RIC1 domain-containing protein

Overview
NameRIC1 domain-containing protein
Smed IDSMED30019230
Length (bp)4721
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of RIC1 domain-containing protein (SMED30019230) t-SNE clustered cells

Violin plots show distribution of expression levels for RIC1 domain-containing protein (SMED30019230) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of RIC1 domain-containing protein (SMED30019230) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for RIC1 domain-containing protein (SMED30019230) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019230

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30019230h1SMcG0003275 dd_Smed_v4_9205_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30019230h1SMcG0003275 dd_Smed_v4_9205_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30019230h1SMcG0003275 dd_Smed_v4_9205_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30019230h1SMcG0003275 dd_Smed_v4_9205_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30019230h1SMcG0003275 dd_Smed_v4_9205_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of RIC1 domain-containing protein vs. Ensembl Human
Match: RIC1 (RIC1 homolog, RAB6A GEF complex partner 1 [Source:HGNC Symbol;Acc:HGNC:17686])

HSP 1 Score: 541.576 bits (1394), Expect = 1.287e-168
Identity = 354/1033 (34.27%), Postives = 541/1033 (52.37%), Query Frame = 3
Query:   21 MYYFFNCPKRI-----SRHFVPSNITGIISSKSFALCAIFNSSQIIVFENKNNSIVAYYCRCEESLDIYGNSINLEWNSDGSLIAIGTDKGFLLIFSVKT----------VSQEVNVGYQNEKEFLEEGFINRQLSLFGEIILLDVISFPYKISCICLYRDDLLVAIEDGTLSRIKWNGSLLYNQEFNLTSISFFSDLEFSK-ASNLSKNEAICRNIEWLPSLSGVIVLFKNGKSAFLHIPNHKLLSEQITGVWAENLRNVTCSAVNVKFRSIAYGLKIGEAVIYKTDEETGALRLQHRLKILSNEYPDADKVTGAVTYLKWSPDNFCLALCWEYIGFSLWSVQGSLLFSSLGNKAGI--------DMSLLSLDWGCEGYSLWLI----------EKPDKS--GKPAILIFQMAKSVLVVNPTKNNHEHXXXXXXXHIIFG---------PRKLLSSSETNLEYIPYPE------------------------------NYVTWNWPIKYAAIDLNGSRLVISGKHGFALYFFVSKKWRLFGNETQERTIEVSGGIVWYNHIVGLACFDNKEGKFEIRLYDSLQKIDNSLSTNHPVNSQILLMNIFDNTLVVLSIDGSIGLFEITLNEKSHDIS--MEYIQTIPLENYIEFAACIVSFNLSSLHTEIGHNKDVDELIR-YQSLLINYSGHLLLFQRDKSFSAPRTSDKSLNSQENSFFKLAFKNTLIAKQKITFTGPLVVAYNVEIMWTPIIDEEFQSKRLKLDDWNAKIYTMENSLWLNCGSQGLRVWLPLNGGSNVTQVGEKKSKYSFLSKRIMLTFKIRNFYPLVVLNNEALLMSPMNE-------FSNDFVNTPTCLNLSFSSINKNRHIFLQHIVKELLRINLGIHALDLTFELKKLPYFNHSXXXXXXXXXXXXATSKEPIPDPLLPRVVAFIQEFPNFLRTVVQCARKTELALWSYLFESAGNPKDLFESCLMNNELDTAASYLIILQNIEHPLISQKQAILLLDAALNRSNWGLVSNLIRFLKNI 2864
            MY+    PKR+     S    P ++    S    A  A+  ++++ ++ ++ + ++  Y    +S   +G+    EW  D ++IA+ T  G++L F + +          V  + +   +    F EE     Q +    + +  ++     I  +    +DLLVA  DG L  I W G     +  NL ++ F  DL+ S+  S L   +   R++E+  +L G  V+F +GK  F+   + +  +EQ+ GVW +++ + TC AVN K+R +A+G   G   +Y  D  TGA+ L H+L++ + +YPD    TGAV  ++WSPDN  + + WEY G SLWSV G+ L  +LG              + + S+ WG EGY LW+I          E   +S   +P+IL+FQ  KSVL VNP  +N E +LL     +            PR    SS T+ E+ P  E                               Y+  NWPI+++AID  G  + + GK GFA Y  ++KKW+LFGN TQE+ + V+GG+ W+N  + LAC++  + + E+R+Y     +DN+ +      ++ LL+++F + ++V   D SI L+ I       + +  ++ +Q + +  YI     +VS  L+S+ TE G    + +  R  +S+++N +G L++ QRD+S    R  D + N+Q               ++ + F  P+V+A +VE +WT       + KR  L+           +LWL+CG  G++VWLPL          + +  +SFLS+RIML F I N YPL VL  +AL++  +N+       ++ +       +   F  + +   I+L HI+++LL  NLG  AL L      LPYF H LEL+LHEVLEEEATS+EPIPDPLLP V  FI EFP FL+TVV CARKTE ALW+YLF + GNPKDLFE CLM  +LDTAASYLIILQN+E P +S++ A LL + AL +  W L  ++IRFLK I
Sbjct:    1 MYFLSGWPKRLLCPLGSPAEAPFHVQ---SDPQRAFFAVLAAARLSIWYSRPSVLIVTYKEPAKSSTQFGSYKQAEWRPDSTMIAVSTANGYILFFHITSTRGDKYLYEPVYPKGSPQMKGTPHFKEE-----QCAPALNLEMRKILDLQAPIMSLQSVLEDLLVATSDGLLHLIHWEGMTNGRKAINLCTVPFSVDLQSSRVGSFLGFTDVHIRDMEYCATLDGFAVVFNDGKVGFITPVSSRFTAEQLHGVWPQDVVDGTCVAVNNKYRLMAFGCVSGSVQVYTIDNSTGAMLLSHKLELTAKQYPDIWNKTGAVKLMRWSPDNSVVIVTWEYGGLSLWSVFGAQLICTLGGDFAYRSDGTKKDPLKINSMSWGAEGYHLWVISGFGSQNTEIESDLRSVVKQPSILLFQFIKSVLTVNPCMSNQEQVLLQGEDRLYLNCGEASQTQNPR----SSSTHSEHKPSREKSPFADGGLESQGLSTLLGHRHWHVVQISSTYLESNWPIRFSAIDKLGQNIAVVGKFGFAHYSLLTKKWKLFGNITQEQNMIVTGGLAWWNDFMVLACYNINDRQEELRVYLRTSNLDNAFAHVTKAQAETLLLSVFQDMVIVFRADCSICLYSIERKSDGPNTTAGIQVLQEVSMSRYIPHPFLVVSVTLTSVSTENGITLKMPQQARGAESIMLNLAGQLIMMQRDRSGPQIREKDSNPNNQ---------------RKLLPFCPPVVLAQSVENVWTTC--RANKQKRHLLE-----------ALWLSCGGAGMKVWLPLFPR-------DHRKPHSFLSQRIMLPFHI-NIYPLAVLFEDALVLGAVNDTLLYDSLYTRNNAREQLEVLFPFCVVERTSQIYLHHILRQLLVRNLGEQALLLAQSCATLPYFPHVLELMLHEVLEEEATSREPIPDPLLPTVAKFITEFPLFLQTVVHCARKTEYALWNYLFAAVGNPKDLFEECLMAQDLDTAASYLIILQNMEVPAVSRQHATLLFNTALEQGKWDLCRHMIRFLKAI 985          
BLAST of RIC1 domain-containing protein vs. Ensembl Human
Match: RIC1 (RIC1 homolog, RAB6A GEF complex partner 1 [Source:HGNC Symbol;Acc:HGNC:17686])

HSP 1 Score: 543.502 bits (1399), Expect = 9.980e-167
Identity = 354/1033 (34.27%), Postives = 541/1033 (52.37%), Query Frame = 3
Query:   21 MYYFFNCPKRI-----SRHFVPSNITGIISSKSFALCAIFNSSQIIVFENKNNSIVAYYCRCEESLDIYGNSINLEWNSDGSLIAIGTDKGFLLIFSVKT----------VSQEVNVGYQNEKEFLEEGFINRQLSLFGEIILLDVISFPYKISCICLYRDDLLVAIEDGTLSRIKWNGSLLYNQEFNLTSISFFSDLEFSK-ASNLSKNEAICRNIEWLPSLSGVIVLFKNGKSAFLHIPNHKLLSEQITGVWAENLRNVTCSAVNVKFRSIAYGLKIGEAVIYKTDEETGALRLQHRLKILSNEYPDADKVTGAVTYLKWSPDNFCLALCWEYIGFSLWSVQGSLLFSSLGNKAGI--------DMSLLSLDWGCEGYSLWLI----------EKPDKS--GKPAILIFQMAKSVLVVNPTKNNHEHXXXXXXXHIIFG---------PRKLLSSSETNLEYIPYPE------------------------------NYVTWNWPIKYAAIDLNGSRLVISGKHGFALYFFVSKKWRLFGNETQERTIEVSGGIVWYNHIVGLACFDNKEGKFEIRLYDSLQKIDNSLSTNHPVNSQILLMNIFDNTLVVLSIDGSIGLFEITLNEKSHDIS--MEYIQTIPLENYIEFAACIVSFNLSSLHTEIGHNKDVDELIR-YQSLLINYSGHLLLFQRDKSFSAPRTSDKSLNSQENSFFKLAFKNTLIAKQKITFTGPLVVAYNVEIMWTPIIDEEFQSKRLKLDDWNAKIYTMENSLWLNCGSQGLRVWLPLNGGSNVTQVGEKKSKYSFLSKRIMLTFKIRNFYPLVVLNNEALLMSPMNE-------FSNDFVNTPTCLNLSFSSINKNRHIFLQHIVKELLRINLGIHALDLTFELKKLPYFNHSXXXXXXXXXXXXATSKEPIPDPLLPRVVAFIQEFPNFLRTVVQCARKTELALWSYLFESAGNPKDLFESCLMNNELDTAASYLIILQNIEHPLISQKQAILLLDAALNRSNWGLVSNLIRFLKNI 2864
            MY+    PKR+     S    P ++    S    A  A+  ++++ ++ ++ + ++  Y    +S   +G+    EW  D ++IA+ T  G++L F + +          V  + +   +    F EE     Q +    + +  ++     I  +    +DLLVA  DG L  I W G     +  NL ++ F  DL+ S+  S L   +   R++E+  +L G  V+F +GK  F+   + +  +EQ+ GVW +++ + TC AVN K+R +A+G   G   +Y  D  TGA+ L H+L++ + +YPD    TGAV  ++WSPDN  + + WEY G SLWSV G+ L  +LG              + + S+ WG EGY LW+I          E   +S   +P+IL+FQ  KSVL VNP  +N E +LL     +            PR    SS T+ E+ P  E                               Y+  NWPI+++AID  G  + + GK GFA Y  ++KKW+LFGN TQE+ + V+GG+ W+N  + LAC++  + + E+R+Y     +DN+ +      ++ LL+++F + ++V   D SI L+ I       + +  ++ +Q + +  YI     +VS  L+S+ TE G    + +  R  +S+++N +G L++ QRD+S    R  D + N+Q               ++ + F  P+V+A +VE +WT       + KR  L+           +LWL+CG  G++VWLPL          + +  +SFLS+RIML F I N YPL VL  +AL++  +N+       ++ +       +   F  + +   I+L HI+++LL  NLG  AL L      LPYF H LEL+LHEVLEEEATS+EPIPDPLLP V  FI EFP FL+TVV CARKTE ALW+YLF + GNPKDLFE CLM  +LDTAASYLIILQN+E P +S++ A LL + AL +  W L  ++IRFLK I
Sbjct:    1 MYFLSGWPKRLLCPLGSPAEAPFHVQ---SDPQRAFFAVLAAARLSIWYSRPSVLIVTYKEPAKSSTQFGSYKQAEWRPDSTMIAVSTANGYILFFHITSTRGDKYLYEPVYPKGSPQMKGTPHFKEE-----QCAPALNLEMRKILDLQAPIMSLQSVLEDLLVATSDGLLHLIHWEGMTNGRKAINLCTVPFSVDLQSSRVGSFLGFTDVHIRDMEYCATLDGFAVVFNDGKVGFITPVSSRFTAEQLHGVWPQDVVDGTCVAVNNKYRLMAFGCVSGSVQVYTIDNSTGAMLLSHKLELTAKQYPDIWNKTGAVKLMRWSPDNSVVIVTWEYGGLSLWSVFGAQLICTLGGDFAYRSDGTKKDPLKINSMSWGAEGYHLWVISGFGSQNTEIESDLRSVVKQPSILLFQFIKSVLTVNPCMSNQEQVLLQGEDRLYLNCGEASQTQNPR----SSSTHSEHKPSREKSPFADGGLESQGLSTLLGHRHWHVVQISSTYLESNWPIRFSAIDKLGQNIAVVGKFGFAHYSLLTKKWKLFGNITQEQNMIVTGGLAWWNDFMVLACYNINDRQEELRVYLRTSNLDNAFAHVTKAQAETLLLSVFQDMVIVFRADCSICLYSIERKSDGPNTTAGIQVLQEVSMSRYIPHPFLVVSVTLTSVSTENGITLKMPQQARGAESIMLNLAGQLIMMQRDRSGPQIREKDSNPNNQ---------------RKLLPFCPPVVLAQSVENVWTTC--RANKQKRHLLE-----------ALWLSCGGAGMKVWLPLFPR-------DHRKPHSFLSQRIMLPFHI-NIYPLAVLFEDALVLGAVNDTLLYDSLYTRNNAREQLEVLFPFCVVERTSQIYLHHILRQLLVRNLGEQALLLAQSCATLPYFPHVLELMLHEVLEEEATSREPIPDPLLPTVAKFITEFPLFLQTVVHCARKTEYALWNYLFAAVGNPKDLFEECLMAQDLDTAASYLIILQNMEVPAVSRQHATLLFNTALEQGKWDLCRHMIRFLKAI 985          
BLAST of RIC1 domain-containing protein vs. Ensembl Human
Match: RIC1 (RIC1 homolog, RAB6A GEF complex partner 1 [Source:HGNC Symbol;Acc:HGNC:17686])

