39S ribosomal protein L19

Overview
Name39S ribosomal protein L19
Smed IDSMED30019242
Length (bp)1347
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 39S ribosomal protein L19 (SMED30019242) t-SNE clustered cells

Violin plots show distribution of expression levels for 39S ribosomal protein L19 (SMED30019242) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 39S ribosomal protein L19 (SMED30019242) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 39S ribosomal protein L19 (SMED30019242) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019242

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30019242SMESG000076325.1 Contig4281uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30019242SMESG000076325.1 Contig4281newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30019242SMESG000001797.1 Contig4281uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30019242SMESG000001797.1 Contig4281newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
headSMED30019242SMESG000050888.1 SMESG000050884.1 SMESG000050880.1 SmedASXL_017781SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
X1 cellSMED30019242SMESG000076325.1 SMESG000050888.1 SMESG000050880.1 SmedASXL_007902SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
cephalic gangliaSMED30019242SMESG000050888.1 SMESG000050880.1 SMESG000076325.1 SMESG000050884.1 SMU15028413SMUPMID:30237141
Trost et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30019242SMESG000050888.1 SMESG000050880.1 SMESG000076325.1 SMESG000050884.1 SMU15028413SMUPMID:30237141
Trost et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
cephalic gangliaSMED30019242SMESG000076325.1 SMESG000050888.1 SMESG000050884.1 SMESG000050880.1 SMU15002166SMUPMID:30237141
Trost et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30019242SMESG000076325.1 SMESG000050888.1 SMESG000050884.1 SMESG000050880.1 SMU15002166SMUPMID:30237141
Trost et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 39S ribosomal protein L19 vs. Ensembl Human
Match: MRPL19 (mitochondrial ribosomal protein L19 [Source:HGNC Symbol;Acc:HGNC:14052])

HSP 1 Score: 147.132 bits (370), Expect = 5.579e-42
Identity = 66/133 (49.62%), Postives = 101/133 (75.94%), Query Frame = 3
Query:  495 LEIPEFYAGTIMAVTTSDPFMPNKQNRFVGICIHKKIAGLFSSVRLRNIIDKIGIEVEYEMYNPTLIKIEVLKLERRLDENLLYLRDALPIYSTVPLDMVPAPRDADEKVPLNDLKVEMKARPWSVDWHHFSY 893
            L IPEFY G+I+ VTT+DP+   K ++F+GICI +   GL ++  LRN+I+  G+E+ +E+YNP + +I+V+KLE+RLD++LLYLRDALP YST  ++M P  ++ ++KVP+N+LKV+MK +PWS  W   ++
Sbjct:    8 LHIPEFYVGSILRVTTADPYASGKISQFLGICIQRSGRGLGATFILRNVIEGQGVEICFELYNPRVQEIQVVKLEKRLDDSLLYLRDALPEYSTFDVNMKPVVQEPNQKVPVNELKVKMKPKPWSKRWERPNF 140          
BLAST of 39S ribosomal protein L19 vs. Ensembl Human
Match: MRPL19 (mitochondrial ribosomal protein L19 [Source:HGNC Symbol;Acc:HGNC:14052])

HSP 1 Score: 149.443 bits (376), Expect = 5.396e-41
Identity = 69/138 (50.00%), Postives = 105/138 (76.09%), Query Frame = 3
Query:  495 LEIPEFYAGTIMAVTTSDPFMPNKQNRFVGICIHKKIAGLFSSVRLRNIIDKIGIEVEYEMYNPTLIKIEVLKLERRLDENLLYLRDALPIYSTVPLDMVPAPRDADEKVPLNDLKVEMKARPWSVDWH--HFSYRGI 902
            L IPEFY G+I+ VTT+DP+   K ++F+GICI +   GL ++  LRN+I+  G+E+ +E+YNP + +I+V+KLE+RLD++LLYLRDALP YST  ++M P  ++ ++KVP+N+LKV+MK +PWS  W   +F+ +GI
Sbjct:  106 LHIPEFYVGSILRVTTADPYASGKISQFLGICIQRSGRGLGATFILRNVIEGQGVEICFELYNPRVQEIQVVKLEKRLDDSLLYLRDALPEYSTFDVNMKPVVQEPNQKVPVNELKVKMKPKPWSKRWERPNFNIKGI 243          
BLAST of 39S ribosomal protein L19 vs. Ensembl Human
Match: MRPL19 (mitochondrial ribosomal protein L19 [Source:HGNC Symbol;Acc:HGNC:14052])

HSP 1 Score: 149.443 bits (376), Expect = 5.396e-41
Identity = 69/138 (50.00%), Postives = 105/138 (76.09%), Query Frame = 3
Query:  495 LEIPEFYAGTIMAVTTSDPFMPNKQNRFVGICIHKKIAGLFSSVRLRNIIDKIGIEVEYEMYNPTLIKIEVLKLERRLDENLLYLRDALPIYSTVPLDMVPAPRDADEKVPLNDLKVEMKARPWSVDWH--HFSYRGI 902
            L IPEFY G+I+ VTT+DP+   K ++F+GICI +   GL ++  LRN+I+  G+E+ +E+YNP + +I+V+KLE+RLD++LLYLRDALP YST  ++M P  ++ ++KVP+N+LKV+MK +PWS  W   +F+ +GI
Sbjct:  106 LHIPEFYVGSILRVTTADPYASGKISQFLGICIQRSGRGLGATFILRNVIEGQGVEICFELYNPRVQEIQVVKLEKRLDDSLLYLRDALPEYSTFDVNMKPVVQEPNQKVPVNELKVKMKPKPWSKRWERPNFNIKGI 243          
BLAST of 39S ribosomal protein L19 vs. Ensembl Human
Match: MRPL19 (mitochondrial ribosomal protein L19 [Source:HGNC Symbol;Acc:HGNC:14052])

HSP 1 Score: 59.6918 bits (143), Expect = 6.387e-10
Identity = 26/54 (48.15%), Postives = 38/54 (70.37%), Query Frame = 3
Query:  495 LEIPEFYAGTIMAVTTSDPFMPNKQNRFVGICIHKKIAGLFSSVRLRNIIDKIG 656
            L IPEFY G+I+ VTT+DP+   K ++F+GICI +   GL ++  LRN+I+  G
Sbjct:  106 LHIPEFYVGSILRVTTADPYASGKISQFLGICIQRSGRGLGATFILRNVIEGQG 159          
BLAST of 39S ribosomal protein L19 vs. Ensembl Human
Match: MRPL19 (mitochondrial ribosomal protein L19 [Source:HGNC Symbol;Acc:HGNC:14052])

