIVGNYRCSL GRDLNRNYK+ LKD +P I  V+N+ ++LL++ EI  YCDFHGHSRK N+FMYGC ++ +  + L ER FP ++AKNA  KF YK CKFK+QKSK GT R+V    GI +SFT+EA+FCG+ L       RN   +HFNT DL+ MG  FC +LLDF DPD T+   IL  +++ L ++   K++ +G          ++ID N
Sbjct:   17 IKSTDDHTLLFESRFESGNLKRAIKTGDYEYQLWMRTDLYTSKHTQWFYFRVRNTRAGATYKFTIMNFIKSGSLYNDGMRPLAYSEVNASKNKIGWLRTGSNVKYYKTEIRRDDTTKDRYYYALTWTCQFQYSNDTCYFAHCYPYTYSDLQEYLQGIRNDPVKSRICKQRVLCRTLAGNFVYILTVTNPSRRPSDAEAKRAVVVTARVHPGETNSSWMMKGLLDFLTSNSADAKLLRDTFIFKIVPMINPDGVIVGNYRCSLAGRDLNRNYKTMLKDSFPSIWHVRNMIKRLLEEREITVYCDFHGHSRKQNVFMYGCENRSNPLKRLRERVFPTMMAKNAPCKFSYKGCKFKVQKSKEGTGRVVMWQLGILNSFTMEATFCGSSL-----GKRNG--FHFNTVDLEAMGYHFCDTLLDFCDPDDTKYVAILLELEKTLREKILAKMKKKGTAAPNMSLSDVDIDAN 476          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Nematostella
Match: EDO42858 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0D9])

HSP 1 Score: 394.045 bits (1011), Expect = 4.158e-128
Identity = 204/419 (48.69%), Postives = 275/419 (65.63%), Query Frame = 2
Query:  656 LCFESRFESGNLEKVYKISPFEYELHLRPDLYTSKHTQWYYFRVSNTRENKMYRFTIVNFYKAESLYNEGLKPLLYSEKDARLSNKGWRRWGSNIAYYRN-NLKYETKKGENYYYSLTWNCLFPHDNDTVYFSHCYPYTYSNLMKYVETVSKDPVKSKICRIKLLTKSLAENISLLLTITNSFTEQERKNYKKIILITGRVHPGETNASWMMEGVLDFLLSDKPDAMLLRDLFIFKIVPMLNPDGVIVGNYRCSLTGRDLNRNYKSKLKDYYPIICSVKNLAEKLLKDHEILFYCDFHGHSRKNNIFMYGCN-DQK--SENEFLLERAFPYILAKNASDKFDYKSCKFKMQKSKSGTSRIV-FRNFGIPHSFTLEASFCGTDLISNTNSNRNEQFYHFNTDDLKKMGEAFCYSLLDFSD 1897
            L FESRFE GNL++  +I  +EY+L L  DLYT +HTQWYYFRV N      Y+F I+N  K +SLYN G+KPLLYS K A  S+ GW+R G ++ Y R  N K      +  Y++LT+   FPH  DT Y +HCYPY+YS+L +Y+ ++  +P+ S+  R ++L K+ A N   +LTIT+S         K  ++I+ RVHPGETNASWMM+G+LD+L S+   A  LR  F+FKIVPMLNPDGVIVGNYR +L  RDLNR YK   K+ +P +   KN+ E   K+HE++ YCD HGHSRK N+FMYGC  D K  S   FL ER FP+++++ A DKF ++ CKF ++K K  T+R+V ++  GI +SFT+EA+FCG      +N    E   HFNT D + MG  FC  LL++S+
Sbjct:    5 LKFESRFECGNLQQAKRIGRYEYDLVLSNDLYTKRHTQWYYFRVENMVPGVTYKFNIINLLKRDSLYNYGMKPLLYSSKVAEDSSIGWQRSGHHVNYTRTVNNKNVLLSRDLIYFTLTFQVEFPHAGDTCYLAHCYPYSYSDLERYLMSLVDNPLTSQHVRREVLCKTKAGNNCYVLTITSSQGMNLETVDKLGVVISARVHPGETNASWMMKGLLDYLSSNDKVAESLRQKFVFKIVPMLNPDGVIVGNYRTNLAARDLNRTYKDPKKESFPTVWYTKNMLESFKKNHEVIIYCDLHGHSRKPNVFMYGCTADPKVYSSASFLEERLFPWMMSQKAPDKFSFQGCKFMVRKCKESTARVVMWQQLGIMNSFTMEATFCG------SNFGDMEGGRHFNTRDFEDMGRHFCEVLLEYSE 417          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Nematostella
Match: EDO47454 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RM73])

HSP 1 Score: 233.417 bits (594), Expect = 1.759e-67
Identity = 152/417 (36.45%), Postives = 223/417 (53.48%), Query Frame = 2
Query:  656 LCFESRFESGNLEKVYKISPFEYELHLRPDLYTSKHTQWYYFRVSNTRENKMYRFTIVNFYKAESLYNEGLKPLLYSEKDARLSNKGWRRW-GSNIAYYRNNLKYETKKGENYYYSLTWNCLFPHDNDTVYFSHCYPYTYSNLMKYVETVSKDPVKSKICRIKLLTKSLAENISLLLTITNSFTEQERKNYKKIILITGRVHPGETNASWMMEGVLDFLLSDKPDAMLLRDLFIFKIVPMLNPDGVIVGNYRCSLTGRDLNRNYKSKLKDYYPIICSVKNLAEKLLKDH--EILFYCDFHGHSRKNNIFMYGCNDQKSENEFLLERAFPYILAKNASDKFDYKSCKFKMQKSKSGTSRIVFRNFGIP--HSFTLEASFCGTDLISNTNSNRNEQFYHFNTDDLKKMGEAFCYSLLDF 1891
            L F++ FESGNL +V  I+ FEY+L +RPD    +   W+ F V NT   +   F IVNF K +SLY EG+ PL+ S    R     W+R    N  YYR     + +K     Y L++   F +D D   F++C+PYTYS L  Y++ + +  +     + ++L  ++ +    LLTIT S         K+++ IT R+HPGET +S++ +G++DF++S+ P A +LR+  +FK++PMLNPDGV++GNYRCSL G DLNR++       +P + + KNL  +L  D    + FY D H HS   N FMYG N    E  +  +  FP +L  NA D F   +  F     K+GT R    +   P  H +TLE SF       NTNS  +     +  D   K+G     + LD+
Sbjct:   29 LIFDACFESGNLGRVDYITEFEYDLFIRPDTCNPRFRVWFNFTVENTAPYQRVIFNIVNFSKTKSLYREGMTPLVKSTSRPR-----WQRIPAKNCFYYRCP---DHRKN----YVLSFAFAFDNDTDVYQFAYCFPYTYSRLQGYLDDIERRSLS--YFKREMLCLTVQQRRLDLLTIT-SPDNMNSPLRKRVVFITARIHPGETPSSYVCQGLIDFIISNHPVAKVLREYLVFKVIPMLNPDGVVLGNYRCSLMGFDLNRHWHEPSPWAHPTLVASKNLLMELDSDSTAHLDFYIDIHAHSTLMNGFMYG-NIYDEEERYERQAVFPKLLCANADD-FSMSNTSFNRDAMKAGTGRRFLGSSLDPETHCYTLEVSF----FSYNTNSTTSP----YTEDGYYKLGRNVARTFLDY 420          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Nematostella
Match: EDO34305 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPP4])