HSP 1 Score: 497.664 bits (1280), Expect = 2.542e-150
Identity = 334/1006 (33.20%), Postives = 522/1006 (51.89%), Query Frame = 3
Query:   21 MYYFFNCPKRI-----SRHFVPSNITGIISSKSFALCAIFNSSQIIVFENKNNSIVAYYCRCEESLDIYGNSINLEWNSDGSLIAIGTDKGFLLIFSVKT----------VSQEVNVGYQNEKEFLEEGFINRQLSLFGEIILLDVISFPYKISCICLYRDDLLVAIEDGTLSRIKWNGSLLYNQEFNLTSISFFSDLEFSK-ASNLSKNEAICRNIEWLPSLSGVIVLFKNGKSAFLHIPNHKLLSEQITGVWAENLRNVTCSAVNVKFRSIAYGLKIGEAVIYKTDEETGALRLQHRLKILSNEYPDADKVTGAVTYLKWSPDNFCLALCWEYIGFSLWSVQGSLLFSSLGNKAGI--------DMSLLSLDWGCEGYSLWLI----------EKPDKS--GKPAILIFQMAKSVLVVNPTKNNHEHXXXXXXXHIIFG---------PRKLLSSSETNLEYIPYPENYVTWNWPIKYAAIDLNGSRLVISGKHGFALYF---FVSKKWRLFGNETQERTIEVSGGIVWYNHIVGLACFDNKEGKFEIRLYDSLQKIDNSLSTNHPVNSQILLMNIFDNTLVVLSIDGSIGLFEITLNEKSHDIS--MEYIQTIPLENYIEFAACIVSFNLSSLHTEIGHNKDVDELIR-YQSLLINYSGHLLLFQRDKSFSAPRTSDKSLNSQENSFFKLAFKNTLIAKQKITFTGPLVVAYNVEIMWTPIIDEEFQSKRLKLDDWNAKIYTMENSLWLNCGSQGLRVWLPLNGGSNVTQVGEKKSKYSFLSKRIMLTFKIRNFYPLVVLNNEALLMSPMNE-------FSNDFVNTPTCLNLSFSSINKNRHIFLQHIVKELLRINLGIHALDLTFELKKLPYFNHSXXXXXXXXXXXXATSKEPIPDPLLPRVVAFIQEFPNFLRTVVQCARKTELALWSYLFESAGNPKDLFESCLMNNELDTAASYLIILQNIEHPLISQKQAILLLDAALNRSNWGLVSNLIRFLKNI 2864
            MY+    PKR+     S    P ++    S    A  A+  ++++ ++ ++ + ++  Y    +S   +G+    EW  D ++IA+ T  G++L F + +          V  + +   +    F EE     Q +    + +  ++     I  +    +DLLVA  DG L  I W G     +  NL ++ F  DL+ S+  S L   +   R++E+  +L G  V+F +GK  F+   + +  +EQ+ GVW +++ + TC AVN K+R +A+G   G   +Y  D  TGA+ L H+L++ + +YPD    TGAV  ++WSPDN  + + WEY G SLWSV G+ L  +LG              + + S+ WG EGY LW+I          E   +S   +P+IL+FQ  KSVL VNP  +N E +LL     +            PR    SS T+ E+ P  E       P     ++  G   ++  +H   +     ++   W +     +E+ + V+GG+ W+N  + LAC++  + + E+R+Y     +DN+ +      ++ LL+++F + ++V   D SI L+ I       + +  ++ +Q + +  YI     +VS  L+S+ TE G    + +  R  +S+++N +G L++ QRD+S    R  D + N+Q               ++ + F  P+V+A +VE +WT       + KR  L+           +LWL+CG  G++VWLPL          + +  +SFLS+RIML F I N YPL VL  +AL++  +N+       ++ +       +   F  + +   I+L HI+++LL  NLG  AL L      LPYF H LEL+LHEVLEEEATS+EPIPDPLLP V  FI EFP FL+TVV CARKTE ALW+YLF + GNPKDLFE CLM  +LDTAASYLIILQN+E P +S++ A LL + AL +  W L  ++IRFLK I
Sbjct:    1 MYFLSGWPKRLLCPLGSPAEAPFHVQ---SDPQRAFFAVLAAARLSIWYSRPSVLIVTYKEPAKSSTQFGSYKQAEWRPDSTMIAVSTANGYILFFHITSTRGDKYLYEPVYPKGSPQMKGTPHFKEE-----QCAPALNLEMRKILDLQAPIMSLQSVLEDLLVATSDGLLHLIHWEGMTNGRKAINLCTVPFSVDLQSSRVGSFLGFTDVHIRDMEYCATLDGFAVVFNDGKVGFITPVSSRFTAEQLHGVWPQDVVDGTCVAVNNKYRLMAFGCVSGSVQVYTIDNSTGAMLLSHKLELTAKQYPDIWNKTGAVKLMRWSPDNSVVIVTWEYGGLSLWSVFGAQLICTLGGDFAYRSDGTKKDPLKINSMSWGAEGYHLWVISGFGSQNTEIESDLRSVVKQPSILLFQFIKSVLTVNPCMSNQEQVLLQGEDRLYLNCGEASQTQNPR----SSSTHSEHKPSREKS-----PFADGGLESQGLSTLLGHRHWHVVQISSTYLESNWPI-----REQNMIVTGGLAWWNDFMVLACYNINDRQEELRVYLRTSNLDNAFAHVTKAQAETLLLSVFQDMVIVFRADCSICLYSIERKSDGPNTTAGIQVLQEVSMSRYIPHPFLVVSVTLTSVSTENGITLKMPQQARGAESIMLNLAGQLIMMQRDRSGPQIREKDSNPNNQ---------------RKLLPFCPPVVLAQSVENVWTTC--RANKQKRHLLE-----------ALWLSCGGAGMKVWLPLFPR-------DHRKPHSFLSQRIMLPFHI-NIYPLAVLFEDALVLGAVNDTLLYDSLYTRNNAREQLEVLFPFCVVERTSQIYLHHILRQLLVRNLGEQALLLAQSCATLPYFPHVLELMLHEVLEEEATSREPIPDPLLPTVAKFITEFPLFLQTVVHCARKTEYALWNYLFAAVGNPKDLFEECLMAQDLDTAASYLIILQNMEVPAVSRQHATLLFNTALEQGKWDLCRHMIRFLKAI 948          
BLAST of RIC1 domain-containing protein vs. Ensembl Human
Match: RIC1 (RIC1 homolog, RAB6A GEF complex partner 1 [Source:HGNC Symbol;Acc:HGNC:17686])