HSP 1 Score: 51.6026 bits (122), Expect = 2.697e-8
Identity = 24/43 (55.81%), Postives = 36/43 (83.72%), Query Frame = 3
Query:  708 LKLERRLDENLLYLRDALPIYSTVPLDMVPAPRDADEKVPLND 836
            +KLE+RLD++LLYLRDALP YST  ++M P  ++ ++KVP+N+
Sbjct:    2 VKLEKRLDDSLLYLRDALPEYSTFDVNMKPVVQEPNQKVPVNE 44          
BLAST of 39S ribosomal protein L19 vs. Ensembl Celegans
Match: mrpl-19 (Probable 39S ribosomal protein L19, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:Q95Y83])

HSP 1 Score: 155.606 bits (392), Expect = 6.573e-44
Identity = 91/203 (44.83%), Postives = 132/203 (65.02%), Query Frame = 3
Query:  396 LYPELFNYVPLPEMRDSLXXXXXXXXXXXXXXHLEIPEFYAGTIMAVTTSDPFMPNKQNRFVGICIHKKIAGLFSSVRLRNIIDKIGIEVEYEMYNPTLIKIEVLKLERRLDENLLYLRDALPIYSTVPLDMVPAPRDADEKVPLNDLKVEMKARPWSVDWHHFSYRGIADSGWENEDGRKLKYIQDSRCQIERYDLMKIYRN 1004
            +YP+ F   P+   R++L+E +ER++M++RR +++IPEFY G+I+AVT+SD  + +K++RFVGICI ++  GL     LRN I+ IG+EV Y++YNPT+ KIE LKLE+RLD +L YL DALP YST    M P    A   +P+N+ KV++K  PW+  W   S RGI D+  +     K K  +      E+YDL+  YR 
Sbjct:   48 IYPD-FLQSPVWNRRNALKEELERQDMLERRMNIDIPEFYVGSIVAVTSSDKNLGSKEHRFVGICIRREKEGLLHQFTLRNTIENIGVEVVYDLYNPTIKKIETLKLEKRLDNDLSYLVDALPEYSTFDFHMEPQAHPAGTPIPVNECKVKLKTPPWTRRWEVASVRGIEDTWTQATPWFKRKLHKTIVNDYEKYDLIADYRT 249          
BLAST of 39S ribosomal protein L19 vs. Ensembl Fly
Match: mRpL19 (gene:FBgn0037608 transcript:FBtr0081901)

HSP 1 Score: 162.155 bits (409), Expect = 4.604e-46
Identity = 83/192 (43.23%), Postives = 122/192 (63.54%), Query Frame = 3
Query:  492 HLEIPEFYAGTIMAVTTSDPFMPNKQNRFVGICIHKKIAGLFSSVRLRNIIDKIGIEVEYEMYNPTLIKIEVLKLERRLDENLLYLRDALPIYSTVPLDMVPAPRDADEKVPLNDLKVEMKARPWSVDWHHFSYRGIADSGWENEDGRKLKYIQDSRCQIERYDLMKIYRNRGPAAARNDAMRHVEIMHHDL 1067
             +++PEFY G+++AVT+SDP    K +RFVGICI++   GL +   LRN+ID  G+EV YE+Y+PT++KIEVL+LE+RLD++L YLRDALP YST   +M   P +    VP+ND+KV ++ RPW   W   + RG+A+     +D  +L   +  +   E+YD+MK YR+  P   + +    V    H L
Sbjct:   96 QIDLPEFYVGSVLAVTSSDPHAAGKTSRFVGICINRDRCGLRARFILRNVIDHQGMEVVYELYDPTILKIEVLRLEKRLDDSLFYLRDALPEYSTFDENMEAEPLEEGAPVPVNDIKVVLRPRPWLERWERQNLRGVANIDEYLKDKHRLSAAKVQK-PWEKYDMMKDYRSSIPEEEQTEIFAEVHTELHAL 286          
BLAST of 39S ribosomal protein L19 vs. Ensembl Zebrafish
Match: mrpl19 (mitochondrial ribosomal protein L19 [Source:ZFIN;Acc:ZDB-GENE-040801-55])

HSP 1 Score: 152.91 bits (385), Expect = 1.007e-42
Identity = 73/138 (52.90%), Postives = 97/138 (70.29%), Query Frame = 3
Query:  495 LEIPEFYAGTIMAVTTSDPFMPNKQNRFVGICIHKKIAGLFSSVRLRNIIDKIGIEVEYEMYNPTLIKIEVLKLERRLDENLLYLRDALPIYSTVPLDMVPAPRDADEKVPLNDLKVEMKARPWSVDWHH--FSYRGI 902
            L+IPEFY G+I+AVT +DP+     NRFVGIC  +   GL ++  LRN+ID  G+E+ YE+Y+P + KIEVLKLE+RLD+NL+YLRDALP YST   DM P   +  + +P+N LKV+MK +PWS  W    F  +GI
Sbjct:   95 LQIPEFYVGSILAVTMTDPYASGNLNRFVGICTQRSGKGLGATFILRNVIDGQGVEICYELYSPRMRKIEVLKLEKRLDDNLMYLRDALPEYSTFDFDMQPVHYELTKDIPVNPLKVKMKPKPWSKRWERPKFDIKGI 232          
BLAST of 39S ribosomal protein L19 vs. Ensembl Zebrafish
Match: mrpl19 (mitochondrial ribosomal protein L19 [Source:ZFIN;Acc:ZDB-GENE-040801-55])

HSP 1 Score: 147.132 bits (370), Expect = 1.371e-40
Identity = 73/138 (52.90%), Postives = 96/138 (69.57%), Query Frame = 3
Query:  495 LEIPEFYAGTIMAVTTSDPFMPNKQNRFVGICIHKKIAGLFSSVRLRNIIDKIGIEVEYEMYNPTLIKIEVLKLERRLDENLLYLRDALPIYSTVPLDMVPAPRDADEKVPLNDLKVEMKARPWSVDWHH--FSYRGI 902
            L+IPEFY G+I+AVT +DP+     NRFVGIC  +   GL ++  LRN+ID  G E+ YE+Y+P + KIEVLKLE+RLD+NL+YLRDALP YST   DM P   +  + +P+N LKV+MK +PWS  W    F  +GI
Sbjct:   95 LQIPEFYVGSILAVTMTDPYASGNLNRFVGICTQRSGKGLGATFILRNVID--GQEICYELYSPRMRKIEVLKLEKRLDDNLMYLRDALPEYSTFDFDMQPVHYELTKDIPVNPLKVKMKPKPWSKRWERPKFDIKGI 230          
BLAST of 39S ribosomal protein L19 vs. Ensembl Xenopus
Match: MRPL19 (mitochondrial ribosomal protein L19 [Source:NCBI gene;Acc:100496116])

