Immunoglobulin superfamily member 10

Overview
NameImmunoglobulin superfamily member 10
Smed IDSMED30019253
Length (bp)1965
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Immunoglobulin superfamily member 10 (SMED30019253) t-SNE clustered cells

Violin plots show distribution of expression levels for Immunoglobulin superfamily member 10 (SMED30019253) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Immunoglobulin superfamily member 10 (SMED30019253) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Immunoglobulin superfamily member 10 (SMED30019253) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019253

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30019253SMESG000044503.1 SmedASXL_014412SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30019253SMESG000044503.1 dd_Smed_v4_11299_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30019253SMESG000044503.1 dd_Smed_v6_11299_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Immunoglobulin superfamily member 10 vs. Ensembl Human
Match: SLIT2 (slit guidance ligand 2 [Source:HGNC Symbol;Acc:HGNC:11086])

HSP 1 Score: 85.1149 bits (209), Expect = 2.651e-16
Identity = 72/241 (29.88%), Postives = 119/241 (49.38%), Query Frame = 1
Query:  460 PSLCNNRCLCIPQNMVVCNANDAIRAIPTNVPKTFSRLLIQNIDLISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSG-LNLKELHLMENPYIKIETGSFSG-LKVKQINLRSNFISHLSSSEFKDL-DVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNC 1173
            P  C  +C C   + V C+   A+R++P N+P+   RL + N + I+RI  K++  GL HL  L+++  KI  IE  AF+++ +L  L L+ N +++     F G   L  L L EN    I   +F G + +K + L  N IS +    F+ L D+E L L NN++  +     +   K      +  N L+CDCHL WL+  L+ + +  +      C+ PS L    +  +  ++  C
Sbjct:   25 PQACPAQCSC-SGSTVDCHGL-ALRSVPRNIPRNTERLDL-NGNNITRIT-KTDFAGLRHLRVLQLMENKISTIERGAFQDLKELERLRLNRNHLQLFPELLFLGTAKLYRLDLSENQIQAIPRKAFRGAVDIKNLQLDYNQISCIEDGAFRALRDLEVLTLNNNNITRLSVASFNHMPK-LRTFRLHSNNLYCDCHLAWLSDWLRQRPRVGLY---TQCMGPSHLRGHNVAEVQKREFVC 257          

HSP 2 Score: 72.0182 bits (175), Expect = 2.759e-12
Identity = 59/241 (24.48%), Postives = 102/241 (42.32%), Query Frame = 1
Query:  463 SLCNNRCLCIPQNMVVCNANDAIRAIPTNVPKTFSRLLIQNIDLISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGL-NLKELHLMENPYIKIETGSFSGLKVKQINLRSNFISHLSSSEFKDLDVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNCRRP 1182
            S C   C C+  + VV  +N  ++ +P  +P+  + L +   D     +    L+  +HL+ + +   +I  +  ++F NM QL  L LS+NR+R I P+TF GL +L+ L L  N    +  G+F+ L           +SHL+                                      I  NPL+CDC++QWL+  ++ + K+        C  P  +  + L++   K   C+ P
Sbjct:  729 SRCPTECTCL--DTVVRCSNKGLKVLPKGIPRDVTELYL---DGNQFTLVPKELSNYKHLTLIDLSNNRISTLSNQSFSNMTQLLTLILSYNRLRCIPPRTFDGLKSLRLLSLHGNDISVVPEGAFNDLSA---------LSHLA--------------------------------------IGANPLYCDCNMQWLSDWVKSEYKEPG---IARCAGPGEMADKLLLTTPSKKFTCQGP 914          

HSP 3 Score: 71.2478 bits (173), Expect = 4.935e-12
Identity = 68/239 (28.45%), Postives = 107/239 (44.77%), Query Frame = 1
Query:  469 CNNRCLCIPQNMVVCNANDAIRAIPTNVPKTFSRL-LIQNIDLISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGL-NLKELHLMENPYIKIETGSFSG-LKVKQINLRSNFISHLSSSEFKDL-DVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNC 1173
            C   C C   N+V C     +  IPTN+P+T + + L QN                            I+VI   AF    +L  +DLS+N+I  +AP  F GL +L  L L  N   ++    F G   ++ + L +N I+ L    F+DL ++  L L++N L+TI +G  S   +    + + +NP  CDCHL+WLA  L     + ++     C +P  L  + +  +  K   C
Sbjct:  277 CPAACTC-SNNIVDCRGK-GLTEIPTNLPETITEIRLEQNT---------------------------IKVIPPGAFSPYKKLRRIDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHNLNLLSLYDNKLQTIAKGTFSPL-RAIQTMHLAQNPFICDCHLKWLADYLH---TNPIETSGARCTSPRRLANKRIGQIKSKKFRC 482          

HSP 4 Score: 68.5514 bits (166), Expect = 3.379e-11
Identity = 56/196 (28.57%), Postives = 96/196 (48.98%), Query Frame = 1
Query:  676 VIEARA-FENMVQLYYLDLSHNRIRIIAPQTFSGL-NLKELHLMENPYIKIETGSFSGLK-VKQINLRSNFISHLSSSEFKDLD-VEKLFLFNNSLKTIDQGMMSIFDKPHHL--IDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNCRRPHIQSLAIDFSSSQTQLSCLAT 1245
            V+EA   F+ + QL  ++ S+N+I  I    F G   + E+ L  N    ++   F GL+ +K + LRSN I+ + +  F  L  V  L L++N + T+  G    FD  H L  +++  NP +C+C+L WL + L+   K  +   +  C  P  L + P+  ++ +D  C   +  +     S   T+ +CL T
Sbjct:  551 VLEATGIFKKLPQLRKINFSNNKITDIEEGAFEGASGVNEILLTSNRLENVQHKMFKGLESLKTLMLRSNRITCVGNDSFIGLSSVRLLSLYDNQITTVAPGA---FDTLHSLSTLNLLANPFNCNCYLAWLGEWLR---KKRIVTGNPRCQKPYFLKEIPIQDVAIQDFTCDDGNDDNSCSPLSRCPTECTCLDT 740          
BLAST of Immunoglobulin superfamily member 10 vs. Ensembl Human
Match: SLIT2 (slit guidance ligand 2 [Source:HGNC Symbol;Acc:HGNC:11086])

HSP 1 Score: 84.7297 bits (208), Expect = 3.008e-16
Identity = 72/241 (29.88%), Postives = 119/241 (49.38%), Query Frame = 1
Query:  460 PSLCNNRCLCIPQNMVVCNANDAIRAIPTNVPKTFSRLLIQNIDLISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSG-LNLKELHLMENPYIKIETGSFSG-LKVKQINLRSNFISHLSSSEFKDL-DVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNC 1173
            P  C  +C C   + V C+   A+R++P N+P+   RL + N + I+RI  K++  GL HL  L+++  KI  IE  AF+++ +L  L L+ N +++     F G   L  L L EN    I   +F G + +K + L  N IS +    F+ L D+E L L NN++  +     +   K      +  N L+CDCHL WL+  L+ + +  +      C+ PS L    +  +  ++  C
Sbjct:   25 PQACPAQCSC-SGSTVDCHGL-ALRSVPRNIPRNTERLDL-NGNNITRIT-KTDFAGLRHLRVLQLMENKISTIERGAFQDLKELERLRLNRNHLQLFPELLFLGTAKLYRLDLSENQIQAIPRKAFRGAVDIKNLQLDYNQISCIEDGAFRALRDLEVLTLNNNNITRLSVASFNHMPK-LRTFRLHSNNLYCDCHLAWLSDWLRQRPRVGLY---TQCMGPSHLRGHNVAEVQKREFVC 257          

HSP 2 Score: 72.0182 bits (175), Expect = 2.923e-12
Identity = 59/241 (24.48%), Postives = 102/241 (42.32%), Query Frame = 1
Query:  463 SLCNNRCLCIPQNMVVCNANDAIRAIPTNVPKTFSRLLIQNIDLISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGL-NLKELHLMENPYIKIETGSFSGLKVKQINLRSNFISHLSSSEFKDLDVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNCRRP 1182
            S C   C C+  + VV  +N  ++ +P  +P+  + L +   D     +    L+  +HL+ + +   +I  +  ++F NM QL  L LS+NR+R I P+TF GL +L+ L L  N    +  G+F+ L           +SHL+                                      I  NPL+CDC++QWL+  ++ + K+        C  P  +  + L++   K   C+ P
Sbjct:  725 SRCPTECTCL--DTVVRCSNKGLKVLPKGIPRDVTELYL---DGNQFTLVPKELSNYKHLTLIDLSNNRISTLSNQSFSNMTQLLTLILSYNRLRCIPPRTFDGLKSLRLLSLHGNDISVVPEGAFNDLSA---------LSHLA--------------------------------------IGANPLYCDCNMQWLSDWVKSEYKEPG---IARCAGPGEMADKLLLTTPSKKFTCQGP 910          

HSP 3 Score: 71.2478 bits (173), Expect = 4.968e-12
Identity = 68/239 (28.45%), Postives = 107/239 (44.77%), Query Frame = 1
Query:  469 CNNRCLCIPQNMVVCNANDAIRAIPTNVPKTFSRL-LIQNIDLISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGL-NLKELHLMENPYIKIETGSFSG-LKVKQINLRSNFISHLSSSEFKDL-DVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNC 1173
            C   C C   N+V C     +  IPTN+P+T + + L QN                            I+VI   AF    +L  +DLS+N+I  +AP  F GL +L  L L  N   ++    F G   ++ + L +N I+ L    F+DL ++  L L++N L+TI +G  S   +    + + +NP  CDCHL+WLA  L     + ++     C +P  L  + +  +  K   C
Sbjct:  273 CPAACTC-SNNIVDCRGK-GLTEIPTNLPETITEIRLEQNT---------------------------IKVIPPGAFSPYKKLRRIDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHNLNLLSLYDNKLQTIAKGTFSPL-RAIQTMHLAQNPFICDCHLKWLADYLH---TNPIETSGARCTSPRRLANKRIGQIKSKKFRC 478          

HSP 4 Score: 68.5514 bits (166), Expect = 3.551e-11
Identity = 56/196 (28.57%), Postives = 96/196 (48.98%), Query Frame = 1
Query:  676 VIEARA-FENMVQLYYLDLSHNRIRIIAPQTFSGL-NLKELHLMENPYIKIETGSFSGLK-VKQINLRSNFISHLSSSEFKDLD-VEKLFLFNNSLKTIDQGMMSIFDKPHHL--IDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNCRRPHIQSLAIDFSSSQTQLSCLAT 1245
            V+EA   F+ + QL  ++ S+N+I  I    F G   + E+ L  N    ++   F GL+ +K + LRSN I+ + +  F  L  V  L L++N + T+  G    FD  H L  +++  NP +C+C+L WL + L+   K  +   +  C  P  L + P+  ++ +D  C   +  +     S   T+ +CL T
Sbjct:  547 VLEATGIFKKLPQLRKINFSNNKITDIEEGAFEGASGVNEILLTSNRLENVQHKMFKGLESLKTLMLRSNRITCVGNDSFIGLSSVRLLSLYDNQITTVAPGA---FDTLHSLSTLNLLANPFNCNCYLAWLGEWLR---KKRIVTGNPRCQKPYFLKEIPIQDVAIQDFTCDDGNDDNSCSPLSRCPTECTCLDT 736          
BLAST of Immunoglobulin superfamily member 10 vs. Ensembl Human
Match: SLIT2 (slit guidance ligand 2 [Source:HGNC Symbol;Acc:HGNC:11086])

HSP 1 Score: 84.7297 bits (208), Expect = 3.509e-16
Identity = 72/241 (29.88%), Postives = 119/241 (49.38%), Query Frame = 1
Query:  460 PSLCNNRCLCIPQNMVVCNANDAIRAIPTNVPKTFSRLLIQNIDLISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSG-LNLKELHLMENPYIKIETGSFSG-LKVKQINLRSNFISHLSSSEFKDL-DVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNC 1173
            P  C  +C C   + V C+   A+R++P N+P+   RL + N + I+RI  K++  GL HL  L+++  KI  IE  AF+++ +L  L L+ N +++     F G   L  L L EN    I   +F G + +K + L  N IS +    F+ L D+E L L NN++  +     +   K      +  N L+CDCHL WL+  L+ + +  +      C+ PS L    +  +  ++  C
Sbjct:   25 PQACPAQCSC-SGSTVDCHGL-ALRSVPRNIPRNTERLDL-NGNNITRIT-KTDFAGLRHLRVLQLMENKISTIERGAFQDLKELERLRLNRNHLQLFPELLFLGTAKLYRLDLSENQIQAIPRKAFRGAVDIKNLQLDYNQISCIEDGAFRALRDLEVLTLNNNNITRLSVASFNHMPK-LRTFRLHSNNLYCDCHLAWLSDWLRQRPRVGLY---TQCMGPSHLRGHNVAEVQKREFVC 257          

HSP 2 Score: 71.633 bits (174), Expect = 3.437e-12
Identity = 59/241 (24.48%), Postives = 102/241 (42.32%), Query Frame = 1
Query:  463 SLCNNRCLCIPQNMVVCNANDAIRAIPTNVPKTFSRLLIQNIDLISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGL-NLKELHLMENPYIKIETGSFSGLKVKQINLRSNFISHLSSSEFKDLDVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNCRRP 1182
            S C   C C+  + VV  +N  ++ +P  +P+  + L +   D     +    L+  +HL+ + +   +I  +  ++F NM QL  L LS+NR+R I P+TF GL +L+ L L  N    +  G+F+ L           +SHL+                                      I  NPL+CDC++QWL+  ++ + K+        C  P  +  + L++   K   C+ P
Sbjct:  721 SRCPTECTCL--DTVVRCSNKGLKVLPKGIPRDVTELYL---DGNQFTLVPKELSNYKHLTLIDLSNNRISTLSNQSFSNMTQLLTLILSYNRLRCIPPRTFDGLKSLRLLSLHGNDISVVPEGAFNDLSA---------LSHLA--------------------------------------IGANPLYCDCNMQWLSDWVKSEYKEPG---IARCAGPGEMADKLLLTTPSKKFTCQGP 906          

HSP 3 Score: 70.8626 bits (172), Expect = 5.993e-12
Identity = 68/239 (28.45%), Postives = 107/239 (44.77%), Query Frame = 1
Query:  469 CNNRCLCIPQNMVVCNANDAIRAIPTNVPKTFSRL-LIQNIDLISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGL-NLKELHLMENPYIKIETGSFSG-LKVKQINLRSNFISHLSSSEFKDL-DVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNC 1173
            C   C C   N+V C     +  IPTN+P+T + + L QN                            I+VI   AF    +L  +DLS+N+I  +AP  F GL +L  L L  N   ++    F G   ++ + L +N I+ L    F+DL ++  L L++N L+TI +G  S   +    + + +NP  CDCHL+WLA  L     + ++     C +P  L  + +  +  K   C
Sbjct:  277 CPAACTC-SNNIVDCRGK-GLTEIPTNLPETITEIRLEQNT---------------------------IKVIPPGAFSPYKKLRRIDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHNLNLLSLYDNKLQTIAKGTFSPL-RAIQTMHLAQNPFICDCHLKWLADYLH---TNPIETSGARCTSPRRLANKRIGQIKSKKFRC 482          

HSP 4 Score: 68.1662 bits (165), Expect = 4.000e-11
Identity = 56/196 (28.57%), Postives = 96/196 (48.98%), Query Frame = 1
Query:  676 VIEARA-FENMVQLYYLDLSHNRIRIIAPQTFSGL-NLKELHLMENPYIKIETGSFSGLK-VKQINLRSNFISHLSSSEFKDLD-VEKLFLFNNSLKTIDQGMMSIFDKPHHL--IDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNCRRPHIQSLAIDFSSSQTQLSCLAT 1245
            V+EA   F+ + QL  ++ S+N+I  I    F G   + E+ L  N    ++   F GL+ +K + LRSN I+ + +  F  L  V  L L++N + T+  G    FD  H L  +++  NP +C+C+L WL + L+   K  +   +  C  P  L + P+  ++ +D  C   +  +     S   T+ +CL T
Sbjct:  543 VLEATGIFKKLPQLRKINFSNNKITDIEEGAFEGASGVNEILLTSNRLENVQHKMFKGLESLKTLMLRSNRITCVGNDSFIGLSSVRLLSLYDNQITTVAPGA---FDTLHSLSTLNLLANPFNCNCYLAWLGEWLR---KKRIVTGNPRCQKPYFLKEIPIQDVAIQDFTCDDGNDDNSCSPLSRCPTECTCLDT 732          
BLAST of Immunoglobulin superfamily member 10 vs. Ensembl Human
Match: SLIT2 (slit guidance ligand 2 [Source:HGNC Symbol;Acc:HGNC:11086])

HSP 1 Score: 84.7297 bits (208), Expect = 3.537e-16
Identity = 72/241 (29.88%), Postives = 119/241 (49.38%), Query Frame = 1
Query:  460 PSLCNNRCLCIPQNMVVCNANDAIRAIPTNVPKTFSRLLIQNIDLISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSG-LNLKELHLMENPYIKIETGSFSG-LKVKQINLRSNFISHLSSSEFKDL-DVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNC 1173
            P  C  +C C   + V C+   A+R++P N+P+   RL + N + I+RI  K++  GL HL  L+++  KI  IE  AF+++ +L  L L+ N +++     F G   L  L L EN    I   +F G + +K + L  N IS +    F+ L D+E L L NN++  +     +   K      +  N L+CDCHL WL+  L+ + +  +      C+ PS L    +  +  ++  C
Sbjct:   25 PQACPAQCSC-SGSTVDCHGL-ALRSVPRNIPRNTERLDL-NGNNITRIT-KTDFAGLRHLRVLQLMENKISTIERGAFQDLKELERLRLNRNHLQLFPELLFLGTAKLYRLDLSENQIQAIPRKAFRGAVDIKNLQLDYNQISCIEDGAFRALRDLEVLTLNNNNITRLSVASFNHMPK-LRTFRLHSNNLYCDCHLAWLSDWLRQRPRVGLY---TQCMGPSHLRGHNVAEVQKREFVC 257          

HSP 2 Score: 71.633 bits (174), Expect = 3.348e-12
Identity = 59/241 (24.48%), Postives = 102/241 (42.32%), Query Frame = 1
Query:  463 SLCNNRCLCIPQNMVVCNANDAIRAIPTNVPKTFSRLLIQNIDLISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGL-NLKELHLMENPYIKIETGSFSGLKVKQINLRSNFISHLSSSEFKDLDVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNCRRP 1182
            S C   C C+  + VV  +N  ++ +P  +P+  + L +   D     +    L+  +HL+ + +   +I  +  ++F NM QL  L LS+NR+R I P+TF GL +L+ L L  N    +  G+F+ L           +SHL+                                      I  NPL+CDC++QWL+  ++ + K+        C  P  +  + L++   K   C+ P
Sbjct:  717 SRCPTECTCL--DTVVRCSNKGLKVLPKGIPRDVTELYL---DGNQFTLVPKELSNYKHLTLIDLSNNRISTLSNQSFSNMTQLLTLILSYNRLRCIPPRTFDGLKSLRLLSLHGNDISVVPEGAFNDLSA---------LSHLA--------------------------------------IGANPLYCDCNMQWLSDWVKSEYKEPG---IARCAGPGEMADKLLLTTPSKKFTCQGP 902          

HSP 3 Score: 70.8626 bits (172), Expect = 5.990e-12
Identity = 68/239 (28.45%), Postives = 107/239 (44.77%), Query Frame = 1
Query:  469 CNNRCLCIPQNMVVCNANDAIRAIPTNVPKTFSRL-LIQNIDLISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGL-NLKELHLMENPYIKIETGSFSG-LKVKQINLRSNFISHLSSSEFKDL-DVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNC 1173
            C   C C   N+V C     +  IPTN+P+T + + L QN                            I+VI   AF    +L  +DLS+N+I  +AP  F GL +L  L L  N   ++    F G   ++ + L +N I+ L    F+DL ++  L L++N L+TI +G  S   +    + + +NP  CDCHL+WLA  L     + ++     C +P  L  + +  +  K   C
Sbjct:  273 CPAACTC-SNNIVDCRGK-GLTEIPTNLPETITEIRLEQNT---------------------------IKVIPPGAFSPYKKLRRIDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHNLNLLSLYDNKLQTIAKGTFSPL-RAIQTMHLAQNPFICDCHLKWLADYLH---TNPIETSGARCTSPRRLANKRIGQIKSKKFRC 478          

HSP 4 Score: 68.1662 bits (165), Expect = 3.998e-11
Identity = 56/196 (28.57%), Postives = 96/196 (48.98%), Query Frame = 1
Query:  676 VIEARA-FENMVQLYYLDLSHNRIRIIAPQTFSGL-NLKELHLMENPYIKIETGSFSGLK-VKQINLRSNFISHLSSSEFKDLD-VEKLFLFNNSLKTIDQGMMSIFDKPHHL--IDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNCRRPHIQSLAIDFSSSQTQLSCLAT 1245
            V+EA   F+ + QL  ++ S+N+I  I    F G   + E+ L  N    ++   F GL+ +K + LRSN I+ + +  F  L  V  L L++N + T+  G    FD  H L  +++  NP +C+C+L WL + L+   K  +   +  C  P  L + P+  ++ +D  C   +  +     S   T+ +CL T
Sbjct:  539 VLEATGIFKKLPQLRKINFSNNKITDIEEGAFEGASGVNEILLTSNRLENVQHKMFKGLESLKTLMLRSNRITCVGNDSFIGLSSVRLLSLYDNQITTVAPGA---FDTLHSLSTLNLLANPFNCNCYLAWLGEWLR---KKRIVTGNPRCQKPYFLKEIPIQDVAIQDFTCDDGNDDNSCSPLSRCPTECTCLDT 728          
BLAST of Immunoglobulin superfamily member 10 vs. Ensembl Human
Match: SLIT1 (slit guidance ligand 1 [Source:HGNC Symbol;Acc:HGNC:11085])

HSP 1 Score: 78.5666 bits (192), Expect = 7.030e-15
Identity = 67/209 (32.06%), Postives = 108/209 (51.67%), Query Frame = 1
Query:  463 SLCNNRCLCIPQNMVVCNANDAIRAIPTNVPKTFSRLLIQNIDLISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTF-SGLNLKELHLMENPYIKIETGSFSGLK-VKQINLRSNFISHLSSSEFKDL-DVEKLFLFNNSLKTIDQGMMSIFDKPHHL--IDITRNPLHCDCHLQWLAKNLQHQ 1074
            S C   C C     V C+    ++AIP N+P+   RL + N + I+RI +K++  GL+ L  L+++  +I  +E  AF++M +L  L L+ N++ ++    F +   L  L L EN    I   +F G   +K + L  N IS +    F+ L  +E L L NN++ TI    +S F+    L    +  N L CDCHL WL++ L+ +
Sbjct:   32 SACPALCTCT-GTTVDCHGT-GLQAIPKNIPRNTERLEL-NGNNITRI-HKNDFAGLKQLRVLQLMENQIGAVERGAFDDMKELERLRLNRNQLHMLPELLFQNNQALSRLDLSENAIQAIPRKAFRGATDLKNLQLDKNQISCIEEGAFRALRGLEVLTLNNNNITTIP---VSSFNHMPKLRTFRLHSNHLFCDCHLAWLSQWLRQR 233          
BLAST of Immunoglobulin superfamily member 10 vs. Ensembl Celegans
Match: pxn-1 (Peroxidasin homolog [Source:UniProtKB/Swiss-Prot;Acc:Q1ENI8])