HSP 1 Score: 488.034 bits (1255), Expect = 1.912e-147
Identity = 321/931 (34.48%), Postives = 490/931 (52.63%), Query Frame = 3
Query:  231 EWNSDGSLIAIGTDKGFLLIFSVKT----------VSQEVNVGYQNEKEFLEEGFINRQLSLFGEIILLDVISFPYKISCICLYRDDLLVAIEDGTLSRIKWNGSLLYNQEFNLTSISFFSDLEFSK-ASNLSKNEAICRNIEWLPSLSGVIVLFKNGKSAFLHIPNHKLLSEQITGVWAENLRNVTCSAVNVKFRSIAYGLKIGEAVIYKTDEETGALRLQHRLKILSNEYPDADKVTGAVTYLKWSPDNFCLALCWEYIGFSLWSVQGSLLFSSLGNKAGI--------DMSLLSLDWGCEGYSLWLI----------EKPDKS--GKPAILIFQMAKSVLVVNPTKNNHEHXXXXXXXHIIFG---------PRKLLSSSETNLEYIPYPENYVTWNWPIKYAAIDLNGSRLVISGKHGFALYF---FVSKKWRLFGNETQERTIEVSGGIVWYNHIVGLACFDNKEGKFEIRLYDSLQKIDNSLSTNHPVNSQILLMNIFDNTLVVLSIDGSIGLFEITLNEKSHDIS--MEYIQTIPLENYIEFAACIVSFNLSSLHTEIGHNKDVDELIR-YQSLLINYSGHLLLFQRDKSFSAPRTSDKSLNSQENSFFKLAFKNTLIAKQKITFTGPLVVAYNVEIMWTPIIDEEFQSKRLKLDDWNAKIYTMENSLWLNCGSQGLRVWLPLNGGSNVTQVGEKKSKYSFLSKRIMLTFKIRNFYPLVVLNNEALLMSPMNE-------FSNDFVNTPTCLNLSFSSINKNRHIFLQHIVKELLRINLGIHALDLTFELKKLPYFNHSXXXXXXXXXXXXATSKEPIPDPLLPRVVAFIQEFPNFLRTVVQCARKTELALWSYLFESAGNPKDLFESCLMNNELDTAASYLIILQNIEHPLISQKQAILLLDAALNRSNWGLVSNLIRFLKNI 2864
            EW  D ++IA+ T  G++L F + +          V  + +   +    F EE     Q +    + +  ++     I  +    +DLLVA  DG L  I W G     +  NL ++ F  DL+ S+  S L   +   R++E+  +L G  V+F +GK  F+   + +  +EQ+ GVW +++ + TC AVN K+R +A+G   G   +Y  D  TGA+ L H+L++ + +YPD    TGAV  ++WSPDN  + + WEY G SLWSV G+ L  +LG              + + S+ WG EGY LW+I          E   +S   +P+IL+FQ  KSVL VNP  +N E +LL     +            PR    SS T+ E+ P  E       P     ++  G   ++  +H   +     ++   W +     +E+ + V+GG+ W+N  + LAC++  + + E+R+Y     +DN+ +      ++ LL+++F + ++V   D SI L+ I       + +  ++ +Q + +  YI     +VS  L+S+ TE G    + +  R  +S+++N +G L++ QRD+S    R  D + N+Q               ++ + F  P+V+A +VE +WT       + KR  L+           +LWL+CG  G++VWLPL          + +  +SFLS+RIML F I N YPL VL  +AL++  +N+       ++ +       +   F  + +   I+L HI+++LL  NLG  AL L      LPYF H LEL+LHEVLEEEATS+EPIPDPLLP V  FI EFP FL+TVV CARKTE ALW+YLF + GNPKDLFE CLM  +LDTAASYLIILQN+E P +S++ A LL + AL +  W L  ++IRFLK I
Sbjct:    2 EWRPDSTMIAVSTANGYILFFHITSTRGDKYLYEPVYPKGSPQMKGTPHFKEE-----QCAPALNLEMRKILDLQAPIMSLQSVLEDLLVATSDGLLHLIHWEGMTNGRKAINLCTVPFSVDLQSSRVGSFLGFTDVHIRDMEYCATLDGFAVVFNDGKVGFITPVSSRFTAEQLHGVWPQDVVDGTCVAVNNKYRLMAFGCVSGSVQVYTIDNSTGAMLLSHKLELTAKQYPDIWNKTGAVKLMRWSPDNSVVIVTWEYGGLSLWSVFGAQLICTLGGDFAYRSDGTKKDPLKINSMSWGAEGYHLWVISGFGSQNTEIESDLRSVVKQPSILLFQFIKSVLTVNPCMSNQEQVLLQGEDRLYLNCGEASQTQNPR----SSSTHSEHKPSREKS-----PFADGGLESQGLSTLLGHRHWHVVQISSTYLESNWPI-----REQNMIVTGGLAWWNDFMVLACYNINDRQEELRVYLRTSNLDNAFAHVTKAQAETLLLSVFQDMVIVFRADCSICLYSIERKSDGPNTTAGIQVLQEVSMSRYIPHPFLVVSVTLTSVSTENGITLKMPQQARGAESIMLNLAGQLIMMQRDRSGPQIREKDSNPNNQ---------------RKLLPFCPPVVLAQSVENVWTTC--RANKQKRHLLE-----------ALWLSCGGAGMKVWLPLFPR-------DHRKPHSFLSQRIMLPFHI-NIYPLAVLFEDALVLGAVNDTLLYDSLYTRNNAREQLEVLFPFCVVERTSQIYLHHILRQLLVRNLGEQALLLAQSCATLPYFPHVLELMLHEVLEEEATSREPIPDPLLPTVAKFITEFPLFLQTVVHCARKTEYALWNYLFAAVGNPKDLFEECLMAQDLDTAASYLIILQNMEVPAVSRQHATLLFNTALEQGKWDLCRHMIRFLKAI 877          
BLAST of RIC1 domain-containing protein vs. Ensembl Human
Match: RIC1 (RIC1 homolog, RAB6A GEF complex partner 1 [Source:HGNC Symbol;Acc:HGNC:17686])

HSP 1 Score: 154.066 bits (388), Expect = 3.079e-42
Identity = 87/131 (66.41%), Postives = 99/131 (75.57%), Query Frame = 3
Query: 2358 FSSINKNRHIFLQHIVKELLRINLGIHALDLTFELKKLPYFNHSXXXXXXXXXXXXATSKEPIPDPLLPRVVAFIQEFPNFLRTVVQCARKTELALWSYLFESAGNPKDLFESCLMNNELDTAASYLIILQ 2750
            F  + +   I+L HI+++LL  NLG  AL L      LPYF H LEL+LHEVLEEEATS+EPIPDPLLP V  FI EFP FL+TVV CARKTE ALW+YLF + GNPKDLFE CLM  +LDTAASYLIILQ
Sbjct:   28 FCVVERTSQIYLHHILRQLLVRNLGEQALLLAQSCATLPYFPHVLELMLHEVLEEEATSREPIPDPLLPTVAKFITEFPLFLQTVVHCARKTEYALWNYLFAAVGNPKDLFEECLMAQDLDTAASYLIILQ 158          
BLAST of RIC1 domain-containing protein vs. Ensembl Celegans
Match: R06F6.8 (Guanine nucleotide exchange factor subunit R06F6.8 [Source:UniProtKB/Swiss-Prot;Acc:Q09417])

HSP 1 Score: 375.17 bits (962), Expect = 3.715e-107
Identity = 267/996 (26.81%), Postives = 466/996 (46.79%), Query Frame = 3
Query:  234 WNSDGSLIAIGTDKGFLLIFSVKTVSQEVNVGY---------QNEKEFLEEGFINRQLSLFGEIILLDVISFPYKISCICLYRDDLLVAIEDGTLSRIKWNGSLLYNQEFNLTSISFFSDLEFSKASNLSKNEAICRNIEWLPSLSGVIVLFKNGKSAFLHIPNHKLLSEQITGVWAENLRNVTCSAVNVKFRSIAYGLKIGEAVIYKTDEETGALRLQHRLKILSNEYPDADKVTGAVTYLKWSPDNFCLALCWEYIGFSLWSVQGSLLFSSLGNKAGIDMSLL----------SLDWGCEGYSLWLIEKPDKSGKPAILIFQ-MAKSVLVVNPTKNNHEHXXXXXXXHIIFGPRK----LLSSSETNLEYIPYPENYVTWNWPIKYAAIDLNGSRLVISGKHGFALYFFVSKKWRLFGNETQERTIEVSGGI-VWYNHIVGLACFDNKEGKFEIRLYDSLQKIDNSLSTNHPVNSQILLMNIFDNTLVVLSIDGSIGLFEITLN-EKSHD----ISMEYIQTIPLENYIEFAACIVSFNLSSLHTEIGHNKDVDELIRYQSLLINYSGHLLLFQRDKSFSAPRTSDKSLNSQENSFFKLAFKNTLIAKQKITFTGPLVVAYNVEIMW---------TPIIDEEFQSKRLKLDDWNAKIYT--------------------MENSLWLNCGSQGLRVWLPLNGGSNVTQVGEKKSKYSFLSKRIMLTFKIRNFYPLVVLNNEALLM---SPMNEFSNDFVNTPTCLNLSFSSINKNRHIFLQHIVKELLRINLGIHALDLTFELKKLPYFNHSXXXXXXXXXXXXATSKEPIPDPLLPRVVAFIQEFPNFLRTVVQCARKTELALWSYLFESAGNPKDLFESCLMNNELDTAASYLIILQNIEHPLISQKQAILLLDAALNRSNWGLVSNLIRFLKNI----VEEVFKYEHARNEFKMIEKGNYKSTKETYSSFNTKKRYRSGGGIGMATSRQYS 3023
            W  D + IA+ T++  +LI+++     E    +         +N  E   +G  +R  +     I++++   P   +C    RD+ LV +++G    + W G ++ +  F  +SI F  D   SK+ N++       +  + P L G  ++  +G+ A L   +       I GVWA N+++ TC  VN KF  I +G K G+   Y  DE  G+L    R+       PD     G V  +    + +     W  +  +    +   +F+S G ++  ++  +          +++WG EG+ LWL       G    L+ Q   +S    +P   + +  +L+S S ++    +       +  +  ++I     Y++ NWP++YA+ D N   LV++G  G A     +++W++FGNETQE+ + V+GG+ +W + ++G+        K  +  Y   Q++D+  ++   +  + ++  + D+   V  I   I L+++T + E   D    +S E +  I +   +    CIVS  ++ L+ ++             ++L+N SG L+                                TL   +      P+V+A  VE MW         T   +++   K  + +  N  I +                    + N+LW+ CG++G++VW+PL  G       E     +F++KRIML F++ + YP+V+   + L M   S +   +    N     +++   +++N  +F+ H++++LL+ NLG+ AL+L    + LP+F H+LELLLH VLEEEATS EPIPDPLLPR VAFI EFP FL+TV  CARKTELALW  LF+  G+P  LFE CL   +L+ AAS++I+LQN+E   +S  QA  L+  AL    W +   ++RF ++I    ++  F+      +  +  +    S     S+     R+++G   G     ++S
Sbjct:   78 WKPDSTSIAVTTNQCKILIYNLDLRDDEQCYNFTDSADPYFQRNSPELFIKG--SRPTAHLHPTIIINLADIP---TCCVPSRDEFLVCLQNGFTHHVTWTGEIIASLSFRASSIPFSVDQLQSKSENITSKSTYIFDAVYAPLLGGFAIVLSDGQGALLTSNDPNFAPNAILGVWAPNMKDATCCDVNHKFLLILFGCKNGDVCAYNIDELNGSLVQSFRVAPKVTNGPDLTNRLGPVHRITALANGYGFGAIWSPLSGAHALPRLVAVFTSFGAQSFCNLEGVVEEDQNDRYTAIEWGPEGFQLWL-------GTENELMMQPFVRSASCSSPAMEHCDRAVLMSDSQVLISAARDREAEACAPHSVWDHITVTHEYLSSNWPLRYASTDRNYKHLVVAGDQGMAYCSLSNRRWKIFGNETQEKNLLVTGGVFIWNDDVIGVVGVAADTDKSHLSFYPISQRLDSRYASVVDLEHKSVMSVLRDDVCAVFDISAQITLYKLTAHLETGRDAFTKVSTEIVTVIRINEIVPHPTCIVSLQMTQLNLDVRGKLSPAFYSSIDTVLVNISGRLI--------------------------------TLSVNEDGKLHQPMVIASYVEKMWHDRCQVSQSTQSQNQDLPWKNHRRNGSNVSIQSVSTSTTSEPSSPMNQSCSSHLSNALWIACGAKGIKVWMPLVPGKRNLATQE----MTFIAKRIMLPFEL-DIYPIVISAKDCLAMGVESQLQHVARASRNQGQMESITMYGLHRNSEVFVHHLLRQLLKRNLGVFALELAGACRSLPHFTHALELLLHGVLEEEATSSEPIPDPLLPRCVAFIHEFPEFLKTVAHCARKTELALWRTLFDVTGSPNALFEECLQLKQLENAASFVIVLQNLETTEVSMDQAARLVKEALEEKKWTIAKEMVRFARSIGSEDIDAFFRTPPPSAKTSLSRRPTVSSPSADSSTEFVINRFQAGAAGGRLNKVRHS 1024          
BLAST of RIC1 domain-containing protein vs. Ensembl Celegans
Match: R06F6.8 (Guanine nucleotide exchange factor subunit R06F6.8 [Source:UniProtKB/Swiss-Prot;Acc:Q09417])