HSP 1 Score: 206.068 bits (523), Expect = 8.144e-55
Identity = 112/262 (42.75%), Postives = 154/262 (58.78%), Query Frame = 2
Query:  650 ETLCFESRFESGNLEKVYKISPFEYELHLRPDLYTSKHTQWYYFRVSNTRENKMYRFTIVNFYKAESLYNEGLKPLLYSEKDARLSNKG-WRRWGSNIAYYRNNLKYETKKG----ENYYYSLTWNCLFPHDNDTVYFSHCYPYTYSNLMKYVETVSKDPVKSKICRIKLLTKSLAENISLLLTITNSFTEQERKNY-------KKIILITGRVHPGETNASWMMEGVLDFLLSDKPDAMLLRDLFIFKIVPMLNPDGVIVG 1399
            + L FESRFESGNL K  ++  +EY+L L PD+    H QW+YF VSN   +  YRF I+N  K  S +N G++P+LYS ++A +  +  W R G+N+ YYRN        G       Y++ T+   FPH +D  Y ++ YPYTYS L +++  +          R   L  SLA N   ++TIT++   + R  Y       +  + ++ RVHPGE+NASW+M+GVL+FLLS    A  LRD FIFKIVPMLNPDGVI G
Sbjct:  690 KALRFESRFESGNLRKAIQVREYEYDLILNPDINCRHHHQWFYFEVSNMEADVPYRFNIINCEKINSQFNFGMQPVLYSMQEAVVEGRPCWARTGANVCYYRNYFSRSQDLGGGQKSKTYFTATFTVTFPHADDVCYLAYHYPYTYSMLQEHLANIESSIDSDVYYRRSTLCHSLAGNACDVITITSN--PRHRDAYTLDSFRSRPYVFLSARVHPGESNASWVMKGVLEFLLSAFYTAKHLRDRFIFKIVPMLNPDGVING 949          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Nematostella
Match: EDO32134 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVW8])

HSP 1 Score: 95.1301 bits (235), Expect = 4.545e-20
Identity = 60/187 (32.09%), Postives = 89/187 (47.59%), Query Frame = 2
Query:  650 ETLCFESRFESGNLEKVYKISPFEYELHLRPDLYTSKHTQWYYFRVSNTRENKMYRFTIVNFYKAESLYNEGLKPLLYSEKDARLSNK-GWRRWGSNIAYYRNNLKYETKKGENY----YYSLTWNCLFPHDNDTVYFSHCYPYTYSNLMKYVETVSKDPVKSKICRIKLLTKSLAENISLLLTITN 1195
            + L FESRFESGNL K  ++S  E ++                           YRF I+N  K  S +N G++P+LYS ++A +  +  W R G+N+ YYRN        G       Y++ T+   FPH +D  Y ++ YPYTYS L +++  +          R   L  SLA N   ++TIT+
Sbjct:  261 KALRFESRFESGNLRKAIQVSNMEADVP--------------------------YRFNIINCEKINSQFNFGMQPVLYSMQEAVVEGRPCWARTGANVCYYRNYFSRSQDLGGGQKSKTYFTATFTVTFPHADDVCYLAYHYPYTYSMLQEHLANIESSIDSDVYYRRSTLCHSLAGNACDVITITS 421          

HSP 2 Score: 78.5666 bits (192), Expect = 6.303e-15
Identity = 49/158 (31.01%), Postives = 69/158 (43.67%), Query Frame = 2
Query: 1532 YCDFHGHSRKNNIFMYGCN----------------------------------DQKSENEFLLERAFPYILAKNASDKFDYKSCKFKMQKSKSGTSRIV-FRNFGIPHSFTLEASFCGTDLISNTNSNRNEQFYHFNTDDLKKMGEAFCYSLLDFSDP 1900
            YCDFHGHSRK N+FMYGC+                                  D     E +  R  P +L  N +  F   SC F ++ SK  T+R+V +R  G+  S+T+E+++ G D           + YH  T +L++MG  FC  LL    P
Sbjct:  461 YCDFHGHSRKKNVFMYGCSTLATIAAASPSSSADLEVAAPTPATPAPNIPASADPNETVEDVGYRTLPRVL-HNIAPAFSLGSCSFVVEPSKESTARVVVWRELGVVRSYTMESTYSGCD-------QGPYKGYHLGTRELEEMGRFFCAGLLRIGRP 610          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Medaka
Match: agtpbp1 (ATP/GTP binding protein 1 [Source:NCBI gene;Acc:101172500])

HSP 1 Score: 297.745 bits (761), Expect = 1.466e-84
Identity = 167/440 (37.95%), Postives = 255/440 (57.95%), Query Frame = 2
Query:  641 ESDETLCFESRFESGNLEKVYKISPFEYELHLRPDLYTSKHTQWYYFRVSNTRENKMYRFTIVNFYKAESLYNEGLKPLLYSEKDARLSNKGWRRWGSNIAYYRN-----NLKYETKKGENYYYSLTWNCLFPHDNDTVYFSHCYPYTYSNLMKYVETVSKDPVKSKICRIKLLTKSLAENISLLLTITNSFTEQERKNY------KKIILITGRVHPGETNASWMMEGVLDFLLSDKPDAMLLRDLFIFKIVPMLNPDGVIVGNYRCSLTGRDLNRNYKSKLKDYYPIICSVKNLAEKLLKDHEI-LFYCDFHGHSRKNNIFMYGCNDQKSE------------NEFLLERAFPYILAKNASDKFDYKSCKFKMQKSKSGTSR-IVFRNFGIPHSFTLEASFCGTDLISNTNSNRNEQFYHFNTDDLKKMGEAFCYSLL 1885
            +  E+L F S+FESGNL K  +   +EY+L L  D+ ++ + QW+YF VS  R    YRF I+N  K+ S +N G++ L+YS ++A      W R G++I YY+N     ++    +KG++YY +LT++  F H +D  YF++ YPYT+S L  ++  +          R  +L ++L  N   LLTIT +  E +  N+      + +I ++ RVHPGETNASW+M+G L+FL+     A  LR+ +IFKIVPMLNPDGVI GN+RCSL+G DLNR +++   + +P I   K+L + L       L +CD+HGHSRK N+FMYGC+ +++              E L  R  P IL++ A   F   S  F +++SK  T+R +V+R  G+  S+T+E++ CG D           + +   T +L++MG  FC +LL
Sbjct:  715 DEGESLKFNSQFESGNLRKAIQARKYEYDLVLNADINSNHYHQWFYFEVSGMRVGVTYRFNIINCEKSNSQFNYGMQVLMYSVQEAISGRPCWVRTGTDICYYKNYFARSSIAAGGQKGKSYY-TLTFSMSFSHKDDVCYFAYHYPYTFSTLKMHLSKLEDLRTPQIYLRQDVLCETLGGNHCPLLTIT-AMPESKSSNHIYQFRNRPLIFLSARVHPGETNASWVMKGTLEFLMGTSTLAASLREAYIFKIVPMLNPDGVINGNHRCSLSGEDLNRQWQNPNPELHPTIYHTKSLLQYLAHIQRAPLVFCDYHGHSRKKNVFMYGCSLKETVWQSNISATSSDLQEDLGYRTLPKILSEIAP-AFSMASSSFVVERSKESTARVVVWREIGVQRSYTMESTLCGCD-------QGKYKGFQIGTRELEEMGAQFCVALL 1144          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Medaka
Match: agtpbp1 (ATP/GTP binding protein 1 [Source:NCBI gene;Acc:101172500])

HSP 1 Score: 296.975 bits (759), Expect = 1.893e-84
Identity = 167/440 (37.95%), Postives = 255/440 (57.95%), Query Frame = 2
Query:  641 ESDETLCFESRFESGNLEKVYKISPFEYELHLRPDLYTSKHTQWYYFRVSNTRENKMYRFTIVNFYKAESLYNEGLKPLLYSEKDARLSNKGWRRWGSNIAYYRN-----NLKYETKKGENYYYSLTWNCLFPHDNDTVYFSHCYPYTYSNLMKYVETVSKDPVKSKICRIKLLTKSLAENISLLLTITNSFTEQERKNY------KKIILITGRVHPGETNASWMMEGVLDFLLSDKPDAMLLRDLFIFKIVPMLNPDGVIVGNYRCSLTGRDLNRNYKSKLKDYYPIICSVKNLAEKLLKDHEI-LFYCDFHGHSRKNNIFMYGCNDQKSE------------NEFLLERAFPYILAKNASDKFDYKSCKFKMQKSKSGTSR-IVFRNFGIPHSFTLEASFCGTDLISNTNSNRNEQFYHFNTDDLKKMGEAFCYSLL 1885
            +  E+L F S+FESGNL K  +   +EY+L L  D+ ++ + QW+YF VS  R    YRF I+N  K+ S +N G++ L+YS ++A      W R G++I YY+N     ++    +KG++YY +LT++  F H +D  YF++ YPYT+S L  ++  +          R  +L ++L  N   LLTIT +  E +  N+      + +I ++ RVHPGETNASW+M+G L+FL+     A  LR+ +IFKIVPMLNPDGVI GN+RCSL+G DLNR +++   + +P I   K+L + L       L +CD+HGHSRK N+FMYGC+ +++              E L  R  P IL++ A   F   S  F +++SK  T+R +V+R  G+  S+T+E++ CG D           + +   T +L++MG  FC +LL
Sbjct:  680 DEGESLKFNSQFESGNLRKAIQARKYEYDLVLNADINSNHYHQWFYFEVSGMRVGVTYRFNIINCEKSNSQFNYGMQVLMYSVQEAISGRPCWVRTGTDICYYKNYFARSSIAAGGQKGKSYY-TLTFSMSFSHKDDVCYFAYHYPYTFSTLKMHLSKLEDLRTPQIYLRQDVLCETLGGNHCPLLTIT-AMPESKSSNHIYQFRNRPLIFLSARVHPGETNASWVMKGTLEFLMGTSTLAASLREAYIFKIVPMLNPDGVINGNHRCSLSGEDLNRQWQNPNPELHPTIYHTKSLLQYLAHIQRAPLVFCDYHGHSRKKNVFMYGCSLKETVWQSNISATSSDLQEDLGYRTLPKILSEIAP-AFSMASSSFVVERSKESTARVVVWREIGVQRSYTMESTLCGCD-------QGKYKGFQIGTRELEEMGAQFCVALL 1109          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Medaka
Match: agtpbp1 (ATP/GTP binding protein 1 [Source:NCBI gene;Acc:101172500])