HSP 1 Score: 147.517 bits (371), Expect = 3.435e-40
Identity = 68/130 (52.31%), Postives = 96/130 (73.85%), Query Frame = 3
Query:  495 LEIPEFYAGTIMAVTTSDPFMPNKQNRFVGICIHKKIAGLFSSVRLRNIIDKIGIEVEYEMYNPTLIKIEVLKLERRLDENLLYLRDALPIYSTVPLDMVPAPRDADEKVPLNDLKVEMKARPWSVDWHH 884
            L++PEFY G+I+AVT +D +   K+NRFVGICI +   GL ++  LRN+I+  G+E+ Y++Y+P + +I+VLKLE+RLD NL+YLRDALP YST   +M PA   ++ +VP+N LKV+MK RPWS  W  
Sbjct:  115 LDVPEFYVGSILAVTMADAYSSGKRNRFVGICIQRSGNGLGATFVLRNVIEGQGVEMRYDLYSPRIQEIKVLKLEKRLDGNLMYLRDALPEYSTFDFNMKPALSVSEGEVPVNQLKVKMKPRPWSKRWER 244          
BLAST of 39S ribosomal protein L19 vs. Ensembl Mouse
Match: Mrpl19 (mitochondrial ribosomal protein L19 [Source:MGI Symbol;Acc:MGI:1926274])

HSP 1 Score: 154.836 bits (390), Expect = 3.285e-43
Identity = 71/138 (51.45%), Postives = 104/138 (75.36%), Query Frame = 3
Query:  495 LEIPEFYAGTIMAVTTSDPFMPNKQNRFVGICIHKKIAGLFSSVRLRNIIDKIGIEVEYEMYNPTLIKIEVLKLERRLDENLLYLRDALPIYSTVPLDMVPAPRDADEKVPLNDLKVEMKARPWSVDWH--HFSYRGI 902
            L IPEFY G+I+ VTT+DP+   K ++F+GICI +   GL ++  LRN I+  G+E+ +E+YNP + +I+V+KLE+RLD+NLLYLRDALP YST  ++M P P++A ++VP+N LKV+MK +PWS  W   +F+ +GI
Sbjct:  106 LPIPEFYVGSILRVTTADPYASGKTSQFLGICIKRSGNGLGATFTLRNTIEGQGVEICFELYNPRIQEIQVVKLEKRLDDNLLYLRDALPEYSTFDVNMKPVPQEACQEVPVNKLKVKMKPKPWSKRWERPNFNIKGI 243          
BLAST of 39S ribosomal protein L19 vs. UniProt/SwissProt
Match: sp|Q9VHN6|RM19_DROME (39S ribosomal protein L19, mitochondrial OS=Drosophila melanogaster OX=7227 GN=mRpL19 PE=2 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 4.615e-45
Identity = 83/192 (43.23%), Postives = 122/192 (63.54%), Query Frame = 3
Query:  492 HLEIPEFYAGTIMAVTTSDPFMPNKQNRFVGICIHKKIAGLFSSVRLRNIIDKIGIEVEYEMYNPTLIKIEVLKLERRLDENLLYLRDALPIYSTVPLDMVPAPRDADEKVPLNDLKVEMKARPWSVDWHHFSYRGIADSGWENEDGRKLKYIQDSRCQIERYDLMKIYRNRGPAAARNDAMRHVEIMHHDL 1067
             +++PEFY G+++AVT+SDP    K +RFVGICI++   GL +   LRN+ID  G+EV YE+Y+PT++KIEVL+LE+RLD++L YLRDALP YST   +M   P +    VP+ND+KV ++ RPW   W   + RG+A+     +D  +L   +  +   E+YD+MK YR+  P   + +    V    H L
Sbjct:   96 QIDLPEFYVGSVLAVTSSDPHAAGKTSRFVGICINRDRCGLRARFILRNVIDHQGMEVVYELYDPTILKIEVLRLEKRLDDSLFYLRDALPEYSTFDENMEAEPLEEGAPVPVNDIKVVLRPRPWLERWERQNLRGVANIDEYLKDKHRLSAAKVQK-PWEKYDMMKDYRSSIPEEEQTEIFAEVHTELHAL 286          
BLAST of 39S ribosomal protein L19 vs. UniProt/SwissProt
Match: sp|Q95Y83|RM19_CAEEL (Probable 39S ribosomal protein L19, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=mrpl-19 PE=3 SV=1)

HSP 1 Score: 155.606 bits (392), Expect = 8.361e-43
Identity = 91/203 (44.83%), Postives = 132/203 (65.02%), Query Frame = 3
Query:  396 LYPELFNYVPLPEMRDSLXXXXXXXXXXXXXXHLEIPEFYAGTIMAVTTSDPFMPNKQNRFVGICIHKKIAGLFSSVRLRNIIDKIGIEVEYEMYNPTLIKIEVLKLERRLDENLLYLRDALPIYSTVPLDMVPAPRDADEKVPLNDLKVEMKARPWSVDWHHFSYRGIADSGWENEDGRKLKYIQDSRCQIERYDLMKIYRN 1004
            +YP+ F   P+   R++L+E +ER++M++RR +++IPEFY G+I+AVT+SD  + +K++RFVGICI ++  GL     LRN I+ IG+EV Y++YNPT+ KIE LKLE+RLD +L YL DALP YST    M P    A   +P+N+ KV++K  PW+  W   S RGI D+  +     K K  +      E+YDL+  YR 
Sbjct:   48 IYPD-FLQSPVWNRRNALKEELERQDMLERRMNIDIPEFYVGSIVAVTSSDKNLGSKEHRFVGICIRREKEGLLHQFTLRNTIENIGVEVVYDLYNPTIKKIETLKLEKRLDNDLSYLVDALPEYSTFDFHMEPQAHPAGTPIPVNECKVKLKTPPWTRRWEVASVRGIEDTWTQATPWFKRKLHKTIVNDYEKYDLIADYRT 249          
BLAST of 39S ribosomal protein L19 vs. UniProt/SwissProt
Match: sp|Q9D338|RM19_MOUSE (39S ribosomal protein L19, mitochondrial OS=Mus musculus OX=10090 GN=Mrpl19 PE=1 SV=1)

HSP 1 Score: 154.836 bits (390), Expect = 2.298e-42
Identity = 71/138 (51.45%), Postives = 104/138 (75.36%), Query Frame = 3
Query:  495 LEIPEFYAGTIMAVTTSDPFMPNKQNRFVGICIHKKIAGLFSSVRLRNIIDKIGIEVEYEMYNPTLIKIEVLKLERRLDENLLYLRDALPIYSTVPLDMVPAPRDADEKVPLNDLKVEMKARPWSVDWH--HFSYRGI 902
            L IPEFY G+I+ VTT+DP+   K ++F+GICI +   GL ++  LRN I+  G+E+ +E+YNP + +I+V+KLE+RLD+NLLYLRDALP YST  ++M P P++A ++VP+N LKV+MK +PWS  W   +F+ +GI
Sbjct:  106 LPIPEFYVGSILRVTTADPYASGKTSQFLGICIKRSGNGLGATFTLRNTIEGQGVEICFELYNPRIQEIQVVKLEKRLDDNLLYLRDALPEYSTFDVNMKPVPQEACQEVPVNKLKVKMKPKPWSKRWERPNFNIKGI 243          
BLAST of 39S ribosomal protein L19 vs. UniProt/SwissProt
Match: sp|Q5R8M4|RM19_PONAB (39S ribosomal protein L19, mitochondrial OS=Pongo abelii OX=9601 GN=MRPL19 PE=2 SV=1)