HSP 1 Score: 374.015 bits (959), Expect = 1.150e-106
Identity = 261/942 (27.71%), Postives = 446/942 (47.35%), Query Frame = 3
Query:  234 WNSDGSLIAIGTDKGFLLIFSVKTVSQEVNVGY---------QNEKEFLEEGFINRQLSLFGEIILLDVISFPYKISCICLYRDDLLVAIEDGTLSRIKWNGSLLYNQEFNLTSISFFSDLEFSKASNLSKNEAICRNIEWLPSLSGVIVLFKNGKSAFLHIPNHKLLSEQITGVWAENLRNVTCSAVNVKFRSIAYGLKIGEAVIYKTDEETGALRLQHRLKILSNEYPDADKVTGAVTYLKWSPDNFCLALCWEYIGFSLWSVQGSLLFSSLGNKAGIDMSLL----------SLDWGCEGYSLWLIEKPDKSGKPAILIFQ-MAKSVLVVNPTKNNHEHXXXXXXXHIIFGPRK----LLSSSETNLEYIPYPENYVTWNWPIKYAAIDLNGSRLVISGKHGFALYFFVSKKWRLFGNETQERTIEVSGGI-VWYNHIVGLACFDNKEGKFEIRLYDSLQKIDNSLSTNHPVNSQILLMNIFDNTLVVLSIDGSIGLFEITLN-EKSHD----ISMEYIQTIPLENYIEFAACIVSFNLSSLHTEIGHNKDVDELIRYQSLLINYSGHLLLFQRDKSFSAPRTSDKSLNSQENSFFKLAFKNTLIAKQKITFTGPLVVAYNVEIMWTPI--IDEEFQSKRLKLDDWNAK---------------------------IYTMENSLWLNCGSQGLRVWLPLNGGSNVTQVGEKKSKYSFLSKRIMLTFKIRNFYPLVVLNNEALLM---SPMNEFSNDFVNTPTCLNLSFSSINKNRHIFLQHIVKELLRINLGIHALDLTFELKKLPYFNHSXXXXXXXXXXXXATSKEPIPDPLLPRVVAFIQEFPNFLRTVVQCARKTELALWSYLFESAGNPKDLFESCLMNNELDTAASYLIILQNIEHPLISQKQAILLLDAALNRSNWGLVSNLIRFLKNIVEE 2873
            W  D + IA+ T++  +LI+++     E    +         +N  E   +G  +R  +     I++++   P   +C    RD+ LV +++G    + W G ++ +  F  +SI F  D   SK+ N++       +  + P L G  ++  +G+ A L   +       I GVWA N+++ TC  VN KF  I +G K G+   Y  DE  G+L    R+       PD     G V  +    + +     W  +  +    +   +F+S G ++  ++  +          +++WG EG+ LWL       G    L+ Q   +S    +P   + +  +L+S S ++    +       +  +  ++I     Y++ NWP++YA+ D N   LV++G  G A     +++W++FGNETQE+ + V+GG+ +W + ++G+        K  +  Y   Q++D+  ++   +  + ++  + D+   V  I   I L+++T + E   D    +S E +  I +   +    CIVS  ++ L+ ++             ++L+N SG L+                                TL   +      P+V+A  VE MW     + +  QS+   L   N +                              + N+LW+ CG++G++VW+PL  G       E     +F++KRIML F++ + YP+V+   + L M   S +   +    N     +++   +++N  +F+ H++++LL+ NLG+ AL+L    + LP+F H+LELLLH VLEEEATS EPIPDPLLPR VAFI EFP FL+TV  CARKTELALW  LF+  G+P  LFE CL   +L+ AAS++I+LQN+E   +S  QA  L+  AL    W +   ++RF ++I  E
Sbjct:   78 WKPDSTSIAVTTNQCKILIYNLDLRDDEQCYNFTDSADPYFQRNSPELFIKG--SRPTAHLHPTIIINLADIP---TCCVPSRDEFLVCLQNGFTHHVTWTGEIIASLSFRASSIPFSVDQLQSKSENITSKSTYIFDAVYAPLLGGFAIVLSDGQGALLTSNDPNFAPNAILGVWAPNMKDATCCDVNHKFLLILFGCKNGDVCAYNIDELNGSLVQSFRVAPKVTNGPDLTNRLGPVHRITALANGYGFGAIWSPLSGAHALPRLVAVFTSFGAQSFCNLEGVVEEDQNDRYTAIEWGPEGFQLWL-------GTENELMMQPFVRSASCSSPAMEHCDRAVLMSDSQVLISAARDREAEACAPHSVWDHITVTHEYLSSNWPLRYASTDRNYKHLVVAGDQGMAYCSLSNRRWKIFGNETQEKNLLVTGGVFIWNDDVIGVVGVAADTDKSHLSFYPISQRLDSRYASVVDLEHKSVMSVLRDDVCAVFDISAQITLYKLTAHLETGRDAFTKVSTEIVTVIRINEIVPHPTCIVSLQMTQLNLDVRGKLSPAFYSSIDTVLVNISGRLI--------------------------------TLSVNEDGKLHQPMVIASYVEKMWHDRCQVSQSTQSQNQDLPWKNHRRNGSNVSIQSVSTSTTSEPSSPMNQSCSSHLSNALWIACGAKGIKVWMPLVPGKRNLATQE----MTFIAKRIMLPFEL-DIYPIVISAKDCLAMGVESQLQHVARASRNQGQMESITMYGLHRNSEVFVHHLLRQLLKRNLGVFALELAGACRSLPHFTHALELLLHGVLEEEATSSEPIPDPLLPRCVAFIHEFPEFLKTVAHCARKTELALWRTLFDVTGSPNALFEECLQLKQLENAASFVIVLQNLETTEVSMDQAARLVKEALEEKKWTIAKEMVRFARSIGSE 970          
BLAST of RIC1 domain-containing protein vs. Ensembl Fly
Match: Rich (gene:FBgn0028500 transcript:FBtr0078512)

HSP 1 Score: 465.307 bits (1196), Expect = 1.330e-138
Identity = 326/1031 (31.62%), Postives = 516/1031 (50.05%), Query Frame = 3
Query:   21 MYYFFNCPKRIS----------RHFVPSNITGIISSKSFALCAIFNSSQIIVFENKNNSIVAYYCRCEESLDIYGNSINLEWNSDGSLIAIGTDKGFLLIFSVK------TVSQEVNVGYQNEKEFLEEGFINRQLSLFGEIILLDVISFPYKISCICLYRDDLLVAIEDGTLSRIKWNGSLLYNQEFNLTSISF--FSDLEF-------SKASNLSK--NEAICRNIEWLPSLSGVIVLFKNGKSAFLHIPNH-KLLSEQITGVWAENLRNVTCSAVNVKFRSIAYGLKIGEAVIYKTDEETGALRLQHRLKILSNEYPDADKVTGAVTYLKWSPDNFCLALCWEYIGFSLWSVQGSLLFSSLGNKAGIDMSLLS--------LDWGCEGYSLWLIEKPDKSGKPAILIFQMAKSVLVVNPTKNNHEH-----------------XXXXXXXHIIFGPRKLLSSSET--------NLEYIPY----------------PENYVTWNWPIKYAAIDLNGSRLVISGKHGFALYFFVSKKWRLFGNETQERTIEVSGGIVWYNHIVGLACFDNKEGKFEIRLYDSLQKIDNSLSTNHPVNSQILLMNIFDNTLVVLSIDGSIGLFEITLNEKSHDISMEYIQTIPLENYIEFAACIVSFNLSSLHTEIGHNKDVDELIRYQSLLINYSGHLLLFQRDKSFSAPRTSDKSLNSQENSFFKLAFKNTLIAKQKITFTGPLVVAYNVEIMWTPIIDEEFQSKRLKLDDWNAKIYTMENSLWLNCGSQGLRVWLPLNGGSNVTQVGEKKSK---YSFLSKRIMLTFKIRNFYPLVVLNNEALLMSPMNE---FSNDFVNTPTCLNLSFSSINKNRHIFLQHIVKELLRINLGIHALDLTFELKKLPYFNHSXXXXXXXXXXXXATSKEPIPDPLLPRVVAFIQEFPNFLRTVVQCARKTELALWSYLFESAGNPKDLFESCLMNNELDTAASYLIILQNIEHPLISQKQAILLLDAALNRSNWGLVSNLIRFLKNI 2864
            MYY    PKR+           RH     +  ++++       I+ ++ +I         +AY+ R E+SL  YG +  + W  D   +A+ T  G LL++ +        + Q+++    + K    E FI   +       L  V       +  C+   +LL+A +   L R++W        +  L ++S     D+ F         A N+     ++   ++E+ P + G   +F + ++AFL I NH +  ++ + G W  ++ + +  +VN KFR +AYG +     +Y  D+ TG L   HRL +  N  PD+    G+V  LKWSPD   LA+ W   G SLWS  G+LL S+L    G+++ L+         L+W  EGY L++++   +  K  +L  Q  KS L +NP      H                  L  + SH  F P   L S E          L+  P+                P NY   NWPI+YAAID +G  L ++G+ G A Y  V+++W+LFGNE+QE+   VSGG++W++  V + C+   +   E+R Y +  K+DN       V + ++ +N F + L+VL+ DG + LF ++ N  ++ + +E    + +++     ACIVS  +++L  E+     +    + +++++N  G +L+ QRD     P                    NTL+A           +A  VE+ W                  + +   M + LWL  G+ G+RVWLP+       + GE+      +SF+SKRIML+F ++  YPLVVL +  +++   NE   ++N+ V+     +L F+ + +   I+L  ++++L++ NLG  A ++      LPYF H+LELLLHEVLEEEATSK+PIPD  LP ++ FI+EFP +L T+VQCARKTE+ALW YLF  AG PKDLF+ CL + +LDTAASYLIILQN+E  ++S++ A +LLD AL +  W L  +LIRFLK I
Sbjct:    1 MYYPVGWPKRVGLALPGESASIRHICCDAVKILVAAVGDDFLGIWYANPLIP--------IAYFRRTEDSLRQYGANQLIVWKPDSRQLALLTASGSLLLYQLDFEANGMGILQQIDPPAASLKRDSAELFIKENIPRLSLRELCSVTLGSVITTVCCISLSELLLATQSCELLRLQWTELEHAENDLELPALSSIKLRDIPFYVQQQPQQSARNVPPLNRDSYVASLEYSPFIGGCAAVFSDRRAAFL-IANHLRFETDHMHGFWVPDVEDASVCSVNHKFRLLAYGQESSAVKVYAIDDATGGLEFSHRLILTENILPDS---LGSVNELKWSPDGCVLAVSWTNGGLSLWSTFGALLMSTLSWDFGLNVDLVCQNPLKIRRLEWSTEGYQLFMLKLHPEKDKSNVLQLQFVKSALSMNPCMTTSPHILLQGDDCLYLNQGNNLELTYAGSHGTF-PSSGLGSDEDISGDGDCLELKQSPHTGSILTESKYWTVLQLPLNYAATNWPIRYAAIDPDGLHLAVAGRTGLAHYSLVTRRWKLFGNESQEKDFVVSGGLLWWHGFVVMGCYSLLDRTDELRCYPADCKLDNQYGHKLQVRAPVISLNSFRHQLIVLTADGIVSLFNMSKN-SAYALDIECAYELDVKSICIHPACIVSLTVTNLKNELKPQGQLGG-DQAETIIVNVCGRILMIQRDAGEQVP--------------------NTLLAT---------CLASCVEVFWL---------------SHSLERCAMRDCLWLYSGAHGMRVWLPILPPGRERREGEQGGAQRLHSFMSKRIMLSFPLK-LYPLVVLFDNVIVLGVENESTLYANEQVSH---FSLPFAVMERKSQIYLHKVLRQLIKRNLGYSAWEMAQSCCSLPYFPHALELLLHEVLEEEATSKQPIPDAQLPSILDFIREFPVYLETIVQCARKTEIALWPYLFSMAGKPKDLFQMCLQSEQLDTAASYLIILQNLEPSVVSKQYATMLLDIALQQRKWELAKDLIRFLKAI 968          
BLAST of RIC1 domain-containing protein vs. Ensembl Fly
Match: Rich (gene:FBgn0028500 transcript:FBtr0334751)