HSP 1 Score: 69.3218 bits (168), Expect = 7.308e-12
Identity = 68/279 (24.37%), Postives = 114/279 (40.86%), Query Frame = 1
Query:  469 CNNRCLCIPQNMVVCNANDAIRAIPTNVPKTFSRLLIQNIDLISRI--IYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAP-----QTFSGLNLKELHLMENPYIKIETGSFSGLKVKQINLRSNFISHLSSSEFKDLDVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNCRRPHIQSLAIDFSSSQTQLSCLATSESREAEISWTYE 1284
            C   C C  + +VV  ++  +  IP N+ +    L+I+N    +RI  + +S+L G   L  L + + KI++IE    +++ +L  L L+HN +  I P     +  + LNLK  H+                          FI       F DL   +L   +N ++++   +        H   +  NP HCDC    +   LQ    +   Y    C  P  L  + L  + D  L C RP  +S    ++  + +L+C   S S+   + W YE
Sbjct:   23 CPVECTCDKKGLVVDCSSSGLTRIPKNISRNVRSLVIRN----NRIHKLKRSDLEGFNQLETLVLTHNKIKIIEENVLDHLPELKRLSLAHNELVYIPPLCSDSRPLASLNLKRNHIQ-------------------------FIDEQVLRYFPDL--TQLDFSHNRIQSLRTKLFDNLPALSH-AHLHSNPWHCDCRASKVKALLQKVKWEKKVY----CTNPVELRHQALDEVDDSALTCARPAEES----WTGEEIKLTCAKNSSSK--LVVWMYE 259          
BLAST of Immunoglobulin superfamily member 10 vs. Ensembl Celegans
Match: slt-1 (Slit homolog 1 protein [Source:UniProtKB/Swiss-Prot;Acc:G5EFX6])

HSP 1 Score: 53.5286 bits (127), Expect = 4.624e-7
Identity = 61/215 (28.37%), Postives = 95/215 (44.19%), Query Frame = 1
Query:  667 KIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGL-NLKELHLMENPYIKIETGSFSGLKVKQIN---------LRSNFISHLSSSEFKDLDVEKLFLFNNSLKTID----QGMMSIFDKPHHLIDITRNPLHCDCHLQWLAK-NLQHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNCRRP------HIQSLAIDFSSSQTQLSCLATS 1248
            +I  I + +F+N+  L  LDLS N I  I P+ F GL NL  L L  N    +++ +F GL   Q+          +R     H+         +  L L++N +K+I     Q + S+       + + +NPL CDC+LQWLA+ NLQ     +++     C  P  L ++   +L      C+        +  S  ID S   TQ  C  T+
Sbjct:  298 QISSIPSHSFKNLKNLTRLDLSKNIITEIQPKAFLGLHNLHTLVLYGNNITDLKSDTFEGLGSLQLLLLNANQLTCIRRGTFDHVPK-------LSMLSLYDNDIKSISEVTFQNLTSL-----STLHLAKNPLICDCNLQWLAQINLQK----NIETSGARCEQPKRLRKKKFATLPPNKFKCKGSESFVSMYADSCFID-SICPTQCDCYGTT 495          

HSP 2 Score: 53.1434 bits (126), Expect = 7.021e-7
Identity = 61/238 (25.63%), Postives = 99/238 (41.60%), Query Frame = 1
Query:  490 IPQNMVVCNANDAIR------AIPTNVPKTFSRLL----IQNIDLISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGLNLKELHLMENPYIKIETGSFSGLKVKQINLRSNFISHLSSSEFKDLDVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNC 1173
            +PQN+     ND IR       I    P  FS L+    +Q +D     I+  + + L  L  L++   +I  +    F+N ++L +LDLS N I +++     G    E+  ++  +I                L +N IS   S       +E L L  N L T ++   + F +    +D+  NP +CDC L+W+ K L+     +       C TP  L    +  L DK + C
Sbjct:   38 VPQNI----PNDTIRLDLQDNEITKIGPNDFSSLMNLKALQLMDNQIVTIHNQSFSSLVFLQKLRLSRNRIRHLPDNVFQNNLKLTHLDLSENDITVVSDAQLQGPEFLEVLNLDKNHI--------------FCLENNVISSWVS-------LEVLTLNGNRLTTFEEPSNARFRQ----LDLFNNPWNCDCRLRWMRKWLEKAEGQN----KTVCATPLNLQGSSIEILQDKFMTC 242          
BLAST of Immunoglobulin superfamily member 10 vs. Ensembl Celegans
Match: pan-1 (P-granule-associated novel protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9U3A0])

HSP 1 Score: 51.9878 bits (123), Expect = 1.154e-6
Identity = 59/210 (28.10%), Postives = 98/210 (46.67%), Query Frame = 1
Query:  607 IYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGL-NLKELHLMENPYIKIETGSFSGLKVKQINLRSNFISHLSSSEFKDLDVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAK----NLQHQSKDDMKYVSITCLTPSI---LYQRPLI-SLSDKDLN--CRRPHIQSLAI 1203
            + K   TGL+ L  L +   KI+ I+  AFE + ++  L L+ N IR++   TF G+ NLK+L L       I+ G+F GL                        +E+L L NN+L+ ID  + S   K   ++D+  N +  +  ++   K     L + + D MK + +  L PS+   L+ R  I S+ D D+    R   I++L++
Sbjct:  142 LEKGLFTGLKSLKTLDLAMNKIQEIDVGAFEELKKVEELLLNENDIRVLKTGTFDGMKNLKKLTLQNCNLEIIQKGAFRGLN----------------------SLEQLILSNNNLENIDWTIFSAL-KNLRVLDLGSNKIS-NVEMKSFPKLEKLVLNNNTIDSMKSIKLKDL-PSLVVALFDRNKIESIGDMDMFGLTRSDRIETLSL 326          
BLAST of Immunoglobulin superfamily member 10 vs. Ensembl Fly
Match: caps (gene:FBgn0023095 transcript:FBtr0346864)

HSP 1 Score: 82.4185 bits (202), Expect = 5.964e-16
Identity = 75/272 (27.57%), Postives = 131/272 (48.16%), Query Frame = 1
Query:  556 KTFSRLLIQNIDLISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGL-NLKELHLMENPYI-KIETGSFSG-LKVKQINLRSNF-ISHLSSSEFKDL-DVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNC------RRPHIQSLAIDFSSSQTQLS-CLATSESREAEISWTYEENGQK-KEFRKLHSSNQ 1332
            K  +RL ++   L +  I    L GL  L +L +   ++  I   AF+ + +L  L++  N   +I+   FSGL  L+ L L     + ++E+G+FSG   ++ +NL SN  ++ LSS     L  +  + L  N L ++D+G++   D     +D++ NP  CDC L WL ++L        +Y  + C  P+ L   PL  L++  L C      ++  I  L +  ++  T L+  L T   R  E+   +   G+K +E++K  S  +
Sbjct:  240 KGLTRLDLRGAGLHN--ISGDALKGLVSLRFLDLSDNRLPAIPTAAFQRLGRLEQLNIGQNDFEVISSGAFSGLRELRHLELTGAQRLRRVESGAFSGNTNLEHLNLSSNKQLNELSSIALGGLPHLSTVVLKANQLSSLDEGLVPWADL--QTLDLSENPFECDCRLLWL-RHLLVSRNASGQYAPVICAYPTALRDLPLAHLAEPLLGCAHGAASKQAIIGILVVACAALITTLALVLYTCRHRIREMLKGHSALGRKEREYQKTFSDEE 506          

HSP 2 Score: 61.2326 bits (147), Expect = 2.516e-9
Identity = 47/167 (28.14%), Postives = 84/167 (50.30%), Query Frame = 1
Query:  469 CNNRCLCIPQNMVVCNANDAIRAIPTNVPKTFSRLLIQNIDLISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGLN-LKELHLMENPYIKIETGSFSGL-KVKQINLRSNFISHLSSSEFKDLD-VEKLFLFNNSLKTI 960
            C N C C    ++V      +  +P  +     RL+I+N  L +     S++     L++L + +  +  I  R+F    +L  L L HN+I  ++ +TF GL+ +  L+L  N   ++E  +FS + K+ ++NL  N ISH+       LD +  L+L +N+L T+
Sbjct:   43 CPNGCECDDDTLMVNCGEGTLDVLPIALNPAIQRLVIKNNKLKT---IDSSMQFYAQLTFLDLSFNDMLTIPERSFAYHAKLQELHLDHNKIGQVSNKTFLGLSTISVLNLRGNLIAELEYRTFSPMVKLAELNLGQNRISHIDPHALDGLDNLRVLYLDDNTLTTV 206          
BLAST of Immunoglobulin superfamily member 10 vs. Ensembl Fly
Match: caps (gene:FBgn0023095 transcript:FBtr0305480)

HSP 1 Score: 81.6481 bits (200), Expect = 1.027e-15
Identity = 62/211 (29.38%), Postives = 105/211 (49.76%), Query Frame = 1
Query:  556 KTFSRLLIQNIDLISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGL-NLKELHLMENPYI-KIETGSFSG-LKVKQINLRSNF-ISHLSSSEFKDL-DVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNC 1173
            K  +RL ++   L +  I    L GL  L +L +   ++  I   AF+ + +L  L++  N   +I+   FSGL  L+ L L     + ++E+G+FSG   ++ +NL SN  ++ LSS     L  +  + L  N L ++D+G++   D     +D++ NP  CDC L WL ++L        +Y  + C  P+ L   PL  L++  L C
Sbjct:  240 KGLTRLDLRGAGLHN--ISGDALKGLVSLRFLDLSDNRLPAIPTAAFQRLGRLEQLNIGQNDFEVISSGAFSGLRELRHLELTGAQRLRRVESGAFSGNTNLEHLNLSSNKQLNELSSIALGGLPHLSTVVLKANQLSSLDEGLVPWADL--QTLDLSENPFECDCRLLWL-RHLLVSRNASGQYAPVICAYPTALRDLPLAHLAEPLLGC 445          

HSP 2 Score: 60.4622 bits (145), Expect = 3.834e-9
Identity = 47/167 (28.14%), Postives = 84/167 (50.30%), Query Frame = 1
Query:  469 CNNRCLCIPQNMVVCNANDAIRAIPTNVPKTFSRLLIQNIDLISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGLN-LKELHLMENPYIKIETGSFSGL-KVKQINLRSNFISHLSSSEFKDLD-VEKLFLFNNSLKTI 960
            C N C C    ++V      +  +P  +     RL+I+N  L +     S++     L++L + +  +  I  R+F    +L  L L HN+I  ++ +TF GL+ +  L+L  N   ++E  +FS + K+ ++NL  N ISH+       LD +  L+L +N+L T+
Sbjct:   43 CPNGCECDDDTLMVNCGEGTLDVLPIALNPAIQRLVIKNNKLKT---IDSSMQFYAQLTFLDLSFNDMLTIPERSFAYHAKLQELHLDHNKIGQVSNKTFLGLSTISVLNLRGNLIAELEYRTFSPMVKLAELNLGQNRISHIDPHALDGLDNLRVLYLDDNTLTTV 206          
BLAST of Immunoglobulin superfamily member 10 vs. Ensembl Fly
Match: caps (gene:FBgn0023095 transcript:FBtr0075832)

HSP 1 Score: 80.8777 bits (198), Expect = 1.381e-15
Identity = 75/272 (27.57%), Postives = 131/272 (48.16%), Query Frame = 1
Query:  556 KTFSRLLIQNIDLISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGL-NLKELHLMENPYI-KIETGSFSG-LKVKQINLRSNF-ISHLSSSEFKDL-DVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNC------RRPHIQSLAIDFSSSQTQLS-CLATSESREAEISWTYEENGQK-KEFRKLHSSNQ 1332
            K  +RL ++   L +  I    L GL  L +L +   ++  I   AF+ + +L  L++  N   +I+   FSGL  L+ L L     + ++E+G+FSG   ++ +NL SN  ++ LSS     L  +  + L  N L ++D+G++   D     +D++ NP  CDC L WL ++L        +Y  + C  P+ L   PL  L++  L C      ++  I  L +  ++  T L+  L T   R  E+   +   G+K +E++K  S  +
Sbjct:  240 KGLTRLDLRGAGLHN--ISGDALKGLVSLRFLDLSDNRLPAIPTAAFQRLGRLEQLNIGQNDFEVISSGAFSGLRELRHLELTGAQRLRRVESGAFSGNTNLEHLNLSSNKQLNELSSIALGGLPHLSTVVLKANQLSSLDEGLVPWADL--QTLDLSENPFECDCRLLWL-RHLLVSRNASGQYAPVICAYPTALRDLPLAHLAEPLLGCAHGAASKQAIIGILVVACAALITTLALVLYTCRHRIREMLKGHSALGRKEREYQKTFSDEE 506          

HSP 2 Score: 58.9214 bits (141), Expect = 8.833e-9
Identity = 47/167 (28.14%), Postives = 84/167 (50.30%), Query Frame = 1
Query:  469 CNNRCLCIPQNMVVCNANDAIRAIPTNVPKTFSRLLIQNIDLISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGLN-LKELHLMENPYIKIETGSFSGL-KVKQINLRSNFISHLSSSEFKDLD-VEKLFLFNNSLKTI 960
            C N C C    ++V      +  +P  +     RL+I+N  L +     S++     L++L + +  +  I  R+F    +L  L L HN+I  ++ +TF GL+ +  L+L  N   ++E  +FS + K+ ++NL  N ISH+       LD +  L+L +N+L T+
Sbjct:   43 CPNGCECDDDTLMVNCGEGTLDVLPIALNPAIQRLVIKNNKLKT---IDSSMQFYAQLTFLDLSFNDMLTIPERSFAYHAKLQELHLDHNKIGQVSNKTFLGLSTISVLNLRGNLIAELEYRTFSPMVKLAELNLGQNRISHIDPHALDGLDNLRVLYLDDNTLTTV 206          
BLAST of Immunoglobulin superfamily member 10 vs. Ensembl Fly
Match: caps (gene:FBgn0023095 transcript:FBtr0075833)

HSP 1 Score: 80.8777 bits (198), Expect = 1.381e-15
Identity = 75/272 (27.57%), Postives = 131/272 (48.16%), Query Frame = 1
Query:  556 KTFSRLLIQNIDLISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGL-NLKELHLMENPYI-KIETGSFSG-LKVKQINLRSNF-ISHLSSSEFKDL-DVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNC------RRPHIQSLAIDFSSSQTQLS-CLATSESREAEISWTYEENGQK-KEFRKLHSSNQ 1332
            K  +RL ++   L +  I    L GL  L +L +   ++  I   AF+ + +L  L++  N   +I+   FSGL  L+ L L     + ++E+G+FSG   ++ +NL SN  ++ LSS     L  +  + L  N L ++D+G++   D     +D++ NP  CDC L WL ++L        +Y  + C  P+ L   PL  L++  L C      ++  I  L +  ++  T L+  L T   R  E+   +   G+K +E++K  S  +
Sbjct:  240 KGLTRLDLRGAGLHN--ISGDALKGLVSLRFLDLSDNRLPAIPTAAFQRLGRLEQLNIGQNDFEVISSGAFSGLRELRHLELTGAQRLRRVESGAFSGNTNLEHLNLSSNKQLNELSSIALGGLPHLSTVVLKANQLSSLDEGLVPWADL--QTLDLSENPFECDCRLLWL-RHLLVSRNASGQYAPVICAYPTALRDLPLAHLAEPLLGCAHGAASKQAIIGILVVACAALITTLALVLYTCRHRIREMLKGHSALGRKEREYQKTFSDEE 506          

HSP 2 Score: 58.9214 bits (141), Expect = 8.833e-9
Identity = 47/167 (28.14%), Postives = 84/167 (50.30%), Query Frame = 1
Query:  469 CNNRCLCIPQNMVVCNANDAIRAIPTNVPKTFSRLLIQNIDLISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGLN-LKELHLMENPYIKIETGSFSGL-KVKQINLRSNFISHLSSSEFKDLD-VEKLFLFNNSLKTI 960
            C N C C    ++V      +  +P  +     RL+I+N  L +     S++     L++L + +  +  I  R+F    +L  L L HN+I  ++ +TF GL+ +  L+L  N   ++E  +FS + K+ ++NL  N ISH+       LD +  L+L +N+L T+
Sbjct:   43 CPNGCECDDDTLMVNCGEGTLDVLPIALNPAIQRLVIKNNKLKT---IDSSMQFYAQLTFLDLSFNDMLTIPERSFAYHAKLQELHLDHNKIGQVSNKTFLGLSTISVLNLRGNLIAELEYRTFSPMVKLAELNLGQNRISHIDPHALDGLDNLRVLYLDDNTLTTV 206          
BLAST of Immunoglobulin superfamily member 10 vs. Ensembl Fly
Match: sli (gene:FBgn0264089 transcript:FBtr0330734)

HSP 1 Score: 80.4925 bits (197), Expect = 3.388e-15
Identity = 66/239 (27.62%), Postives = 118/239 (49.37%), Query Frame = 1
Query:  469 CNNRCLCIPQNMVVCNANDAIRAIPTNVPKTFSRLLIQNIDLISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTF--SGLNLKELHLMENPYIKIETGSFSGLK-VKQINLRSNFISHLSSSEFKDL-DVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNC 1173
            C   C C   N V C ++  + ++P  +     RL +Q  +L   +IY+++   L  L  L++   +I  IE  +F+++V L  L L++NR++ I P+ F  S  +L  L +  N    +    F G + ++ + L +N I+ L    FK L ++E L L NN+L ++   +     +   L  ++ NP  CDCHL WL++ L+  ++         C +PS L  + +  L D++  C
Sbjct:   73 CPRVCSCTGLN-VDC-SHRGLTSVPRKISADVERLELQGNNLT--VIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLRLNNNRLKAI-PENFVTSSASLLRLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRAL-RLSDNPFACDCHLSWLSRFLRSATR---LAPYTRCQSPSQLKGQNVADLHDQEFKC 302          

HSP 2 Score: 55.8398 bits (133), Expect = 1.321e-7
Identity = 53/230 (23.04%), Postives = 92/230 (40.00%), Query Frame = 1
Query:  484 LCIPQNMVVCNANDAIRAIPTNVPKTFSRLLIQNIDLISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGLNLKELHLMENPYIKIETGSFSGLKVKQINLRSNFISHLSSSEFKDLDVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNC 1173
            +C  +   V      ++ IP ++P   + LL+ + +L  RI        L HL  L++   ++  IE  AFE    +  L L  N+I+ I+ + F GL+                      ++K +NL  N IS +    F+ L         NSL +               +++  NP +C+CHL W A+ L+ +S   +   +  C  PS +    +  L   +  C
Sbjct:  546 MCHCEGTTVDCTGRGLKEIPRDIPLHTTELLLNDNEL-GRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLH----------------------QLKTLNLYDNQISCVMPGSFEHL---------NSLTS---------------LNLASNPFNCNCHLAWFAEWLRKKS---LNGGAARCGAPSKVRDVQIKDLPHSEFKC 725          

HSP 3 Score: 55.4546 bits (132), Expect = 1.593e-7
Identity = 50/171 (29.24%), Postives = 85/171 (49.71%), Query Frame = 1
Query:  670 IEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGL-NLKELHLMENPYIKIETGSFSGLKVKQINL-RSNFISHLSSSEFKDLDVEKLFL-FNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNC 1173
            I  +  ++F +  +L  +DLS+N I  IA    SGL  L  L L  N    + +G F GL   Q+ L  +N IS +    F+DL    L   ++N+++++  G      K    + + +NP  CDC+L+WLA  L    K+ ++     C +P  +++R + SL ++   C
Sbjct:  358 ITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAM-KSIKTVHLAKNPFICDCNLRWLADYLH---KNPIETSGARCESPKRMHRRRIESLREEKFKC 524          
BLAST of Immunoglobulin superfamily member 10 vs. Ensembl Zebrafish
Match: slit3 (slit homolog 3 (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-010306-4])

HSP 1 Score: 82.8037 bits (203), Expect = 8.082e-16
Identity = 69/207 (33.33%), Postives = 108/207 (52.17%), Query Frame = 1
Query:  469 CNNRCLCIPQNMVVCNANDAIRAIPTNVPKTFSRLLIQNIDLISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTF-SGLNLKELHLMENPYIKIETGSFSGL-KVKQINLRSNFISHLSSSEFKDL-DVEKLFLFNNSLKTIDQGMMSIFDKPHHL--IDITRNPLHCDCHLQWLAKNLQHQ 1074
            C ++C C   + V C    A + +P  +P+   RL +   + I+RI  K + +GL++L  L +   +I VIE  AFE + QL  + L+ NR++++    F S   L  L L EN    +   +F G+  VK + L SN IS +    F+ L D+E L L NN++  I    +S F+    L  + +  N LHCDCHL WL+  L+ +
Sbjct:   25 CPHKCSC-SGSHVDCQGQ-AFKTVPRGIPRNAERLDLDRNN-ITRIT-KVDFSGLKNLRVLHLENNQISVIERGAFEGLKQLERIRLNRNRLQVLPELLFQSTTKLSRLDLSENQIQAVPRKAFRGITTVKNLQLDSNHISCIEDGAFRALRDLEILTLNNNNITLIP---LSSFNHMPKLRTLRLHSNNLHCDCHLSWLSDWLRQR 224          

HSP 2 Score: 73.1738 bits (178), Expect = 8.740e-13
Identity = 60/186 (32.26%), Postives = 95/186 (51.08%), Query Frame = 1
Query:  634 EHLSYLKIIYCKIEVIEA-RAFENMVQLYYLDLSHNRIRIIAPQTFSGLN-LKELHLMENPYIKIETGSFSGL-KVKQINLRSNFISHLSSSEFKDLD-VEKLFLFNNSLKTIDQGMMSIFDKPHHL--IDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNC 1173
            EH + L++   +I ++EA  AF+ +  L  ++LS+N++R I    F G   + EL L  N    +    F GL  +K + LRSN IS + ++ F  L  V  L L++N + TI  G    F+  H L  I++  NP  CDCHL WL   L+   K  +   +  C  P+ L + P+  ++  D +C
Sbjct:  524 EHTTDLRLNDNEISILEATGAFKKLPNLRKINLSNNKLRDIREGAFDGAGGVLELLLTGNKLQSVSGRMFKGLIGLKTLMLRSNQISCVDNATFTGLSSVRLLSLYDNRISTIAPGA---FNTLHSLSTINLLSNPYVCDCHLAWLGLWLK---KTRVVSGNPRCQKPAFLKEIPIQDVAMPDFSC 703          

HSP 3 Score: 72.0182 bits (175), Expect = 1.937e-12
Identity = 53/135 (39.26%), Postives = 76/135 (56.30%), Query Frame = 1
Query:  670 IEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGL-NLKELHLMENPYIKIETGSFSGLKVKQINL-RSNFISHLSSSEFKDL-DVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNL 1065
            I+ I A AF    +L  +DLS N+I  IA   FSGL +L  L L  N   +I  G F GL   Q+ L  +N I+ L  + FKDL ++  L L++N L+TI +G+ +   +    + + +NP  CDCHL+WLA  L
Sbjct:  311 IKNIPAGAFSTYKKLKRIDLSKNQISEIAEDAFSGLRSLTSLVLYGNKIAEIPKGLFDGLVSLQLLLLNANKINCLRVNTFKDLQNLNLLSLYDNKLQTISKGLFAPL-RAIKTLHLAQNPFMCDCHLKWLADYL 444          

HSP 4 Score: 55.8398 bits (133), Expect = 1.575e-7
Identity = 63/254 (24.80%), Postives = 93/254 (36.61%), Query Frame = 1
Query:  487 CIPQNMVVCNANDAIRAIPTNVPKTFSRLLIQNIDLISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGLNLKELHLMENPYIKIETGSFSGLKVKQINLRSNFISHLSSSEFKDLDVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSIT-CLTPSILYQRPLISLSDKDLNCRRPHIQSLAIDFSSSQTQLSCLAT 1245
            C     VV  +N  +R++P  +PK  + L ++   L S       L  L+ L+ L +    I  +    F NM QL  L LS+N+IR +    F GL  + L L                                           L L  N L T+ +G  +      HL  +  NPL+CDC L+WL++ +    K   K   I  C  P  +  R L++       C+ P       D +       CLAT
Sbjct:  722 CTCSETVVRCSNRGLRSLPKTIPKDTTELYLEGNLLTS---VPKELPNLKQLTLLDLSNNSISHLAPLTFSNMTQLATLILSYNQIRCVPVHAFDGL--RSLRL-------------------------------------------LTLHGNDLSTVPEGAFNHLTSLSHLA-LGANPLYCDCELRWLSQWV----KAGFKEPGIARCTGPPDMADRLLLTTPLNRFQCKGP------ADLNLMSKCAPCLAT 916          
BLAST of Immunoglobulin superfamily member 10 vs. Ensembl Zebrafish
Match: pxdn (peroxidasin [Source:ZFIN;Acc:ZDB-GENE-140415-2])