HSP 1 Score: 149.443 bits (376), Expect = 2.591e-40
Identity = 69/138 (50.00%), Postives = 105/138 (76.09%), Query Frame = 3
Query:  495 LEIPEFYAGTIMAVTTSDPFMPNKQNRFVGICIHKKIAGLFSSVRLRNIIDKIGIEVEYEMYNPTLIKIEVLKLERRLDENLLYLRDALPIYSTVPLDMVPAPRDADEKVPLNDLKVEMKARPWSVDWH--HFSYRGI 902
            L IPEFY G+I+ VTT+DP+   K ++F+GICI +   GL ++  LRN+I+  G+E+ +E+YNP + +I+V+KLE+RLD++LLYLRDALP YST  ++M P  ++ ++KVP+N+LKV+MK +PWS  W   +F+ +GI
Sbjct:  106 LHIPEFYVGSILRVTTADPYASGKISQFLGICIQRSGRGLGATFILRNVIEGQGVEICFELYNPRVQEIQVVKLEKRLDDSLLYLRDALPEYSTFDVNMKPEVQEPNQKVPVNELKVKMKPKPWSKRWERPNFNIKGI 243          
BLAST of 39S ribosomal protein L19 vs. UniProt/SwissProt
Match: sp|P49406|RM19_HUMAN (39S ribosomal protein L19, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL19 PE=1 SV=2)

HSP 1 Score: 149.443 bits (376), Expect = 2.591e-40
Identity = 69/138 (50.00%), Postives = 105/138 (76.09%), Query Frame = 3
Query:  495 LEIPEFYAGTIMAVTTSDPFMPNKQNRFVGICIHKKIAGLFSSVRLRNIIDKIGIEVEYEMYNPTLIKIEVLKLERRLDENLLYLRDALPIYSTVPLDMVPAPRDADEKVPLNDLKVEMKARPWSVDWH--HFSYRGI 902
            L IPEFY G+I+ VTT+DP+   K ++F+GICI +   GL ++  LRN+I+  G+E+ +E+YNP + +I+V+KLE+RLD++LLYLRDALP YST  ++M P  ++ ++KVP+N+LKV+MK +PWS  W   +F+ +GI
Sbjct:  106 LHIPEFYVGSILRVTTADPYASGKISQFLGICIQRSGRGLGATFILRNVIEGQGVEICFELYNPRVQEIQVVKLEKRLDDSLLYLRDALPEYSTFDVNMKPVVQEPNQKVPVNELKVKMKPKPWSKRWERPNFNIKGI 243          
BLAST of 39S ribosomal protein L19 vs. TrEMBL
Match: A0A504Z4W2 (Large subunit ribosomal protein L19 OS=Fasciola gigantica OX=46835 GN=FGIG_05446 PE=4 SV=1)

HSP 1 Score: 221.09 bits (562), Expect = 8.564e-65
Identity = 140/313 (44.73%), Postives = 192/313 (61.34%), Query Frame = 3
Query:  198 SPAFLYIKSCRGIRYLRNEYLGEYLPKVDDKHLESHRTNKFTKYSEIDKLEEYEINVEVPNEKINRLYPELFNYVPLPEMRDSLXXXXXXXXXXXXXXHLEIPEFYAGTIMAVTTSDPFMPNKQNRFVGICIHKKIAGLFSSVRLRNIIDKIGIEVEYEMYNPTLIKIEVLKLERRLDENLLYLRDALPIYSTVPLDMVPAPRDADEKVPLNDLKVEMKARPWSVDWHHFSYRGIADSGWENEDGRKLKYIQDSRCQIERYDLMKIYRNRGPAAARNDAMRHVEIMHHDLIKYHEMQYQQALADLRKQENIGK 1136
             P +L+ +S    R L  E+L EY+PK+D   L+++R N+F   +     + +E N  +  +++NRLY EL  +   P  RD LRER+ERREMM RR+HL IPEFY G+I+AV  +D F P+  +RFVGICI +   GL+++  LRN++DK  IE+ YE+YNPT+  IEVL LE+RLD+NLLYLRDA    S VP DM P P  ++  VP+N  KV++   PW   W    YRGI DS ++    R+L  IQD     +RYDLMK+YR+R     +      V + H DLI+YHE    Q   +L +Q   GK
Sbjct:   16 GPKYLFQRSAH--RILPPEFLKEYIPKIDVTLLDAYR-NRFIPAA---GKKSWEDNPPLAKDEMNRLYQELLPHNLDPRYRDKLRERLERREMMLRRRHLSIPEFYVGSILAVQVADKFAPDGTHRFVGICIERYNEGLWTTFTLRNVVDKTAIEIAYELYNPTIQSIEVLLLEKRLDQNLLYLRDAPLQESRVPFDMTPIPHPSNTPVPVNTKKVKLLPPPWKFQWFLHGYRGIDDSMYDYLTPRQLDEIQDKVLLTDRYDLMKMYRSRVCEEEKRVTFGDVILQHQDLIRYHE----QRRRELVEQHRTGK 318          
BLAST of 39S ribosomal protein L19 vs. TrEMBL
Match: A0A4E0RT63 (Large subunit ribosomal protein L19 OS=Fasciola hepatica OX=6192 GN=D915_004793 PE=4 SV=1)