HSP 1 Score: 465.307 bits (1196), Expect = 1.330e-138
Identity = 326/1031 (31.62%), Postives = 516/1031 (50.05%), Query Frame = 3
Query:   21 MYYFFNCPKRIS----------RHFVPSNITGIISSKSFALCAIFNSSQIIVFENKNNSIVAYYCRCEESLDIYGNSINLEWNSDGSLIAIGTDKGFLLIFSVK------TVSQEVNVGYQNEKEFLEEGFINRQLSLFGEIILLDVISFPYKISCICLYRDDLLVAIEDGTLSRIKWNGSLLYNQEFNLTSISF--FSDLEF-------SKASNLSK--NEAICRNIEWLPSLSGVIVLFKNGKSAFLHIPNH-KLLSEQITGVWAENLRNVTCSAVNVKFRSIAYGLKIGEAVIYKTDEETGALRLQHRLKILSNEYPDADKVTGAVTYLKWSPDNFCLALCWEYIGFSLWSVQGSLLFSSLGNKAGIDMSLLS--------LDWGCEGYSLWLIEKPDKSGKPAILIFQMAKSVLVVNPTKNNHEH-----------------XXXXXXXHIIFGPRKLLSSSET--------NLEYIPY----------------PENYVTWNWPIKYAAIDLNGSRLVISGKHGFALYFFVSKKWRLFGNETQERTIEVSGGIVWYNHIVGLACFDNKEGKFEIRLYDSLQKIDNSLSTNHPVNSQILLMNIFDNTLVVLSIDGSIGLFEITLNEKSHDISMEYIQTIPLENYIEFAACIVSFNLSSLHTEIGHNKDVDELIRYQSLLINYSGHLLLFQRDKSFSAPRTSDKSLNSQENSFFKLAFKNTLIAKQKITFTGPLVVAYNVEIMWTPIIDEEFQSKRLKLDDWNAKIYTMENSLWLNCGSQGLRVWLPLNGGSNVTQVGEKKSK---YSFLSKRIMLTFKIRNFYPLVVLNNEALLMSPMNE---FSNDFVNTPTCLNLSFSSINKNRHIFLQHIVKELLRINLGIHALDLTFELKKLPYFNHSXXXXXXXXXXXXATSKEPIPDPLLPRVVAFIQEFPNFLRTVVQCARKTELALWSYLFESAGNPKDLFESCLMNNELDTAASYLIILQNIEHPLISQKQAILLLDAALNRSNWGLVSNLIRFLKNI 2864
            MYY    PKR+           RH     +  ++++       I+ ++ +I         +AY+ R E+SL  YG +  + W  D   +A+ T  G LL++ +        + Q+++    + K    E FI   +       L  V       +  C+   +LL+A +   L R++W        +  L ++S     D+ F         A N+     ++   ++E+ P + G   +F + ++AFL I NH +  ++ + G W  ++ + +  +VN KFR +AYG +     +Y  D+ TG L   HRL +  N  PD+    G+V  LKWSPD   LA+ W   G SLWS  G+LL S+L    G+++ L+         L+W  EGY L++++   +  K  +L  Q  KS L +NP      H                  L  + SH  F P   L S E          L+  P+                P NY   NWPI+YAAID +G  L ++G+ G A Y  V+++W+LFGNE+QE+   VSGG++W++  V + C+   +   E+R Y +  K+DN       V + ++ +N F + L+VL+ DG + LF ++ N  ++ + +E    + +++     ACIVS  +++L  E+     +    + +++++N  G +L+ QRD     P                    NTL+A           +A  VE+ W                  + +   M + LWL  G+ G+RVWLP+       + GE+      +SF+SKRIML+F ++  YPLVVL +  +++   NE   ++N+ V+     +L F+ + +   I+L  ++++L++ NLG  A ++      LPYF H+LELLLHEVLEEEATSK+PIPD  LP ++ FI+EFP +L T+VQCARKTE+ALW YLF  AG PKDLF+ CL + +LDTAASYLIILQN+E  ++S++ A +LLD AL +  W L  +LIRFLK I
Sbjct:    1 MYYPVGWPKRVGLALPGESASIRHICCDAVKILVAAVGDDFLGIWYANPLIP--------IAYFRRTEDSLRQYGANQLIVWKPDSRQLALLTASGSLLLYQLDFEANGMGILQQIDPPAASLKRDSAELFIKENIPRLSLRELCSVTLGSVITTVCCISLSELLLATQSCELLRLQWTELEHAENDLELPALSSIKLRDIPFYVQQQPQQSARNVPPLNRDSYVASLEYSPFIGGCAAVFSDRRAAFL-IANHLRFETDHMHGFWVPDVEDASVCSVNHKFRLLAYGQESSAVKVYAIDDATGGLEFSHRLILTENILPDS---LGSVNELKWSPDGCVLAVSWTNGGLSLWSTFGALLMSTLSWDFGLNVDLVCQNPLKIRRLEWSTEGYQLFMLKLHPEKDKSNVLQLQFVKSALSMNPCMTTSPHILLQGDDCLYLNQGNNLELTYAGSHGTF-PSSGLGSDEDISGDGDCLELKQSPHTGSILTESKYWTVLQLPLNYAATNWPIRYAAIDPDGLHLAVAGRTGLAHYSLVTRRWKLFGNESQEKDFVVSGGLLWWHGFVVMGCYSLLDRTDELRCYPADCKLDNQYGHKLQVRAPVISLNSFRHQLIVLTADGIVSLFNMSKN-SAYALDIECAYELDVKSICIHPACIVSLTVTNLKNELKPQGQLGG-DQAETIIVNVCGRILMIQRDAGEQVP--------------------NTLLAT---------CLASCVEVFWL---------------SHSLERCAMRDCLWLYSGAHGMRVWLPILPPGRERREGEQGGAQRLHSFMSKRIMLSFPLK-LYPLVVLFDNVIVLGVENESTLYANEQVSH---FSLPFAVMERKSQIYLHKVLRQLIKRNLGYSAWEMAQSCCSLPYFPHALELLLHEVLEEEATSKQPIPDAQLPSILDFIREFPVYLETIVQCARKTEIALWPYLFSMAGKPKDLFQMCLQSEQLDTAASYLIILQNLEPSVVSKQYATMLLDIALQQRKWELAKDLIRFLKAI 968          
BLAST of RIC1 domain-containing protein vs. Ensembl Zebrafish
Match: RIC1 (RIC1 homolog, RAB6A GEF complex partner 1 [Source:HGNC Symbol;Acc:HGNC:17686])

HSP 1 Score: 477.633 bits (1228), Expect = 7.855e-144
Identity = 324/982 (32.99%), Postives = 501/982 (51.02%), Query Frame = 3
Query:   93 SSKSFALCAIFNSSQIIVFENKNNSIVAYYCRCEESLDIYGNSINLEWNSDGSLIAIGTDKGFLLIFSVKTVSQEVNVGYQNEKEFLEE-------------GFINRQLSLFGEIILLDVISFPYKISCICLYRDDLLVAIEDGTLSRIKWNGSLLYNQEFNLTSISFFSDLEFSKASN-LSKNEAICRNIEWLPSLSGVIVLFKNGKSAFLHIPNHKLLSEQITGVWAENLRNVTCSAVNVKFRSIAYGLKIGEAVIYKTDEETGALRLQHRLKILSNEYPDADKVTGAVTYLKWSPDNFCLALCWEYIGFSLWSVQGSLLFSSLGNKAGI--------DMSLLSLDWGCEGYSLWLI---------EKPDKSGKPAILIFQMAKS---------------VLVVNPTKNNHE-HXXXXXXXHIIFGPRKLLSSSETNLEYIPYPENYVTWNWPIKYA-AIDLNGSRLVISGKHGFALYFFVSKKWRLFGNETQERTIEVSGGIVWYNHIVGLACFDNKEGKFEIRLYDSLQKIDNSLSTNHPVNSQILLMNIFDNTLVVLSIDGSIGLFEITLNEKSHD-----ISMEYIQTIPLENYIEFAACIVSFNLSSLHTEIGHN-KDVDELIRYQSLLINYSGHLLLFQRDKSFSAPRTSDKSLNSQENSFFKLAFKNTLIAKQKITFTGPLVVAYNVEIMWTPIIDEEFQSKRLKLDDWNAKIYTMENSLWLNCGSQGLRVWLPLNGGSNVTQVGEKKSKYSFLSKRIMLTFKIRNFYPLVVLNNEALLMSPMNE--FSNDFVNTPTCLN--LSFSSINKNRHIFLQHIVKELLRINLGIHALDLTFELKKLPYFNHSXXXXXXXXXXXXATSKEPIPDPLLPRVVAFIQEFPNFLRTVVQCARKTELALWSYLFESAGNPKDLFESCLMNNELDTAASYLIILQNIEHPLISQKQAILLLDAALNRSNWGLVSNLIRFLKNI 2864
            S++ F L A+ + +QI ++ ++ + ++  Y    ++   +G    +EW  D S+IA+    G++L+F +        +G  ++K   E              G+   Q +    + +   +     ISC+    +DLLVA  DG L  + W+      +  NL +I F  DL+ S+    L  +    R++E+  +L G  V+F +G+  F+    ++L ++Q+ GVWA ++ + TC AVN K+R +A+G   G  ++Y  D  TG ++L H+L++    YPD    TG V  ++WSPD     + WE  G SLWSV G+ L  +LG              + + S+ WG EGY LW+I         EK +K  +  IL FQ  KS               V   +PT+          S++ +  G   LL     + + +     Y+  NWPI+   A D     L++           ++  + +      E+ + V+GG+ W+N  V +AC++  + + E+RLY     +DN+ ++   +++  LL+N+F N +++   D SI L+ I   E+ HD      S+E +Q + +  YI     +VS  L+S+ TE G   K   +    +S+L+N +G L++ QRD+S    R  D   N                  + + F  P+V+A  VE +WT        S R      N K   +  +LWL+CG  G++VWLPL          + +  +SFLS+RIML F I N YPL VL  +AL++   NE    +   ++   L     + ++ +   I+L HI+++LL  NLG  AL L      LPYF H LEL++H VLEEEATS+EPIPDPLLP V  F+ EFP FL+T+V CARKTE ALW+YLF + GNPKDLFE CLM  +LDTAASYLIILQN+E P +S++ A LL + AL +  W L  ++IRFLK I
Sbjct:   27 SAQRFYL-AVLSETQISIWFSRPSVLIVSYIESGKAAAQFGFYQQVEWKPDDSMIAVAAANGYVLLFDI--------IGGLDDKYLYEPVYPKGSARVKVTPGYKEEQCAPALTLEMKKPVDLEAPISCLQSLAEDLLVATADGFLHMLHWDSVSNGRRAVNLCTIPFSLDLQSSRGGPCLDLDGVYIRDLEYCATLDGFAVVFDDGRIGFITPTANRLATDQLQGVWAADVTDGTCVAVNNKYRLMAFGCTSGSVLVYMIDSSTGCMQLSHKLELTPKHYPDIWNKTGPVKMIRWSPDCSVAMVTWECGGLSLWSVFGAHLICTLGEDFAYRSDGTKKDPLKISSMSWGVEGYHLWVIRSSDSTVTEEKQEKLQQNTILQFQFIKSSNQEQVLLQGEDRLYVTCGDPTQTQTPGQCRSSSTAPLSQGLSTLLG--HKHWQVVQIHSTYLETNWPIRVRNAHDRRRVTLIM---------LMLTDHYAVC-----EQNMTVTGGLAWWNDFVVVACYNFIDRQEELRLYVRSANLDNAFASITKLHADTLLLNVFRNMVILFRADCSICLYSI---ERRHDGPSPSASVELLQEVSMSRYIPHPGLVVSVTLTSVRTESGITLKAPQQACSAESILLNLAGQLIMLQRDRSGPQVREKDAPANH----------------SKLLPFCPPVVLAQCVESVWT--------SSRS-----NRKKRHLMEALWLSCGEAGMKVWLPLFPR-------DHRKPHSFLSRRIMLPFHI-NIYPLTVLFEDALILGASNETVLFDGLSSSAEPLEALFPYCTVERTSQIYLHHILRQLLVRNLGEQALMLAQSCASLPYFPHVLELMVHVVLEEEATSREPIPDPLLPTVAKFVTEFPLFLQTIVHCARKTEYALWNYLFAAVGNPKDLFEECLMAQDLDTAASYLIILQNMEVPAVSRQHATLLFNTALEQGKWDLCRHMIRFLKAI 943          
BLAST of RIC1 domain-containing protein vs. Ensembl Xenopus
Match: nsun3 (NOP2/Sun RNA methyltransferase family member 3 [Source:Xenbase;Acc:XB-GENE-980505])