HSP 1 Score: 79.337 bits (194), Expect = 1.010e-14
Identity = 80/283 (28.27%), Postives = 125/283 (44.17%), Query Frame = 1
Query:  463 SLCNNRCLCIPQNMVVCNANDAIRAIPTNVPKTFSRLLIQNIDLISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGL-NLKELHLMENPYIKIETGSFSGL-KVKQINLRSNFISHLSSSEFKDL-DVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNCRRPHIQS--LAIDFSSSQT-QLSCLATSESREAEISWTYEENG 1293
            S C +RCLC    +   + N  + ++P  +P+T                           + L + + KI+ ++  +F+ +  L  L L++N IR I    F  L NLK L+L +N    I+  +F GL  ++Q+ L  N I  L    F  L  +E+LFL NN +  +  G  S       L  +  N LHCDC L WLA  L+  ++      + TC  P+ L  R + +L+  +LNC  P I S    +D +S  T   +C A    +  +I W    N 
Sbjct:   24 SSCPSRCLCFRTTVRCMHLN--LESVPAVLPQT---------------------------TILDLRFNKIKDLQPGSFKRLKNLNTLLLNNNHIRRIPRGAFEDLENLKYLYLYKNEIQAIDREAFKGLVSLEQLYLHFNNIESLEPESFSHLPKLERLFLHNNRISHLALGTFSHLQSMKRL-RLDSNALHCDCELLWLADLLKQYAESGNAQAAATCDYPNRLQGRSVATLTAHELNCEVPRITSEPQDVDVTSGNTVYFTCRAEGNPK-PQIIWLRNNNA 275          
BLAST of Immunoglobulin superfamily member 10 vs. Ensembl Zebrafish
Match: igsf10 (immunoglobulin superfamily, member 10 [Source:ZFIN;Acc:ZDB-GENE-130530-827])

HSP 1 Score: 79.337 bits (194), Expect = 1.030e-14
Identity = 73/262 (27.86%), Postives = 114/262 (43.51%), Query Frame = 1
Query:  463 SLCNNRCLCIPQNMVVCNANDAIRAIPTNVPKTFSRLLIQNIDLISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGL-NLKELHLMENPYIKIETGSFSGLKVKQ-INLRSNFISHLSSSEF---------KDLDVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQH-----QSKDDMKYVSITCLT---PSILYQRPLISLSDKDLNCRRPHIQ 1191
            S C   C+C   + V C     +  +P ++     R+ +    L S  +  + L+GL  L  L +    I+ +E  AF  +  L  L +S+NR+  +   TF GL NL  L L  N    I   SF GLK  Q INL  N +  L    F         K   ++ ++L +N+L T+   ++S   K  +L  ++ NP  CDC + WLAK ++      + K D K++   C     P       ++ L      C RP I+
Sbjct:   29 SGCPKSCVCYAPSEVHCTFR-YLSEMPGDIQTAVERINLGYNSLSS--LQANALSGLNKLELLMLHSNMIKTVEDSAFSGLTSLQVLKMSYNRVEKLNKDTFRGLDNLVRLQLDHNLITFIHPESFYGLKRLQLINLEGNQLQQLHPDTFISVRFGQILKWSSLKTIYLSDNALGTLPAAVLSGCVKIENLF-LSGNPWSCDCRMSWLAKWIEKHPGVLKCKRDKKFLKEPCPICEFPLSSRGSSIVQLQSDGYTCSRPQIK 286          
BLAST of Immunoglobulin superfamily member 10 vs. Ensembl Zebrafish
Match: pxdn (peroxidasin [Source:ZFIN;Acc:ZDB-GENE-140415-2])

HSP 1 Score: 79.337 bits (194), Expect = 1.050e-14
Identity = 80/283 (28.27%), Postives = 125/283 (44.17%), Query Frame = 1
Query:  463 SLCNNRCLCIPQNMVVCNANDAIRAIPTNVPKTFSRLLIQNIDLISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGL-NLKELHLMENPYIKIETGSFSGL-KVKQINLRSNFISHLSSSEFKDL-DVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNCRRPHIQS--LAIDFSSSQT-QLSCLATSESREAEISWTYEENG 1293
            S C +RCLC    +   + N  + ++P  +P+T                           + L + + KI+ ++  +F+ +  L  L L++N IR I    F  L NLK L+L +N    I+  +F GL  ++Q+ L  N I  L    F  L  +E+LFL NN +  +  G  S       L  +  N LHCDC L WLA  L+  ++      + TC  P+ L  R + +L+  +LNC  P I S    +D +S  T   +C A    +  +I W    N 
Sbjct:   29 SSCPSRCLCFRTTVRCMHLN--LESVPAVLPQT---------------------------TILDLRFNKIKDLQPGSFKRLKNLNTLLLNNNHIRRIPRGAFEDLENLKYLYLYKNEIQAIDREAFKGLVSLEQLYLHFNNIESLEPESFSHLPKLERLFLHNNRISHLALGTFSHLQSMKRL-RLDSNALHCDCELLWLADLLKQYAESGNAQAAATCDYPNRLQGRSVATLTAHELNCEVPRITSEPQDVDVTSGNTVYFTCRAEGNPK-PQIIWLRNNNA 280          
BLAST of Immunoglobulin superfamily member 10 vs. Ensembl Zebrafish
Match: pxdn (peroxidasin [Source:ZFIN;Acc:ZDB-GENE-140415-2])

HSP 1 Score: 78.5666 bits (192), Expect = 1.611e-14
Identity = 71/227 (31.28%), Postives = 108/227 (47.58%), Query Frame = 1
Query:  631 LEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGL-NLKELHLMENPYIKIETGSFSGL-KVKQINLRSNFISHLSSSEFKDL-DVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNCRRPHIQS--LAIDFSSSQT-QLSCLATSESREAEISWTYEENG 1293
            L   + L + + KI+ ++  +F+ +  L  L L++N IR I    F  L NLK L+L +N    I+  +F GL  ++Q+ L  N I  L    F  L  +E+LFL NN +  +  G  S       L  +  N LHCDC L WLA  L+  ++      + TC  P+ L  R + +L+  +LNC  P I S    +D +S  T   +C A    +  +I W    N 
Sbjct:   53 LPQTTILDLRFNKIKDLQPGSFKRLKNLNTLLLNNNHIRRIPRGAFEDLENLKYLYLYKNEIQAIDREAFKGLVSLEQLYLHFNNIESLEPESFSHLPKLERLFLHNNRISHLALGTFSHLQSMKRL-RLDSNALHCDCELLWLADLLKQYAESGNAQAAATCDYPNRLQGRSVATLTAHELNCEVPRITSEPQDVDVTSGNTVYFTCRAEGNPK-PQIIWLRNNNA 277          
BLAST of Immunoglobulin superfamily member 10 vs. Ensembl Xenopus
Match: polr1e (polymerase (RNA) I polypeptide E [Source:Xenbase;Acc:XB-GENE-1003651])

HSP 1 Score: 82.0333 bits (201), Expect = 1.938e-15
Identity = 70/225 (31.11%), Postives = 112/225 (49.78%), Query Frame = 1
Query:  637 HLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGL-NLKELHLMENPYIKIETGSFSGLK-VKQINLRSNFISHLSSSEFKDL-DVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNCRRPHI----QSLAIDFSSSQTQLSCLATSESREAEISWTYEEN 1290
            H + L + + +I+ I+  AF+++  L  L L++N+I+ I  + F  L NLK L+L +N    I+  +F GL  ++Q+ L  N I  L    F  L  +E+LFL NN +  +  G  S  +    L  +  N LHCDC + WLA  L+  S+      + TC  P  L  R + +++  +LNC RP I    Q + + F ++    +C A    +  EI W    N
Sbjct:  122 HTTILDLRFNRIKDIQTGAFKHLKNLNTLLLNNNQIKRIPSEAFKDLENLKYLYLYKNEIQSIDRQAFKGLASLEQLYLHFNQIETLEPESFNYLPKLERLFLHNNRITHLVPGTFSQLESMKRL-RLDSNALHCDCEILWLADLLKIYSESGNAQAAATCEYPRRLQGRSVSTITPSELNCERPRITSEPQDVDVTFGNT-VYFTCRAEGNPK-PEIIWLRNNN 343          
BLAST of Immunoglobulin superfamily member 10 vs. Ensembl Xenopus
Match: rps2 (ribosomal protein S2 [Source:Xenbase;Acc:XB-GENE-1003616])

HSP 1 Score: 82.4185 bits (202), Expect = 1.968e-15
Identity = 70/258 (27.13%), Postives = 117/258 (45.35%), Query Frame = 1
Query:  469 CNNRCLCIPQNMVVCNANDAIRAIPTNVPKTFSRLLIQNIDLISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGL-NLKELHLMENPYIKIETGSFSGL-KVKQINLRSNFISHLSSSE---------FKDLDVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQHQSKDDMK-------YVSITCLTPSILYQRPLISLSDKDLNCRRPHI 1188
            C N C C     V C     + AIP  +     R+ +    +I   + + + +GL+ L  L +   +I  I  RA  ++  L  L +S+N+++     TF GL NL  LH+  N    I   SF GL  +K ++L  N ++ L +           FK   +++++L +N L ++ + M S   +    I +  NP  CDC L+WL ++   QS+D +K            C +P     + L  +S +DL C +P I
Sbjct:   30 CPNPCACYVPTEVHCTFR-YLTAIPKQINPDVERINLGYNSIIK--LEEMDFSGLQKLELLMLHSNEIRAIHERALNDLSSLQVLKMSYNKVKSFHKNTFHGLKNLVRLHMDHNKLDFINPESFYGLTSLKLVHLEGNLLTQLHTDTFLTLRYIHIFKTSSIKQVYLSDNQLSSLPEDMFSYMTELEG-IYLHGNPWSCDCKLEWL-RDWAQQSRDIIKCKKDRSGQQCPLCASPRTNNAKTLTEISSEDLACIKPTI 282          
BLAST of Immunoglobulin superfamily member 10 vs. Ensembl Xenopus
Match: polr1e (polymerase (RNA) I polypeptide E [Source:Xenbase;Acc:XB-GENE-1003651])

HSP 1 Score: 82.0333 bits (201), Expect = 2.190e-15
Identity = 70/225 (31.11%), Postives = 112/225 (49.78%), Query Frame = 1
Query:  637 HLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGL-NLKELHLMENPYIKIETGSFSGLK-VKQINLRSNFISHLSSSEFKDL-DVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNCRRPHI----QSLAIDFSSSQTQLSCLATSESREAEISWTYEEN 1290
            H + L + + +I+ I+  AF+++  L  L L++N+I+ I  + F  L NLK L+L +N    I+  +F GL  ++Q+ L  N I  L    F  L  +E+LFL NN +  +  G  S  +    L  +  N LHCDC + WLA  L+  S+      + TC  P  L  R + +++  +LNC RP I    Q + + F ++    +C A    +  EI W    N
Sbjct:   61 HTTILDLRFNRIKDIQTGAFKHLKNLNTLLLNNNQIKRIPSEAFKDLENLKYLYLYKNEIQSIDRQAFKGLASLEQLYLHFNQIETLEPESFNYLPKLERLFLHNNRITHLVPGTFSQLESMKRL-RLDSNALHCDCEILWLADLLKIYSESGNAQAAATCEYPRRLQGRSVSTITPSELNCERPRITSEPQDVDVTFGNT-VYFTCRAEGNPK-PEIIWLRNNN 282          
BLAST of Immunoglobulin superfamily member 10 vs. Ensembl Xenopus
Match: polr1e (polymerase (RNA) I polypeptide E [Source:Xenbase;Acc:XB-GENE-1003651])

HSP 1 Score: 81.6481 bits (200), Expect = 2.489e-15
Identity = 70/225 (31.11%), Postives = 112/225 (49.78%), Query Frame = 1
Query:  637 HLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGL-NLKELHLMENPYIKIETGSFSGLK-VKQINLRSNFISHLSSSEFKDL-DVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNCRRPHI----QSLAIDFSSSQTQLSCLATSESREAEISWTYEEN 1290
            H + L + + +I+ I+  AF+++  L  L L++N+I+ I  + F  L NLK L+L +N    I+  +F GL  ++Q+ L  N I  L    F  L  +E+LFL NN +  +  G  S  +    L  +  N LHCDC + WLA  L+  S+      + TC  P  L  R + +++  +LNC RP I    Q + + F ++    +C A    +  EI W    N
Sbjct:   56 HTTILDLRFNRIKDIQTGAFKHLKNLNTLLLNNNQIKRIPSEAFKDLENLKYLYLYKNEIQSIDRQAFKGLASLEQLYLHFNQIETLEPESFNYLPKLERLFLHNNRITHLVPGTFSQLESMKRL-RLDSNALHCDCEILWLADLLKIYSESGNAQAAATCEYPRRLQGRSVSTITPSELNCERPRITSEPQDVDVTFGNT-VYFTCRAEGNPK-PEIIWLRNNN 277          
BLAST of Immunoglobulin superfamily member 10 vs. Ensembl Xenopus
Match: atad3a (ATPase family, AAA domain containing 3A [Source:Xenbase;Acc:XB-GENE-946129])

HSP 1 Score: 80.8777 bits (198), Expect = 4.138e-15
Identity = 60/187 (32.09%), Postives = 98/187 (52.41%), Query Frame = 1
Query:  529 IRAIPTNVPKTFSRLLIQNIDLISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGL-NLKELHLMENPYIKIETGSFSG-LKVKQINLRSNFISHLSSSEFKDL-DVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQHQSK 1080
            +R++P N+P+   RL + N + I+RI  K++  GL HL  L+++  KI  IE  AF+++ +L  L L+ N +++     F G   L  L L EN    I   +F G + +K + L  N IS +    F+ L D+E L L NN++  +     +   K      +  N L+CDCHL WL+  L+ + +
Sbjct:   55 LRSVPRNIPRNTERLDL-NANNITRI-SKTDFAGLRHLRILQLMENKITTIERGAFQDLKELERLRLNRNNLQVFPELLFLGTPKLYRLDLSENQIQAIPRKAFRGAVDIKNLQLDYNQISCIEDGAFRALRDLEVLTLNNNNITRLSVASFNHMPK-LRTFRLHSNNLYCDCHLAWLSDWLRQRPR 238          

HSP 2 Score: 76.6406 bits (187), Expect = 8.536e-14
Identity = 74/254 (29.13%), Postives = 115/254 (45.28%), Query Frame = 1
Query:  676 VIEARA-FENMVQLYYLDLSHNRIRIIAPQTFSGLN-LKELHLMENPYIKIETGSFSGLK-VKQINLRSNFISHLSSSEFKDLD-VEKLFLFNNSLKTIDQGMMSIFDKPHHL--IDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNCRRPHIQSLAIDFSSSQTQLSCLATSESREAEISWTYEENGQKKEFRKLHSSNQIFPQYGTLKSNLSVKVFIPPNEKRIYTCS 1419
            V+EA   F+ + QL  ++LS+N+I  I    F G N + EL L  N    +    F GL+ +K + LRSN IS +++  F  L  V  L L++N + T+  G    FD  H L  +++  NP +C+CHL WL   L+   K  +   +  C  P  L + P+  ++ +D  C   +  +     S    + +CL T   R +         G  KE  +L+    +FP      SN      I  +  RI T S
Sbjct:  562 VLEATGIFKKLPQLRKINLSNNKITDIEEGAFEGANGVNELLLTSNRMENVRHKMFKGLEGLKTLMLRSNRISCVNNDSFTGLSSVRLLSLYDNQITTVAPGA---FDTLHSLSTLNLLANPFNCNCHLAWLGDWLR---KKRIVTGNPRCQKPYFLKEIPIQDVAIQDFTCDDGNEDNSCSPLSRCPAECTCLDTV-VRCSNKGLKSLPKGIPKEVTELYLDGNMFPLVPKELSNYKHLTLIDLSNNRISTLS 808          

HSP 3 Score: 71.2478 bits (173), Expect = 3.954e-12
Identity = 70/239 (29.29%), Postives = 108/239 (45.19%), Query Frame = 1
Query:  469 CNNRCLCIPQNMVVCNANDAIRAIPTNVPKTFSRL-LIQNIDLISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGL-NLKELHLMENPYIKIETGSFSGLKVKQINL-RSNFISHLSSSEFKDL-DVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNC 1173
            C   C C   N+V C     +  IPTN+P+T + + L QN                            I+VI   AF    +L  +DLS+N+I  IA   F GL +L  L L  N   ++  G F GL + Q+ L  +N I+ L    F+DL ++  L L++N L+TI +G  +   +    + + +NP  CDCHL+WLA  L     + ++     C +P  L  + +  +  K   C
Sbjct:  282 CPAACTC-SNNIVDCRGK-GLTEIPTNLPETITEMRLEQN---------------------------SIKVIPPGAFSPYKKLRRIDLSNNQISEIAADAFQGLRSLNSLVLYGNKITELPKGLFEGLVLLQLLLLNANKINCLRVDSFQDLHNLNLLSLYDNKLQTIAKGTFAPL-RAIQTLHLAQNPFICDCHLKWLADYLH---TNPIETSGARCTSPRRLANKRIGQIKSKKFRC 487          

HSP 4 Score: 62.3882 bits (150), Expect = 2.058e-9
Identity = 59/238 (24.79%), Postives = 98/238 (41.18%), Query Frame = 1
Query:  463 SLCNNRCLCIPQNMVVCNANDAIRAIPTNVPKTFSRLLIQNIDLISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGL-NLKELHLMENPYIKIETGSFSGLKVKQINLRSNFISHLSSSEFKDLDVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNC 1173
            S C   C C+  + VV  +N  ++++P  +PK  + L +   D     +    L+  +HL+ + +   +I  +   +F NM QL  L LS+NR+R I  + F GL +L+ L L  N    I  G+F+ L           +SHL+                                      I  NPL+CDC+LQWL+  ++ + K+        C  P  +  + L++   K   C
Sbjct:  740 SRCPAECTCL--DTVVRCSNKGLKSLPKGIPKEVTELYL---DGNMFPLVPKELSNYKHLTLIDLSNNRISTLSNHSFSNMTQLLTLILSYNRLRCIPLRAFDGLKSLRLLSLHGNDVSAIPEGAFNDLSS---------LSHLA--------------------------------------IGANPLYCDCNLQWLSDWVKSEYKEPG---IARCSGPGEMADKLLLTTPSKKFTC 922          
BLAST of Immunoglobulin superfamily member 10 vs. Ensembl Mouse
Match: Rtn4rl1 (reticulon 4 receptor-like 1 [Source:MGI Symbol;Acc:MGI:2661375])

HSP 1 Score: 85.5001 bits (210), Expect = 3.560e-17
Identity = 79/280 (28.21%), Postives = 123/280 (43.93%), Query Frame = 1
Query:  469 CNNRCLCIPQNMVV-CNANDAIRAIPTNVPKTFSRLLIQNIDLISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNR-IRIIAPQTFSGL-NLKELHLMENPYIKIETGSFSGL-KVKQINLRSNFISHLSSSEFKDL-DVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQHQ---------SKDDMKYVSITCLTPSILYQRPLISLSDKDLNCRRPHIQSLAIDFSSSQTQLSCLATSESREAE 1266
            C   C+C P  M V C A++   AIP  +P+   R+ +QN    +RI +         +  L I    I  I    FE  V L  LDL  NR +R +AP+TF GL  L  L+L +     +  G F GL  ++ + L+ N I +L    F DL ++  LFL  N L ++ QG+         L+++ R  LH +  LQW+     H            + +  +   CL P +  +   ++ +  D  CR   +      F  S + + C AT E R+ +
Sbjct:   25 CPRDCVCYPAPMTVSCQAHN-FAAIPEGIPEDSERIFLQN----NRITFLQQGHFSPAMVTLWIYSNNITFIAPNTFEGFVHLEELDLGDNRQLRTLAPETFQGLVKLHALYLYKCGLSALPAGIFGGLHSLQYLYLQDNHIEYLQDDIFVDLVNLSHLFLHGNKLWSLGQGIF------RGLVNLDRLLLH-ENQLQWVHHKAFHDLHRLTTLFLFNNSLTELQGDCLAPLVALEFLRLNGNAWDCGCRARSLWEWLRRFRGSSSAVPC-ATPELRQGQ 291          
BLAST of Immunoglobulin superfamily member 10 vs. Ensembl Mouse
Match: Slit2 (slit guidance ligand 2 [Source:MGI Symbol;Acc:MGI:1315205])

HSP 1 Score: 83.1889 bits (204), Expect = 5.032e-16
Identity = 71/241 (29.46%), Postives = 118/241 (48.96%), Query Frame = 1
Query:  460 PSLCNNRCLCIPQNMVVCNANDAIRAIPTNVPKTFSRLLIQNIDLISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSG-LNLKELHLMENPYIKIETGSFSG-LKVKQINLRSNFISHLSSSEFKDL-DVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNC 1173
            P  C  +C C   + V C+   A+R++P N+P+   RL + N + I+RI  K +  GL HL  L+++  +I  IE  AF+++ +L  L L+ N +++     F G   L  L L EN    I   +F G + +K + L  N IS +    F+ L D+E L L NN++  +     +   K      +  N L+CDCHL WL+  L+ + +  +      C+ PS L    +  +  ++  C
Sbjct:   25 PQACPAQCSC-SGSTVDCHG-LALRSVPRNIPRNTERLDL-NGNNITRIT-KIDFAGLRHLRVLQLMENRISTIERGAFQDLKELERLRLNRNNLQLFPELLFLGTAKLYRLDLSENQIQAIPRKAFRGAVDIKNLQLDYNQISCIEDGAFRALRDLEVLTLNNNNITRLSVASFNHMPK-LRTFRLHSNNLYCDCHLAWLSDWLRQRPRVGLY---TQCMGPSHLRGHNVAEVQKREFVC 257          

HSP 2 Score: 72.4034 bits (176), Expect = 1.171e-12
Identity = 68/238 (28.57%), Postives = 106/238 (44.54%), Query Frame = 1
Query:  469 CNNRCLCIPQNMVVCNANDAIRAIPTNVPKTFSRLLIQNIDLISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGL-NLKELHLMENPYIKIETGSFSG-LKVKQINLRSNFISHLSSSEFKDL-DVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNC 1173
            C   C C   N+V C     +  IPTN+P+T           I+ I  + N                I VI   AF    +L  LDLS+N+I  +AP  F GL +L  L L  N   ++    F G   ++ + L +N I+ L    F+DL ++  L L++N L+T+ +G  S   +    + + +NP  CDCHL+WLA  L     + ++     C +P  L  + +  +  K   C
Sbjct:  273 CPAACTC-SNNIVDCRGK-GLTEIPTNLPET-----------ITEIRLEQN---------------SIRVIPPGAFSPYKKLRRLDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHNLNLLSLYDNKLQTVAKGTFSAL-RAIQTMHLAQNPFICDCHLKWLADYLH---TNPIETSGARCTSPRRLANKRIGQIKSKKFRC 478          

HSP 3 Score: 69.3218 bits (168), Expect = 1.097e-11
Identity = 57/210 (27.14%), Postives = 103/210 (49.05%), Query Frame = 1
Query:  634 EHLSYLKIIYCKIEVIEARA-FENMVQLYYLDLSHNRIRIIAPQTFSGL-NLKELHLMENPYIKIETGSFSGLK-VKQINLRSNFISHLSSSEFKDLD-VEKLFLFNNSLKTIDQGMMSIFDKPHHL--IDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNCRRPHIQSLAIDFSSSQTQLSCLAT 1245
            ++ + L++   +  V+EA   F+ + QL  ++ S+N+I  I    F G   + E+ L  N    ++   F GL+ +K + LRSN IS + +  F  L  V  L L++N + T+  G    FD  H L  +++  NP +C+CHL WL + L+ +    +   +  C  P  L + P+  ++ +D  C   +  +     S   ++ +CL T
Sbjct:  525 QYTAELRLNNNEFTVLEATGIFKKLPQLRKINFSNNKITDIEEGAFEGASGVNEILLTSNRLENVQHKMFKGLESLKTLMLRSNRISCVGNDSFIGLGSVRLLSLYDNQITTVAPGA---FDSLHSLSTLNLLANPFNCNCHLAWLGEWLRRKR---IVTGNPRCQKPYFLKEIPIQDVAIQDFTCDDGNDDNSCSPLSRCPSECTCLDT 728          