HSP 1 Score: 220.32 bits (560), Expect = 1.609e-64
Identity = 139/313 (44.41%), Postives = 192/313 (61.34%), Query Frame = 3
Query:  198 SPAFLYIKSCRGIRYLRNEYLGEYLPKVDDKHLESHRTNKFTKYSEIDKLEEYEINVEVPNEKINRLYPELFNYVPLPEMRDSLXXXXXXXXXXXXXXHLEIPEFYAGTIMAVTTSDPFMPNKQNRFVGICIHKKIAGLFSSVRLRNIIDKIGIEVEYEMYNPTLIKIEVLKLERRLDENLLYLRDALPIYSTVPLDMVPAPRDADEKVPLNDLKVEMKARPWSVDWHHFSYRGIADSGWENEDGRKLKYIQDSRCQIERYDLMKIYRNRGPAAARNDAMRHVEIMHHDLIKYHEMQYQQALADLRKQENIGK 1136
             P +L+ +S    R L  E+L EY+PK+D   L+++R N+F   +     + +E N  +  +++NRLY EL  +   P  RD LRER+ERREMM RR+HL IPEFY G+I+AV  +D F P+  +RFVGICI +   GL+++  LRN++DK  +E+ YE+YNPT+  IEVL LE+RLD+NLLYLRDA    S VP DM P P  ++  VP+N  KV++   PW   W    YRGI DS ++    R+L  IQD     +RYDLMK+YR+R     +      V + H DLI+YHE    Q   +L +Q   GK
Sbjct:   16 GPKYLFQRSAH--RILPPEFLKEYIPKIDVTILDAYR-NRFIPAA---GKKSWEDNPPLAKDEMNRLYQELLPHNLDPRYRDKLRERLERREMMLRRRHLSIPEFYVGSILAVQVADKFAPDGTHRFVGICIERYNEGLWTTFTLRNVVDKTAVEIAYELYNPTIQSIEVLLLEKRLDQNLLYLRDAPLQESRVPFDMTPIPHPSNTPVPVNTKKVKLLPPPWKFQWFLHGYRGIDDSMYDYLTPRQLDEIQDKVLLTDRYDLMKMYRSRVCEEEKRVTFGDVILQHQDLIRYHE----QRRRELVEQHQAGK 318          
BLAST of 39S ribosomal protein L19 vs. TrEMBL
Match: Q5DA35 (Putative 39S ribosomal protein L19 isoform 1 OS=Schistosoma japonicum OX=6182 GN=EWB00_005426 PE=2 SV=1)

HSP 1 Score: 217.624 bits (553), Expect = 2.085e-63
Identity = 137/318 (43.08%), Postives = 192/318 (60.38%), Query Frame = 3
Query:  186 IIFKSPAFLYIKSCR-GIRYLRNEYLGEYLPKVDDKHLESHRTNKFTKYSEIDKLEEYEINVEVPNEKINRLYPELFNYVPLPEMRDSLXXXXXXXXXXXXXXHLEIPEFYAGTIMAVTTSDPFMPNKQNRFVGICIHKKIAGLFSSVRLRNIIDKIGIEVEYEMYNPTLIKIEVLKLERRLDENLLYLRDALPIYSTVPLDMVPAPRDADEKVPLNDLKVEMKARPWSVDWHHFSYRGIADSGWENEDGRKLKYIQDSRCQIERYDLMKIYRNRGPAAARNDAMRHVEIMHHDLIKYHEMQYQQALADLRKQENIGK 1136
            +I K P       CR   R L  EY  +YL K++ + L+ +R + F  Y  +   + +EI    P E+  RLY EL  +   P  RD LRER+ERREMM RR++L+IPEFY G+++AV T+D F PN+ +RF+GICI +   GL++   LRN+++K  +E++YE+YNPT+  IEVL LE+RLD NLLYLRDA    S  P DM   P D  + VP+ND KV++   PW   W+   YRGI D+ ++    ++L  IQ     ++RYDLMK+YR+R     +  A   V+I H DLI++HE          R+QE IGK
Sbjct:    6 MIRKLPEIPIFMPCRFARRRLPPEYNKQYLEKINTEALDKYRKSDFVPYPALKSKKLWEIQPMEPKEETKRLYQELIPHNIDPRYRDRLRERLERREMMLRRRNLDIPEFYVGSVVAVKTADKFAPNQSHRFMGICIERFNEGLWTRFTLRNVVEKTAVEIQYELYNPTIQSIEVLLLEKRLDHNLLYLRDAPLEESRFPFDMSRIPYDPSDPVPINDKKVKLLPPPWKFKWYLHGYRGIHDTMYDYLTPQQLSEIQSKINLVDRYDLMKMYRSRLCLEEKQIAFGDVQIQHQDLIRHHER---------RRQELIGK 314          
BLAST of 39S ribosomal protein L19 vs. TrEMBL
Match: C1L5X7 (Putative 39S ribosomal protein L19, mitochondrial OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 217.238 bits (552), Expect = 2.812e-63
Identity = 137/318 (43.08%), Postives = 192/318 (60.38%), Query Frame = 3
Query:  186 IIFKSPAFLYIKSCR-GIRYLRNEYLGEYLPKVDDKHLESHRTNKFTKYSEIDKLEEYEINVEVPNEKINRLYPELFNYVPLPEMRDSLXXXXXXXXXXXXXXHLEIPEFYAGTIMAVTTSDPFMPNKQNRFVGICIHKKIAGLFSSVRLRNIIDKIGIEVEYEMYNPTLIKIEVLKLERRLDENLLYLRDALPIYSTVPLDMVPAPRDADEKVPLNDLKVEMKARPWSVDWHHFSYRGIADSGWENEDGRKLKYIQDSRCQIERYDLMKIYRNRGPAAARNDAMRHVEIMHHDLIKYHEMQYQQALADLRKQENIGK 1136
            +I K P       CR   R L  EY  +YL K++ + L+ +R + F  Y  +   + +EI    P E+  RLY EL  +   P  RD LRER+ERREMM RR++L+IPEFY G+++AV T+D F PN+ +RF+GICI +   GL++   LRN+++K  +E++YE+YNPT+  IEVL LE+RLD NLLYLRDA    S  P DM   P D  + VP+ND KV++   PW   W+   YRGI D+ ++    ++L  IQ     ++RYDLMK+YR+R     +  A   V+I H DLI++HE          R+QE IGK
Sbjct:    6 MIRKLPEIPIFMPCRFARRRLPPEYNKQYLEKINTEALDKYRKSDFVPYPALKSEKLWEIQPMEPKEETKRLYQELIPHNIDPRYRDRLRERLERREMMLRRRNLDIPEFYVGSVVAVKTADKFAPNQSHRFMGICIERFNEGLWTRFTLRNVVEKTAVEIQYELYNPTIQSIEVLLLEKRLDHNLLYLRDAPLEESRFPFDMSRIPYDPSDPVPINDKKVKLLPPPWKFKWYLHGYRGIHDTMYDYLTPQQLSEIQSKINLVDRYDLMKMYRSRLCLEEKQIAFGDVQIQHQDLIRHHER---------RRQELIGK 314          
BLAST of 39S ribosomal protein L19 vs. TrEMBL
Match: A0A095B1C0 (Uncharacterized protein (Fragment) OS=Schistosoma haematobium OX=6185 GN=MS3_09404 PE=4 SV=1)