HSP 1 Score: 297.36 bits (760), Expect = 2.116e-84
Identity = 167/440 (37.95%), Postives = 255/440 (57.95%), Query Frame = 2
Query:  641 ESDETLCFESRFESGNLEKVYKISPFEYELHLRPDLYTSKHTQWYYFRVSNTRENKMYRFTIVNFYKAESLYNEGLKPLLYSEKDARLSNKGWRRWGSNIAYYRN-----NLKYETKKGENYYYSLTWNCLFPHDNDTVYFSHCYPYTYSNLMKYVETVSKDPVKSKICRIKLLTKSLAENISLLLTITNSFTEQERKNY------KKIILITGRVHPGETNASWMMEGVLDFLLSDKPDAMLLRDLFIFKIVPMLNPDGVIVGNYRCSLTGRDLNRNYKSKLKDYYPIICSVKNLAEKLLKDHEI-LFYCDFHGHSRKNNIFMYGCNDQKSE------------NEFLLERAFPYILAKNASDKFDYKSCKFKMQKSKSGTSR-IVFRNFGIPHSFTLEASFCGTDLISNTNSNRNEQFYHFNTDDLKKMGEAFCYSLL 1885
            +  E+L F S+FESGNL K  +   +EY+L L  D+ ++ + QW+YF VS  R    YRF I+N  K+ S +N G++ L+YS ++A      W R G++I YY+N     ++    +KG++YY +LT++  F H +D  YF++ YPYT+S L  ++  +          R  +L ++L  N   LLTIT +  E +  N+      + +I ++ RVHPGETNASW+M+G L+FL+     A  LR+ +IFKIVPMLNPDGVI GN+RCSL+G DLNR +++   + +P I   K+L + L       L +CD+HGHSRK N+FMYGC+ +++              E L  R  P IL++ A   F   S  F +++SK  T+R +V+R  G+  S+T+E++ CG D           + +   T +L++MG  FC +LL
Sbjct:  729 DEGESLKFNSQFESGNLRKAIQARKYEYDLVLNADINSNHYHQWFYFEVSGMRVGVTYRFNIINCEKSNSQFNYGMQVLMYSVQEAISGRPCWVRTGTDICYYKNYFARSSIAAGGQKGKSYY-TLTFSMSFSHKDDVCYFAYHYPYTFSTLKMHLSKLEDLRTPQIYLRQDVLCETLGGNHCPLLTIT-AMPESKSSNHIYQFRNRPLIFLSARVHPGETNASWVMKGTLEFLMGTSTLAASLREAYIFKIVPMLNPDGVINGNHRCSLSGEDLNRQWQNPNPELHPTIYHTKSLLQYLAHIQRAPLVFCDYHGHSRKKNVFMYGCSLKETVWQSNISATSSDLQEDLGYRTLPKILSEIAP-AFSMASSSFVVERSKESTARVVVWREIGVQRSYTMESTLCGCD-------QGKYKGFQIGTRELEEMGAQFCVALL 1158          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Medaka
Match: ENSORLT00000020650.2 (pep primary_assembly:ASM223467v1:6:31072043:31073402:1 gene:ENSORLG00000016495.2 transcript:ENSORLT00000020650.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 234.958 bits (598), Expect = 4.380e-70
Identity = 110/222 (49.55%), Postives = 148/222 (66.67%), Query Frame = 2
Query: 1157 LAENISLLLTITNSFTEQERKNYKKIILITGRVHPGETNASWMMEGVLDFLLSDKPDAMLLRDLFIFKIVPMLNPDGVIVGNYRCSLTGRDLNRNYKSKLKDYYPIICSVKNLAEKLLKDHEILFYCDFHGHSRKNNIFMYGCNDQKSENEFLLERAFPYILAKNASD------KFDYKSCKFKMQKSKSGTSRIVFRNFGIPHSFTLEASFCGTDLISNTN 1804
            LA N   +LT+T+    +    +K+ +++T RVHPGETNASW+MEG+LDFLL D  DA +LRD F+FK+VPMLNPDGV+VGNYRCSL GRDLNR Y+S L++ +P +   KN+ E+L  + E+  YCDFHGH+RKNN FMYGC               P++L+   S       +F ++SCKF++QKSK GT RI     GI +S+T+E SF G+ L   T+
Sbjct:   14 LAGNAVHVLTVTSESASRREAAHKRAVVLTARVHPGETNASWVMEGLLDFLLGDSEDAQVLRDNFVFKVVPMLNPDGVVVGNYRCSLAGRDLNRYYRSVLRESFPGVWHTKNMVERLRAEMEVALYCDFHGHNRKNNAFMYGCRR-------------PHLLSCCTSAFVQLPLQFSFQSCKFRVQKSKEGTGRICMWRLGIQNSYTMETSFGGSTLGEQTS 222          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Medaka
Match: agbl5 (ATP/GTP binding protein like 5 [Source:NCBI gene;Acc:101155157])

HSP 1 Score: 135.961 bits (341), Expect = 3.288e-32
Identity = 103/368 (27.99%), Postives = 165/368 (44.84%), Query Frame = 2
Query:  656 LCFESRFESGNLEKVYKI-----SP-------------------FEYELHLRPDLYTSKHT----QWYYFRVSNTRENKMYRFTIVNFYKAESLYNEGLKPLLYSEKDARLSNKGWRRWGSNIAYYRNNLKYETKKGENYYYSLTWNCLFPHDNDTVYFSHCYPYTYSNLMKYVETVSKD-PVKSKIC----------RIKLLTKSLAENISLLLTITNSFTEQERKNY-------------------KKIILITGRVHPGETNASWMMEGVLDFLLS-DKPDAMLLRDLFIFKIVPMLNPDGVIVGNYRCSLTGRDLNRNYKSKLKDYYPIICSVKNLAEKLLKDHEILFYCDFHGHSRKNNIFMYG 1582
            + F S+F+SGNL +V K+     SP                   +E+ +  +PD   ++H      W+YF V      K+ +  + N      LY++G+ PL+ S         G  RW       R   +  T+  +N +     + L      T YFS CYPY+Y+   + ++ +    P  +++             +LL +SL  N   LLT+TN    QE +                     K++  ++ RVHPGET +S++  G L F+L  D P A +LR +F+FK++PMLNPDGV+ G+YR    G +LNR Y +   + +P I + K L         +L++   H H+R +N    G
Sbjct:    8 IVFSSKFDSGNLARVEKVERGNLSPASDTASSGSSPSGSHLAPDYEFNVWTQPDCAGTEHENGNRSWFYFSVKGAAPGKLVKINVRNMNNQRKLYSQGMAPLVRSLP-------GKNRW------ERIRDRPTTEIIDNQFVLSFTHRLSEARGATTYFSFCYPYSYTECQEMLQKLDDSYPNAAQLSPSSAPSTVYYHRELLCRSLDGNRVDLLTVTNCSKMQEEREARLPKLFPDTNTPRPHRFAGKRVFFLSSRVHPGETPSSFVFNGFLSFILRRDDPRAHMLRSMFVFKLIPMLNPDGVVRGHYRTDSRGVNLNRQYLNPSPELHPSIYAAKTL---------LLYH---HTHNRLHNTHTNG 350          