HSP 4 Score: 61.2326 bits (147), Expect = 3.870e-9
Identity = 40/131 (30.53%), Postives = 68/131 (51.91%), Query Frame = 1
Query:  463 SLCNNRCLCIPQNMVVCNANDAIRAIPTNVPKTFSRLLIQNIDLISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGL-NLKELHLMENPYIKIETGSFSGLKV 852
            S C + C C+  + VV  +N  ++ +P  +PK  + L +   D     +    L+  +HL+ + +   +I  +  ++F NM QL  L LS+NR+R I P+TF GL +L+ L L  N    +  G+F+ L  
Sbjct:  717 SRCPSECTCL--DTVVRCSNKGLKVLPKGIPKDVTELYL---DGNQFTLVPKELSNYKHLTLIDLSNNRISTLSNQSFSNMTQLLTLILSYNRLRCIPPRTFDGLKSLRLLSLHGNDISVVPEGAFNDLSA 842          
BLAST of Immunoglobulin superfamily member 10 vs. Ensembl Mouse
Match: Slit2 (slit guidance ligand 2 [Source:MGI Symbol;Acc:MGI:1315205])

HSP 1 Score: 82.8037 bits (203), Expect = 9.372e-16
Identity = 71/241 (29.46%), Postives = 118/241 (48.96%), Query Frame = 1
Query:  460 PSLCNNRCLCIPQNMVVCNANDAIRAIPTNVPKTFSRLLIQNIDLISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSG-LNLKELHLMENPYIKIETGSFSG-LKVKQINLRSNFISHLSSSEFKDL-DVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNC 1173
            P  C  +C C   + V C+   A+R++P N+P+   RL + N + I+RI  K +  GL HL  L+++  +I  IE  AF+++ +L  L L+ N +++     F G   L  L L EN    I   +F G + +K + L  N IS +    F+ L D+E L L NN++  +     +   K      +  N L+CDCHL WL+  L+ + +  +      C+ PS L    +  +  ++  C
Sbjct:   25 PQACPAQCSC-SGSTVDCHGL-ALRSVPRNIPRNTERLDL-NGNNITRIT-KIDFAGLRHLRVLQLMENRISTIERGAFQDLKELERLRLNRNNLQLFPELLFLGTAKLYRLDLSENQIQAIPRKAFRGAVDIKNLQLDYNQISCIEDGAFRALRDLEVLTLNNNNITRLSVASFNHMPK-LRTFRLHSNNLYCDCHLAWLSDWLRQRPRVGLY---TQCMGPSHLRGHNVAEVQKREFVC 257          

HSP 2 Score: 73.1738 bits (178), Expect = 8.318e-13
Identity = 60/241 (24.90%), Postives = 103/241 (42.74%), Query Frame = 1
Query:  463 SLCNNRCLCIPQNMVVCNANDAIRAIPTNVPKTFSRLLIQNIDLISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGL-NLKELHLMENPYIKIETGSFSGLKVKQINLRSNFISHLSSSEFKDLDVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNCRRP 1182
            S C + C C+  + VV  +N  ++ +P  +PK  + L +   D     +    L+  +HL+ + +   +I  +  ++F NM QL  L LS+NR+R I P+TF GL +L+ L L  N    +  G+F+ L           +SHL+                                      I  NPL+CDC++QWL+  ++ + K+        C  P  +  + L++   K   C+ P
Sbjct:  729 SRCPSECTCL--DTVVRCSNKGLKVLPKGIPKDVTELYL---DGNQFTLVPKELSNYKHLTLIDLSNNRISTLSNQSFSNMTQLLTLILSYNRLRCIPPRTFDGLKSLRLLSLHGNDISVVPEGAFNDLSA---------LSHLA--------------------------------------IGANPLYCDCNMQWLSDWVKSEYKEPG---IARCAGPGEMADKLLLTTPSKKFTCQGP 914          

HSP 3 Score: 72.4034 bits (176), Expect = 1.414e-12
Identity = 68/239 (28.45%), Postives = 106/239 (44.35%), Query Frame = 1
Query:  469 CNNRCLCIPQNMVVCNANDAIRAIPTNVPKTFSRL-LIQNIDLISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGL-NLKELHLMENPYIKIETGSFSG-LKVKQINLRSNFISHLSSSEFKDL-DVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNC 1173
            C   C C   N+V C     +  IPTN+P+T + + L QN                            I VI   AF    +L  LDLS+N+I  +AP  F GL +L  L L  N   ++    F G   ++ + L +N I+ L    F+DL ++  L L++N L+T+ +G  S   +    + + +NP  CDCHL+WLA  L     + ++     C +P  L  + +  +  K   C
Sbjct:  277 CPAACTC-SNNIVDCRGK-GLTEIPTNLPETITEIRLEQN---------------------------SIRVIPPGAFSPYKKLRRLDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHNLNLLSLYDNKLQTVAKGTFSAL-RAIQTMHLAQNPFICDCHLKWLADYLH---TNPIETSGARCTSPRRLANKRIGQIKSKKFRC 482          

HSP 4 Score: 70.0922 bits (170), Expect = 6.707e-12
Identity = 56/196 (28.57%), Postives = 96/196 (48.98%), Query Frame = 1
Query:  676 VIEARA-FENMVQLYYLDLSHNRIRIIAPQTFSGL-NLKELHLMENPYIKIETGSFSGLK-VKQINLRSNFISHLSSSEFKDLD-VEKLFLFNNSLKTIDQGMMSIFDKPHHL--IDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNCRRPHIQSLAIDFSSSQTQLSCLAT 1245
            V+EA   F+ + QL  ++ S+N+I  I    F G   + E+ L  N    ++   F GL+ +K + LRSN IS + +  F  L  V  L L++N + T+  G    FD  H L  +++  NP +C+CHL WL + L+ +    +   +  C  P  L + P+  ++ +D  C   +  +     S   ++ +CL T
Sbjct:  551 VLEATGIFKKLPQLRKINFSNNKITDIEEGAFEGASGVNEILLTSNRLENVQHKMFKGLESLKTLMLRSNRISCVGNDSFIGLGSVRLLSLYDNQITTVAPGA---FDSLHSLSTLNLLANPFNCNCHLAWLGEWLRRKR---IVTGNPRCQKPYFLKEIPIQDVAIQDFTCDDGNDDNSCSPLSRCPSECTCLDT 740          
BLAST of Immunoglobulin superfamily member 10 vs. Ensembl Mouse
Match: Slit2 (slit guidance ligand 2 [Source:MGI Symbol;Acc:MGI:1315205])

HSP 1 Score: 82.8037 bits (203), Expect = 9.883e-16
Identity = 71/241 (29.46%), Postives = 118/241 (48.96%), Query Frame = 1
Query:  460 PSLCNNRCLCIPQNMVVCNANDAIRAIPTNVPKTFSRLLIQNIDLISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSG-LNLKELHLMENPYIKIETGSFSG-LKVKQINLRSNFISHLSSSEFKDL-DVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNC 1173
            P  C  +C C   + V C+   A+R++P N+P+   RL + N + I+RI  K +  GL HL  L+++  +I  IE  AF+++ +L  L L+ N +++     F G   L  L L EN    I   +F G + +K + L  N IS +    F+ L D+E L L NN++  +     +   K      +  N L+CDCHL WL+  L+ + +  +      C+ PS L    +  +  ++  C
Sbjct:   25 PQACPAQCSC-SGSTVDCHGL-ALRSVPRNIPRNTERLDL-NGNNITRIT-KIDFAGLRHLRVLQLMENRISTIERGAFQDLKELERLRLNRNNLQLFPELLFLGTAKLYRLDLSENQIQAIPRKAFRGAVDIKNLQLDYNQISCIEDGAFRALRDLEVLTLNNNNITRLSVASFNHMPK-LRTFRLHSNNLYCDCHLAWLSDWLRQRPRVGLY---TQCMGPSHLRGHNVAEVQKREFVC 257          

HSP 2 Score: 73.1738 bits (178), Expect = 8.546e-13
Identity = 60/241 (24.90%), Postives = 103/241 (42.74%), Query Frame = 1
Query:  463 SLCNNRCLCIPQNMVVCNANDAIRAIPTNVPKTFSRLLIQNIDLISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGL-NLKELHLMENPYIKIETGSFSGLKVKQINLRSNFISHLSSSEFKDLDVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNCRRP 1182
            S C + C C+  + VV  +N  ++ +P  +PK  + L +   D     +    L+  +HL+ + +   +I  +  ++F NM QL  L LS+NR+R I P+TF GL +L+ L L  N    +  G+F+ L           +SHL+                                      I  NPL+CDC++QWL+  ++ + K+        C  P  +  + L++   K   C+ P
Sbjct:  729 SRCPSECTCL--DTVVRCSNKGLKVLPKGIPKDVTELYL---DGNQFTLVPKELSNYKHLTLIDLSNNRISTLSNQSFSNMTQLLTLILSYNRLRCIPPRTFDGLKSLRLLSLHGNDISVVPEGAFNDLSA---------LSHLA--------------------------------------IGANPLYCDCNMQWLSDWVKSEYKEPG---IARCAGPGEMADKLLLTTPSKKFTCQGP 914          

HSP 3 Score: 72.4034 bits (176), Expect = 1.453e-12
Identity = 68/239 (28.45%), Postives = 106/239 (44.35%), Query Frame = 1
Query:  469 CNNRCLCIPQNMVVCNANDAIRAIPTNVPKTFSRL-LIQNIDLISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGL-NLKELHLMENPYIKIETGSFSG-LKVKQINLRSNFISHLSSSEFKDL-DVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNC 1173
            C   C C   N+V C     +  IPTN+P+T + + L QN                            I VI   AF    +L  LDLS+N+I  +AP  F GL +L  L L  N   ++    F G   ++ + L +N I+ L    F+DL ++  L L++N L+T+ +G  S   +    + + +NP  CDCHL+WLA  L     + ++     C +P  L  + +  +  K   C
Sbjct:  277 CPAACTC-SNNIVDCRGK-GLTEIPTNLPETITEIRLEQN---------------------------SIRVIPPGAFSPYKKLRRLDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHNLNLLSLYDNKLQTVAKGTFSAL-RAIQTMHLAQNPFICDCHLKWLADYLH---TNPIETSGARCTSPRRLANKRIGQIKSKKFRC 482          

HSP 4 Score: 70.4774 bits (171), Expect = 6.113e-12
Identity = 56/196 (28.57%), Postives = 96/196 (48.98%), Query Frame = 1
Query:  676 VIEARA-FENMVQLYYLDLSHNRIRIIAPQTFSGL-NLKELHLMENPYIKIETGSFSGLK-VKQINLRSNFISHLSSSEFKDLD-VEKLFLFNNSLKTIDQGMMSIFDKPHHL--IDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNCRRPHIQSLAIDFSSSQTQLSCLAT 1245
            V+EA   F+ + QL  ++ S+N+I  I    F G   + E+ L  N    ++   F GL+ +K + LRSN IS + +  F  L  V  L L++N + T+  G    FD  H L  +++  NP +C+CHL WL + L+ +    +   +  C  P  L + P+  ++ +D  C   +  +     S   ++ +CL T
Sbjct:  551 VLEATGIFKKLPQLRKINFSNNKITDIEEGAFEGASGVNEILLTSNRLENVQHKMFKGLESLKTLMLRSNRISCVGNDSFIGLGSVRLLSLYDNQITTVAPGA---FDSLHSLSTLNLLANPFNCNCHLAWLGEWLRRKR---IVTGNPRCQKPYFLKEIPIQDVAIQDFTCDDGNDDNSCSPLSRCPSECTCLDT 740          
BLAST of Immunoglobulin superfamily member 10 vs. Ensembl Mouse
Match: Slit2 (slit guidance ligand 2 [Source:MGI Symbol;Acc:MGI:1315205])

HSP 1 Score: 82.4185 bits (202), Expect = 1.082e-15
Identity = 71/241 (29.46%), Postives = 118/241 (48.96%), Query Frame = 1
Query:  460 PSLCNNRCLCIPQNMVVCNANDAIRAIPTNVPKTFSRLLIQNIDLISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSG-LNLKELHLMENPYIKIETGSFSG-LKVKQINLRSNFISHLSSSEFKDL-DVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNC 1173
            P  C  +C C   + V C+   A+R++P N+P+   RL + N + I+RI  K +  GL HL  L+++  +I  IE  AF+++ +L  L L+ N +++     F G   L  L L EN    I   +F G + +K + L  N IS +    F+ L D+E L L NN++  +     +   K      +  N L+CDCHL WL+  L+ + +  +      C+ PS L    +  +  ++  C
Sbjct:   25 PQACPAQCSC-SGSTVDCHGL-ALRSVPRNIPRNTERLDL-NGNNITRIT-KIDFAGLRHLRVLQLMENRISTIERGAFQDLKELERLRLNRNNLQLFPELLFLGTAKLYRLDLSENQIQAIPRKAFRGAVDIKNLQLDYNQISCIEDGAFRALRDLEVLTLNNNNITRLSVASFNHMPK-LRTFRLHSNNLYCDCHLAWLSDWLRQRPRVGLY---TQCMGPSHLRGHNVAEVQKREFVC 257          

HSP 2 Score: 73.1738 bits (178), Expect = 9.122e-13
Identity = 60/241 (24.90%), Postives = 103/241 (42.74%), Query Frame = 1
Query:  463 SLCNNRCLCIPQNMVVCNANDAIRAIPTNVPKTFSRLLIQNIDLISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGL-NLKELHLMENPYIKIETGSFSGLKVKQINLRSNFISHLSSSEFKDLDVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNCRRP 1182
            S C + C C+  + VV  +N  ++ +P  +PK  + L +   D     +    L+  +HL+ + +   +I  +  ++F NM QL  L LS+NR+R I P+TF GL +L+ L L  N    +  G+F+ L           +SHL+                                      I  NPL+CDC++QWL+  ++ + K+        C  P  +  + L++   K   C+ P
Sbjct:  717 SRCPSECTCL--DTVVRCSNKGLKVLPKGIPKDVTELYL---DGNQFTLVPKELSNYKHLTLIDLSNNRISTLSNQSFSNMTQLLTLILSYNRLRCIPPRTFDGLKSLRLLSLHGNDISVVPEGAFNDLSA---------LSHLA--------------------------------------IGANPLYCDCNMQWLSDWVKSEYKEPG---IARCAGPGEMADKLLLTTPSKKFTCQGP 902          

HSP 3 Score: 72.4034 bits (176), Expect = 1.551e-12
Identity = 68/239 (28.45%), Postives = 106/239 (44.35%), Query Frame = 1
Query:  469 CNNRCLCIPQNMVVCNANDAIRAIPTNVPKTFSRL-LIQNIDLISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGL-NLKELHLMENPYIKIETGSFSG-LKVKQINLRSNFISHLSSSEFKDL-DVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNC 1173
            C   C C   N+V C     +  IPTN+P+T + + L QN                            I VI   AF    +L  LDLS+N+I  +AP  F GL +L  L L  N   ++    F G   ++ + L +N I+ L    F+DL ++  L L++N L+T+ +G  S   +    + + +NP  CDCHL+WLA  L     + ++     C +P  L  + +  +  K   C
Sbjct:  273 CPAACTC-SNNIVDCRGK-GLTEIPTNLPETITEIRLEQN---------------------------SIRVIPPGAFSPYKKLRRLDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHNLNLLSLYDNKLQTVAKGTFSAL-RAIQTMHLAQNPFICDCHLKWLADYLH---TNPIETSGARCTSPRRLANKRIGQIKSKKFRC 478          

HSP 4 Score: 70.0922 bits (170), Expect = 6.696e-12
Identity = 56/196 (28.57%), Postives = 96/196 (48.98%), Query Frame = 1
Query:  676 VIEARA-FENMVQLYYLDLSHNRIRIIAPQTFSGL-NLKELHLMENPYIKIETGSFSGLK-VKQINLRSNFISHLSSSEFKDLD-VEKLFLFNNSLKTIDQGMMSIFDKPHHL--IDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNCRRPHIQSLAIDFSSSQTQLSCLAT 1245
            V+EA   F+ + QL  ++ S+N+I  I    F G   + E+ L  N    ++   F GL+ +K + LRSN IS + +  F  L  V  L L++N + T+  G    FD  H L  +++  NP +C+CHL WL + L+ +    +   +  C  P  L + P+  ++ +D  C   +  +     S   ++ +CL T
Sbjct:  539 VLEATGIFKKLPQLRKINFSNNKITDIEEGAFEGASGVNEILLTSNRLENVQHKMFKGLESLKTLMLRSNRISCVGNDSFIGLGSVRLLSLYDNQITTVAPGA---FDSLHSLSTLNLLANPFNCNCHLAWLGEWLRRKR---IVTGNPRCQKPYFLKEIPIQDVAIQDFTCDDGNDDNSCSPLSRCPSECTCLDT 728          
BLAST of Immunoglobulin superfamily member 10 vs. UniProt/SwissProt
Match: sp|Q8K0S5|R4RL1_MOUSE (Reticulon-4 receptor-like 1 OS=Mus musculus OX=10090 GN=Rtn4rl1 PE=1 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 2.490e-16
Identity = 79/280 (28.21%), Postives = 123/280 (43.93%), Query Frame = 1
Query:  469 CNNRCLCIPQNMVV-CNANDAIRAIPTNVPKTFSRLLIQNIDLISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNR-IRIIAPQTFSGL-NLKELHLMENPYIKIETGSFSGL-KVKQINLRSNFISHLSSSEFKDL-DVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQHQ---------SKDDMKYVSITCLTPSILYQRPLISLSDKDLNCRRPHIQSLAIDFSSSQTQLSCLATSESREAE 1266
            C   C+C P  M V C A++   AIP  +P+   R+ +QN    +RI +         +  L I    I  I    FE  V L  LDL  NR +R +AP+TF GL  L  L+L +     +  G F GL  ++ + L+ N I +L    F DL ++  LFL  N L ++ QG+         L+++ R  LH +  LQW+     H            + +  +   CL P +  +   ++ +  D  CR   +      F  S + + C AT E R+ +
Sbjct:   25 CPRDCVCYPAPMTVSCQAHN-FAAIPEGIPEDSERIFLQN----NRITFLQQGHFSPAMVTLWIYSNNITFIAPNTFEGFVHLEELDLGDNRQLRTLAPETFQGLVKLHALYLYKCGLSALPAGIFGGLHSLQYLYLQDNHIEYLQDDIFVDLVNLSHLFLHGNKLWSLGQGIF------RGLVNLDRLLLH-ENQLQWVHHKAFHDLHRLTTLFLFNNSLTELQGDCLAPLVALEFLRLNGNAWDCGCRARSLWEWLRRFRGSSSAVPC-ATPELRQGQ 291          
BLAST of Immunoglobulin superfamily member 10 vs. UniProt/SwissProt
Match: sp|Q6WRH9|IGS10_RAT (Immunoglobulin superfamily member 10 OS=Rattus norvegicus OX=10116 GN=Igsf10 PE=1 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 1.052e-15
Identity = 74/271 (27.31%), Postives = 111/271 (40.96%), Query Frame = 1
Query:  469 CNNRCLCIPQNMVVCN---ANDAIRAIPTNVPK------TFSRLLIQNIDLISRI------------IYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGL-NLKELHLMENPYIKIETGSFSGLKVKQINLRSNFISHLSSSEFKDLDVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQH-----QSKDDMKYVSIT----CLTPSILYQRPLISLSDKDLNCRRPHI 1188
            C  RC C     V C           IP NV +      + +RL   + D +S++            +     +GL+ L  LK+ Y K+++I    F  +  L  L L HN I  I P+ F GL +L+ +HL  N   K+   +F  L   QI              FK   ++ LFL +N L ++ + M+S       L  +  NP  CDCHL+WL++ +Q      + K D    S      C+ P I   RP   +      C +P I
Sbjct:   29 CPRRCACYVPTEVHCTFRYLTSIPDGIPANVERINLGYNSLTRLTENDFDGLSKLELLMLHSNGIHRVSDKTFSGLQSLQVLKMSYNKVQIIRKDTFYGLGSLVRLHLDHNNIEFINPEAFYGLTSLRLVHLEGNRLTKLHPDTFVSLSYLQI--------------FKTSFIKYLFLSDNFLTSLPKEMVSYMPNLESLY-LHGNPWTCDCHLKWLSEWMQGNPDIIKCKKDRSSSSPQQCPLCMNPRISKGRPFAMVPSGAFLCTKPTI 284          
BLAST of Immunoglobulin superfamily member 10 vs. UniProt/SwissProt
Match: sp|O88280|SLIT3_RAT (Slit homolog 3 protein OS=Rattus norvegicus OX=10116 GN=Slit3 PE=2 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 1.394e-15
Identity = 72/242 (29.75%), Postives = 125/242 (51.65%), Query Frame = 1
Query:  526 AIRAIPTNVPKTFSRLLIQNIDLISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTF-SGLNLKELHLMENPYIKIETGSFSGL-KVKQINLRSNFISHLSSSEFKDL-DVEKLFLFNNSLKTIDQGMMSIFDKPHHL--IDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNCRRPHIQSLAIDFSSSQTQLSC 1236
             +RA+P  +P+   RL +   + I+RI  K + TGL++L  L +   ++ VIE  AF+++ QL  L L+ N+++++    F S   L  L L EN    I   +F G+  VK + L +N IS +    F+ L D+E L L NN++  I   +++ F+    +  + +  N L+CDCHL WL+  L+ Q +   ++    C+ P  L    +  +  K+  C  PH ++ A + +S     +C
Sbjct:   51 GLRAVPRGIPRNAERLDLDRNN-ITRIT-KMDFTGLKNLRVLHLEDNQVSVIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRGVTGVKNLQLDNNHISCIEDGAFRALRDLEILTLNNNNISRI---LVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLR-QRRTIGQFT--LCMAPVHLRGFSVADVQKKEYVCPGPHSEAPACNANSLSCPSAC 284          

HSP 2 Score: 73.9442 bits (180), Expect = 3.005e-12
Identity = 58/171 (33.92%), Postives = 88/171 (51.46%), Query Frame = 1
Query:  670 IEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGL-NLKELHLMENPYIKIETGSFSGLKVKQINL-RSNFISHLSSSEFKDL-DVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNC 1173
            I+ I A AF    +L  +D+S N+I  IAP  F GL +L  L L  N   +I  G F GL   Q+ L  +N I+ L  + F+DL ++  L L++N L+TI +G+ +       L  + +NP  CDCHL+WLA  LQ    + ++     C +P  L  + +  +  K   C
Sbjct:  319 IKSIPAGAFIQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIPKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFAPLQSIQTL-HLAQNPFVCDCHLKWLADYLQ---DNPIETSGARCSSPRRLANKRISQIKSKKFRC 485          

HSP 3 Score: 69.707 bits (169), Expect = 6.484e-11
Identity = 54/184 (29.35%), Postives = 92/184 (50.00%), Query Frame = 1
Query:  634 EHLSYLKIIYCKIEVIEARA-FENMVQLYYLDLSHNRIRIIAPQTFSGL-NLKELHLMENPYIKIETGSFSGL-KVKQINLRSNFISHLSSSEFKDLD-VEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNC 1173
            E+ + L++    I V+EA   F+ +  L  ++LS+NRI+ +    F G   ++EL L  N    +    F GL  +K + LRSN IS +++  F  L  V  L L++N + TI  G  +        I++  NP +C+CH+ WL + L+   K  +   +  C  P  L + P+  ++ +D  C
Sbjct:  532 EYTTDLRLNDNDIAVLEATGIFKKLPNLRKINLSNNRIKEVREGAFDGAAGVQELMLTGNQLETMHGRMFRGLSGLKTLMLRSNLISCVNNDTFAGLSSVRLLSLYDNRITTISPGAFTTL-VSLSTINLLSNPFNCNCHMAWLGRWLR---KRRIVSGNPRCQKPFFLKEIPIQDVAIQDFTC 711          