HSP 1 Score: 216.468 bits (550), Expect = 8.141e-63
Identity = 133/313 (42.49%), Postives = 194/313 (61.98%), Query Frame = 3
Query:  186 IIFKSPAFLYIKSCR-GIRYLRNEYLGEYLPKVDDKHLESHRTNKFTKYSEIDKLEEYEINVEVPNEKINRLYPELFNYVPLPEMRDSLXXXXXXXXXXXXXXHLEIPEFYAGTIMAVTTSDPFMPNKQNRFVGICIHKKIAGLFSSVRLRNIIDKIGIEVEYEMYNPTLIKIEVLKLERRLDENLLYLRDALPIYSTVPLDMVPAPRDADEKVPLNDLKVEMKARPWSVDWHHFSYRGIADSGWENEDGRKLKYIQDSRCQIERYDLMKIYRNRGPAAARNDAMRHVEIMHHDLIKYHEMQYQQALADLRKQ 1121
            +I + P    +  CR   R L  EY  +YL K+ +  L+ +R + F  Y  +     +E+  + P ++  RLY EL  +   P  RD LRER+ER EMM RR++L++PEFY G+++AV T+D F PN+ +RF+GICI +   GL++   LRN+I+K  +E++YE+YNPT+  IEVL LE+RLD NLLYLRDA    S  P DM   P +  + VP+ND KV++   PW+  W+   YRGI D+ ++    ++L  IQD    ++RYDLMK+YR+R        A+R V+I H DLI++HE Q +Q L D  K+
Sbjct:   14 VITRVPKVPILMPCRFSRRRLPPEYRKQYLEKISNGALDKYRKSDFVPYPALKTQRLWEVQPQEPEKETKRLYQELVPHFIDPRYRDRLRERLERHEMMLRRRNLDMPEFYVGSVVAVRTADKFAPNQSHRFLGICIERFNEGLWTKFTLRNVIEKTAVEIQYELYNPTIQSIEVLLLEKRLDRNLLYLRDAPLDESRFPFDMSRIPYNPSDPVPINDKKVKLLPPPWAFKWYLHGYRGIHDTMYDYLTPQQLSEIQDKINLVDRYDLMKMYRSRLCLEEERIALRDVQIQHQDLIRHHE-QRRQELMDKHKE 325          
BLAST of 39S ribosomal protein L19 vs. Ensembl Cavefish
Match: mrpl19 (mitochondrial ribosomal protein L19 [Source:NCBI gene;Acc:103022520])

HSP 1 Score: 153.68 bits (387), Expect = 4.809e-43
Identity = 87/210 (41.43%), Postives = 121/210 (57.62%), Query Frame = 3
Query:  495 LEIPEFYAGTIMAVTTSDPFMPNKQNRFVGICIHKKIAGLFSSVRLRNIIDKIGIEVEYEMYNPTLIKIEVLKLERRLDENLLYLRDALPIYSTVPLDMVPAPRDADEKVPLNDLKVEMKARPWSVDWHH--FSYRGIADSGWENEDGRKLKYIQDSRCQIERYDLMKIYRNRGPAAARNDAMRHVEIMHHDLIKYHEMQYQQALADLRK 1118
            L IPEFY G+I++VT SDP    K NRFVGICI +   GL ++  LRN++D  G+E+ YE+Y+P +  IEVLKLE+RLD+NL+YLRDALP YST   +M P     ++ VP+N LKV+MK RPWS  W    F+ +GI    +   +  ++++ Q      + YD++K Y                     D     E  YQ+  A+LRK
Sbjct:   97 LNIPEFYVGSILSVTMSDPHAAGKTNRFVGICIQRSGKGLGATFILRNVVDGQGVEICYELYSPRIRSIEVLKLEKRLDDNLMYLRDALPDYSTFDFEMKPVHISPNQDVPVNPLKVKMKPRPWSKRWDRPKFNIKGIRFDLYVTPE--QMEHAQKWAQPWQEYDMLKEY---------------------DTSALEEKIYQEVQAELRK 283          
BLAST of 39S ribosomal protein L19 vs. Ensembl Nematostella
Match: EDO38340 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SD84])

HSP 1 Score: 83.5741 bits (205), Expect = 3.730e-18
Identity = 46/106 (43.40%), Postives = 63/106 (59.43%), Query Frame = 3
Query:  492 HLEIPEFYAGTIMAVTTSDPFMPNKQNRFVGICIHKK--IAGLFSSVRLRNIIDKIGIEVEYEMYNPTLIKIEVLKLERRLDENLLYLRDALPIYSTVPLDMVPAP 803
             L++PEF  G+ +AVT +D ++P    RFVGICI        L ++  LRN+ID   +EV +++Y+P + KIEVLK ERR  + L YLRD  P  S V   M   P
Sbjct:  130 QLKVPEFCVGSTVAVTRADNYVPKGHVRFVGICIAMNHWQNTLGATFTLRNVIDGEPMEVNFQLYSPVIQKIEVLKHERRDKQALWYLRDYPPALSYVSATMKALP 235          
BLAST of 39S ribosomal protein L19 vs. Ensembl Medaka
Match: mrpl19 (mitochondrial ribosomal protein L19 [Source:NCBI gene;Acc:101174241])

HSP 1 Score: 148.288 bits (373), Expect = 6.244e-41
Identity = 79/171 (46.20%), Postives = 110/171 (64.33%), Query Frame = 3
Query:  495 LEIPEFYAGTIMAVTTSDPFMPNKQNRFVGICIHKKIAGLFSSVRLRNIIDKIGIEVEYEMYNPTLIKIEVLKLERRLDENLLYLRDALPIYSTVPLDMVPAPRDADEKVPLNDLKVEMKARPWSVDWH--HFSYRGIADSGWENEDGRKLKYIQDSRCQ-IERYDLMKIY 998
            L IPEFY G+I+AVT +D     K NRFVGICI +   GL ++  LRNI++  G+E+ YE+Y+P +  IEVLKLE+RLD NL+YLRDALP YSTV  +M P P     +VP+N LKV+M  +PWS  W    F+ +GI          ++++++Q    +  E YD++K Y
Sbjct:   96 LNIPEFYVGSILAVTMADANASGKTNRFVGICIQRGGRGLGATFVLRNILNGQGVEICYELYSPRIQTIEVLKLEKRLDSNLMYLRDALPEYSTVDPEMKPVPFSPTGEVPVNKLKVKMCPKPWSKHWERPQFAIQGIRFDLCMTP--KQMEFVQKKYAKPWEEYDMLKEY 264          
BLAST of 39S ribosomal protein L19 vs. Planmine SMEST
Match: SMESG000076325.1 (SMESG000076325.1)