HSP 2 Score: 54.299 bits (129), Expect = 5.789e-7
Identity = 44/188 (23.40%), Postives = 84/188 (44.68%), Query Frame = 2
Query: 1511 KDHEILFYCDFHGHSRKNNIFMYGCNDQKSENEFLLERAFPYILAKNASDKFDYKSCKFKMQ----------KSKSGTSRI-VFRNFGIPHSFTLEASFCGTDLISN-----------TNSNRNEQFYHFNTDDLKKMGEAFCYSLLDFSDPDQTQMNII-----LDNIKEDLTKRYTNKLETRGINI 1993
            ++  + +Y D HGH+ K   FMYG N    E++ +    +P ++A N S  FD+  C F  +          +SK G+ R+ + +  G+ HS+TLE ++     ++            T    +     +  +  +++G A   S LD ++ +     ++     L N++  L K   N   T+G+N+
Sbjct:  435 REGGVAYYVDLHGHASKRGCFMYG-NSLPDESQQVENMLYPRLIAVN-SPHFDFMGCNFSEKNMYARDKRDGQSKEGSGRVAIHKAIGLLHSYTLECNYNTGKTMNTIPPACHDNGRATPPPPSSFPPKYTPEIFEQVGRAVAVSALDMAECNPWPRLVLSEHTCLTNLRAWLLKHVRN---TKGLNM 617          
BLAST of Cytosolic carboxypeptidase 2 vs. Planmine SMEST
Match: SMESG000058240.1 (SMESG000058240.1)

HSP 1 Score: 1771.13 bits (4586), Expect = 0.000e+0
Identity = 921/926 (99.46%), Postives = 926/926 (100.00%), Query Frame = 2
Query:  128 RFMKKHLQHYGYYKGNKLIMRELEGYEKTHEHSQSDESTSESENAIKCNQKTGTSPSLRTTQLIYDYFEDGSYVRKLKAPHNYVLNLQQAPRWPIEMQVLPERIHHITALPQQREFIYIPSNSELKPQPRGEENGRLIFEYKTCSGPYFTKSKTISKEIGNLLPVTAEFESESDETLCFESRFESGNLEKVYKISPFEYELHLRPDLYTSKHTQWYYFRVSNTRENKMYRFTIVNFYKAESLYNEGLKPLLYSEKDARLSNKGWRRWGSNIAYYRNNLKYETKKGENYYYSLTWNCLFPHDNDTVYFSHCYPYTYSNLMKYVETVSKDPVKSKICRIKLLTKSLAENISLLLTITNSFTEQERKNYKKIILITGRVHPGETNASWMMEGVLDFLLSDKPDAMLLRDLFIFKIVPMLNPDGVIVGNYRCSLTGRDLNRNYKSKLKDYYPIICSVKNLAEKLLKDHEILFYCDFHGHSRKNNIFMYGCNDQKSENEFLLERAFPYILAKNASDKFDYKSCKFKMQKSKSGTSRIVFRNFGIPHSFTLEASFCGTDLISNTNSNRNEQFYHFNTDDLKKMGEAFCYSLLDFSDPDQTQMNIILDNIKEDLTKRYTNKLETRGINIDGNKIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYCXXXXXXXXXXXXXXXXXXXXXXXXXLIENKSLLGARCLTCLSLNYNNITPIKTPVENKPKFVHFNETNKKKLKSPSPKTDRTLSIDEKERGVILPKCYTNNLVFKRFSPNLQEEPTKLTYQEIEASRIQLSYPGVSKYKSEKTVESLCPLHISESLKDKEKRSRKHTNYVFRKPSTILNNQDFLTKPYPQQNIIRPTSGLPTNTFQILSFKNMLTEPNNKLRVDRHKSLNPIKRVQSITISKKNSKQSENFKPTEKPLSISNIIEN 2905
            RFMKKHLQHYGYYKGNKLIMRELEGYEKTHEHSQSDESTSESENAIKCNQKTGTSPSLRTTQLIYDYFEDGSYVRKLKAPHNYVLNLQQAPRWPIEMQVLPERIHHITALPQQREFIYIPSNSELKPQPRGEENGRLIFEYKTCSGPYFTKSKTISKEIGNLLPVTAEFESES+ETLCFESRFESGNLEKVYKISPFEYELHLRPD+YTSKHTQWYYFRVSNTRENKMYRFTIVNFYKAESLYNEGLKPLLYSEKDARLSNKGWRRWGSNIAYYRNNLKYETKKGENYYYSLTWNCLFPHDNDTVYFSHCYPYTYSNLMKYVETVSKDPVKSKICRIKLLTKSLAENISLLLTITNSFTEQERKNYKKIILITGRVHPGETNASWMMEGVLDFLLSDKPDAMLLRDLFIFKIVPMLNPDGVIVGNYRCSLTGRDLNRNYKSKLKDYYPIICSVKNLAEKLLKDHEILFYCDFHGHSRKNNIFMYGCNDQKSENEFLLERAFPYILAKNASDKFDYKSCKFKMQKSKSGTSRIVFRNFGIPHSFTLEASFCGTDLISNTNSNRNEQFYHFNTDDLKKMGEAFCYSLLDFSDPDQTQMNIIL+NIKEDLTKRYTNKLETRGINIDGNKILSISVLDLDLDDGSSGDDDGSDSSDSNGLPSYCEYVEENRVKKVKRKE+KEKKSAPKELIENKSLLGARCLTCLSLNYNNITPIKTPVENKPKFVHFNETNKKKLKSPSPKTDRTLSIDEKERGVILPKCYTNNLVFKRFSPNLQEEPTKLTYQE+EASRIQLSYPGVSKYKSEKTVESLCPLHISESLKDKEKRSRKHTNYVFRKPSTILNNQDFLTKPYPQQNIIRPTSGLPTNTFQILSFKNMLTEPNNKLRVDRHKSLNPIKRVQSITISKKNSKQSENFKPTEKPLSISNIIEN
Sbjct:   18 RFMKKHLQHYGYYKGNKLIMRELEGYEKTHEHSQSDESTSESENAIKCNQKTGTSPSLRTTQLIYDYFEDGSYVRKLKAPHNYVLNLQQAPRWPIEMQVLPERIHHITALPQQREFIYIPSNSELKPQPRGEENGRLIFEYKTCSGPYFTKSKTISKEIGNLLPVTAEFESESNETLCFESRFESGNLEKVYKISPFEYELHLRPDMYTSKHTQWYYFRVSNTRENKMYRFTIVNFYKAESLYNEGLKPLLYSEKDARLSNKGWRRWGSNIAYYRNNLKYETKKGENYYYSLTWNCLFPHDNDTVYFSHCYPYTYSNLMKYVETVSKDPVKSKICRIKLLTKSLAENISLLLTITNSFTEQERKNYKKIILITGRVHPGETNASWMMEGVLDFLLSDKPDAMLLRDLFIFKIVPMLNPDGVIVGNYRCSLTGRDLNRNYKSKLKDYYPIICSVKNLAEKLLKDHEILFYCDFHGHSRKNNIFMYGCNDQKSENEFLLERAFPYILAKNASDKFDYKSCKFKMQKSKSGTSRIVFRNFGIPHSFTLEASFCGTDLISNTNSNRNEQFYHFNTDDLKKMGEAFCYSLLDFSDPDQTQMNIILENIKEDLTKRYTNKLETRGINIDGNKILSISVLDLDLDDGSSGDDDGSDSSDSNGLPSYCEYVEENRVKKVKRKENKEKKSAPKELIENKSLLGARCLTCLSLNYNNITPIKTPVENKPKFVHFNETNKKKLKSPSPKTDRTLSIDEKERGVILPKCYTNNLVFKRFSPNLQEEPTKLTYQEVEASRIQLSYPGVSKYKSEKTVESLCPLHISESLKDKEKRSRKHTNYVFRKPSTILNNQDFLTKPYPQQNIIRPTSGLPTNTFQILSFKNMLTEPNNKLRVDRHKSLNPIKRVQSITISKKNSKQSENFKPTEKPLSISNIIEN 943          
BLAST of Cytosolic carboxypeptidase 2 vs. Planmine SMEST
Match: SMESG000058240.1 (SMESG000058240.1)