HSP 4 Score: 56.9954 bits (136), Expect = 6.171e-7
Identity = 57/239 (23.85%), Postives = 93/239 (38.91%), Query Frame = 1
Query:  469 CNNRCLCIPQNMVVCNANDAIRAIPTNVPKTFSRLLIQNIDLISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGLNLKELHLMENPYIKIETGSFSGLKVKQINLRSNFISHLSSSEFKDLDVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSIT-CLTPSILYQRPLISLSDKDLNCRRP 1182
            C  +C C+ + +V C +N  +  +P  +PK  + L ++   L +       L+    L+ + +    I ++    F NM  L  L LS+NR+R I    F+GL                        ++ + L  N IS +    F DL          SL  +  G+               NPLHCDC L+WL++ +    K   K   I  C +P  +  R L++       C+ P
Sbjct:  725 CPEQCTCV-ETVVRC-SNRGLHTLPKGMPKDVTELYLEGNHLTA---VPKELSTFRQLTLIDLSNNSISMLTNHTFSNMSHLSTLILSYNRLRCIPVHAFNGLR----------------------SLRVLTLHGNDISSVPEGSFNDL---------TSLSHLALGI---------------NPLHCDCSLRWLSEWI----KAGYKEPGIARCSSPESMADRLLLTTPTHRFQCKGP 908          
BLAST of Immunoglobulin superfamily member 10 vs. UniProt/SwissProt
Match: sp|O94813|SLIT2_HUMAN (Slit homolog 2 protein OS=Homo sapiens OX=9606 GN=SLIT2 PE=1 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 1.445e-15
Identity = 72/241 (29.88%), Postives = 119/241 (49.38%), Query Frame = 1
Query:  460 PSLCNNRCLCIPQNMVVCNANDAIRAIPTNVPKTFSRLLIQNIDLISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSG-LNLKELHLMENPYIKIETGSFSG-LKVKQINLRSNFISHLSSSEFKDL-DVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNC 1173
            P  C  +C C   + V C+   A+R++P N+P+   RL + N + I+RI  K++  GL HL  L+++  KI  IE  AF+++ +L  L L+ N +++     F G   L  L L EN    I   +F G + +K + L  N IS +    F+ L D+E L L NN++  +     +   K      +  N L+CDCHL WL+  L+ + +  +      C+ PS L    +  +  ++  C
Sbjct:   25 PQACPAQCSC-SGSTVDCHGL-ALRSVPRNIPRNTERLDL-NGNNITRIT-KTDFAGLRHLRVLQLMENKISTIERGAFQDLKELERLRLNRNHLQLFPELLFLGTAKLYRLDLSENQIQAIPRKAFRGAVDIKNLQLDYNQISCIEDGAFRALRDLEVLTLNNNNITRLSVASFNHMPK-LRTFRLHSNNLYCDCHLAWLSDWLRQRPRVGLY---TQCMGPSHLRGHNVAEVQKREFVC 257          

HSP 2 Score: 72.0182 bits (175), Expect = 1.404e-11
Identity = 59/241 (24.48%), Postives = 102/241 (42.32%), Query Frame = 1
Query:  463 SLCNNRCLCIPQNMVVCNANDAIRAIPTNVPKTFSRLLIQNIDLISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGL-NLKELHLMENPYIKIETGSFSGLKVKQINLRSNFISHLSSSEFKDLDVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNCRRP 1182
            S C   C C+  + VV  +N  ++ +P  +P+  + L +   D     +    L+  +HL+ + +   +I  +  ++F NM QL  L LS+NR+R I P+TF GL +L+ L L  N    +  G+F+ L           +SHL+                                      I  NPL+CDC++QWL+  ++ + K+        C  P  +  + L++   K   C+ P
Sbjct:  725 SRCPTECTCL--DTVVRCSNKGLKVLPKGIPRDVTELYL---DGNQFTLVPKELSNYKHLTLIDLSNNRISTLSNQSFSNMTQLLTLILSYNRLRCIPPRTFDGLKSLRLLSLHGNDISVVPEGAFNDLSA---------LSHLA--------------------------------------IGANPLYCDCNMQWLSDWVKSEYKEPG---IARCAGPGEMADKLLLTTPSKKFTCQGP 910          

HSP 3 Score: 71.2478 bits (173), Expect = 2.386e-11
Identity = 68/239 (28.45%), Postives = 107/239 (44.77%), Query Frame = 1
Query:  469 CNNRCLCIPQNMVVCNANDAIRAIPTNVPKTFSRL-LIQNIDLISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGL-NLKELHLMENPYIKIETGSFSG-LKVKQINLRSNFISHLSSSEFKDL-DVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNC 1173
            C   C C   N+V C     +  IPTN+P+T + + L QN                            I+VI   AF    +L  +DLS+N+I  +AP  F GL +L  L L  N   ++    F G   ++ + L +N I+ L    F+DL ++  L L++N L+TI +G  S   +    + + +NP  CDCHL+WLA  L     + ++     C +P  L  + +  +  K   C
Sbjct:  273 CPAACTC-SNNIVDCRGK-GLTEIPTNLPETITEIRLEQNT---------------------------IKVIPPGAFSPYKKLRRIDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHNLNLLSLYDNKLQTIAKGTFSPL-RAIQTMHLAQNPFICDCHLKWLADYLH---TNPIETSGARCTSPRRLANKRIGQIKSKKFRC 478          

HSP 4 Score: 68.5514 bits (166), Expect = 1.705e-10
Identity = 56/196 (28.57%), Postives = 96/196 (48.98%), Query Frame = 1
Query:  676 VIEARA-FENMVQLYYLDLSHNRIRIIAPQTFSGL-NLKELHLMENPYIKIETGSFSGLK-VKQINLRSNFISHLSSSEFKDLD-VEKLFLFNNSLKTIDQGMMSIFDKPHHL--IDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNCRRPHIQSLAIDFSSSQTQLSCLAT 1245
            V+EA   F+ + QL  ++ S+N+I  I    F G   + E+ L  N    ++   F GL+ +K + LRSN I+ + +  F  L  V  L L++N + T+  G    FD  H L  +++  NP +C+C+L WL + L+   K  +   +  C  P  L + P+  ++ +D  C   +  +     S   T+ +CL T
Sbjct:  547 VLEATGIFKKLPQLRKINFSNNKITDIEEGAFEGASGVNEILLTSNRLENVQHKMFKGLESLKTLMLRSNRITCVGNDSFIGLSSVRLLSLYDNQITTVAPGA---FDTLHSLSTLNLLANPFNCNCYLAWLGEWLR---KKRIVTGNPRCQKPYFLKEIPIQDVAIQDFTCDDGNDDNSCSPLSRCPTECTCLDT 736          
BLAST of Immunoglobulin superfamily member 10 vs. UniProt/SwissProt
Match: sp|Q80WD0|R4RL1_RAT (Reticulon-4 receptor-like 1 OS=Rattus norvegicus OX=10116 GN=Rtn4rl1 PE=1 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 3.209e-15
Identity = 78/280 (27.86%), Postives = 122/280 (43.57%), Query Frame = 1
Query:  469 CNNRCLCIPQNMVV-CNANDAIRAIPTNVPKTFSRLLIQNIDLISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNR-IRIIAPQTFSGL-NLKELHLMENPYIKIETGSFSGL-KVKQINLRSNFISHLSSSEFKDL-DVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQHQ---------SKDDMKYVSITCLTPSILYQRPLISLSDKDLNCRRPHIQSLAIDFSSSQTQLSCLATSESREAE 1266
            C   C+C P  M V C A++   AIP  +P+   R+ +QN    + I +         +  L I    I  I    FE  V L  LDL  NR +R +AP+TF GL  L  L+L +     +  G F GL  ++ + L+ N I +L    F DL ++  LFL  N L ++ QG+         L+++ R  LH +  LQW+     H            + +  +   CL P +  +   ++ +  D  CR   +      F  S + + C AT E R+ +
Sbjct:   25 CPRDCVCYPSPMTVSCQAHN-FAAIPEGIPEDSERIFLQN----NHITFLQQGHFSPAMVTLWIYSNNITFIAPNTFEGFVHLEELDLGDNRQLRTLAPETFQGLVKLHALYLYKCGLSSLPAGIFGGLHSLQYLYLQDNHIEYLQDDIFVDLVNLSHLFLHGNKLWSLGQGIF------RGLVNLDRLLLH-ENQLQWVHHKAFHDLHRLTTLFLFNNSLTELQGDCLAPLVALEFLRLNGNAWDCGCRARSLWEWLRRFRGSSSVVPC-ATPELRQGQ 291          
BLAST of Immunoglobulin superfamily member 10 vs. TrEMBL
Match: A0A183K0P7 (Uncharacterized protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS8558 PE=4 SV=1)

HSP 1 Score: 185.652 bits (470), Expect = 1.021e-46
Identity = 143/458 (31.22%), Postives = 218/458 (47.60%), Query Frame = 1
Query:  448 QYSDPSLCNNRCLC-IPQNMVVCNANDAIRAIPTNVPKTFSRLLIQNIDL-ISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGLNLKELHLME-----NPYIKIETGSFSGLKVKQINLRSNFISHLSSSEFKDL-DVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCL--------TPSILYQRPLISLSDKDLNCRRPHIQSLAIDF--SSSQTQLSCLATSESREAE----------------------ISWTYEENGQKKEFRKLHSSNQ--------IFPQYGTLK-SNLSVKVFIPPNEK-RIYTCSTWIKDNDPQTVSVHIRTPNTHYPIMFPHDNR------------------------KSSSSNTINSPAIEDGNYLFKKQFTVLEM 1599
            QY  P LC N+C C   +N+V C+  D +  +PTN+P   ++L IQ  D  I   + ++N+TGLE L YL+IIYC ++VIE R F  M +L +LDLSHN +  I   TF GL L  L+L E     +  I I   SF GL   QINLR N I  +    F  +  +++L L +N +KTID G    F+ P+ L+D+T NPL C+C L W+ +      KD +  +++TC+           I     L+ L+ + L C    IQ + I+    +S+  +SC A +  + ++                      ++W Y E+GQ +E R L S+N         ++    T+   + +V++ I  ++K R YTC+TW    + + V V ++ P     I  P  N                         K S     N    +   YL++KQFT+LEM
Sbjct:    7 QYIQPGLCENQCHCPKGENVVHCDRQDHLYGVPTNIPNGITKLFIQQSDFPIPNSLNQANMTGLEKLEYLRIIYCNLQVIEPRTFMKMTELKHLDLSHNSLIRIESYTFYGLQLNHLYLSEQHTLPDNGILITEDSFHGLSANQINLRGNRIQSIHYEIFHKVPSLDRLILSDNLIKTIDDGFEKYFNHPNKLLDLTGNPLECNCRLSWIVQR-TIDWKDSLPGLNMTCIHLTRKDNSIQKIKNIYELVKLTPEQL-CPTSRIQQIFINLLDDTSRALISCTAVTVPKHSQHLLYNTNMIISNNKILSHTPPGVAWRYIESGQLREVRYLTSTNHLTNHNNEYLYHANSTIDYPSATVQLNITLDKKPRKYTCTTWDDKKETEEVIVTLKGPEL---INIPKFNNTLSIDHELINTQTNTNTNNRNYYIKQSDDLLRNEILYDQSYYLYQKQFTLLEM 459          
BLAST of Immunoglobulin superfamily member 10 vs. TrEMBL
Match: A0A0R3U5K3 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS2007 PE=4 SV=1)

HSP 1 Score: 186.422 bits (472), Expect = 1.327e-46
Identity = 144/462 (31.17%), Postives = 215/462 (46.54%), Query Frame = 1
Query:  448 QYSDPSLCNNRCLCIPQNMVV-CNANDAIRAIPTNVPKTFSRLLIQNIDLISRI-IYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGLNLKELHLME-----NPYIK----------IETGSFSGLKVKQINLRSNFISHLSSSEFKDL-DVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLS--DKDLNCRRPHIQSLAIDFSSS--QTQLSCLATSESR-------------EAE--------------ISWTYEENGQKKEFRKLHSS-NQIF-PQYG---------TLKSNLSVKVFIPPNEKRIYTCSTWIKDNDPQTVSVHIRTPNTHYPIMFPHDNRKSS-----SSNTINSPAIEDG-------------NYLFKKQFTVLEM 1599
            QY +P LC+  C C     VV C+  D I  IPTN+P    +L+IQ         +   NLTGL HL  L+I+  K+  +E+RAF  M  L  LDLS N +  I P+TF GLNL+ L+L E     +PY+           I + +F GL   +I+LR NFIS +S S F ++  +EKL L NN ++ +D    + FD  +H++D+T NPL C C L WL + ++          +   + P I      + L     D  C    IQS+ +D +S+     LSC A + +R             E E              ++W Y+E+GQ ++   + S   Q F P +G         T++ N+S+         R +TC TW +  + Q V V IR P     + F   N+ S+        T   P +++G             N+LF+KQ+T+LEM
Sbjct:   24 QYIEPRLCDGVCYCSRAEAVVDCSPQDRIMGIPTNLPPGTRKLVIQGGVFPEPGHLSAKNLTGLTHLVSLRIVNSKLRSVESRAFLGMTNLRDLDLSLNLLYRIEPRTFYGLNLQTLYLQEQRLQQDPYLYGPPTDPEPLLITSEAFYGLSAARIDLRRNFISDISFSLFSEVKGLEKLILSNNQIRQLDPTFATYFDNSNHMLDLTDNPLECSCKLAWLVRRVKEWVVQSPTLKTTCIVDPRIGGPGSRVELKKLSADHLCMASRIQSIGVDIASAGRAATLSCTAVAFNRMDVGAQHGGFRYGELEPYMYHPVVRLRPPSVAWKYKESGQLRQVTGMPSDLPQPFDPTFGANEEQKTMTTVQLNVSLS-----QASRQFTCITWDEKENDQEVLVTIRGPVFPALVEFQGGNKDSAVDFSNDKPTQLDPKVKEGGPTSPSNVAYAHSNFLFQKQYTLLEM 480          
BLAST of Immunoglobulin superfamily member 10 vs. TrEMBL
Match: A0A5K3FG50 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 186.037 bits (471), Expect = 2.154e-46
Identity = 142/462 (30.74%), Postives = 212/462 (45.89%), Query Frame = 1
Query:  448 QYSDPSLCNNRCLCIPQNMVV-CNANDAIRAIPTNVPKTFSRLLIQNIDLISRI-IYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGLNLKELHLME-----NPYIK----------IETGSFSGLKVKQINLRSNFISHLSSSEFKDL-DVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLS--DKDLNCRRPHIQSLAIDFSSS--QTQLSCLATS---------------------------ESREAEISWTYEENGQKKEFRKLHSS-NQIF-PQYG---------TLKSNLSVKVFIPPNEKRIYTCSTWIKDNDPQTVSVHIRTPNTHYPIMFPHDNRKSS-----SSNTINSPAIEDG-------------NYLFKKQFTVLEM 1599
            QY +P LC+  C C     VV C+  D I  IPTN+P    +L+IQ         +   NLTGL HL  L+I+  K+  +E+RAF  M  L  LDLS N +  I P+TF GLNL+ L+L E     +PY+           I + +F GL   +I+LR NFIS +S S F ++  +EKL L NN ++ +D    + FD  +H++D+T NPL C C L WL + ++          +   + P I      + L     D  C    IQS+ +D +S+     LSC A +                             R   ++W Y+E+GQ ++   + S   Q F P +G         T++ N+S+         R +TC TW +  + Q V V IR P     + F   N+ S+        T   P +++G             N+LF+KQ+T+LEM
Sbjct:   24 QYIEPRLCDGVCYCSRAEAVVDCSPQDRIMGIPTNLPPGTRKLVIQGGVFPEPGHLSAKNLTGLTHLVSLRIVNSKLRSVESRAFLGMTNLRDLDLSLNLLYRIEPRTFYGLNLQTLYLQEQRLQQDPYLYGPPTDPEPLLITSEAFYGLSAARIDLRRNFISDISFSLFSEVKGLEKLILSNNQIRQLDPTFATYFDNSNHMLDLTDNPLECSCKLAWLVRRVKEWVVQSPTLKTTCIVDPRIGGPGSRVELKKLSADHLCMASRIQSIGVDIASAGRAATLSCTAVAFNRMDVGAQHGGFRYGELEPYMYHPVVRLRPPSVAWKYKESGQLRQVTGMPSDLPQPFDPTFGANEEQKTMTTVQLNVSLS-----QASRQFTCITWDEKENDQEVLVTIRGPVFPALVEFQGGNKDSAVDFSNDKPTQLDPKVKEGGPTSPSNVAYAHSNFLFQKQYTLLEM 480          
BLAST of Immunoglobulin superfamily member 10 vs. TrEMBL
Match: A0A430PZT0 (Uncharacterized protein OS=Schistosoma bovis OX=6184 GN=DC041_0007236 PE=4 SV=1)

HSP 1 Score: 185.267 bits (469), Expect = 4.714e-46
Identity = 142/456 (31.14%), Postives = 218/456 (47.81%), Query Frame = 1
Query:  448 QYSDPSLCNNRCLC-IPQNMVVCNANDAIRAIPTNVPKTFSRLLIQNIDL-ISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGLNLKELHLME-----NPYIKIETGSFSGLKVKQINLRSNFISHLSSSEFKDL-DVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCL--------TPSILYQRPLISLSDKDLNCRRPHIQSLAIDF--SSSQTQLSCLATSESREAE----------------------ISWTYEENGQKKEFRKL----HSSNQIFPQYGTLK-SNLSVKVFIPPNEK-RIYTCSTWIKDNDPQTVSVHIRTPNTHYPIMFPHDNR--------------------------KSSSSNTINSPAIEDGNYLFKKQFTVLEM 1599
            QY  P LC N+C C   +N+V C+  D +  +PTN+P   ++L IQ  D  I   + ++N+TGLE L YL+IIYC ++VIE R F  M +L +LDLSHN +  I   TF GL L  L+L E     +  I I   SF GL   QINLR N I  +    F  +  +++L L +N +KTID G    F+ P+ L+D+T NPL C+C L W+ +      KD +  +++TC+           I     L+ L+ + L C    IQ + I+    +S+  +SC A +  + ++                      ++W Y E+GQ +E R L    H++  ++    T+   + +V++ I  ++K R YTC+TW    + + V V ++ P     I  P  N                           K S     N    +   YL++KQFT+LEM
Sbjct:    7 QYIQPGLCENQCHCPKGENVVHCDRQDHLYGVPTNIPNGITKLFIQQSDFPIPNSLNQANMTGLEKLEYLRIIYCNLQVIEPRTFMKMTELKHLDLSHNSLIRIESYTFYGLQLNHLYLSEQHTLPDNGIFITEDSFHGLSANQINLRGNRIQSIHYEIFHKVPSLDRLILSDNLIKTIDDGFEKYFNYPNKLLDLTGNPLECNCRLSWIVQR-TIDWKDSLPGLNMTCIHLTRKDNSIQKIKNIYELVKLTPEQL-CPTSRIQQIFINLLDDTSRALISCTAVTVPKHSQHLLYNTNMIISNNKILSHTPPGVAWRYIESGQLREVRYLTSINHNNEYLYQTNSTIDYPSATVQLNITLDKKPRKYTCTTWDDKKETEEVIVTLKGPEL---INIPKINNTLSIDHELINTQTNTNINTNNRNYYIKQSDDLLRNEILYDQSYYLYQKQFTLLEM 457          
BLAST of Immunoglobulin superfamily member 10 vs. TrEMBL
Match: A0A0R3TZ48 (Uncharacterized protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS13121 PE=4 SV=1)

HSP 1 Score: 183.726 bits (465), Expect = 8.791e-46
Identity = 140/457 (30.63%), Postives = 214/457 (46.83%), Query Frame = 1
Query:  448 QYSDPSLCNNRCLCIPQNMVV-CNANDAIRAIPTNVPKTFSRLLIQNIDLISRIIYKS--NLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGLNLKELHLMENPY----------------IKIETGSFSGLKVKQINLRSNFISHLSSSEFKDL-DVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQHQSKD-DMKYVSITCLTPSILYQRPLISLSDKDLNCRRPHIQSLAIDFS--SSQTQLSCLATSES----------------------------REAEISWTYEENGQKKEFRKLHSSNQIFPQYGTLKSNLSVKVFIPPNEKRIYTCSTWIKDNDPQTVSVHIRTPNTHYPIMFPHDNRKSSSSNTI----------------------NSPAIEDGNYLFKKQFTVLEM 1599
            QY++P LC+  C C  +  VV C   D I  +PTN+P    +L+IQ   L     Y S  NLTGL HL  L+II  K+  +E+RAF  M  L  LDLS N +  I  +TF GLNL+ L+L +  Y                + I   +F GL    I+LR NFIS++S S F  +  +EKL L +N ++ +D      FD P+HL+D+T NPL C C L WL     +++KD   +  ++TC++ S    R  +     D  C    IQS+ +D S   +   LSC A + S                            R   ++WTY E+GQ ++  ++ S +    +  +  + L + V +     R ++C TW    + Q + V +R      P++ P ++ K SS+ ++                      N P  + G +LF+KQ+T+LEM
Sbjct:   25 QYTEPRLCDGLCYCSREEQVVDCGRQDKIMGVPTNLPPGTVKLMIQG-GLFPEPGYLSAKNLTGLAHLVSLRIINSKLRAVESRAFLGMTNLRDLDLSLNLLYRIESRTFYGLNLQTLYLQQQRYQPDLYTSFGSPTDPEPLDISAEAFYGLSATSIDLRKNFISNISYSLFSQVRGLEKLVLSDNKIRQLDSRFAEYFDNPNHLLDLTENPLDCSCKLAWLV----NRAKDWGAQASTLTCISGS--GSRIELKRLTTDHLCMGSKIQSIGVDISPAGNAATLSCTAVTFSRLDSANKNLEGYRYTALEPYVNHPVVRQRPPAVAWTYVESGQLRKIAEMPSDHPPSIEQESTSTTLPLNVSL-SQTGRKFSCITWDDKQNEQEILVTLRG-CALPPLIEPKESVKDSSTGSLEDGLSQQEAKLKEGASGPASMGNMPYPQSG-FLFQKQYTLLEM 471          
BLAST of Immunoglobulin superfamily member 10 vs. Ensembl Cavefish
Match: slit3 (slit guidance ligand 3 [Source:NCBI gene;Acc:103037708])

HSP 1 Score: 87.4261 bits (215), Expect = 2.712e-17
Identity = 73/224 (32.59%), Postives = 115/224 (51.34%), Query Frame = 1
Query:  526 AIRAIPTNVPKTFSRLLIQNIDLISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTF-SGLNLKELHLMENPYIKIETGSFSGL-KVKQINLRSNFISHLSSSEFKDL-DVEKLFLFNNSLKTIDQGMMSIFDKPHHL--IDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNCRRP 1182
              R++P  +P+   RL +   + I+RI  K + +GL++L  L +   +I VIE  AF+++ QL  L L+ NR++++    F S   L  L L EN    I   SF G+  VK + L SN IS +    F+ L D+E L L NN++  I    +S F+    L  + +  N LHCDCHL WL+  L+ Q K    +    C++P+ +    +  +  +D  C  P
Sbjct:   50 GFRSVPRGIPRNAERLDVDRNN-ITRIT-KVDFSGLKNLRVLHLENNQISVIERGAFQDLKQLERLRLNRNRLQVLPELLFQSTPKLGRLDLSENQIQAIPRKSFRGITNVKNLQLDSNHISCIEDGAFRALRDLEILTLNNNNITLIP---LSSFNHMPKLRTLRLHSNNLHCDCHLSWLSDWLR-QRKGLAHFTQ--CMSPAHMRGLSVPDVQKRDFVCTGP 265          