HSP 1 Score: 628.246 bits (1619), Expect = 0.000e+0
Identity = 319/322 (99.07%), Postives = 320/322 (99.38%), Query Frame = 3
Query:  171 MQKFSIIFKSPAFLYIKSCRGIRYLRNEYLGEYLPKVDDKHLESHRTNKFTKYSEIDKLEEYEINVEVPNEKINRLYPELFNYVPLPEMRDSLXXXXXXXXXXXXXXHLEIPEFYAGTIMAVTTSDPFMPNKQNRFVGICIHKKIAGLFSSVRLRNIIDKIGIEVEYEMYNPTLIKIEVLKLERRLDENLLYLRDALPIYSTVPLDMVPAPRDADEKVPLNDLKVEMKARPWSVDWHHFSYRGIADSGWENEDGRKLKYIQDSRCQIERYDLMKIYRNRGPAAARNDAMRHVEIMHHDLIKYHEMQYQQALADLRKQENIGK 1136
            MQKFS+IFKSPAFLYIKSCRGIRYLRNEYLGEYLPKVDDKHLESHRTNKFTKYSEIDKLEEYEIN EVPNEKINRLYPELFNYVPLPEMRDSLRERIERREMMKRRKHLEIPEFYAGTIMAVTTSDPFMPNKQNRFVGICIHKKIAGLFSSVRLRNIIDKIGIEVEYEMYNPTLIKIEVLKLERRLDENLLYLRDALPIYSTVPLDMVPAPRDADEKVPLNDLKVEMKARPWSVDWHHFSYRGIADSGWENEDGRKLKYIQDSRCQIERYDLMKIYRNRGPAAARNDAMRHVEIMHHDLIKYHEMQYQQALADLRKQE IGK
Sbjct:    1 MQKFSVIFKSPAFLYIKSCRGIRYLRNEYLGEYLPKVDDKHLESHRTNKFTKYSEIDKLEEYEINEEVPNEKINRLYPELFNYVPLPEMRDSLRERIERREMMKRRKHLEIPEFYAGTIMAVTTSDPFMPNKQNRFVGICIHKKIAGLFSSVRLRNIIDKIGIEVEYEMYNPTLIKIEVLKLERRLDENLLYLRDALPIYSTVPLDMVPAPRDADEKVPLNDLKVEMKARPWSVDWHHFSYRGIADSGWENEDGRKLKYIQDSRCQIERYDLMKIYRNRGPAAARNDAMRHVEIMHHDLIKYHEMQYQQALADLRKQEKIGK 322          
BLAST of 39S ribosomal protein L19 vs. Planmine SMEST
Match: SMESG000050888.1 (SMESG000050888.1)

HSP 1 Score: 50.8322 bits (120), Expect = 2.016e-6
Identity = 54/54 (100.00%), Postives = 54/54 (100.00%), Query Frame = -2
Query:    3 FKIIKLNKAVLNYFTNSXXXXXXXXXXXXXXXXXXXXXXXXEGYRKLIDEKKDM 164
            FKIIKLNKAVLNYFTNSERYKRKEQERIERERMRRLMAEDEEGYRKLIDEKKDM
Sbjct:  395 FKIIKLNKAVLNYFTNSERYKRKEQERIERERMRRLMAEDEEGYRKLIDEKKDM 448          
BLAST of 39S ribosomal protein L19 vs. Planmine SMEST
Match: SMESG000050888.1 (SMESG000050888.1)

HSP 1 Score: 50.447 bits (119), Expect = 2.200e-6
Identity = 54/54 (100.00%), Postives = 54/54 (100.00%), Query Frame = -2
Query:    3 FKIIKLNKAVLNYFTNSXXXXXXXXXXXXXXXXXXXXXXXXEGYRKLIDEKKDM 164
            FKIIKLNKAVLNYFTNSERYKRKEQERIERERMRRLMAEDEEGYRKLIDEKKDM
Sbjct:  317 FKIIKLNKAVLNYFTNSERYKRKEQERIERERMRRLMAEDEEGYRKLIDEKKDM 370          
BLAST of 39S ribosomal protein L19 vs. Planmine SMEST
Match: SMESG000050880.1 (SMESG000050880.1)

HSP 1 Score: 50.447 bits (119), Expect = 2.200e-6
Identity = 54/54 (100.00%), Postives = 54/54 (100.00%), Query Frame = -2
Query:    3 FKIIKLNKAVLNYFTNSXXXXXXXXXXXXXXXXXXXXXXXXEGYRKLIDEKKDM 164
            FKIIKLNKAVLNYFTNSERYKRKEQERIERERMRRLMAEDEEGYRKLIDEKKDM
Sbjct:  317 FKIIKLNKAVLNYFTNSERYKRKEQERIERERMRRLMAEDEEGYRKLIDEKKDM 370          
BLAST of 39S ribosomal protein L19 vs. Planmine SMEST
Match: SMESG000050888.1 (SMESG000050888.1)