HSP 1 Score: 1744.17 bits (4516), Expect = 0.000e+0
Identity = 912/926 (98.49%), Postives = 917/926 (99.03%), Query Frame = 2
Query:  128 RFMKKHLQHYGYYKGNKLIMRELEGYEKTHEHSQSDESTSESENAIKCNQKTGTSPSLRTTQLIYDYFEDGSYVRKLKAPHNYVLNLQQAPRWPIEMQVLPERIHHITALPQQREFIYIPSNSELKPQPRGEENGRLIFEYKTCSGPYFTKSKTISKEIGNLLPVTAEFESESDETLCFESRFESGNLEKVYKISPFEYELHLRPDLYTSKHTQWYYFRVSNTRENKMYRFTIVNFYKAESLYNEGLKPLLYSEKDARLSNKGWRRWGSNIAYYRNNLKYETKKGENYYYSLTWNCLFPHDNDTVYFSHCYPYTYSNLMKYVETVSKDPVKSKICRIKLLTKSLAENISLLLTITNSFTEQERKNYKKIILITGRVHPGETNASWMMEGVLDFLLSDKPDAMLLRDLFIFKIVPMLNPDGVIVGNYRCSLTGRDLNRNYKSKLKDYYPIICSVKNLAEKLLKDHEILFYCDFHGHSRKNNIFMYGCNDQKSENEFLLERAFPYILAKNASDKFDYKSCKFKMQKSKSGTSRIVFRNFGIPHSFTLEASFCGTDLISNTNSNRNEQFYHFNTDDLKKMGEAFCYSLLDFSDPDQTQMNIILDNIKEDLTKRYTNKLETRGINIDGNKIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYCXXXXXXXXXXXXXXXXXXXXXXXXXLIENKSLLGARCLTCLSLNYNNITPIKTPVENKPKFVHFNETNKKKLKSPSPKTDRTLSIDEKERGVILPKCYTNNLVFKRFSPNLQEEPTKLTYQEIEASRIQLSYPGVSKYKSEKTVESLCPLHISESLKDKEKRSRKHTNYVFRKPSTILNNQDFLTKPYPQQNIIRPTSGLPTNTFQILSFKNMLTEPNNKLRVDRHKSLNPIKRVQSITISKKNSKQSENFKPTEKPLSISNIIEN 2905
            RFMKKHLQHYGYYKGNKLIMRELEGYEKTHEHSQSDESTSESENAIKCNQKTGTSPSLRTTQLIYDYFEDGSYVRKLKAPHNYVLNLQQAPRWPIEMQVLPERIHHITALPQQREFIYIPSNSELKPQPRGEENGRLIFEYKTCSGPYFTKSKTISKEIGNLLPVTAEFESES+ETLCFESRFESGNLEKVYKISPFEYELHLRPD+YTSKHTQWYYFRVSNTRENKMYRFTIVNFYKAESLYNEGLKPLLYSEKDARLSNKGWRRWGSNIAYYRNNLKYETKKGENYYYSLTWNCLFPHDNDTVYFSHCYPYTYSNLMKYVETVSKDPVKSKICRIKLLTKSLAENISLLLTITNSFTEQERKNYKKIILITGRVHPGETNASWMMEGVLDFLLSDKPDAMLLRDLFIFKIVPMLNPDGVIVGNYRCSLTGRDLNRNYKSKLKDYYPIICSVKNLAEKLLKDHEILFYCDFHGHSRKNNIFMYGCNDQKSENEFLLERAFPYILAKNASDKFDYKSCKFKMQKSKSGTSRIVFRNFGIPHSFTLEASFCGTDLISNTNSNRNEQFYHFNTDDLKKMGEAFCYSLLDFSDPDQTQMNIIL+NIKEDLTKRYTNKLETRGINIDGNKILSISVLDLDLDDGSSGDDDGSDSSDSNGLPSYCEYVEENRVKKVKRKE+KEKKSAPKELIEN         TCLSLNYNNITPIKTPVENKPKFVHFNETNKKKLKSPSPKTDRTLSIDEKERGVILPKCYTNNLVFKRFSPNLQEEPTKLTYQE+EASRIQLSYPGVSKYKSEKTVESLCPLHISESLKDKEKRSRKHTNYVFRKPSTILNNQDFLTKPYPQQNIIRPTSGLPTNTFQILSFKNMLTEPNNKLRVDRHKSLNPIKRVQSITISKKNSKQSENFKPTEKPLSISNIIEN
Sbjct:   18 RFMKKHLQHYGYYKGNKLIMRELEGYEKTHEHSQSDESTSESENAIKCNQKTGTSPSLRTTQLIYDYFEDGSYVRKLKAPHNYVLNLQQAPRWPIEMQVLPERIHHITALPQQREFIYIPSNSELKPQPRGEENGRLIFEYKTCSGPYFTKSKTISKEIGNLLPVTAEFESESNETLCFESRFESGNLEKVYKISPFEYELHLRPDMYTSKHTQWYYFRVSNTRENKMYRFTIVNFYKAESLYNEGLKPLLYSEKDARLSNKGWRRWGSNIAYYRNNLKYETKKGENYYYSLTWNCLFPHDNDTVYFSHCYPYTYSNLMKYVETVSKDPVKSKICRIKLLTKSLAENISLLLTITNSFTEQERKNYKKIILITGRVHPGETNASWMMEGVLDFLLSDKPDAMLLRDLFIFKIVPMLNPDGVIVGNYRCSLTGRDLNRNYKSKLKDYYPIICSVKNLAEKLLKDHEILFYCDFHGHSRKNNIFMYGCNDQKSENEFLLERAFPYILAKNASDKFDYKSCKFKMQKSKSGTSRIVFRNFGIPHSFTLEASFCGTDLISNTNSNRNEQFYHFNTDDLKKMGEAFCYSLLDFSDPDQTQMNIILENIKEDLTKRYTNKLETRGINIDGNKILSISVLDLDLDDGSSGDDDGSDSSDSNGLPSYCEYVEENRVKKVKRKENKEKKSAPKELIEN---------TCLSLNYNNITPIKTPVENKPKFVHFNETNKKKLKSPSPKTDRTLSIDEKERGVILPKCYTNNLVFKRFSPNLQEEPTKLTYQEVEASRIQLSYPGVSKYKSEKTVESLCPLHISESLKDKEKRSRKHTNYVFRKPSTILNNQDFLTKPYPQQNIIRPTSGLPTNTFQILSFKNMLTEPNNKLRVDRHKSLNPIKRVQSITISKKNSKQSENFKPTEKPLSISNIIEN 934          
BLAST of Cytosolic carboxypeptidase 2 vs. Planmine SMEST
Match: SMESG000006325.1 (SMESG000006325.1)