HSP 2 Score: 70.0922 bits (170), Expect = 5.782e-12
Identity = 58/186 (31.18%), Postives = 94/186 (50.54%), Query Frame = 1
Query:  634 EHLSYLKIIYCKIEVIEA-RAFENMVQLYYLDLSHNRIRIIAPQTFSGLN-LKELHLMENPYIKIETGSFSGL-KVKQINLRSNFISHLSSSEFKDLD-VEKLFLFNNSLKTIDQGMMSIFDKPHHL--IDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNC 1173
            EH + L++   +I  ++A  AF+ +  L  ++LS+N++R I    F G   + EL L  N    ++   F GL  +K + LRSN I+ + ++ F  L  V  L L++N + TI  G    F+  H L  I++  NP  CDCHL WL   L+   K  +   +  C  P+ L + P+  ++  D  C
Sbjct:  532 EHTTDLRLNDNEISSLDATGAFKKLPNLRKINLSNNKLRDIREGVFDGAGGVLELLLTGNKLQAVQGRMFRGLTGLKTLMLRSNQITCVDNATFTGLSSVRLLSLYDNRISTIAPGA---FNTLHSLSTINLLSNPYVCDCHLAWLGLWLK---KTRVVSGNPRCQRPAFLKEIPIQDVAAPDFTC 711          

HSP 3 Score: 68.1662 bits (165), Expect = 2.516e-11
Identity = 67/204 (32.84%), Postives = 94/204 (46.08%), Query Frame = 1
Query:  463 SLCNNRCLCIPQNMVVCNANDAIRAIPTNVPKTFSRLLIQNIDLISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGL-NLKELHLMENPYIKIETGSFSGLKVKQINL-RSNFISHLSSSEFKDL-DVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNL 1065
            S+C   C C   N+V C     +  IP N+P+            I  I  + NL               I+ I   AF    +L  +DLS N I  IA   FSGL +L  L L  N   +I  G F GL   Q+ L  +N I+ L  + FKDL  +  L L++N L+TI +G+ +   +    + + +NP  CDCHL+WLA  L
Sbjct:  278 SVCPASCSCT-NNIVDCR-RKGLTEIPANLPEG-----------IVEIRLEQNL---------------IKSIPPGAFSPYKKLKRIDLSKNHISDIADDAFSGLRSLTSLVLYGNKIAEIPKGLFDGLVSLQLLLLNANKINCLRVNTFKDLQSLNLLSLYDNKLQTISKGLFTPL-RAIKTLHLAQNPFMCDCHLKWLADYL 452          

HSP 4 Score: 58.5362 bits (140), Expect = 2.347e-8
Identity = 64/255 (25.10%), Postives = 99/255 (38.82%), Query Frame = 1
Query:  487 CIPQNMVVCNANDAIRAIPTNVPKTFSRLLIQNIDLISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGL-NLKELHLMENPYIKIETGSFSGLKVKQINLRSNFISHLSSSEFKDLDVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSIT-CLTPSILYQRPLISLSDKDLNCRRPHIQSLAIDFSSSQTQLSCLAT 1245
            C   + VV  +N  +R++P  +PK  + L ++   L S       L+ L+ LS + +    I  +    F NM QL  L LS+N+IR +    F GL +L+ L L  N    I  G+F+ L           +SHL+                                      +  NPL+CDC L+WL++ +    K   K   I  C  P  +  R L++       C+ P      +D +       CLAT
Sbjct:  730 CTCSDTVVRCSNHGLRSLPKGIPKDTTELYLEGNMLTS---VPKELSSLKQLSLVDLSNNSISSLTPFIFSNMTQLSTLILSYNQIRCVPVHAFDGLRSLRLLTLHGNDLSTIPEGAFNHLTS---------LSHLA--------------------------------------LGANPLYCDCELRWLSQWV----KAGFKEPGIARCTGPPDMADRLLLTTPLNRFQCKGP------VDLNLMSKCAPCLAT 924          
BLAST of Immunoglobulin superfamily member 10 vs. Ensembl Cavefish
Match: slit2 (slit homolog 2 (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-010306-3])

HSP 1 Score: 78.1814 bits (191), Expect = 1.797e-14
Identity = 63/246 (25.61%), Postives = 117/246 (47.56%), Query Frame = 1
Query:  466 LCNNRCLCIPQNMVVCNANDAIRAIPTNVPKTFSRLLIQNIDLISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTF-SGLNLKELHLMENPYIKIETGSFSG-LKVKQINLRSNFISHLSSSEFKDL-DVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNCRRPHIQS 1194
            LC  +C C     V C+A   +R +P  + ++  R+ + + +L    I K++  G  HL  L+++  KI +IE  AF+++ +L  L L+ N ++++    F + + L  L L EN    I   +F G  ++K + L  N IS +    F+ L D+E L L NN++  +     +   K      +  N L CDCH+ WL+  L+ + +  +      C+ P  +    +  +  ++  C    +Q+
Sbjct:   21 LCPPQCTCA-GTAVDCHAQ-GLRNVPRGITRSAERIDLNSNNLTK--ISKADFAGFRHLRVLQLMENKISIIERGAFQDLKELERLRLNRNNLQVLPELLFLATVKLSRLDLSENQIQGIPRKAFRGPTELKNLQLDYNQISCIEDGAFRALRDLEVLTLNNNNISRMSVASFNHMPK-LRTFRLHSNNLICDCHVAWLSDWLRQRPRLGLY---TQCMAPPSMRGHNVAEVQKREFVCTGSQVQT 258          

HSP 2 Score: 74.7146 bits (182), Expect = 1.931e-13
Identity = 61/210 (29.05%), Postives = 103/210 (49.05%), Query Frame = 1
Query:  634 EHLSYLKIIYCKIEVIEARA-FENMVQLYYLDLSHNRIRIIAPQTFSGL-NLKELHLMENPYIKIETGSFSGL-KVKQINLRSNFISHLSSSEFKDLD-VEKLFLFNNSLKTIDQGMMSIFDKPHHL--IDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNCRRPHIQSLAIDFSSSQTQLSCLAT 1245
            ++ + L++   +  V+EA   F+ + QL  ++LS NRI  I   TF G   + EL L  N    +      GL  ++ + LRSN IS +S+S F  L  V  L L++N + +I  G    FD  H L  +++  NP +C+CHL WL + L+ +    +   +  C  P  L + P+  ++ +D  C   + ++     +    + SCL T
Sbjct:  517 QYTAELRLNNNEFSVLEATGIFKKLPQLRKINLSSNRISDIEEGTFEGAAGVNELILTSNRLENVHHSMLKGLTGLRTLMLRSNKISCVSNSSFTGLSSVRLLSLYDNLITSIAPGA---FDTLHSLSTLNLLANPFNCNCHLAWLGEWLRRKR---IVTGNPRCQNPYFLKEIPIQDVAAQDFACEDGNDENSCSPLARCPAECSCLDT 720          

HSP 3 Score: 70.4774 bits (171), Expect = 4.509e-12
Identity = 68/239 (28.45%), Postives = 108/239 (45.19%), Query Frame = 1
Query:  469 CNNRCLCIPQNMVVCNANDAIRAIPTNVPKTFSRL-LIQNIDLISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGL-NLKELHLMENPYIKIETGSFSGLKVKQINLRSNFISHLSSSE-FKDL-DVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNC 1173
            C   C C   N+V C     +  IPTN+P+T + + L QN                            I+VI   AF    +L  +DLS+N+I  +A  +F GL +L  L L  N   ++  G F GL   Q+ L +    +    + F+DL ++  L L++N L+TI +G  S   +    + + +NP  CDCHL+WLA  LQ   ++ ++     C +P  L  + +  +  K   C
Sbjct:  265 CPEFCTC-SNNIVDCRGK-GLTEIPTNLPETITEIRLEQN---------------------------SIKVIPPGAFSPYKRLRRIDLSNNQISELAADSFQGLRSLNSLVLYGNKITELPKGLFEGLFSLQLLLLNANKLNCLRVDAFQDLQNLNLLSLYDNKLQTIAKGTFSSL-RSIQTLHLAQNPFMCDCHLKWLADYLQ---ENPIETSGARCTSPRRLANKRIGQIKSKKFRC 470          
BLAST of Immunoglobulin superfamily member 10 vs. Ensembl Cavefish
Match: pxdn (peroxidasin [Source:NCBI gene;Acc:103028918])

HSP 1 Score: 77.411 bits (189), Expect = 3.174e-14
Identity = 80/283 (28.27%), Postives = 123/283 (43.46%), Query Frame = 1
Query:  463 SLCNNRCLCIPQNMVVCNANDAIRAIPTNVPKTFSRLLIQNIDLISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGL-NLKELHLMENPYIKIETGSFSGL-KVKQINLRSNFISHLSSSEFKDL-DVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNCRRPHIQS--LAIDFSSSQT-QLSCLATSESREAEISWTYEENG 1293
            S C +RCLC    +   + N  +  +P   P+T                           + L + + KI+ ++  +F  +  L  L L++N IR I    F  L NLK L+L +N    I+  +F GL  ++Q+ L  N I  L    F  L  +E+LFL NN +  +  G  S       L  +  N L+CDC L WLA  L+  ++      + TC  PS L  R + +L+ ++LNC  P I S    +D +S  T   +C A    +  +I W    N 
Sbjct:   30 SACPSRCLCFRTTVRCMHLN--LETVPAVSPQT---------------------------TILDLRFNKIKDLQLGSFRRLKNLNTLLLNNNHIRRIPRAAFEDLENLKYLYLYKNEIQSIDRQAFKGLVSLEQLYLHFNNIEALEPESFTHLPKLERLFLHNNRITHLTLGTFSHLQAMKRL-RLDSNTLNCDCELLWLADLLKQYAESGNAQAAATCEFPSRLQGRSVATLTAEELNCEVPRITSEPQDVDVTSGNTVYFTCRAEGNPK-PQIIWLRNNNA 281          
BLAST of Immunoglobulin superfamily member 10 vs. Ensembl Cavefish
Match: slit2 (slit homolog 2 (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-010306-3])

HSP 1 Score: 73.9442 bits (180), Expect = 9.471e-14
Identity = 59/208 (28.37%), Postives = 104/208 (50.00%), Query Frame = 1
Query:  466 LCNNRCLCIPQNMVVCNANDAIRAIPTNVPKTFSRLLIQNIDLISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTF-SGLNLKELHLMENPYIKIETGSFSG-LKVKQINLRSNFISHLSSSEFKDL-DVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQHQSK 1080
            LC  +C C     V C+A   +R +P  + ++  R+ + + +L    I K++  G  HL  L+++  KI +IE  AF+++ +L  L L+ N ++++    F + + L  L L EN    I   +F G  ++K + L  N IS +    F+ L D+E L L NN++  +     +   K      +  N L CDCH+ WL+  L+ + +
Sbjct:   21 LCPPQCTC-AGTAVDCHA-QGLRNVPRGITRSAERIDLNSNNLTK--ISKADFAGFRHLRVLQLMENKISIIERGAFQDLKELERLRLNRNNLQVLPELLFLATVKLSRLDLSENQIQGIPRKAFRGPTELKNLQLDYNQISCIEDGAFRALRDLEVLTLNNNNISRMSVASFNHMPKLRTF-RLHSNNLICDCHVAWLSDWLRQRPR 223          
BLAST of Immunoglobulin superfamily member 10 vs. Ensembl Cavefish
Match: nyx (nyctalopin [Source:ZFIN;Acc:ZDB-GENE-061026-3])

HSP 1 Score: 73.559 bits (179), Expect = 2.047e-13
Identity = 72/269 (26.77%), Postives = 127/269 (47.21%), Query Frame = 1
Query:  568 RLLIQNIDLISRIIYKSN-------LTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGLNLKELHLMENPYI------KIETGSFSGL-KVKQINLRSNFISHLSSSEFKDL-DVEKLFLFNNSLKTIDQGM---------------------MSIFDKPHHLID---ITRNPLHCDCHLQWLAKNLQHQSKDDMKYV-SITCLTPSILYQRPLISLSDKDLN--CRRPHIQSLAI---DFSSSQTQLSCL 1239
            R+ ++ I L     + +N       + G+E+L+++ +   KIE +   +   +  L YL+L  NRI +I   +F     K+LH +EN Y+      ++   SF GL ++K +NL  N ++++S S F DL ++E L+L  N L +ID G                       ++F +P + I    + RNP  C+C L+WL + ++       K V  I C +PS +    L  ++   LN  C  P   +L     D+S+++ + + L
Sbjct:  136 RIFVEQISLKELFCFHNNFRRVPVAIRGMENLTHVYLERNKIEAVAYNSLLGLSNLKYLNLQENRISVIHDDSF-----KDLHRLENFYLNDNLLSELPQQSFKGLSRLKMLNLGGNLLTNISKSWFGDLMELEVLYLDRNRLISIDMGAFENLTSLMTLHLNSNNLTTLPFAVF-QPIYFIGRLYLFRNPWECNCELEWLKEWME-----SYKLVRDIPCASPSSVAGLDLSEVTYAHLNSTCIDPAELNLTTALPDYSTTENKFNSL 393          
BLAST of Immunoglobulin superfamily member 10 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010345.1 (pep scaffold:Pmarinus_7.0:GL477728:405586:411287:1 gene:ENSPMAG00000009370.1 transcript:ENSPMAT00000010345.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.559 bits (179), Expect = 1.888e-14
Identity = 52/161 (32.30%), Postives = 84/161 (52.17%), Query Frame = 1
Query:  619 NLTGLEHLSY--------LKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGL-NLKELHLMENPYIKIETGSFSGL-KVKQINLRSNFISHLSSSEF-KDLDVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHL----QWLA 1056
            N+T L  L++        L + Y KI+ I  +AF  +  L YL+L +N+I  IAP T   L NL+ L L  N   ++ + +F GL  ++++   +N +S L+   F  ++ + +L + +N +K I+ G  S       +I +  NP HCDC L    QWLA
Sbjct:  166 NITSLPALAFQHTPSLVILDLAYNKIQQISPKAFVGLKNLDYLNLDNNKITTIAPGTLQSLQNLEMLVLNNNNIKRVTSSTFKGLTNLRELYFSNNMVSVLTKDAFNSNIKLTQLTISDNKIKVIEAGTFSTLSG-LQMIYLHGNPYHCDCKLNPLVQWLA 325          
BLAST of Immunoglobulin superfamily member 10 vs. Ensembl Sea Lamprey
Match: pxdn (peroxidasin [Source:ZFIN;Acc:ZDB-GENE-140415-2])

HSP 1 Score: 72.0182 bits (175), Expect = 2.775e-13
Identity = 69/222 (31.08%), Postives = 106/222 (47.75%), Query Frame = 1
Query:  643 SYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGL-NLKELHLMENPYIKIETGSFSGL-KVKQINLRSNFISHLSSSEFKDL-DVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNCRRPHIQSLA--IDFSSSQT-QLSCLATSESREAEISWTYEEN 1290
            SY  + + +I  I   AF+ +  L  L L++N I+ I  + F  L +LK L+L +N    I+  +F GL  ++Q+ +  N I  L  + F DL  +E+LFL NN L  I  G  +       L  +  N L CDC L WLA+ L+  +       + TC  P  L  R + S++ ++ +C  P I S    +D +   T  L C A    + A I W +  N
Sbjct:    2 SYRDLRFNRIREIPPGAFKKLKNLNTLLLNNNHIKRIPRRAFEDLESLKYLYLYKNEIQSIDRHAFKGLVSLEQLYIHFNHIEVLEPNTFVDLPKLERLFLHNNRLSRIATGTFTQLSSLRRL-RLDSNRLVCDCELVWLAELLRAFAGSGGTLAAATCEHPRRLQGRSVSSITAQEFHCESPRITSEPHDVDVTPGNTVYLRCRAEGNPKPA-IIWLHNSN 221          
BLAST of Immunoglobulin superfamily member 10 vs. Ensembl Sea Lamprey
Match: flrt3 (fibronectin leucine rich transmembrane 3 [Source:ZFIN;Acc:ZDB-GENE-030131-1988])

HSP 1 Score: 62.3882 bits (150), Expect = 1.388e-10
Identity = 54/220 (24.55%), Postives = 93/220 (42.27%), Query Frame = 1
Query:  529 IRAIPTNVPKTFSRLLIQNIDLISRIIYKSNLTGLEHLSYLKIIYCKI--EVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGLNLKELHLMENPYIKIETGSFSGLKVKQINLRSNFISHLSSSEFKDLDVEKLFLFNNSLKTIDQGMMSIFDKPHHL--IDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNCR 1176
            + A+P  +P+    L + +  + +  I +  L GL +L  L +   ++  + I  RAF ++  L  L L+ N    + P    G  L+ L+L +N   ++  G+ +GL+                       + +L L  NSL  + QG   +FD    L  + +  NP  C C L WL + ++ +S   M    + C  P      PL  L+   L+CR
Sbjct:  166 LSAVPIGLPRGLEELRLDDNRVGA--ISEQALGGLGNLKRLFLEGNQLSEKSIAERAFRDLDSLAELSLARNAFAAV-PANLPGTRLERLYLQDNRISRVSAGALAGLR----------------------QLARLDLSGNSLGVLPQG---VFDDLSQLAQLSVRNNPWRCTCALLWLQEWMKRRSSVTMVR-GMVCQAPETARGTPLEGLA---LDCR 353          
BLAST of Immunoglobulin superfamily member 10 vs. Ensembl Sea Lamprey
Match: LGI1 (leucine rich glioma inactivated 1 [Source:HGNC Symbol;Acc:HGNC:6572])

HSP 1 Score: 60.8474 bits (146), Expect = 6.045e-10
Identity = 50/174 (28.74%), Postives = 80/174 (45.98%), Query Frame = 1
Query:  658 IYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGLNLKELHLMENPYIKIETGSFSGL-KVKQINLRSNFISHLSSSEFKDLD-VEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNC 1173
            + CK  V+      +   L + D   N+I   A  TFS L    + L+ +    I   +F GL K+  + + +N I  +S + F+ L  +  L L NN L+++ + +    D     +D+  N LHCDC ++WL   L H +   +    ITC +P     R   SLS  D +C
Sbjct:   38 VICKSAVVPRNLPLDATSLTFDDADFNQI---ANGTFSHLPTLHVLLLGSSSFSIRDDAFKGLVKLHYLFIENNIIDEISRNAFRGLKTLTHLSLANNKLRSLPRDVFKGLDAMTD-VDLRGNALHCDCKMKWLVSWL-HSTNASVH--DITCASPPEFAGRSTRSLSASDFSC 204          
BLAST of Immunoglobulin superfamily member 10 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008602.1 (pep scaffold:Pmarinus_7.0:GL490863:524:3445:1 gene:ENSPMAG00000007797.1 transcript:ENSPMAT00000008602.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 59.6918 bits (143), Expect = 7.894e-10
Identity = 63/243 (25.93%), Postives = 107/243 (44.03%), Query Frame = 1
Query:  469 CNNRCLCI-PQNMVVCNANDAIRAIPTNVPKTFSRLLIQNIDLISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGL-NLKELHLMENPYIKIETGSFSGLK-------------------------VKQINLRSNFISHLSSSEFKDLD-VEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKN---LQHQSKDDMKYVSI 1104
            C   C C+ PQ    C  +  +  +P NVP   S+L +Q   L  R +  +    L  L  L +I C++ +++  AF  + QL YL L +N ++ +    F GL ++  L+L  N    I +G FS +K                         ++ + L  N +S++S   F  L  + +L L  N+L T     + + D   +L+ ++RNP+       WLA+    L H + D+M   S+
Sbjct:   22 CPEHCRCLLPQRHTSC-LDARLSEVPQNVPSNTSQLDLQGNQL--RTLPTNAFENLSVLKSLHLIDCELSIVKPGAFNGLSQLTYLYLQNNSLKSLPIGLFDGLVSVTYLYLDYNQLDSICSGIFSPMKKLTGLYIRYNHLTWLADHTFQGLTSLQWLYLSDNSVSNISKDAFHGLQALRRLTLDGNNLTTPPSNAIRVLDN-LNLLRLSRNPVP-SLKNNWLARGIRSLTHLNLDEMGLTSL 259          
BLAST of Immunoglobulin superfamily member 10 vs. Ensembl Nematostella
Match: EDO27257 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T9R6])

HSP 1 Score: 72.7886 bits (177), Expect = 8.452e-15
Identity = 58/196 (29.59%), Postives = 96/196 (48.98%), Query Frame = 1
Query:  607 IYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGLNLKE-LHLMENPYIKIETGSFSGLK-VKQINLRSNFISHLSSSEFK-DLDVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQ----WLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNC 1173
            I +    GL++L  L +    ++ I    F +++ L +LD+S N IR    ++ + L L E LH+  N    +   +   +K +K+++L +N IS++SS+ F  +  ++KL L NN+++ I +   S       L  +  NP  CDC L     WL  N    + +   Y    C+TP  L  R L+ LS  DL C
Sbjct:    1 IEEGAFNGLDNLRKLHVSATGMKKITQGTFGSLMSLEFLDVSFNEIRHFDEESLACLPLLEVLHINNNSLTTVPLHALRKVKFLKELDLSANLISYVSSTAFANNSKLQKLLLHNNTIRLIHEDAFSQLKGLRALF-LRGNPFQCDCQLNGFHAWLRNNQYLVNFNGHMY----CMTPDKLTGRDLLELSSSDLKC 191          
BLAST of Immunoglobulin superfamily member 10 vs. Ensembl Nematostella
Match: EDO35407 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLJ8])

HSP 1 Score: 63.5438 bits (153), Expect = 3.904e-11
Identity = 65/244 (26.64%), Postives = 97/244 (39.75%), Query Frame = 1
Query:  631 LEHLSYLKIIYC---KIEVIEARAFENMVQLYYLDLSHNRIRI--------------------------IAPQTFSGL-NLKELHLMENPYIKIETGSFSGLK----------------------------VKQINLRSNFISHLSSSEFKD-LDVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQ----WLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNC 1173
             E+L YLK +     KI  + A  F+ +V L  LDL  N ++                           I    F+GL NL++LH+      KI  G+F  L                             +K+++L +N IS++SS+ F +   ++KL L NN+++ I +   S       L  +  NP  CDC L     WL  N    + +   Y    C+TP  L  R L+ LS  DL C
Sbjct:   38 FENLRYLKQLNLGENKIRTVSASMFKGLVSLEKLDLRFNDLKALPRGVFKPLKSLRELFLHDNRNMGSRIEEGAFNGLDNLRKLHVSATGMKKITQGTFGSLMSLEFLDVLHINNNSLTTVPLHALRKVKFLKELDLSANLISYVSSTAFANNSKLQKLLLHNNTIRLIHEDAFSQLKGLRALF-LRGNPFQCDCQLNGFHAWLRNNQYLVNFNGHMY----CMTPDKLTGRDLLELSSSDLKC 276          
BLAST of Immunoglobulin superfamily member 10 vs. Ensembl Nematostella
Match: EDO47109 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNB0])

HSP 1 Score: 62.3882 bits (150), Expect = 3.402e-10
Identity = 64/273 (23.44%), Postives = 109/273 (39.93%), Query Frame = 1
Query:  517 ANDAIRAIPTNVPKTFSRL--LIQNIDLISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGLN--LKELHLMENPYIKI---------------------ETGSFSGLKVK------------------------QINLRSNFISHLSSSEFKDL-DVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQHQSKDDMKYV----SITCLTPSILYQRPLISLSDKDLNC 1173
            +N+ +  I     K+  +L  L  N + +  ++Y     GL  L YL + +  I  I   AF     L  LD+S NR+     +T  GL+  L EL L  N   ++                     E  +F GL ++                        ++++  N++  ++S +  DL  +E+L L  N++  I  G +    K    I ++ NPL CDC L WL   L   S+ D  ++    S TC +P+ +  +  + L  +   C
Sbjct:  104 SNNELSVIANGTFKSLGKLKTLTLNSNRLE-VVYAETFRGLRDLRYLSLRHNSIRTIGDGAFRFSAFLICLDISFNRLSEFKTETLRGLSSTLTELRLRSNILRRVAIKRRFNITLLDLGDNLLEVFEVDAFDGLSLRKLRLDGNKLDEIPEAFAKVGHFLQELDMSGNYLHEITSDQLLDLHAIERLDLNENNISKIRIGALRGMKKLRQ-ISLSGNPLSCDCRLVWLKHVL--DSRQDQLHLSSPQSTTCASPASVKGQTFLGLDARSFLC 372          
BLAST of Immunoglobulin superfamily member 10 vs. Ensembl Nematostella
Match: EDO31669 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXA1])