HSP 1 Score: 50.447 bits (119), Expect = 2.304e-6
Identity = 54/54 (100.00%), Postives = 54/54 (100.00%), Query Frame = -2
Query:    3 FKIIKLNKAVLNYFTNSXXXXXXXXXXXXXXXXXXXXXXXXEGYRKLIDEKKDM 164
            FKIIKLNKAVLNYFTNSERYKRKEQERIERERMRRLMAEDEEGYRKLIDEKKDM
Sbjct:  317 FKIIKLNKAVLNYFTNSERYKRKEQERIERERMRRLMAEDEEGYRKLIDEKKDM 370          
The following BLAST results are available for this feature:
BLAST of 39S ribosomal protein L19 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MRPL195.579e-4249.62mitochondrial ribosomal protein L19 [Source:HGNC S... [more]
MRPL195.396e-4150.00mitochondrial ribosomal protein L19 [Source:HGNC S... [more]
MRPL195.396e-4150.00mitochondrial ribosomal protein L19 [Source:HGNC S... [more]
MRPL196.387e-1048.15mitochondrial ribosomal protein L19 [Source:HGNC S... [more]
MRPL192.697e-855.81mitochondrial ribosomal protein L19 [Source:HGNC S... [more]
back to top
BLAST of 39S ribosomal protein L19 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mrpl-196.573e-4444.83Probable 39S ribosomal protein L19, mitochondrial ... [more]
back to top
BLAST of 39S ribosomal protein L19 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mRpL194.604e-4643.23gene:FBgn0037608 transcript:FBtr0081901[more]
back to top
BLAST of 39S ribosomal protein L19 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
mrpl191.007e-4252.90mitochondrial ribosomal protein L19 [Source:ZFIN;A... [more]
mrpl191.371e-4052.90mitochondrial ribosomal protein L19 [Source:ZFIN;A... [more]
back to top
BLAST of 39S ribosomal protein L19 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
MRPL193.435e-4052.31mitochondrial ribosomal protein L19 [Source:NCBI g... [more]
back to top
BLAST of 39S ribosomal protein L19 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Mrpl193.285e-4351.45mitochondrial ribosomal protein L19 [Source:MGI Sy... [more]
back to top
BLAST of 39S ribosomal protein L19 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9VHN6|RM19_DROME4.615e-4543.2339S ribosomal protein L19, mitochondrial OS=Drosop... [more]
sp|Q95Y83|RM19_CAEEL8.361e-4344.83Probable 39S ribosomal protein L19, mitochondrial ... [more]
sp|Q9D338|RM19_MOUSE2.298e-4251.4539S ribosomal protein L19, mitochondrial OS=Mus mu... [more]
sp|Q5R8M4|RM19_PONAB2.591e-4050.0039S ribosomal protein L19, mitochondrial OS=Pongo ... [more]
sp|P49406|RM19_HUMAN2.591e-4050.0039S ribosomal protein L19, mitochondrial OS=Homo s... [more]
back to top
BLAST of 39S ribosomal protein L19 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A504Z4W28.564e-6544.73Large subunit ribosomal protein L19 OS=Fasciola gi... [more]
A0A4E0RT631.609e-6444.41Large subunit ribosomal protein L19 OS=Fasciola he... [more]
Q5DA352.085e-6343.08Putative 39S ribosomal protein L19 isoform 1 OS=Sc... [more]
C1L5X72.812e-6343.08Putative 39S ribosomal protein L19, mitochondrial ... [more]
A0A095B1C08.141e-6342.49Uncharacterized protein (Fragment) OS=Schistosoma ... [more]
back to top
BLAST of 39S ribosomal protein L19 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mrpl194.809e-4341.43mitochondrial ribosomal protein L19 [Source:NCBI g... [more]
back to top
BLAST of 39S ribosomal protein L19 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 39S ribosomal protein L19 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 39S ribosomal protein L19 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO383403.730e-1843.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of 39S ribosomal protein L19 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mrpl196.244e-4146.20mitochondrial ribosomal protein L19 [Source:NCBI g... [more]
back to top
BLAST of 39S ribosomal protein L19 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000076325.10.000e+099.07SMESG000076325.1[more]
SMESG000050888.12.016e-6100.00SMESG000050888.1[more]
SMESG000050888.12.200e-6100.00SMESG000050888.1[more]
SMESG000050880.12.200e-6100.00SMESG000050880.1[more]
SMESG000050888.12.304e-6100.00SMESG000050888.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019242 ID=SMED30019242|Name=39S ribosomal protein L19|organism=Schmidtea mediterranea sexual|type=transcript|length=1347bp
CTCATATCTTTCTTCTCGTCAATAAGTTTCCTATAACCTTCTTCATCTTC
TGCCATTAAGCGACGCATTCTTTCTCTTTCGATTCGTTCTTGTTCCTTTC
TTTTGTATCGTTCGCTGTTGGTGAAATAATTCAAAACTGCTTTATTTAAT
TTAATAATTTTAAATTAGCAATGCAAAAATTTTCTATTATATTTAAATCT
CCAGCATTTTTATACATTAAATCATGTAGAGGCATTCGTTACCTTCGTAA
CGAATATTTAGGCGAGTATTTACCCAAAGTTGATGATAAACATCTTGAAT
CTCACCGTACAAATAAATTCACAAAGTATTCTGAGATAGACAAATTGGAA
GAGTATGAAATAAATGTAGAAGTTCCAAATGAAAAGATTAACCGGCTATA
TCCAGAACTGTTTAATTATGTCCCTCTGCCAGAAATGCGCGACAGTTTAC
GGGAACGAATTGAAAGAAGAGAAATGATGAAGCGTCGTAAACATTTAGAA
ATACCAGAATTTTATGCCGGAACAATTATGGCGGTCACGACCTCAGATCC
GTTTATGCCAAACAAGCAGAATCGATTTGTTGGAATTTGTATACATAAAA
AGATTGCCGGATTATTTTCCAGCGTTCGATTGAGGAATATAATCGATAAA
ATAGGCATCGAAGTCGAGTATGAGATGTACAACCCTACTCTGATAAAAAT
CGAAGTACTCAAATTGGAAAGGCGATTGGATGAGAATTTGTTGTATCTGC
GTGACGCGCTGCCAATATACAGCACGGTTCCATTGGATATGGTTCCGGCT
CCTCGGGATGCCGATGAAAAGGTGCCGTTGAATGATTTGAAGGTAGAAAT
GAAAGCGCGGCCTTGGTCTGTCGATTGGCACCATTTCAGTTACCGGGGGA
TTGCTGACAGCGGCTGGGAAAATGAGGACGGACGTAAATTGAAATACATT
CAGGATTCCCGATGTCAGATCGAGAGGTACGATCTGATGAAGATTTATCG
GAACCGGGGGCCTGCTGCAGCCCGGAATGACGCAATGAGACACGTGGAAA
TCATGCACCATGACCTCATCAAATATCACGAGATGCAATATCAGCAGGCG
CTCGCTGACTTGAGGAAGCAGGAGAACATTGGCAAATAAATATTGGGTTT
TCGTTATTGATTTCTATTATTATCTGTAGTGTATATTTCTGCTGCAATTT
TATTATTTGCTGCATTCTGATTGGTCAATATTTAGTAATTATTGATTTAT
ATAAATATTTTATGTTGCAATTTCATTATTTGCTGCATTCTGATTGGTCA
ATATTTAGTAATTATTGATTTATATAAATATTTTATGTTGCAATTTC
back to top

protein sequence of SMED30019242-orf-1

>SMED30019242-orf-1 ID=SMED30019242-orf-1|Name=SMED30019242-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=323bp
MQKFSIIFKSPAFLYIKSCRGIRYLRNEYLGEYLPKVDDKHLESHRTNKF
TKYSEIDKLEEYEINVEVPNEKINRLYPELFNYVPLPEMRDSLRERIERR
EMMKRRKHLEIPEFYAGTIMAVTTSDPFMPNKQNRFVGICIHKKIAGLFS
SVRLRNIIDKIGIEVEYEMYNPTLIKIEVLKLERRLDENLLYLRDALPIY
STVPLDMVPAPRDADEKVPLNDLKVEMKARPWSVDWHHFSYRGIADSGWE
NEDGRKLKYIQDSRCQIERYDLMKIYRNRGPAAARNDAMRHVEIMHHDLI
KYHEMQYQQALADLRKQENIGK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000044cephalic ganglia
PLANA:0000070intestinal phagocyte
PLANA:0000418head
PLANA:0002109X1 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR038657L19_sf
IPR014012HSA_dom
IPR001857Ribosomal_L19
IPR008991Translation_prot_SH3-like_sf
Vocabulary: biological process
TermDefinition
GO:0006412translation
Vocabulary: molecular function
TermDefinition
GO:0003735structural constituent of ribosome
Vocabulary: cellular component
TermDefinition
GO:0005840ribosome
GO:0005622intracellular
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR038657Ribosomal protein L19 superfamilyGENE3DG3DSA:2.30.30.790coord: 82..203
e-value: 2.8E-13
score: 51.7
IPR001857Ribosomal protein L19PFAMPF01245Ribosomal_L19coord: 102..195
e-value: 1.5E-10
score: 40.9
IPR001857Ribosomal protein L19PANTHERPTHR15680RIBOSOMAL PROTEIN L19coord: 78..207
NoneNo IPR availablePANTHERPTHR15680:SF939S RIBOSOMAL PROTEIN L19, MITOCHONDRIALcoord: 78..207
IPR008991Translation protein SH3-like domain superfamilySUPERFAMILYSSF50104Translation proteins SH3-like domaincoord: 94..228