HSP 1 Score: 350.517 bits (898), Expect = 4.476e-104
Identity = 192/456 (42.11%), Postives = 273/456 (59.87%), Query Frame = 2
Query:  653 TLCFESRFESGNLEKVYKISPFEYELHLRPDLYTSKHTQWYYFRVSNTRENKMYRFTIVNFYKAESLYNEGLKPLLYSEKDARLSNKGWRRWGSNIAYYRN--NLKYETKKGENYYYSLTWNCLFPHDNDTVYFSHCYPYTYSNLMKYVETVSKDPVKSKICRIKLLTKSLAENISLLLTITN-SFTEQERKNYKKIILITGRVHPGETNASWMMEGVLDFLLSDKPDAMLLRDLFIFKIVPMLNPDGVIVGNYRCSLTGRDLNRNYKSKLKDYYPIICSVKNLAEKLLKD-HEILFYCDFHGHSRKNNIFMYGCNDQ--KSEN--------------EFLLERAFPYILAKNASDKFDYKSCKFKMQKSKSGTSRIV-FRNFGIPHSFTLEASFCGTDLISNTNSNRNEQFYHFNTDDLKKMGEAFCYSLLDF---SDPDQTQMNIILDNIKEDL 1948
            +L FESRFE+GNL +  +   +EYEL L  DLYT +HTQW+YFR+ N  +N  Y+F I+N  K++SLY EG++ L+YS+K+A  ++ GW R G +I Y RN   L+      E  Y+ L +   F +  DT Y SHCYPYT+++L   + T   +     + +  +L ++   N   LLTIT+ S  E+E+       +IT RVHPGETN+SWMM+G++ +L+ +   A  LR   +FKIVPMLNPDGVIVGNYRCS  GRDLNRNY++  ++ +P I   K L E L K    +  YCD HGHSRK+N+FMYGC+ Q   SEN              +++ +R F +++ KN  + F +  C FK++K K  T R+V ++ F +  S+TLEA+F GTD+    N  R     HFN +DL+ +G+ F  SL  +      +Q Q  I LD +K  L
Sbjct:  318 SLIFESRFETGNLRQSRRTGQYEYELLLNNDLYTKRHTQWFYFRLQNMEKNVTYKFIIINLLKSKSLYEEGMRILMYSDKNATTNSIGWYRTGHHIRYTRNFTRLQCPLLNREMAYFQLEFQIEFQYSEDTCYLSHCYPYTFTDLKNDLRTFESNCNTKPLLKKDILCETNIGNSCFLLTITDKSIPEKEKLG----AVITARVHPGETNSSWMMKGLIQYLIGNSETAKTLRRRIVFKIVPMLNPDGVIVGNYRCSTVGRDLNRNYRNPKEERFPTIFHTKRLIEDLKKSCTAMALYCDLHGHSRKHNVFMYGCDSQYLHSENFNDINPVLNINTIEDYIKDRIFTFLMQKNGPETFSFNGCHFKIRKCKESTGRVVMWKQFNVNDSYTLEATFSGTDI----NDRR-----HFNINDLENIGKIFSESLFSYISIMKDEQQQKEIGLDLLKAIL 760          
BLAST of Cytosolic carboxypeptidase 2 vs. Planmine SMEST
Match: SMESG000006325.1 (SMESG000006325.1)

HSP 1 Score: 350.903 bits (899), Expect = 8.604e-104
Identity = 192/456 (42.11%), Postives = 273/456 (59.87%), Query Frame = 2
Query:  653 TLCFESRFESGNLEKVYKISPFEYELHLRPDLYTSKHTQWYYFRVSNTRENKMYRFTIVNFYKAESLYNEGLKPLLYSEKDARLSNKGWRRWGSNIAYYRN--NLKYETKKGENYYYSLTWNCLFPHDNDTVYFSHCYPYTYSNLMKYVETVSKDPVKSKICRIKLLTKSLAENISLLLTITN-SFTEQERKNYKKIILITGRVHPGETNASWMMEGVLDFLLSDKPDAMLLRDLFIFKIVPMLNPDGVIVGNYRCSLTGRDLNRNYKSKLKDYYPIICSVKNLAEKLLKD-HEILFYCDFHGHSRKNNIFMYGCNDQ--KSEN--------------EFLLERAFPYILAKNASDKFDYKSCKFKMQKSKSGTSRIV-FRNFGIPHSFTLEASFCGTDLISNTNSNRNEQFYHFNTDDLKKMGEAFCYSLLDF---SDPDQTQMNIILDNIKEDL 1948
            +L FESRFE+GNL +  +   +EYEL L  DLYT +HTQW+YFR+ N  +N  Y+F I+N  K++SLY EG++ L+YS+K+A  ++ GW R G +I Y RN   L+      E  Y+ L +   F +  DT Y SHCYPYT+++L   + T   +     + +  +L ++   N   LLTIT+ S  E+E+       +IT RVHPGETN+SWMM+G++ +L+ +   A  LR   +FKIVPMLNPDGVIVGNYRCS  GRDLNRNY++  ++ +P I   K L E L K    +  YCD HGHSRK+N+FMYGC+ Q   SEN              +++ +R F +++ KN  + F +  C FK++K K  T R+V ++ F +  S+TLEA+F GTD+    N  R     HFN +DL+ +G+ F  SL  +      +Q Q  I LD +K  L
Sbjct:  318 SLIFESRFETGNLRQSRRTGQYEYELLLNNDLYTKRHTQWFYFRLQNMEKNVTYKFIIINLLKSKSLYEEGMRILMYSDKNATTNSIGWYRTGHHIRYTRNFTRLQCPLLNREMAYFQLEFQIEFQYSEDTCYLSHCYPYTFTDLKNDLRTFESNCNTKPLLKKDILCETNIGNSCFLLTITDKSIPEKEKLG----AVITARVHPGETNSSWMMKGLIQYLIGNSETAKTLRRRIVFKIVPMLNPDGVIVGNYRCSTVGRDLNRNYRNPKEERFPTIFHTKRLIEDLKKSCTAMALYCDLHGHSRKHNVFMYGCDSQYLHSENFNDINPVLNINTIEDYIKDRIFTFLMQKNGPETFSFNGCHFKIRKCKESTGRVVMWKQFNVNDSYTLEATFSGTDI----NDRR-----HFNINDLENIGKIFSESLFSYISIMKDEQQQKEIGLDLLKAIL 760          
BLAST of Cytosolic carboxypeptidase 2 vs. Planmine SMEST
Match: SMESG000006325.1 (SMESG000006325.1)