HSP 1 Score: 56.9954 bits (136), Expect = 2.203e-8
Identity = 58/204 (28.43%), Postives = 91/204 (44.61%), Query Frame = 1
Query:  619 NLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGL-NLKELHLMENPYIKIETGSFSGLK-VKQINLRSNFISHLSSSEFKDL-DVEKLFLFNNSLKTIDQGMMS--------IFDKPH-------HLIDITRNPLHCDCHLQWLAKNL-QHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNC 1173
            NLT LE L   K    K+  +    F+ +  L  L L  NR+  +    FSGL +L+EL+L  N    IE  +F+ LK +  + L SN ++ +S      L +V+ + ++ N L+ + +            ++D P           ++  N LHCDC+  W    L  H    D     +TC TP  L    L +L+D D+ C
Sbjct:  141 NLTALESLILSK---NKLRRLTYAMFDTLSYLRLLSLVDNRLTGLTRSMFSGLKSLRELYLQRNQIQDIEPWTFTSLKSLASLYLDSNQLTVISRDTLLGLTNVKDIHVYFNKLRYVARDAFKPNPQLTRIVWDVPALFRRTRPEFANMVGNMLHCDCNALWFRDWLISHAYTRD-----VTCQTPPRLKGVLLGNLNDSDIKC 336          
BLAST of Immunoglobulin superfamily member 10 vs. Ensembl Nematostella
Match: EDO49136 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGZ6])

HSP 1 Score: 55.8398 bits (133), Expect = 2.928e-8
Identity = 57/180 (31.67%), Postives = 85/180 (47.22%), Query Frame = 1
Query:  445 TQYSDPSLCNNRCLC---IPQNMVVCNANDAIRAIPTNVPKTFSRLLIQNIDLISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGL-NLKELHLMENPYIKIETGSFSG---LKVKQINLRSNFISHLSSSEFKD-LDVEKLFLFNNSLKTI 960
            +Q +  + C   C C      N  VC   D   A P   P T    L+ N+ LI+  + +  L  L  L  L +   +I+ I +  F +M +L  LDLS N++  I+   F+GL NL  L L  N  + +    F G   LK+  IN   N I+ L    F++ L +E LF+ +N+L TI
Sbjct:   12 SQIAVVAACPGFCHCDSSYMANKTVCRRQDLWLAPPGVSPHTTHLDLLGNL-LIT--VTRGYLRNLRQLLELNLGMNQIDYIASGTFTDMAKLELLDLSGNQLTFISEGMFTGLRNLTTLFLFMNEILDLPASLFWGTPNLKILSIN--RNNITKLHQHLFRNSLHLEYLFMDDNNLTTI 186          
BLAST of Immunoglobulin superfamily member 10 vs. Ensembl Medaka
Match: lrrc24 (leucine-rich repeat-containing protein 24 [Source:NCBI gene;Acc:101166166])

HSP 1 Score: 84.3445 bits (207), Expect = 1.481e-16
Identity = 83/311 (26.69%), Postives = 144/311 (46.30%), Query Frame = 1
Query:  469 CNNRCLCIPQNMVVCNANDAIRAIPTNVPKTFSRLLIQNIDLISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGL-NLKELHLMENPYIKIETGSFSGL-KVKQINLRSNFISHLSS-SEFKDLDVEKLFLFNNSLKTIDQGMMSIFDKPH---HLIDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVS------ITCLTPSILYQRPLISLSDKDLNCRRPHIQ----SLAIDFSSSQTQLSCLATSESREAEISWTYEENGQ-----KKEFRKLHSSNQIF 1338
            C + C C   ++ V   +  I+ +P  +P     + +Q+  ++   I   +LTGLE L YL +    I  +E  AF N  QL  L L+ N I ++ P  F GL +L+ L+L  N   +I+  +F GL ++++++L+ N I  L+  +      +  L L  N L+T+     + F KP     ++ +T NP  CDC L WL   +   S+D  + +S      + C  P  L    L  ++   L C  P +Q     L +    S  ++SC A+   +   ++W    +G+     +  F++L  S  +F
Sbjct:   24 CPSGCRCY--SLTVECGSLGIKEVPHGIPSITETIFLQDNTIVQ--IRLQDLTGLESLHYLYLQNNSISALEPGAFLNQGQLLELALNGNLIHLVTPDMFQGLEHLRILYLAGNQITRIQDHTFRGLQRLQELHLQENSIELLAEHALSGLSSLALLDLSKNHLRTLG----ASFLKPLVSLQVLRVTENPWRCDCALAWLRTWI---SEDGQRLLSSAEQRRLMCSEPPRLSHLSLAEVAPNSLVCIPPVVQLEPSHLTVRLGES-LRVSCQASGYPQPL-VTWKKSAHGRAQLSPRGLFQELGPSGDLF 321          
BLAST of Immunoglobulin superfamily member 10 vs. Ensembl Medaka
Match: lrrc24 (leucine-rich repeat-containing protein 24 [Source:NCBI gene;Acc:101166166])

HSP 1 Score: 84.3445 bits (207), Expect = 1.514e-16
Identity = 83/311 (26.69%), Postives = 144/311 (46.30%), Query Frame = 1
Query:  469 CNNRCLCIPQNMVVCNANDAIRAIPTNVPKTFSRLLIQNIDLISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGL-NLKELHLMENPYIKIETGSFSGL-KVKQINLRSNFISHLSS-SEFKDLDVEKLFLFNNSLKTIDQGMMSIFDKPH---HLIDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVS------ITCLTPSILYQRPLISLSDKDLNCRRPHIQ----SLAIDFSSSQTQLSCLATSESREAEISWTYEENGQ-----KKEFRKLHSSNQIF 1338
            C + C C   ++ V   +  I+ +P  +P     + +Q+  ++   I   +LTGLE L YL +    I  +E  AF N  QL  L L+ N I ++ P  F GL +L+ L+L  N   +I+  +F GL ++++++L+ N I  L+  +      +  L L  N L+T+     + F KP     ++ +T NP  CDC L WL   +   S+D  + +S      + C  P  L    L  ++   L C  P +Q     L +    S  ++SC A+   +   ++W    +G+     +  F++L  S  +F
Sbjct:   24 CPSGCRCY--SLTVECGSLGIKEVPHGIPSITETIFLQDNTIVQ--IRLQDLTGLESLHYLYLQNNSISALEPGAFLNQGQLLELALNGNLIHLVTPDMFQGLEHLRILYLAGNQITRIQDHTFRGLQRLQELHLQENSIELLAEHALSGLSSLALLDLSKNHLRTLG----ASFLKPLVSLQVLRVTENPWRCDCALAWLRTWI---SEDGQRLLSSAEQRRLMCSEPPRLSHLSLAEVAPNSLVCIPPVVQLEPSHLTVRLGES-LRVSCQASGYPQPL-VTWKKSAHGRAQLSPRGLFQELGPSGDLF 321          
BLAST of Immunoglobulin superfamily member 10 vs. Ensembl Medaka
Match: ENSORLT00000000072.2 (pep primary_assembly:ASM223467v1:1:1576629:1604541:-1 gene:ENSORLG00000000055.2 transcript:ENSORLT00000000072.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 82.0333 bits (201), Expect = 3.127e-16
Identity = 73/240 (30.42%), Postives = 112/240 (46.67%), Query Frame = 1
Query:  469 CNNRCLCIPQNMVVCNANDAIRAIPTNVPKTFSRLLIQNIDLISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTF-SGLNLKELHLMENPYIKIETGSFSGLK-VKQINLRSNFISHLSSSEFKDL-DVEKLFLFNNSLKTIDQGMMSIFDKPHHL--IDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNC 1173
            C   C C   N V C+    I+++P N+P+   RL +   +L   +I KS+L+GL HL  L ++  +I  IE  AF+ + +L  L L+ NR+  +    F     L  L L EN    +   +F G   +K + L  N IS +    F+ L  +E L L NN++ +I    +S F+    L    +  N L CDCHL WL+  L+ +    +      C +P+ L    L  L   D  C
Sbjct:   45 CPAPCTCA-GNTVDCHGR-GIQSVPKNIPRGTERLDLNGNNLT--VITKSDLSGLRHLRVLHLMENQISNIERGAFDELKELERLRLNRNRLSQLPELLFQKNEALSRLDLSENRIQAVPRRAFRGAADLKNLQLDKNHISCVEEGAFRALRSLEVLTLNNNNISSIP---VSSFNHMPKLRTFRLHSNSLRCDCHLAWLSPWLRQRPALGLY---TQCSSPAALRGLNLAELRKSDFAC 274          
BLAST of Immunoglobulin superfamily member 10 vs. Ensembl Medaka
Match: slit2 (slit guidance ligand 2 [Source:NCBI gene;Acc:101173607])

HSP 1 Score: 83.1889 bits (204), Expect = 4.750e-16
Identity = 67/243 (27.57%), Postives = 115/243 (47.33%), Query Frame = 1
Query:  454 SDPSLCNNRCLCIPQNMVVCNANDAIRAIPTNVPKTFSRLLIQNIDLISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGLN-LKELHLMENPYIKIETGSFSG-LKVKQINLRSNFISHLSSSEFKDL-DVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNC 1173
            +D   C  +C C     V C+    +R++P N+P+   RL +   +L    I K++  GL HL  L+++  KI  IE  AF+++ +L  L L+ N + +     F G   L  L L EN    +   +F G +++K + L  N IS +    F+ L D+E L L NN++  +     +   K      +  N L CDCH+ WL++ L+ + +  +      C++P  L    +  +  K+  C
Sbjct:   31 ADAQPCPTQCSCT-GTTVDCHGQ-GLRSVPRNIPRNTERLDLNANNLTK--ITKADFAGLRHLRVLQLMENKITTIERGAFQDLKELERLRLNRNNLAVFPELLFLGTTKLHRLDLSENQIQGVPRKAFRGAVEIKNLQLDYNHISCIEDGAFRALRDLEVLTLNNNNISRLSVASFNHMPK-LRTFRLHSNNLQCDCHVAWLSEWLRQRPRLGLY---TQCMSPPHLRGHNVAEVQKKEFVC 265          

HSP 2 Score: 78.9518 bits (193), Expect = 1.052e-14
Identity = 73/239 (30.54%), Postives = 109/239 (45.61%), Query Frame = 1
Query:  469 CNNRCLCIPQNMVVCNANDAIRAIPTNVPKTFSRL-LIQNIDLISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGL-NLKELHLMENPYIKIETGSFSGLKVKQINL-RSNFISHLSSSEFKDL-DVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNC 1173
            C   C C   N+V C     +  IPTN+P+T + + L QN                            I+VI A AF    +L  +DLS+N+I  +A   F GL +L  L L  N   +I  G F GL   Q+ L  +N I+ L    F+DL ++  L L++N L+TI +G  S   +    + + +NP  CDCHL+WLA  LQ    + ++     C +P  L  + +  +  K   C
Sbjct:  285 CPESCTC-SNNIVDCRGK-GLTEIPTNLPETITEIRLEQN---------------------------AIKVIPAGAFSPYKRLRRIDLSNNQISELASDAFQGLRSLNSLVLYGNKITEISKGLFEGLFSLQLLLLNANKIACLRVDAFQDLHNLNLLSLYDNKLQTIAKGTFSSL-RAIQTLHLAQNPFICDCHLKWLADYLQ---DNPIETSGARCTSPRRLANKRIGQIKSKKFRC 490          

HSP 3 Score: 70.0922 bits (170), Expect = 5.136e-12
Identity = 67/232 (28.88%), Postives = 106/232 (45.69%), Query Frame = 1
Query:  667 KIEVIEARA-FENMVQLYYLDLSHNRIRIIAPQTFSGL-NLKELHLMENPYIKIETGSFSGLK-VKQINLRSNFISHLSSSEFKDLD-VEKLFLFNNSLKTIDQGMMSIFDKPHHL--IDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNCRRPHIQSLAIDFSSSQTQLSCLATSESREAEISWTYEENGQKKEFRKLHSSNQIFPQ 1344
            +  V+EA   F+ +  L  ++LS+NRI  I   TF G   + EL L  N    I      GL  ++ + LRSN IS +S+S F  L  V  L L++N + ++  G    FD  H L  +++  NP +C+CHL WL   L+ +    +   +  C  P  L + P+  ++ +D  C   + ++          + SCL T   R +    T    G  KE  +L+     F Q
Sbjct:  548 EFTVLEATGIFKKLPHLRKINLSNNRITDIEEGTFEGASGVNELILTSNKLENIHHSMLKGLGGLRTLMLRSNRISCVSNSSFVGLSSVRLLSLYDNQVTSMTPGA---FDTLHSLSTLNLLANPFNCNCHLAWLGDWLRRKR---IVTGNPRCQNPYFLKEIPIQDVAVQDFACEDGNNENSCSPVMRCPAECSCLDTV-VRCSNKGLTTLPKGLPKETTELYLDGNHFTQ 772          

HSP 4 Score: 60.077 bits (144), Expect = 6.373e-9
Identity = 61/239 (25.52%), Postives = 94/239 (39.33%), Query Frame = 1
Query:  469 CNNRCLCIPQNMVVCNANDAIRAIPTNVPKTFSRLLIQNIDLISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGLNLKELHLMENPYIKIETGSFSGLKVKQINLRSNFISHLSSSEFKDLDVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSIT-CLTPSILYQRPLISLSDKDLNCRRP 1182
            C   C C+  + VV  +N  +  +P  +PK  + L +         +  SN    +HL+ + +   +I  +   +  NM +L  L LS+NR+R I  + F G  LK L L+                    +L  N IS +    FKDL         +SL  +  G                NPL+CDCH+QWL+  +    K   K   I  C  P  +  + L++   K   C  P
Sbjct:  731 CPAECSCL--DTVVRCSNKGLTTLPKGLPKETTELYLDGNHFTQVPVELSNY---KHLTLIDLSNNQISTLSNHSLSNMSELLTLILSYNRLRCIPVRAFDG--LKSLRLL--------------------SLHGNDISLIPEGAFKDL---------SSLSHLALGA---------------NPLYCDCHMQWLSDWV----KSGYKEPGIARCAGPGDMTDKLLLTTPSKKFTCTGP 914          
BLAST of Immunoglobulin superfamily member 10 vs. Ensembl Medaka
Match: slit2 (slit guidance ligand 2 [Source:NCBI gene;Acc:101173607])

HSP 1 Score: 82.8037 bits (203), Expect = 6.342e-16
Identity = 67/243 (27.57%), Postives = 115/243 (47.33%), Query Frame = 1
Query:  454 SDPSLCNNRCLCIPQNMVVCNANDAIRAIPTNVPKTFSRLLIQNIDLISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGLN-LKELHLMENPYIKIETGSFSG-LKVKQINLRSNFISHLSSSEFKDL-DVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNC 1173
            +D   C  +C C     V C+    +R++P N+P+   RL +   +L    I K++  GL HL  L+++  KI  IE  AF+++ +L  L L+ N + +     F G   L  L L EN    +   +F G +++K + L  N IS +    F+ L D+E L L NN++  +     +   K      +  N L CDCH+ WL++ L+ + +  +      C++P  L    +  +  K+  C
Sbjct:   31 ADAQPCPTQCSCT-GTTVDCHGQ-GLRSVPRNIPRNTERLDLNANNLTK--ITKADFAGLRHLRVLQLMENKITTIERGAFQDLKELERLRLNRNNLAVFPELLFLGTTKLHRLDLSENQIQGVPRKAFRGAVEIKNLQLDYNHISCIEDGAFRALRDLEVLTLNNNNISRLSVASFNHMPK-LRTFRLHSNNLQCDCHVAWLSEWLRQRPRLGLY---TQCMSPPHLRGHNVAEVQKKEFVC 265          

HSP 2 Score: 78.9518 bits (193), Expect = 1.203e-14
Identity = 73/239 (30.54%), Postives = 109/239 (45.61%), Query Frame = 1
Query:  469 CNNRCLCIPQNMVVCNANDAIRAIPTNVPKTFSRL-LIQNIDLISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGL-NLKELHLMENPYIKIETGSFSGLKVKQINL-RSNFISHLSSSEFKDL-DVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNC 1173
            C   C C   N+V C     +  IPTN+P+T + + L QN                            I+VI A AF    +L  +DLS+N+I  +A   F GL +L  L L  N   +I  G F GL   Q+ L  +N I+ L    F+DL ++  L L++N L+TI +G  S   +    + + +NP  CDCHL+WLA  LQ    + ++     C +P  L  + +  +  K   C
Sbjct:  285 CPESCTC-SNNIVDCRGK-GLTEIPTNLPETITEIRLEQN---------------------------AIKVIPAGAFSPYKRLRRIDLSNNQISELASDAFQGLRSLNSLVLYGNKITEISKGLFEGLFSLQLLLLNANKIACLRVDAFQDLHNLNLLSLYDNKLQTIAKGTFSSL-RAIQTLHLAQNPFICDCHLKWLADYLQ---DNPIETSGARCTSPRRLANKRIGQIKSKKFRC 490          

HSP 3 Score: 70.0922 bits (170), Expect = 6.445e-12
Identity = 67/229 (29.26%), Postives = 105/229 (45.85%), Query Frame = 1
Query:  676 VIEARA-FENMVQLYYLDLSHNRIRIIAPQTFSGL-NLKELHLMENPYIKIETGSFSGLK-VKQINLRSNFISHLSSSEFKDLD-VEKLFLFNNSLKTIDQGMMSIFDKPHHL--IDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNCRRPHIQSLAIDFSSSQTQLSCLATSESREAEISWTYEENGQKKEFRKLHSSNQIFPQ 1344
            V+EA   F+ +  L  ++LS+NRI  I   TF G   + EL L  N    I      GL  ++ + LRSN IS +S+S F  L  V  L L++N + ++  G    FD  H L  +++  NP +C+CHL WL   L+ +    +   +  C  P  L + P+  ++ +D  C   + ++          + SCL T   R +    T    G  KE  +L+     F Q
Sbjct:  559 VLEATGIFKKLPHLRKINLSNNRITDIEEGTFEGASGVNELILTSNKLENIHHSMLKGLGGLRTLMLRSNRISCVSNSSFVGLSSVRLLSLYDNQVTSMTPGA---FDTLHSLSTLNLLANPFNCNCHLAWLGDWLRRKR---IVTGNPRCQNPYFLKEIPIQDVAVQDFACEDGNNENSCSPVMRCPAECSCLDTV-VRCSNKGLTTLPKGLPKETTELYLDGNHFTQ 780          
BLAST of Immunoglobulin superfamily member 10 vs. Planmine SMEST
Match: SMESG000044503.1 (SMESG000044503.1)

HSP 1 Score: 957.207 bits (2473), Expect = 0.000e+0
Identity = 502/504 (99.60%), Postives = 504/504 (100.00%), Query Frame = 1
Query:  373 MAFRKQKXXXXXXXXXXXXXXXXXTQYSDPSLCNNRCLCIPQNMVVCNANDAIRAIPTNVPKTFSRLLIQNIDLISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGLNLKELHLMENPYIKIETGSFSGLKVKQINLRSNFISHLSSSEFKDLDVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNCRRPHIQSLAIDFSSSQTQLSCLATSESREAEISWTYEENGQKKEFRKLHSSNQIFPQYGTLKSNLSVKVFIPPNEKRIYTCSTWIKDNDPQTVSVHIRTPNTHYPIMFPHDNRKSSSSNTINSPAIEDGNYLFKKQFTVLEMXXXXXXXXXXXXXXXXXXXHFIRLYRYRLVKTASLKPYWPHNPAQESMYSQPVSHTGEYEIPRVCETHTFPPPPSFDHIEFLDFKNHNKLYPNCS 1884
            MAFRKQKISESIILFILGIIFSVS+QYSDPSLCNNRCLCIPQNMVVCNANDAIRAIPTNVPKTFSRLLIQNIDLISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGLNLKELHLMENPYIKIETGSFSGLKVKQINLRSNFISHLSSSEFKDLDVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNCRRPHIQSLAIDFSSSQTQLSCLATSESREAEISWTYEENGQKKEFRKLHS+NQIFPQYGTLKSNLSVKVFIPPNEKRIYTCSTWIKDNDPQTVSVHIRTPNTHYPIMFPHDNRKSSSSNTINSPAIEDGNYLFKKQFTVLEMIGAVVGTFTVTVFLLLIVAHFIRLYRYRLVKTASLKPYWPHNPAQESMYSQPVSHTGEYEIPRVCETHTFPPPPSFDHIEFLDFKNHNKLYPNCS
Sbjct:    1 MAFRKQKISESIILFILGIIFSVSSQYSDPSLCNNRCLCIPQNMVVCNANDAIRAIPTNVPKTFSRLLIQNIDLISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGLNLKELHLMENPYIKIETGSFSGLKVKQINLRSNFISHLSSSEFKDLDVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCLTPSILYQRPLISLSDKDLNCRRPHIQSLAIDFSSSQTQLSCLATSESREAEISWTYEENGQKKEFRKLHSNNQIFPQYGTLKSNLSVKVFIPPNEKRIYTCSTWIKDNDPQTVSVHIRTPNTHYPIMFPHDNRKSSSSNTINSPAIEDGNYLFKKQFTVLEMIGAVVGTFTVTVFLLLIVAHFIRLYRYRLVKTASLKPYWPHNPAQESMYSQPVSHTGEYEIPRVCETHTFPPPPSFDHIEFLDFKNHNKLYPNCS 504          
BLAST of Immunoglobulin superfamily member 10 vs. Planmine SMEST
Match: SMESG000051622.1 (SMESG000051622.1)

HSP 1 Score: 295.049 bits (754), Expect = 5.134e-92
Identity = 184/497 (37.02%), Postives = 291/497 (58.55%), Query Frame = 1
Query:  448 QYSDPSLCNNRCLCIPQN-MVVCNANDAIRAIPTNVPKTFSRLLIQNIDLISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGLNLKELHLMENPYIKIETGSFSGLKVKQINLRSNFISHLSSSEFKDLDVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQHQSKDD-------MKYVSITCLTPSILYQRPLISLSDKDLNCRRPHIQSLAIDFSSSQTQLSCLATSESREA-EISWTYEENGQKKEFRKLHSSNQIFPQYGTLKSNLSVKVFIPPNEKRIYTCSTWIKDNDPQTVSVHIRTPNTHY---PIMFPHDNRKSSSSNTINSPAIEDGNYLFKKQFTVLEMXXXXXXXXXXXXXXXXXXXHFIRLYR--------YRLVKTASLKPYWPHNPAQESMYSQPVSHTGEYEIPRVCETH--TFPPPPSFDHIEFLDFKNHNKLY 1872
            Q+    LC+  C C   + +V+C+    I  IP+N+ + ++RL IQN   +  IIY+ NLTGL HL+YLK+IY  +  IE RAFE M+ L  LDLSHN+++II P TF+GL+LKELH+M+NP I++   SF+ + VK INLRSN IS +    F   D E LFL+NN +KT++Q       KP+  ID+T N L+C C L+WL   LQ +  ++       MK+V+ITC  P  L  + L  LS K L+C +  I ++ +     +T+L+C+A   + +   ++W Y E+   +E R+     Q       L+++LSVKV +  ++ + +TC++W +D+  + + V I+  + +    P+   + N K+ S+  +    + + +++FKKQFT+LEMIGAV+GTF +T+ LL+++A  +R ++        Y+ V    +KPYW       + YS P+SHT +Y+ PR  ET   +    P     EFLD+K  N+++
Sbjct:   23 QFIQDRLCSGICFCSHSDRLVICDKPHIIGGIPSNLDEKYNRLTIQNGHFLHPIIYQYNLTGLRHLNYLKVIYSGLRSIEPRAFEFMIHLKTLDLSHNKLQIIEPYTFAGLDLKELHIMDNPGIRLLPNSFAAMTVKSINLRSNNISSIQYEIFSGADFEVLFLYNNKIKTLEQKFSDFLMKPNSFIDLTNNSLNCSCELKWLLPILQEKRNNNQISSLAFMKHVNITCKYPLKLKDKELSRLSVKSLSCPKAKITAITVALGLPETELTCVAEGNNHKVPGVAWNYAESDNVRELRRTPLEKQS-NSTENLQASLSVKVKV-TDKLQAFTCTSWFEDSQSENIVVKIQAQSQYLNKNPLTTINYNNKTESNTKVIFRPVPEAHFIFKKQFTILEMIGAVIGTFVITLILLIMLAQILRWWKRSHKSETNYKSVNI--IKPYWTLGHDSNNTYSHPISHT-DYDFPRTFETEAPSMCQSPPLRRGEFLDYKTQNRIF 514          
BLAST of Immunoglobulin superfamily member 10 vs. Planmine SMEST
Match: SMESG000051622.1 (SMESG000051622.1)