HSP 1 Score: 545.428 bits (1404), Expect = 1.787e-167
Identity = 367/1079 (34.01%), Postives = 563/1079 (52.18%), Query Frame = 3
Query:  117 AIFNSSQIIVFENKNNSIVAYYCRCEESLDIYGNSINLEWNSDGSLIAIGTDKGFLLIFSVKTVSQEVNVGYQNEKEF--------LEEGFINRQLSLFGEIILLDVISFPYKISCICLYRDDLLVAIEDGTLSRIKWNGSLLYNQEFNLTSISFFSDLEFSKASN-LSKNEAICRNIEWLPSLSGVIVLFKNGKSAFLHIPNHKLLSEQITGVWAENLRNVTCSAVNVKFRSIAYGLKIGEAVIYKTDEETGALRLQHRLKILSNEYPDADKVTGAVTYLKWSPDNFCLALCWEYIGFSLWSVQGSLLFSSLGNKAGID--------MSLLSLDWGCEGYSLWLI----------EKPDKS--GKPAILIFQMAKSVLVVNPTKNNHEHXXXXXXXHIIFG---------PRKLLSSSETN--LEYIPYP------------------------ENYVTWNWPIKYAAIDLNGSRLVISGKHGFALYFFVSKKWRLFGNETQERTIEVSGGIVWYNHIVGLACFDNKEGKFEIRLYDSLQKIDNSLSTNHPVNSQILLMNIFDNTLVVLSIDGSIGLFEITLNEKSHD--ISMEYIQTIPLENYIEFAACIVSFNLSSLHTEIGHN-KDVDELIRYQSLLINYSGHLLLFQRDKSFSAPRTSDKSLNSQENSFFKLAFKNTLIAKQKITFTGPLVVAYNVEIMWTPIIDEEFQSKRLKLDDWNAKIYTMENSLWLNCGSQGLRVWLPLNGGSNVTQVGEKKSKYSFLSKRIMLTFKIRNFYPLVVLNNEALLMSPMNE-FSNDFVNTPTC------LNLSFSSINKNRHIFLQHIVKELLRINLGIHALDLTFELKKLPYFNHSXXXXXXXXXXXXATSKEPIPDPLLPRVVAFIQEFPNFLRTVVQCARKTELALWSYLFESAGNPKDLFESCLMNNELDTAASYLIILQNIEHPLISQKQAILLLDAALNRSNWGLVSNLIRFLKNIVEEVFKYEHARNEFKMIEKGNYKSTKETYSSFNTK-KRYRSGGGIGMATSRQ-YSTGK--IKDIEILKSSKSAQNGNIDENCYDDLVFD 3119
            ++ + +Q+ ++ ++ + ++A Y    ++   +GN    EW  D S+I I T  G++L F +  V ++    Y  E  +        L   +   Q +    +    V+     I+ I    +DLLVA EDG L  I W G     +  NLT+I F  D + S+A + L   +   R++E+  +L G  V+F +G+  F+   +++L ++QI GVWA ++ + TC AVN K+R +A+G   G  +++  D  TGAL+L H+L++   +YPD    TGAV  ++WSPD   + + WE  G SLWSV G+ L  +LG              + + S+ WG EGY LW I          E  DKS   +  IL FQ  KS L VNP  +N E +LL     +             R   S SE     +  P+P                          Y+  NWPI+Y AID  G  + + GK GFA Y  ++KKW+LFGN TQE+ + VSGG+ W+   + LACF+  E + E+R+Y     +DN+ +    V  + LL++IF + +++   D SI L+ I   ++  +  + ++ +Q + +  YI   + +VS  L+S+ TE G + K   +    +S+L+N +G L++ QRD+S   P+  +K   + ++                + F  P+V+A +VE +W+       + KR  L+           +LWL+CG  G++VWLPL          + +  +SFLSKRIML F I N YPL VL  +AL++  +NE  + D +N  +       ++  F  + +   I+L HI+++LL  NLG  AL L      LPYF H LEL+LHEVLEEEATS+EPIPDPLLP V  FI EFP FL+TVV CARKTE ALW+YLF + GNPKDLFE CLM  +L+TAASYLIILQN+E   +S++ A LL + AL +  W L  ++IRFLK I              +M       +T+E  S+   +  R+RS   I ++ S + + +GK  ++    + S  + +  + D +C +++  D
Sbjct:   34 SVLSQTQLSIWYSRPSVLIASYKESAKATAQFGNYKQAEWRPDSSMIVIATANGYILFFDIIPVGED---KYLYEPVYPKGSPHIKLNPHYKEEQCAPALNLETKKVMDLQASITSIQSMMEDLLVATEDGLLHIIHWEGMTNGRKAINLTTIPFSIDFQPSRAGSFLDFGDVHIRDMEYCATLDGFAVVFNDGRVGFITPGSNRLTADQIHGVWAPDVVDGTCVAVNNKYRLMAFGCVGGSVLVFTIDNTTGALQLSHKLELTPKQYPDMWNKTGAVKLIRWSPDCSVVMVTWECGGLSLWSVFGAHLICTLGGDFDYRADGTKKEALRICSMSWGTEGYHLWAITADSSQNTGYEMSDKSVPQQSGILQFQFIKSALTVNPCMSNQEQVLLQGEDRLYLNCGDATQTQNARNGSSQSEHKPLRDRSPFPGSSGNSQGLSTLLGHRHWHVVQIQSTYLQSNWPIRYTAIDKVGQNVAVVGKFGFAHYSLLTKKWKLFGNITQEQNMVVSGGLSWWKEFIVLACFNLSEQQEELRVYLRTSNLDNAFAHVIKVQLETLLLSIFRDMVIIFRADCSICLYSIERKKEGPNPSVCLQVLQEVSMSRYIPHPSLVVSVTLTSVRTETGISLKMPQQACDAESILLNLAGQLIMLQRDRS--GPQIREKDAKTHQHKL--------------LPFCAPVVLAQSVENVWSTC--RANKQKRHLLE-----------ALWLSCGGAGMKVWLPLFPR-------DHRKPHSFLSKRIMLPFHI-NIYPLAVLFEDALVLGAINETVAYDCLNNLSTSSEHLEVHFPFCIVERTSQIYLHHILRQLLVRNLGEQALLLAQSCAALPYFPHVLELMLHEVLEEEATSREPIPDPLLPTVAKFITEFPLFLQTVVHCARKTEYALWNYLFAAVGNPKDLFEECLMAQDLETAASYLIILQNMEAAAVSRQHATLLFNTALEQGKWDLCRHMIRFLKAI-----------GSGEMETPPATPTTQEPSSTGGFEFFRHRS---ISLSQSAENFPSGKFNLQKTHSMPSGAAGKRWSKDSDCAENMYID 1058          
BLAST of RIC1 domain-containing protein vs. Ensembl Xenopus
Match: nsun3 (NOP2/Sun RNA methyltransferase family member 3 [Source:Xenbase;Acc:XB-GENE-980505])