HSP 1 Score: 349.747 bits (896), Expect = 1.322e-103
Identity = 192/456 (42.11%), Postives = 273/456 (59.87%), Query Frame = 2
Query:  653 TLCFESRFESGNLEKVYKISPFEYELHLRPDLYTSKHTQWYYFRVSNTRENKMYRFTIVNFYKAESLYNEGLKPLLYSEKDARLSNKGWRRWGSNIAYYRN--NLKYETKKGENYYYSLTWNCLFPHDNDTVYFSHCYPYTYSNLMKYVETVSKDPVKSKICRIKLLTKSLAENISLLLTITN-SFTEQERKNYKKIILITGRVHPGETNASWMMEGVLDFLLSDKPDAMLLRDLFIFKIVPMLNPDGVIVGNYRCSLTGRDLNRNYKSKLKDYYPIICSVKNLAEKLLKD-HEILFYCDFHGHSRKNNIFMYGCNDQ--KSEN--------------EFLLERAFPYILAKNASDKFDYKSCKFKMQKSKSGTSRIV-FRNFGIPHSFTLEASFCGTDLISNTNSNRNEQFYHFNTDDLKKMGEAFCYSLLDF---SDPDQTQMNIILDNIKEDL 1948
            +L FESRFE+GNL +  +   +EYEL L  DLYT +HTQW+YFR+ N  +N  Y+F I+N  K++SLY EG++ L+YS+K+A  ++ GW R G +I Y RN   L+      E  Y+ L +   F +  DT Y SHCYPYT+++L   + T   +     + +  +L ++   N   LLTIT+ S  E+E+       +IT RVHPGETN+SWMM+G++ +L+ +   A  LR   +FKIVPMLNPDGVIVGNYRCS  GRDLNRNY++  ++ +P I   K L E L K    +  YCD HGHSRK+N+FMYGC+ Q   SEN              +++ +R F +++ KN  + F +  C FK++K K  T R+V ++ F +  S+TLEA+F GTD+    N  R     HFN +DL+ +G+ F  SL  +      +Q Q  I LD +K  L
Sbjct:  318 SLIFESRFETGNLRQSRRTGQYEYELLLNNDLYTKRHTQWFYFRLQNMEKNVTYKFIIINLLKSKSLYEEGMRILMYSDKNATTNSIGWYRTGHHIRYTRNFTRLQCPLLNREMAYFQLEFQIEFQYSEDTCYLSHCYPYTFTDLKNDLRTFESNCNTKPLLKKDILCETNIGNSCFLLTITDKSIPEKEKLG----AVITARVHPGETNSSWMMKGLIQYLIGNSETAKTLRRRIVFKIVPMLNPDGVIVGNYRCSTVGRDLNRNYRNPKEERFPTIFHTKRLIEDLKKSCTAMALYCDLHGHSRKHNVFMYGCDSQYLHSENFNDINPVLNINTIEDYIKDRIFTFLMQKNGPETFSFNGCHFKIRKCKESTGRVVMWKQFNVNDSYTLEATFSGTDI----NDRR-----HFNINDLENIGKIFSESLFSYISIMKDEQQQKEIGLDLLKAIL 760          
The following BLAST results are available for this feature:
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AGBL20.000e+044.26ATP/GTP binding protein like 2 [Source:HGNC Symbol... [more]
AGBL20.000e+044.26ATP/GTP binding protein like 2 [Source:HGNC Symbol... [more]
AGBL20.000e+048.17ATP/GTP binding protein like 2 [Source:HGNC Symbol... [more]
AGBL20.000e+048.17ATP/GTP binding protein like 2 [Source:HGNC Symbol... [more]
AGBL20.000e+048.17ATP/GTP binding protein like 2 [Source:HGNC Symbol... [more]
back to top
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ccpp-15.931e-8535.31Cytosolic carboxypeptidase 1 [Source:UniProtKB/Sw... [more]
ccpp-61.631e-6133.64Cytosolic carboxypeptidase 6 [Source:UniProtKB/Sw... [more]
back to top
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nna14.531e-16546.74gene:FBgn0265726 transcript:FBtr0340677[more]
Nna11.489e-14049.64gene:FBgn0265726 transcript:FBtr0340676[more]
Nna11.489e-14049.64gene:FBgn0265726 transcript:FBtr0340673[more]
Nna15.230e-14049.64gene:FBgn0265726 transcript:FBtr0340672[more]
Nna17.398e-13949.64gene:FBgn0265726 transcript:FBtr0340675[more]
back to top
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
agbl20.000e+045.77ATP/GTP binding protein-like 2 [Source:NCBI gene;A... [more]
agbl20.000e+045.77ATP/GTP binding protein-like 2 [Source:NCBI gene;A... [more]
agbl20.000e+045.51ATP/GTP binding protein-like 2 [Source:NCBI gene;A... [more]
agtpbp11.076e-9038.18ATP/GTP binding protein 1 [Source:NCBI gene;Acc:55... [more]
agtpbp17.371e-8838.18ATP/GTP binding protein 1 [Source:NCBI gene;Acc:55... [more]
back to top
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fgfr10.000e+046.93fibroblast growth factor receptor 1 [Source:Xenbas... [more]
AGBL33.541e-17046.62ATP/GTP binding protein like 3 [Source:HGNC Symbol... [more]
AGBL33.630e-12347.69ATP/GTP binding protein like 3 [Source:HGNC Symbol... [more]
agtpbp11.604e-8637.63ATP/GTP binding protein 1 [Source:NCBI gene;Acc:10... [more]
agtpbp13.405e-8639.13ATP/GTP binding protein 1 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Agbl20.000e+045.29ATP/GTP binding protein-like 2 [Source:MGI Symbol;... [more]
Agbl20.000e+045.29ATP/GTP binding protein-like 2 [Source:MGI Symbol;... [more]
Agbl20.000e+045.29ATP/GTP binding protein-like 2 [Source:MGI Symbol;... [more]
Agbl20.000e+045.29ATP/GTP binding protein-like 2 [Source:MGI Symbol;... [more]
Agbl20.000e+045.29ATP/GTP binding protein-like 2 [Source:MGI Symbol;... [more]
back to top
BLAST of Cytosolic carboxypeptidase 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8CDK2|CBPC2_MOUSE0.000e+045.29Cytosolic carboxypeptidase 2 OS=Mus musculus OX=10... [more]
sp|A6H8T7|CBPC2_DANRE0.000e+045.68Cytosolic carboxypeptidase 2 OS=Danio rerio OX=795... [more]
sp|Q0P4M4|CBPC2_XENTR0.000e+046.93Cytosolic carboxypeptidase 2 OS=Xenopus tropicalis... [more]
sp|Q5U5Z8|CBPC2_HUMAN0.000e+048.17Cytosolic carboxypeptidase 2 OS=Homo sapiens OX=96... [more]
sp|Q4R632|CBPC2_MACFA0.000e+043.62Cytosolic carboxypeptidase 2 OS=Macaca fasciculari... [more]
back to top
BLAST of Cytosolic carboxypeptidase 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2C9JRG10.000e+049.69Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A1S3J9690.000e+050.39cytosolic carboxypeptidase 2 isoform X5 OS=Lingula... [more]
A0A2G8K9R70.000e+050.08Putative cytosolic carboxypeptidase 2-like OS=Stic... [more]
K1QKD80.000e+052.74Cytosolic carboxypeptidase 2 OS=Crassostrea gigas ... [more]
A0A3M7R2N70.000e+047.57Cytosolic carboxypeptidase 2 OS=Brachionus plicati... [more]
back to top
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
agbl23.201e-17944.44cytosolic carboxypeptidase 2 [Source:NCBI gene;Acc... [more]
agbl27.183e-17944.44cytosolic carboxypeptidase 2 [Source:NCBI gene;Acc... [more]
agbl21.409e-17847.29cytosolic carboxypeptidase 2 [Source:NCBI gene;Acc... [more]
agbl21.510e-17844.44cytosolic carboxypeptidase 2 [Source:NCBI gene;Acc... [more]
agbl23.566e-17844.44cytosolic carboxypeptidase 2 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
agtpbp11.612e-8839.23ATP/GTP binding protein 1 [Source:NCBI gene;Acc:55... [more]
back to top
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO492705.114e-17753.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO428584.158e-12848.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO474541.759e-6736.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO343058.144e-5542.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO321344.545e-2032.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
agtpbp11.466e-8437.95ATP/GTP binding protein 1 [Source:NCBI gene;Acc:10... [more]
agtpbp11.893e-8437.95ATP/GTP binding protein 1 [Source:NCBI gene;Acc:10... [more]
agtpbp12.116e-8437.95ATP/GTP binding protein 1 [Source:NCBI gene;Acc:10... [more]
ENSORLT00000020650.24.380e-7049.55pep primary_assembly:ASM223467v1:6:31072043:310734... [more]
agbl53.288e-3227.99ATP/GTP binding protein like 5 [Source:NCBI gene;A... [more]
back to top
BLAST of Cytosolic carboxypeptidase 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000058240.10.000e+099.46SMESG000058240.1[more]
SMESG000058240.10.000e+098.49SMESG000058240.1[more]
SMESG000006325.14.476e-10442.11SMESG000006325.1[more]
SMESG000006325.18.604e-10442.11SMESG000006325.1[more]
SMESG000006325.11.322e-10342.11SMESG000006325.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019258 ID=SMED30019258|Name=Cytosolic carboxypeptidase 2|organism=Schmidtea mediterranea sexual|type=transcript|length=2932bp
TAGTTCAATAAATTACAGTAACTGAGGAAACTTTTTGACCTTTTTTTAAT
GAAAATTCAATTAGTCTAATAAAATCATGCTTAAAAGTGAATCAAATTAT
TACTACAATTTAGAGAATTCATACGAAAGATTTATGAAAAAACATCTCCA
ACACTATGGATATTACAAAGGAAACAAATTAATTATGAGAGAACTAGAGG
GATACGAAAAGACTCACGAACACTCACAAAGCGATGAATCCACATCTGAA
TCAGAAAATGCAATCAAATGCAATCAAAAAACAGGCACATCACCATCATT
GAGAACTACTCAGTTGATTTATGATTACTTCGAAGATGGGTCTTACGTAA
GGAAATTAAAAGCTCCTCATAATTACGTTCTTAATTTGCAGCAAGCTCCA
CGATGGCCTATTGAAATGCAAGTTCTCCCGGAAAGAATTCATCATATCAC
TGCTCTTCCTCAACAGAGAGAATTTATTTACATACCAAGCAATTCAGAAT
TAAAGCCTCAGCCAAGAGGGGAAGAAAATGGACGACTCATATTTGAGTAT
AAAACATGTTCAGGCCCTTATTTTACAAAATCAAAAACCATCTCAAAAGA
AATTGGAAATCTGCTCCCGGTTACAGCAGAATTCGAATCAGAATCCGATG
AAACACTTTGTTTCGAATCACGGTTTGAATCTGGGAATTTAGAAAAAGTC
TACAAAATCTCACCGTTCGAGTACGAATTGCATTTGCGTCCTGATTTGTA
CACATCAAAACACACACAATGGTACTATTTTAGAGTTTCGAATACTCGGG
AAAACAAAATGTACAGATTTACTATTGTCAATTTCTATAAAGCTGAAAGT
CTATATAATGAAGGTCTGAAGCCACTTTTATACAGCGAAAAAGACGCACG
GTTGTCAAATAAGGGATGGAGAAGATGGGGAAGCAATATTGCATACTATA
GAAATAACCTCAAATATGAAACCAAAAAGGGAGAAAATTATTATTATTCT
CTAACCTGGAACTGTTTATTTCCGCATGACAATGATACCGTTTATTTTAG
TCATTGTTATCCCTATACCTATTCAAATCTAATGAAATATGTTGAGACTG
TCTCTAAAGATCCAGTTAAAAGCAAAATATGCCGTATTAAGCTACTTACA
AAATCACTGGCTGAAAATATTAGTCTTTTATTAACAATAACAAATTCATT
CACAGAACAAGAAAGAAAAAACTACAAAAAAATTATTCTTATTACTGGAC
GTGTTCATCCAGGAGAAACAAATGCTAGTTGGATGATGGAAGGAGTTCTC
GACTTCTTATTAAGCGATAAACCAGACGCCATGTTGTTGAGAGATTTGTT
TATTTTCAAAATAGTCCCAATGCTCAATCCAGACGGTGTTATAGTTGGAA
ACTACAGGTGCTCTCTCACCGGAAGAGATCTGAACCGGAACTACAAGTCA
AAACTGAAAGATTATTATCCAATAATATGCAGTGTTAAAAATCTCGCTGA
AAAATTATTAAAAGATCACGAAATATTATTTTATTGTGATTTCCACGGAC
ATAGCAGAAAAAATAACATCTTCATGTATGGTTGCAATGATCAAAAATCC
GAAAATGAATTTTTACTTGAAAGAGCGTTTCCGTATATTCTTGCTAAAAA
TGCTTCTGATAAATTTGATTACAAAAGTTGCAAATTCAAAATGCAGAAAA
GCAAAAGTGGTACAAGTCGGATAGTTTTCAGAAATTTCGGGATACCCCAC
AGCTTCACTTTGGAAGCTTCGTTCTGTGGAACGGATTTAATTTCAAATAC
CAATAGCAATAGAAATGAGCAATTTTATCATTTTAATACCGATGACCTTA
AAAAGATGGGAGAAGCTTTTTGTTATTCGCTATTAGACTTTTCTGATCCA
GATCAGACGCAAATGAACATTATTCTTGACAATATTAAAGAAGATCTAAC
GAAAAGATATACAAATAAATTAGAGACCAGAGGAATTAATATAGATGGCA
ATAAAATATTATCAATTAGTGTTCTTGATCTAGATTTAGATGATGGATCC
AGTGGAGATGATGATGGCTCTGACAGCTCGGATTCAAATGGCTTACCATC
ATATTGTGAGTATGTGGAAGAAAATAGAGTGAAAAAAGTTAAACGTAAAG
AACATAAAGAAAAAAAAAGTGCACCTAAAGAATTGATTGAAAATAAGTCA
CTTTTGGGAGCACGATGCTTGACTTGTCTCAGTCTCAATTACAATAATAT
TACCCCGATCAAAACTCCAGTTGAAAATAAACCGAAATTTGTCCATTTCA
ATGAAACAAATAAAAAAAAACTCAAATCCCCATCACCAAAAACTGATCGC
ACTTTAAGCATTGATGAAAAAGAAAGAGGTGTAATTTTACCAAAATGTTA
TACAAATAATTTAGTGTTTAAAAGATTTTCACCGAATTTGCAAGAAGAAC
CAACAAAATTGACTTATCAAGAAATTGAAGCATCGAGAATTCAGTTGTCA
TATCCCGGTGTCTCAAAATACAAATCAGAGAAAACTGTTGAAAGCTTGTG
TCCTCTTCACATTTCCGAATCATTAAAAGACAAAGAAAAACGATCCAGAA
AACATACAAATTATGTATTTCGGAAACCATCTACAATATTGAATAACCAA
GATTTTTTAACAAAACCATATCCACAACAAAACATAATTCGACCAACTTC
TGGTTTGCCAACAAATACATTTCAAATCCTCAGTTTTAAAAATATGTTGA
CAGAACCCAACAATAAACTTCGGGTAGACCGCCATAAATCACTGAATCCA
ATAAAAAGAGTCCAGTCAATAACAATTTCCAAAAAGAATTCAAAACAATC
AGAAAATTTCAAACCAACTGAGAAACCTTTGTCAATATCGAATATAATTG
AAAATTAATGAAAATACTTCCCAGAAATGCTC
back to top