HSP 1 Score: 294.664 bits (753), Expect = 7.392e-92
Identity = 184/497 (37.02%), Postives = 291/497 (58.55%), Query Frame = 1
Query:  448 QYSDPSLCNNRCLCIPQN-MVVCNANDAIRAIPTNVPKTFSRLLIQNIDLISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGLNLKELHLMENPYIKIETGSFSGLKVKQINLRSNFISHLSSSEFKDLDVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQHQSKDD-------MKYVSITCLTPSILYQRPLISLSDKDLNCRRPHIQSLAIDFSSSQTQLSCLATSESREA-EISWTYEENGQKKEFRKLHSSNQIFPQYGTLKSNLSVKVFIPPNEKRIYTCSTWIKDNDPQTVSVHIRTPNTHY---PIMFPHDNRKSSSSNTINSPAIEDGNYLFKKQFTVLEMXXXXXXXXXXXXXXXXXXXHFIRLYR--------YRLVKTASLKPYWPHNPAQESMYSQPVSHTGEYEIPRVCETH--TFPPPPSFDHIEFLDFKNHNKLY 1872
            Q+    LC+  C C   + +V+C+    I  IP+N+ + ++RL IQN   +  IIY+ NLTGL HL+YLK+IY  +  IE RAFE M+ L  LDLSHN+++II P TF+GL+LKELH+M+NP I++   SF+ + VK INLRSN IS +    F   D E LFL+NN +KT++Q       KP+  ID+T N L+C C L+WL   LQ +  ++       MK+V+ITC  P  L  + L  LS K L+C +  I ++ +     +T+L+C+A   + +   ++W Y E+   +E R+     Q       L+++LSVKV +  ++ + +TC++W +D+  + + V I+  + +    P+   + N K+ S+  +    + + +++FKKQFT+LEMIGAV+GTF +T+ LL+++A  +R ++        Y+ V    +KPYW       + YS P+SHT +Y+ PR  ET   +    P     EFLD+K  N+++
Sbjct:   27 QFIQDRLCSGICFCSHSDRLVICDKPHIIGGIPSNLDEKYNRLTIQNGHFLHPIIYQYNLTGLRHLNYLKVIYSGLRSIEPRAFEFMIHLKTLDLSHNKLQIIEPYTFAGLDLKELHIMDNPGIRLLPNSFAAMTVKSINLRSNNISSIQYEIFSGADFEVLFLYNNKIKTLEQKFSDFLMKPNSFIDLTNNSLNCSCELKWLLPILQEKRNNNQISSLAFMKHVNITCKYPLKLKDKELSRLSVKSLSCPKAKITAITVALGLPETELTCVAEGNNHKVPGVAWNYAESDNVRELRRTPLEKQ-SNSTENLQASLSVKVKV-TDKLQAFTCTSWFEDSQSENIVVKIQAQSQYLNKNPLTTINYNNKTESNTKVIFRPVPEAHFIFKKQFTILEMIGAVIGTFVITLILLIMLAQILRWWKRSHKSETNYKSVNI--IKPYWTLGHDSNNTYSHPISHT-DYDFPRTFETEAPSMCQSPPLRRGEFLDYKTQNRIF 518          
BLAST of Immunoglobulin superfamily member 10 vs. Planmine SMEST
Match: SMESG000066007.1 (SMESG000066007.1)

HSP 1 Score: 245.743 bits (626), Expect = 1.766e-73
Identity = 175/505 (34.65%), Postives = 281/505 (55.64%), Query Frame = 1
Query:  448 QYSDPSLCNNRCLCIPQN-MVVCNANDAIRAIPTNVPKTFSRLLIQNIDLISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGLNLKELHLMENPYIKIETGSFSGLKVKQINLRSNFISHLSSSEFKDLDVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQHQSKDD-------MKYVSITCLTPSILYQRPLISLSDKDLNCRRPHIQSLAIDFSSSQTQLSCLATSESREA-EISWTYEENGQKKEFRKLHSSNQIFPQYGT--LKSNLSVKVFIPPNEKRIYTCSTWIKDNDPQTVSVHIRTP----NTHYPIMFPHDNRKSSSSNTINSPAIEDGNYLFKKQFTVLEMXXXXXXXXXXXXXXXXXXXHFIRLYRYR-------LVKTAS-LKPYWPHNPAQESMYSQPVSH-------TGEYEIPRVCETHTFPPPPSFDHIEFLDFKNHNKLY 1872
            Q+    LC+  C C   + +V C   D +  IP N+ + ++RL+I+N + +  IIY+ NLT L  L+ LK+IY  +  IEARAFE M+ L  LDLSHN++++I P TFSGL+L ELHLM+NP I++   SF+ + VK +NL SN I  +    F   D E LFL+NN +KT+++       KP+  ID+T N L+C C L+WL   LQ +  D+       MK+V+ITC  P  L  + L  LS K L+C +  I ++ +     +T L+C+A   + +   ++W Y E+     FR+L  ++   P   T  L+++LSVKV    ++ + + C++W +D+  + +++ I       N +      ++N+  S++  I  P + + +++FKKQFT LEMIGAVVGTF +T+ LL      + LY ++       + K+ + +KPYW       + +S P+SH       T E E   +C+T      P     ++LD+K  N+++
Sbjct:   23 QFIQDRLCSALCFCSHSDRLVFC---DKLYIIPRNLDEKYNRLVIRNGNFLHPIIYQFNLTRLSRLNTLKVIYSGLRSIEARAFEFMIHLKTLDLSHNKLQVIEPYTFSGLDLNELHLMDNPGIRLLPNSFAVMTVKFMNLGSNNIYSIQYEIFSGADFEVLFLYNNKIKTLEKRFSYFLMKPNSFIDLTNNSLNCSCELKWLLSILQEKRNDNQLNSLPFMKHVNITCEYPLKLKDKELSKLSVKSLSCPKAKITAITVALGLLETVLTCVAEGNNHKVPGVAWNYAESDN---FRELRRTSVEKPSNSTENLQASLSVKV-KGIDKLQTFNCTSWFEDSQSEDITIKILVQSQYLNKNSVTTINYNNKTESNTKVIFRP-VSELHFIFKKQFTNLEMIGAVVGTFVITLILLT----MLALYWWKRSHKSETISKSVNIIKPYWVLGHDSNNTHSHPISHIDYGFLTTFETEALSMCQT------PPLRRGKYLDYKTQNRIF 509          
BLAST of Immunoglobulin superfamily member 10 vs. Planmine SMEST
Match: SMESG000079961.1 (SMESG000079961.1)

HSP 1 Score: 240.736 bits (613), Expect = 1.817e-71
Identity = 168/505 (33.27%), Postives = 263/505 (52.08%), Query Frame = 1
Query:  445 TQYSDPSLCNNRCLCIP-QNMVVCNANDAIRAIPTNVPKTFSRLLIQNIDLISRIIYKSNLTGLEHLSYLKIIYCKIEVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGLNLKELHLMENPYIKIETGSFSGLKVKQINLRSNFISHLSSSEFKDLDVEKLFLFNNSLKTIDQGMMSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVS-----ITCLTPSILYQRPLISLSDKDLNCRRPHIQSLAIDFSSSQTQLSCLA-TSESREAEISWT-----YEEN------GQKKEFRKLHSSNQIFPQYGTLKSNLSVKVFIPPNEKRIYTCSTWIKDNDPQTVSVHIRTPNTHYPIMFPHDNRKS-SSSNTINSPAIEDGNYLFKKQFTVLEMXXXXXXXXXXXXXXXXXXXHFIRLYRYRLVK---------TASLKPYWPHNPAQESMYSQPVSHTGEYEIPRV----CETHTFPPPPSFDHIEFLDFKNHN 1863
            +Q+++P++C N+C+C+  + +V C+ ND I A+PTN+     RL+IQ     S  I+  NLTGL HL++LKIIY  ++VI  RAF  M  L YLDLSHN++  ++   FSGL+L +LHLMEN  I++E+ SF  ++   INLRSN ++ L    FK+  V+ L+L+NNS+  I+     IF+    L+D++ NPL CDC L WLA+ L  Q   +  +++     I C  P  L+ + L+ L    L C    I+ + I+ +    Q++C++     +   I W      Y +N        KK     H    +     ++  NL  K FI         C   I D   Q + V++  P  ++    P+   K   +SN +        NY FKK FT+LEM+ AV GTF  T   L++   +++ Y+++++K         + ++KPYW  +    S YS P S+  EYE+P       E  +    P  + +EF+D+K HN
Sbjct:   24 SQHNEPTICINKCVCLTNERVVACHENDRITALPTNIGLIHDRLIIQRGKFDSPTIFSHNLTGLTHLTFLKIIYYNLQVIAPRAFYRMKNLNYLDLSHNKLIKVSDYAFSGLSLSDLHLMENSNIQLESLSFVSMQATTINLRSNNMTFLDYDLFKNTKVKYLYLYNNSISRINPRFRQIFNSTDKLLDVSNNPLICDCSLSWLAETLSMQLSKEKSFITSKKIHIVCKKPESLFNKELMFLQPNQLKCLHLKIEEIKINVNFDAYQITCVSKVGGYKLPTIIWQQYLNEYHQNIIPGVVTHKKISENEHQMISVSSNTVSVPLNLFYKGFIK------LVCIASIDDTLIQRLEVNLNQPTFNFIASRPNKTIKQIEASNNV--------NYWFKKNFTLLEMMSAVFGTFCATFVSLVVTLKYLKTYQHKIIKDTDSERNKHSNTIKPYWYASNGHSSTYSMPNSNL-EYELPVSMLPRTEISSIFNQPHNNRLEFIDYKTHN 513          
The following BLAST results are available for this feature:
BLAST of Immunoglobulin superfamily member 10 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLIT22.651e-1629.88slit guidance ligand 2 [Source:HGNC Symbol;Acc:HGN... [more]
SLIT23.008e-1629.88slit guidance ligand 2 [Source:HGNC Symbol;Acc:HGN... [more]
SLIT23.509e-1629.88slit guidance ligand 2 [Source:HGNC Symbol;Acc:HGN... [more]
SLIT23.537e-1629.88slit guidance ligand 2 [Source:HGNC Symbol;Acc:HGN... [more]
SLIT17.030e-1532.06slit guidance ligand 1 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of Immunoglobulin superfamily member 10 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
pxn-17.308e-1224.37Peroxidasin homolog [Source:UniProtKB/Swiss-Prot;... [more]
slt-14.624e-728.37Slit homolog 1 protein [Source:UniProtKB/Swiss-Pr... [more]
pan-11.154e-628.10P-granule-associated novel protein 1 [Source:UniP... [more]
back to top
BLAST of Immunoglobulin superfamily member 10 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
caps5.964e-1627.57gene:FBgn0023095 transcript:FBtr0346864[more]
caps1.027e-1529.38gene:FBgn0023095 transcript:FBtr0305480[more]
caps1.381e-1527.57gene:FBgn0023095 transcript:FBtr0075832[more]
caps1.381e-1527.57gene:FBgn0023095 transcript:FBtr0075833[more]
sli3.388e-1527.62gene:FBgn0264089 transcript:FBtr0330734[more]
back to top
BLAST of Immunoglobulin superfamily member 10 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slit38.082e-1633.33slit homolog 3 (Drosophila) [Source:ZFIN;Acc:ZDB-G... [more]
pxdn1.010e-1428.27peroxidasin [Source:ZFIN;Acc:ZDB-GENE-140415-2][more]
igsf101.030e-1427.86immunoglobulin superfamily, member 10 [Source:ZFIN... [more]
pxdn1.050e-1428.27peroxidasin [Source:ZFIN;Acc:ZDB-GENE-140415-2][more]
pxdn1.611e-1431.28peroxidasin [Source:ZFIN;Acc:ZDB-GENE-140415-2][more]
back to top
BLAST of Immunoglobulin superfamily member 10 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
polr1e1.938e-1531.11polymerase (RNA) I polypeptide E [Source:Xenbase;A... [more]
rps21.968e-1527.13ribosomal protein S2 [Source:Xenbase;Acc:XB-GENE-1... [more]
polr1e2.190e-1531.11polymerase (RNA) I polypeptide E [Source:Xenbase;A... [more]
polr1e2.489e-1531.11polymerase (RNA) I polypeptide E [Source:Xenbase;A... [more]
atad3a4.138e-1532.09ATPase family, AAA domain containing 3A [Source:Xe... [more]
back to top
BLAST of Immunoglobulin superfamily member 10 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rtn4rl13.560e-1728.21reticulon 4 receptor-like 1 [Source:MGI Symbol;Acc... [more]
Slit25.032e-1629.46slit guidance ligand 2 [Source:MGI Symbol;Acc:MGI:... [more]
Slit29.372e-1629.46slit guidance ligand 2 [Source:MGI Symbol;Acc:MGI:... [more]
Slit29.883e-1629.46slit guidance ligand 2 [Source:MGI Symbol;Acc:MGI:... [more]
Slit21.082e-1529.46slit guidance ligand 2 [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of Immunoglobulin superfamily member 10 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8K0S5|R4RL1_MOUSE2.490e-1628.21Reticulon-4 receptor-like 1 OS=Mus musculus OX=100... [more]
sp|Q6WRH9|IGS10_RAT1.052e-1527.31Immunoglobulin superfamily member 10 OS=Rattus nor... [more]
sp|O88280|SLIT3_RAT1.394e-1529.75Slit homolog 3 protein OS=Rattus norvegicus OX=101... [more]
sp|O94813|SLIT2_HUMAN1.445e-1529.88Slit homolog 2 protein OS=Homo sapiens OX=9606 GN=... [more]
sp|Q80WD0|R4RL1_RAT3.209e-1527.86Reticulon-4 receptor-like 1 OS=Rattus norvegicus O... [more]
back to top
BLAST of Immunoglobulin superfamily member 10 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183K0P71.021e-4631.22Uncharacterized protein OS=Schistosoma curassoni O... [more]
A0A0R3U5K31.327e-4631.17Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A5K3FG502.154e-4630.74Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A430PZT04.714e-4631.14Uncharacterized protein OS=Schistosoma bovis OX=61... [more]
A0A0R3TZ488.791e-4630.63Uncharacterized protein OS=Rodentolepis nana OX=10... [more]
back to top
BLAST of Immunoglobulin superfamily member 10 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slit32.712e-1732.59slit guidance ligand 3 [Source:NCBI gene;Acc:10303... [more]
slit21.797e-1425.61slit homolog 2 (Drosophila) [Source:ZFIN;Acc:ZDB-G... [more]
pxdn3.174e-1428.27peroxidasin [Source:NCBI gene;Acc:103028918][more]
slit29.471e-1428.37slit homolog 2 (Drosophila) [Source:ZFIN;Acc:ZDB-G... [more]
nyx2.047e-1326.77nyctalopin [Source:ZFIN;Acc:ZDB-GENE-061026-3][more]
back to top
BLAST of Immunoglobulin superfamily member 10 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010345.11.888e-1432.30pep scaffold:Pmarinus_7.0:GL477728:405586:411287:1... [more]
pxdn2.775e-1331.08peroxidasin [Source:ZFIN;Acc:ZDB-GENE-140415-2][more]
flrt31.388e-1024.55fibronectin leucine rich transmembrane 3 [Source:Z... [more]
LGI16.045e-1028.74leucine rich glioma inactivated 1 [Source:HGNC Sym... [more]
ENSPMAT00000008602.17.894e-1025.93pep scaffold:Pmarinus_7.0:GL490863:524:3445:1 gene... [more]
back to top
BLAST of Immunoglobulin superfamily member 10 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Immunoglobulin superfamily member 10 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO272578.452e-1529.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354073.904e-1126.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO471093.402e-1023.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO316692.203e-828.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO491362.928e-831.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Immunoglobulin superfamily member 10 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrrc241.481e-1626.69leucine-rich repeat-containing protein 24 [Source:... [more]
lrrc241.514e-1626.69leucine-rich repeat-containing protein 24 [Source:... [more]
ENSORLT00000000072.23.127e-1630.42pep primary_assembly:ASM223467v1:1:1576629:1604541... [more]
slit24.750e-1627.57slit guidance ligand 2 [Source:NCBI gene;Acc:10117... [more]
slit26.342e-1627.57slit guidance ligand 2 [Source:NCBI gene;Acc:10117... [more]
back to top
BLAST of Immunoglobulin superfamily member 10 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000044503.10.000e+099.60SMESG000044503.1[more]
SMESG000051622.15.134e-9237.02SMESG000051622.1[more]
SMESG000051622.17.392e-9237.02SMESG000051622.1[more]
SMESG000066007.11.766e-7334.65SMESG000066007.1[more]
SMESG000079961.11.817e-7133.27SMESG000079961.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019253 ID=SMED30019253|Name=Immunoglobulin superfamily member 10|organism=Schmidtea mediterranea sexual|type=transcript|length=1965bp
TGGGTTGTAGAGCAAGTTTGCAAACAAAAGTGCAATTAGAAACTGTAGCT
TTCTGTAGAGAATTTTACAATTTTTGGAAACTAGCAATTAAATAATAAAT
GATAATAATGATTCATTAACTCAACAGCTAATCAAAATTCAGTTGGTCAA
TCTGAAAGCCGGTTGGCTACTGGCACAAATCGGTTGTTACAAGCAAATAA
AACCGTAATAATTTTTTCAAATCTATACAATAAAAAAATTCAGCAAACTT
TGAAAAGATTTTGGAATTTAATTTTTTTTCTCCGTTTCTTTATCCCATTT
TTTTTATCTCATTGCAGCTGAGTAGTTTTCTGGTGTTTGGATAACGGATT
ATTATTTTCTCCAATTGTTGAAATGGCTTTCAGAAAGCAAAAAATTAGTG
AGTCAATAATATTATTTATTCTTGGAATTATTTTCTCAGTCAGTACTCAG
TATTCAGATCCGAGTTTATGCAACAACAGATGCCTTTGCATTCCACAAAA
TATGGTGGTCTGCAATGCAAACGATGCAATTCGAGCTATTCCTACAAACG
TTCCGAAAACTTTTTCTCGGCTTCTTATTCAAAACATAGATCTGATTTCT
CGAATAATTTATAAATCCAATCTGACCGGTCTCGAACATTTGAGCTATCT
GAAAATCATATATTGCAAAATTGAAGTGATTGAGGCGCGTGCTTTTGAAA
ATATGGTCCAGCTCTATTATCTTGATCTCTCTCACAATAGAATCAGAATC
ATTGCTCCTCAGACGTTTTCCGGTCTCAACTTGAAGGAGCTGCATTTAAT
GGAGAATCCTTATATCAAAATCGAAACCGGTTCATTTAGCGGTTTAAAGG
TCAAACAGATTAATCTGAGAAGCAACTTCATTAGTCATTTATCTTCATCA
GAATTCAAAGATCTAGACGTAGAGAAACTTTTTCTTTTTAATAATAGCTT
GAAGACCATCGATCAAGGTATGATGTCCATATTTGACAAACCACACCACT
TAATTGACATAACCAGAAACCCTCTTCACTGTGATTGCCATTTGCAATGG
CTGGCTAAAAACCTACAACATCAATCCAAGGACGACATGAAATACGTTAG
TATAACTTGTCTCACTCCTTCAATATTATATCAAAGACCTCTAATATCTT
TGTCAGACAAAGACCTTAATTGTCGACGTCCACATATCCAATCGCTTGCA
ATAGATTTCAGTTCCTCTCAAACACAACTCAGTTGTTTGGCTACGAGTGA
ATCTAGAGAAGCTGAAATATCATGGACATACGAAGAGAACGGGCAGAAAA
AGGAATTTCGCAAACTTCATTCAAGTAATCAAATATTCCCTCAATATGGA
ACTTTGAAGTCAAACTTATCTGTCAAAGTATTCATTCCCCCGAATGAAAA
ACGGATTTACACTTGTTCCACTTGGATCAAAGACAATGATCCTCAAACTG
TCTCAGTCCACATCCGAACACCGAATACCCATTACCCCATTATGTTTCCC
CATGACAATCGAAAATCCAGTTCATCAAACACAATTAATTCTCCAGCAAT
CGAAGATGGAAATTATTTATTTAAAAAACAATTCACTGTTCTTGAAATGA
TTGGAGCAGTTGTCGGTACTTTTACAGTGACTGTGTTTCTATTGTTGATC
GTTGCACATTTCATCAGACTCTATCGCTATCGGCTGGTAAAGACTGCTTC
TCTCAAGCCGTACTGGCCCCACAACCCCGCCCAAGAATCCATGTATTCCC
AGCCAGTCAGCCATACTGGGGAATATGAAATTCCAAGGGTCTGTGAAACT
CACACCTTTCCCCCGCCGCCGTCATTTGATCATATCGAATTTCTAGATTT
CAAAAACCACAATAAACTTTATCCAAATTGTTCTTAATTATATATTTTTT
TATACAAAAAAGGAAAAAAAACAAACAAACAGACAATGGATATAATAATA
ATAATAACAATAATA
back to top

protein sequence of SMED30019253-orf-1

>SMED30019253-orf-1 ID=SMED30019253-orf-1|Name=SMED30019253-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=505bp
MAFRKQKISESIILFILGIIFSVSTQYSDPSLCNNRCLCIPQNMVVCNAN
DAIRAIPTNVPKTFSRLLIQNIDLISRIIYKSNLTGLEHLSYLKIIYCKI
EVIEARAFENMVQLYYLDLSHNRIRIIAPQTFSGLNLKELHLMENPYIKI
ETGSFSGLKVKQINLRSNFISHLSSSEFKDLDVEKLFLFNNSLKTIDQGM
MSIFDKPHHLIDITRNPLHCDCHLQWLAKNLQHQSKDDMKYVSITCLTPS
ILYQRPLISLSDKDLNCRRPHIQSLAIDFSSSQTQLSCLATSESREAEIS
WTYEENGQKKEFRKLHSSNQIFPQYGTLKSNLSVKVFIPPNEKRIYTCST
WIKDNDPQTVSVHIRTPNTHYPIMFPHDNRKSSSSNTINSPAIEDGNYLF
KKQFTVLEMIGAVVGTFTVTVFLLLIVAHFIRLYRYRLVKTASLKPYWPH
NPAQESMYSQPVSHTGEYEIPRVCETHTFPPPPSFDHIEFLDFKNHNKLY
PNCS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR007110Ig-like_dom
IPR003591Leu-rich_rpt_typical-subtyp
IPR000483Cys-rich_flank_reg_C
IPR032675LRR_dom_sf
IPR001611Leu-rich_rpt
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003591Leucine-rich repeat, typical subtypeSMARTSM00369LRR_typ_2coord: 87..110
e-value: 77.0
score: 6.0
coord: 111..134
e-value: 0.0064
score: 25.7
IPR000483Cysteine-rich flanking region, C-terminalSMARTSM00082lrrct1coord: 216..268
e-value: 2.4E-7
score: 40.4
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 149..269
e-value: 3.1E-18
score: 67.7
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 33..148
e-value: 1.6E-19
score: 71.7
IPR001611Leucine-rich repeatPFAMPF13855LRR_8coord: 89..145
e-value: 6.1E-12
score: 45.1
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 136..157
score: 5.433
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 113..134
score: 7.335
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 159..180
score: 5.625
NoneNo IPR availablePANTHERPTHR45836FAMILY NOT NAMEDcoord: 11..200
coord: 83..320
NoneNo IPR availablePANTHERPTHR45836:SF11RETICULON-4 RECEPTOR-LIKE 1coord: 11..200
coord: 83..320
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..25
score: 0.721
NoneNo IPR availableSUPERFAMILYSSF52058L domain-likecoord: 52..272
NoneNo IPR availableTMHMMTMhelixcoord: 409..431
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 270..361
score: 8.92