HSP 1 Score: 540.421 bits (1391), Expect = 5.619e-166
Identity = 364/1071 (33.99%), Postives = 556/1071 (51.91%), Query Frame = 3
Query:  117 AIFNSSQIIVFENKNNSIVAYYCRCEESLDIYGNSINLEWNSDGSLIAIGTDKGFLLIFSVKTVSQEVNVGYQNEKEFLEEGFINRQLSLFGEIILLDVISFPYKISCICLYRDDLLVAIEDGTLSRIKWNGSLLYNQEFNLTSISFFSDLEFSKASN-LSKNEAICRNIEWLPSLSGVIVLFKNGKSAFLHIPNHKLLSEQITGVWAENLRNVTCSAVNVKFRSIAYGLKIGEAVIYKTDEETGALRLQHRLKILSNEYPDADKVTGAVTYLKWSPDNFCLALCWEYIGFSLWSVQGSLLFSSLGNKAGID--------MSLLSLDWGCEGYSLWLI----------EKPDKS--GKPAILIFQMAKSVLVVNPTKNNHEHXXXXXXXHIIFG---------PRKLLSSSETN--LEYIPYP------------------------ENYVTWNWPIKYAAIDLNGSRLVISGKHGFALYFFVSKKWRLFGNETQERTIEVSGGIVWYNHIVGLACFDNKEGKFEIRLYDSLQKIDNSLSTNHPVNSQILLMNIFDNTLVVLSIDGSIGLFEITLNEKSHD--ISMEYIQTIPLENYIEFAACIVSFNLSSLHTEIGHN-KDVDELIRYQSLLINYSGHLLLFQRDKSFSAPRTSDKSLNSQENSFFKLAFKNTLIAKQKITFTGPLVVAYNVEIMWTPIIDEEFQSKRLKLDDWNAKIYTMENSLWLNCGSQGLRVWLPLNGGSNVTQVGEKKSKYSFLSKRIMLTFKIRNFYPLVVLNNEALLMSPMNE-FSNDFVNTPTC------LNLSFSSINKNRHIFLQHIVKELLRINLGIHALDLTFELKKLPYFNHSXXXXXXXXXXXXATSKEPIPDPLLPRVVAFIQEFPNFLRTVVQCARKTELALWSYLFESAGNPKDLFESCLMNNELDTAASYLIILQNIEHPLISQKQAILLLDAALNRSNWGLVSNLIRFLKNIVEEVFKYEHARNEFKMIEKGNYKSTKETYSSFNTK-KRYRSGGGIGMATSRQ-YSTGK--IKDIEILKSSKSAQNGNIDENCYDDLVFD 3119
            ++ + +Q+ ++ ++ + ++A Y    ++   +GN    EW  D S+I I T  G++L F +  V ++        K   E  + N Q  +                       +DLLVA EDG L  I W G     +  NLT+I F  D + S+A + L   +   R++E+  +L G  V+F +G+  F+   +++L ++QI GVWA ++ + TC AVN K+R +A+G   G  +++  D  TGAL+L H+L++   +YPD    TGAV  ++WSPD   + + WE  G SLWSV G+ L  +LG              + + S+ WG EGY LW I          E  DKS   +  IL FQ  KS L VNP  +N E +LL     +             R   S SE     +  P+P                          Y+  NWPI+Y AID  G  + + GK GFA Y  ++KKW+LFGN TQE+ + VSGG+ W+   + LACF+  E + E+R+Y     +DN+ +    V  + LL++IF + +++   D SI L+ I   ++  +  + ++ +Q + +  YI   + +VS  L+S+ TE G + K   +    +S+L+N +G L++ QRD+S   P+  +K   + ++                + F  P+V+A +VE +W+       + KR  L+           +LWL+CG  G++VWLPL          + +  +SFLSKRIML F I N YPL VL  +AL++  +NE  + D +N  +       ++  F  + +   I+L HI+++LL  NLG  AL L      LPYF H LEL+LHEVLEEEATS+EPIPDPLLP V  FI EFP FL+TVV CARKTE ALW+YLF + GNPKDLFE CLM  +L+TAASYLIILQN+E   +S++ A LL + AL +  W L  ++IRFLK I              +M       +T+E  S+   +  R+RS   I ++ S + + +GK  ++    + S  + +  + D +C +++  D
Sbjct:   34 SVLSQTQLSIWYSRPSVLIASYKESAKATAQFGNYKQAEWRPDSSMIVIATANGYILFFDIIPVGED--------KYLYEPVYPNIQSMM-----------------------EDLLVATEDGLLHIIHWEGMTNGRKAINLTTIPFSIDFQPSRAGSFLDFGDVHIRDMEYCATLDGFAVVFNDGRVGFITPGSNRLTADQIHGVWAPDVVDGTCVAVNNKYRLMAFGCVGGSVLVFTIDNTTGALQLSHKLELTPKQYPDMWNKTGAVKLIRWSPDCSVVMVTWECGGLSLWSVFGAHLICTLGGDFDYRADGTKKEALRICSMSWGTEGYHLWAITADSSQNTGYEMSDKSVPQQSGILQFQFIKSALTVNPCMSNQEQVLLQGEDRLYLNCGDATQTQNARNGSSQSEHKPLRDRSPFPGSSGNSQGLSTLLGHRHWHVVQIQSTYLQSNWPIRYTAIDKVGQNVAVVGKFGFAHYSLLTKKWKLFGNITQEQNMVVSGGLSWWKEFIVLACFNLSEQQEELRVYLRTSNLDNAFAHVIKVQLETLLLSIFRDMVIIFRADCSICLYSIERKKEGPNPSVCLQVLQEVSMSRYIPHPSLVVSVTLTSVRTETGISLKMPQQACDAESILLNLAGQLIMLQRDRS--GPQIREKDAKTHQHKL--------------LPFCAPVVLAQSVENVWSTC--RANKQKRHLLE-----------ALWLSCGGAGMKVWLPLFPR-------DHRKPHSFLSKRIMLPFHI-NIYPLAVLFEDALVLGAINETVAYDCLNNLSTSSEHLEVHFPFCIVERTSQIYLHHILRQLLVRNLGEQALLLAQSCAALPYFPHVLELMLHEVLEEEATSREPIPDPLLPTVAKFITEFPLFLQTVVHCARKTEYALWNYLFAAVGNPKDLFEECLMAQDLETAASYLIILQNMEAAAVSRQHATLLFNTALEQGKWDLCRHMIRFLKAI-----------GSGEMETPPATPTTQEPSSTGGFEFFRHRS---ISLSQSAENFPSGKFNLQKTHSMPSGAAGKRWSKDSDCAENMYID 1022          
BLAST of RIC1 domain-containing protein vs. Ensembl Xenopus
Match: nsun3 (NOP2/Sun RNA methyltransferase family member 3 [Source:Xenbase;Acc:XB-GENE-980505])

HSP 1 Score: 540.036 bits (1390), Expect = 1.617e-165
Identity = 367/1079 (34.01%), Postives = 563/1079 (52.18%), Query Frame = 3
Query:  117 AIFNSSQIIVFENKNNSIVAYYCRCEESLDIYGNSINLEWNSDGSLIAIGTDKGFLLIFSVKTVSQEVNVGYQNEKEF--------LEEGFINRQLSLFGEIILLDVISFPYKISCICLYRDDLLVAIEDGTLSRIKWNGSLLYNQEFNLTSISFFSDLEFSKASN-LSKNEAICRNIEWLPSLSGVIVLFKNGKSAFLHIPNHKLLSEQITGVWAENLRNVTCSAVNVKFRSIAYGLKIGEAVIYKTDEETGALRLQHRLKILSNEYPDADKVTGAVTYLKWSPDNFCLALCWEYIGFSLWSVQGSLLFSSLGNKAGID--------MSLLSLDWGCEGYSLWLI----------EKPDKS--GKPAILIFQMAKSVLVVNPTKNNHEHXXXXXXXHIIFG---------PRKLLSSSETN--LEYIPYP------------------------ENYVTWNWPIKYAAIDLNGSRLVISGKHGFALYFFVSKKWRLFGNETQERTIEVSGGIVWYNHIVGLACFDNKEGKFEIRLYDSLQKIDNSLSTNHPVNSQILLMNIFDNTLVVLSIDGSIGLFEITLNEKSHD--ISMEYIQTIPLENYIEFAACIVSFNLSSLHTEIGHN-KDVDELIRYQSLLINYSGHLLLFQRDKSFSAPRTSDKSLNSQENSFFKLAFKNTLIAKQKITFTGPLVVAYNVEIMWTPIIDEEFQSKRLKLDDWNAKIYTMENSLWLNCGSQGLRVWLPLNGGSNVTQVGEKKSKYSFLSKRIMLTFKIRNFYPLVVLNNEALLMSPMNE-FSNDFVNTPTC------LNLSFSSINKNRHIFLQHIVKELLRINLGIHALDLTFELKKLPYFNHSXXXXXXXXXXXXATSKEPIPDPLLPRVVAFIQEFPNFLRTVVQCARKTELALWSYLFESAGNPKDLFESCLMNNELDTAASYLIILQNIEHPLISQKQAILLLDAALNRSNWGLVSNLIRFLKNIVEEVFKYEHARNEFKMIEKGNYKSTKETYSSFNTK-KRYRSGGGIGMATSRQ-YSTGK--IKDIEILKSSKSAQNGNIDENCYDDLVFD 3119
            ++ + +Q+ ++ ++ + ++A Y    ++   +GN    EW  D S+I I T  G++L F +  V ++    Y  E  +        L   +   Q +    +    V+     I+ I    +DLLVA EDG L  I W G     +  NLT+I F  D + S+A + L   +   R++E+  +L G  V+F +G+  F+   +++L ++QI GVWA ++ + TC AVN K+R +A+G   G  +++  D  TGAL+L H+L++   +YPD    TGAV  ++WSPD   + + WE  G SLWSV G+ L  +LG              + + S+ WG EGY LW I          E  DKS   +  IL FQ  KS L VNP  +N E +LL     +             R   S SE     +  P+P                          Y+  NWPI+Y AID  G  + + GK GFA Y  ++KKW+LFGN TQE+ + VSGG+ W+   + LACF+  E + E+R+Y     +DN+ +    V  + LL++IF + +++   D SI L+ I   ++  +  + ++ +Q + +  YI   + +VS  L+S+ TE G + K   +    +S+L+N +G L++ QRD+S   P+  +K   + ++                + F  P+V+A +VE +W+       + KR  L+           +LWL+CG  G++VWLPL          + +  +SFLSKRIML F I N YPL VL  +AL++  +NE  + D +N  +       ++  F  + +   I+L HI+++LL  NLG  AL L      LPYF H LEL+LHEVLEEEATS+EPIPDPLLP V  FI EFP FL+TVV CARKTE ALW+YLF + GNPKDLFE CLM  +L+TAASYLIILQN+E   +S++ A LL + AL +  W L  ++IRFLK I              +M       +T+E  S+   +  R+RS   I ++ S + + +GK  ++    + S  + +  + D +C +++  D
Sbjct:   34 SVLSQTQLSIWYSRPSVLIASYKESAKATAQFGNYKQAEWRPDSSMIVI-TANGYILFFDIIPVGED---KYLYEPVYPKGSPHIKLNPHYKEEQCAPALNLETKKVMDLQASITSIQSMMEDLLVATEDGLLHIIHWEGMTNGRKAINLTTIPFSIDFQPSRAGSFLDFGDVHIRDMEYCATLDGFAVVFNDGRVGFITPGSNRLTADQIHGVWAPDVVDGTCVAVNNKYRLMAFGCVGGSVLVFTIDNTTGALQLSHKLELTPKQYPDMWNKTGAVKLIRWSPDCSVVMVTWECGGLSLWSVFGAHLICTLGGDFDYRADGTKKEALRICSMSWGTEGYHLWAITADSSQNTGYEMSDKSVPQQSGILQFQFIKSALTVNPCMSNQEQVLLQGEDRLYLNCGDATQTQNARNGSSQSEHKPLRDRSPFPGSSGNSQGLSTLLGHRHWHVVQIQSTYLQSNWPIRYTAIDKVGQNVAVVGKFGFAHYSLLTKKWKLFGNITQEQNMVVSGGLSWWKEFIVLACFNLSEQQEELRVYLRTSNLDNAFAHVIKVQLETLLLSIFRDMVIIFRADCSICLYSIERKKEGPNPSVCLQVLQEVSMSRYIPHPSLVVSVTLTSVRTETGISLKMPQQACDAESILLNLAGQLIMLQRDRS--GPQIREKDAKTHQHKL--------------LPFCAPVVLAQSVENVWSTC--RANKQKRHLLE-----------ALWLSCGGAGMKVWLPLFPR-------DHRKPHSFLSKRIMLPFHI-NIYPLAVLFEDALVLGAINETVAYDCLNNLSTSSEHLEVHFPFCIVERTSQIYLHHILRQLLVRNLGEQALLLAQSCAALPYFPHVLELMLHEVLEEEATSREPIPDPLLPTVAKFITEFPLFLQTVVHCARKTEYALWNYLFAAVGNPKDLFEECLMAQDLETAASYLIILQNMEAAAVSRQHATLLFNTALEQGKWDLCRHMIRFLKAI-----------GSGEMETPPATPTTQEPSSTGGFEFFRHRS---ISLSQSAENFPSGKFNLQKTHSMPSGAAGKRWSKDSDCAENMYID 1057          
BLAST of RIC1 domain-containing protein vs. Ensembl Xenopus
Match: nsun3 (NOP2/Sun RNA methyltransferase family member 3 [Source:Xenbase;Acc:XB-GENE-980505])