protein sequence of SMED30019258-orf-1

>SMED30019258-orf-1 ID=SMED30019258-orf-1|Name=SMED30019258-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=944bp
MLKSESNYYYNLENSYERFMKKHLQHYGYYKGNKLIMRELEGYEKTHEHS
QSDESTSESENAIKCNQKTGTSPSLRTTQLIYDYFEDGSYVRKLKAPHNY
VLNLQQAPRWPIEMQVLPERIHHITALPQQREFIYIPSNSELKPQPRGEE
NGRLIFEYKTCSGPYFTKSKTISKEIGNLLPVTAEFESESDETLCFESRF
ESGNLEKVYKISPFEYELHLRPDLYTSKHTQWYYFRVSNTRENKMYRFTI
VNFYKAESLYNEGLKPLLYSEKDARLSNKGWRRWGSNIAYYRNNLKYETK
KGENYYYSLTWNCLFPHDNDTVYFSHCYPYTYSNLMKYVETVSKDPVKSK
ICRIKLLTKSLAENISLLLTITNSFTEQERKNYKKIILITGRVHPGETNA
SWMMEGVLDFLLSDKPDAMLLRDLFIFKIVPMLNPDGVIVGNYRCSLTGR
DLNRNYKSKLKDYYPIICSVKNLAEKLLKDHEILFYCDFHGHSRKNNIFM
YGCNDQKSENEFLLERAFPYILAKNASDKFDYKSCKFKMQKSKSGTSRIV
FRNFGIPHSFTLEASFCGTDLISNTNSNRNEQFYHFNTDDLKKMGEAFCY
SLLDFSDPDQTQMNIILDNIKEDLTKRYTNKLETRGINIDGNKILSISVL
DLDLDDGSSGDDDGSDSSDSNGLPSYCEYVEENRVKKVKRKEHKEKKSAP
KELIENKSLLGARCLTCLSLNYNNITPIKTPVENKPKFVHFNETNKKKLK
SPSPKTDRTLSIDEKERGVILPKCYTNNLVFKRFSPNLQEEPTKLTYQEI
EASRIQLSYPGVSKYKSEKTVESLCPLHISESLKDKEKRSRKHTNYVFRK
PSTILNNQDFLTKPYPQQNIIRPTSGLPTNTFQILSFKNMLTEPNNKLRV
DRHKSLNPIKRVQSITISKKNSKQSENFKPTEKPLSISNIIEN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR040626Pepdidase_M14_N
IPR000834Peptidase_M14
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
Vocabulary: molecular function
TermDefinition
GO:0004181metallocarboxypeptidase activity
GO:0008270zinc ion binding
GO:0004180carboxypeptidase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000834Peptidase M14, carboxypeptidase APFAMPF00246Peptidase_M14coord: 349..575
e-value: 1.1E-16
score: 61.6
IPR040626Cytosolic carboxypeptidase, N-terminalPFAMPF18027Pepdidase_M14_Ncoord: 196..326
e-value: 1.5E-17
score: 63.9
NoneNo IPR availableGENE3DG3DSA:2.60.40.3120coord: 183..330
e-value: 2.0E-16
score: 61.8
NoneNo IPR availableGENE3DG3DSA:3.40.630.10coord: 337..608
e-value: 5.7E-70
score: 237.7
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 56..70
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 44..70
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 920..943
NoneNo IPR availablePANTHERPTHR12756:SF41CYTOSOLIC CARBOXYPEPTIDASE 2coord: 9..698
NoneNo IPR availablePANTHERPTHR12756ATP/GTP-BINDING MOTIF CONTAINING PROTEIN RELATEDcoord: 9..698
NoneNo IPR availableCDDcd06907M14_AGBL2-3_likecoord: 348..605
e-value: 8.50915E-133
score: 397.053
NoneNo IPR availableSUPERFAMILYSSF53187Zn-dependent exopeptidasescoord: 320..611