HSP 1 Score: 534.643 bits (1376), Expect = 6.789e-164
Identity = 349/982 (35.54%), Postives = 519/982 (52.85%), Query Frame = 3
Query:  117 AIFNSSQIIVFENKNNSIVAYYCRCEESLDIYGNSINLEWNSDGSLIAIGTDKGFLLIFSVKTVSQEVNVGYQNEKEFLEEGFINRQLSLFGEIILLDVISFPYKISCICLYRDDLLVAIEDGTLSRIKWNGSLLYNQEFNLTSISFFSDLEFSKASN-LSKNEAICRNIEWLPSLSGVIVLFKNGKSAFLHIPNHKLLSEQITGVWAENLRNVTCSAVNVKFRSIAYGLKIGEAVIYKTDEETGALRLQHRLKILSNEYPDADKVTGAVTYLKWSPDNFCLALCWEYIGFSLWSVQGSLLFSSLGNKAGID--------MSLLSLDWGCEGYSLWLI----------EKPDKS--GKPAILIFQMAKSVLVVNPTKNNHEHXXXXXXXHIIFG---------PRKLLSSSETN--LEYIPYP------------------------ENYVTWNWPIKYAAIDLNGSRLVISGKHGFALYFFVSKKWRLFGNETQERTIEVSGGIVWYNHIVGLACFDNKEGKFEIRLYDSLQKIDNSLSTNHPVNSQILLMNIFDNTLVVLSIDGSIGLFEITLNEKSHD--ISMEYIQTIPLENYIEFAACIVSFNLSSLHTEIGHN-KDVDELIRYQSLLINYSGHLLLFQRDKSFSAPRTSDKSLNSQENSFFKLAFKNTLIAKQKITFTGPLVVAYNVEIMWTPIIDEEFQSKRLKLDDWNAKIYTMENSLWLNCGSQGLRVWLPLNGGSNVTQVGEKKSKYSFLSKRIMLTFKIRNFYPLVVLNNEALLMSPMNE-FSNDFVNTPTC------LNLSFSSINKNRHIFLQHIVKELLRINLGIHALDLTFELKKLPYFNHSXXXXXXXXXXXXATSKEPIPDPLLPRVVAFIQEFPNFLRTVVQCARKTELALWSYLFESAGNPKDLFESCLMNNELDTAASYLIILQNIEHPLISQKQAILLLDAALNRSNWGLVSNLIRFLKNI 2864
            ++ + +Q+ ++ ++ + ++A Y    ++   +GN    EW  D S+I I     F  +F V  +       Y +    L   +   Q +    +    V+     I+ I    +DLLVA EDG L  I W G     +  NLT+I F  D + S+A + L   +   R++E+  +L G  V+F +G+  F+   +++L   QI GVWA ++ + TC AVN K+R +A+G   G  +++  D  TGAL+L H+L++   +YPD    TGAV  ++WSPD   + + WE  G SLWSV G+ L  +LG              + + S+ WG EGY LW I          E  DKS   +  IL FQ  KS L VNP  +N E +LL     +             R   S SE     +  P+P                          Y+  NWPI+Y AID  G  + + GK GFA Y  ++KKW+LFGN TQE+ + VSGG+ W+   + LACF+  E + E+R+Y     +DN+ +    V  + LL++IF + +++   D SI L+ I   ++  +  + ++ +Q + +  YI   + +VS  L+S+ TE G + K   +    +S+L+N +G L++ QRD+S   P+  +K   + ++                + F  P+V+A +VE +W+       + KR  L+           +LWL+CG  G++VWLPL          + +  +SFLSKRIML F I N YPL VL  +AL++  +NE  + D +N  +       ++  F  + +   I+L HI+++LL  NLG  AL L      LPYF H LEL+LHEVLEEEATS+EPIPDPLLP V  FI EFP FL+TVV CARKTE ALW+YLF + GNPKDLFE CLM  +L+TAASYLIILQN+E   +S++ A LL + AL +  W L  ++IRFLK I
Sbjct:   34 SVLSQTQLSIWYSRPSVLIASYKESAKATAQFGNYKQAEWRPDSSMIVIAVSTCFYSVFGVTYM-------YGSPHIKLNPHYKEEQCAPALNLETKKVMDLQASITSIQSMMEDLLVATEDGLLHIIHWEGMTNGRKAINLTTIPFSIDFQPSRAGSFLDFGDVHIRDMEYCATLDGFAVVFNDGRVGFITPGSNRL--TQIHGVWAPDVVDGTCVAVNNKYRLMAFGCVGGSVLVFTIDNTTGALQLSHKLELTPKQYPDMWNKTGAVKLIRWSPDCSVVMVTWECGGLSLWSVFGAHLICTLGGDFDYRADGTKKEALRICSMSWGTEGYHLWAITADSSQNTGYEMSDKSVPQQSGILQFQFIKSALTVNPCMSNQEQVLLQGEDRLYLNCGDATQTQNARNGSSQSEHKPLRDRSPFPGSSGNSQGLSTLLGHRHWHVVQIQSTYLQSNWPIRYTAIDKVGQNVAVVGKFGFAHYSLLTKKWKLFGNITQEQNMVVSGGLSWWKEFIVLACFNLSEQQEELRVYLRTSNLDNAFAHVIKVQLETLLLSIFRDMVIIFRADCSICLYSIERKKEGPNPSVCLQVLQEVSMSRYIPHPSLVVSVTLTSVRTETGISLKMPQQACDAESILLNLAGQLIMLQRDRS--GPQIREKDAKTHQHKL--------------LPFCAPVVLAQSVENVWSTC--RANKQKRHLLE-----------ALWLSCGGAGMKVWLPLFPR-------DHRKPHSFLSKRIMLPFHI-NIYPLAVLFEDALVLGAINETVAYDCLNNLSTSSEHLEVHFPFCIVERTSQIYLHHILRQLLVRNLGEQALLLAQSCAALPYFPHVLELMLHEVLEEEATSREPIPDPLLPTVAKFITEFPLFLQTVVHCARKTEYALWNYLFAAVGNPKDLFEECLMAQDLETAASYLIILQNMEAAAVSRQHATLLFNTALEQGKWDLCRHMIRFLKAI 969          
BLAST of RIC1 domain-containing protein vs. Ensembl Xenopus
Match: nsun3 (NOP2/Sun RNA methyltransferase family member 3 [Source:Xenbase;Acc:XB-GENE-980505])

HSP 1 Score: 534.643 bits (1376), Expect = 1.286e-163
Identity = 362/1076 (33.64%), Postives = 559/1076 (51.95%), Query Frame = 3
Query:  117 AIFNSSQIIVFENKNNSIVAYYCRCEESLDIYGNSINLEWNSDGSLIAIGTDKGFLLIFSVKTVSQEVNVGYQNEKEF--------LEEGFINRQLSLFGEIILLDVISFPYKISCICLYRDDLLVAIEDGTLSRIKWNGSLLYNQEFNLTSISFFSDLEFSKASNLSKNEAICRNIEWLPSLSGVIVLFKNGKSAFLHIPNHKLLSEQITGVWAENLRNVTCSAVNVKFRSIAYGLKIGEAVIYKTDEETGALRLQHRLKILSNEYPDADKVTGAVTYLKWSPDNFCLALCWEYIGFSLWSVQGSLLFSSLGNKAGID--------MSLLSLDWGCEGYSLWLI----------EKPDKS--GKPAILIFQMAKSVLVVNPTKNNHEHXX-----------------------XXXXXHIIFGPRKLLSSSETNLEYIPYPENYVTWN----------WPIKYAAIDLNGSRLVISGKHGFALYFFVSKKWRLFGNETQERTIEVSGGIVWYNHIVGLACFDNKEGKFEIRLYDSLQKIDNSLSTNHPVNSQILLMNIFDNTLVVLSIDGSIGLFEITLNEKSHD--ISMEYIQTIPLENYIEFAACIVSFNLSSLHTEIGHN-KDVDELIRYQSLLINYSGHLLLFQRDKSFSAPRTSDKSLNSQENSFFKLAFKNTLIAKQKITFTGPLVVAYNVEIMWTPIIDEEFQSKRLKLDDWNAKIYTMENSLWLNCGSQGLRVWLPLNGGSNVTQVGEKKSKYSFLSKRIMLTFKIRNFYPLVVLNNEALLMSPMNE-FSNDFVNTPTC------LNLSFSSINKNRHIFLQHIVKELLRINLGIHALDLTFELKKLPYFNHSXXXXXXXXXXXXATSKEPIPDPLLPRVVAFIQEFPNFLRTVVQCARKTELALWSYLFESAGNPKDLFESCLMNNELDTAASYLIILQNIEHPLISQKQAILLLDAALNRSNWGLVSNLIRFLKNIVEEVFKYEHARNEFKMIEKGNYKSTKETYSSFNTK-KRYRSGGGIGMATSRQ-YSTGK--IKDIEILKSSKSAQNGNIDENCYDDLVFD 3119
            ++ + +Q+ ++ ++ + ++A Y    ++   +GN    EW  D S+I I T  G++L F +  V ++    Y  E  +        L   +   Q +    +    V+     I+ I    +DLLVA EDG L  I W G     +  NLT+I F  D + S+ S L   +   R++E+  +L G  V+F +G+  F+   +++L ++QI GVWA ++ + TC AVN K+R +A+G   G  +++  D  TGAL+L H+L++   +YPD    TGAV  ++WSPD   + + WE  G SLWSV G+ L  +LG              + + S+ WG EGY LW I          E  DKS   +  IL FQ  KS L VNP  +N E +L                          S H     R     S  N + +     +  W+          +P++Y AID  G  + + GK GFA Y  ++KKW+LFGN TQE+ + VSGG+ W+   + LACF+  E + E+R+Y     +DN+ +    V  + LL++IF + +++   D SI L+ I   ++  +  + ++ +Q + +  YI   + +VS  L+S+ TE G + K   +    +S+L+N +G L++ QRD+S   P+  +K   + ++                + F  P+V+A +VE +W+       + KR  L+           +LWL+CG  G++VWLPL          + +  +SFLSKRIML F I N YPL VL  +AL++  +NE  + D +N  +       ++  F  + +   I+L HI+++LL  NLG  AL L      LPYF H LEL+LHEVLEEEATS+EPIPDPLLP V  FI EFP FL+TVV CARKTE ALW+YLF + GNPKDLFE CLM  +L+TAASYLIILQN+E   +S++ A LL + AL +  W L  ++IRFLK I              +M       +T+E  S+   +  R+RS   I ++ S + + +GK  ++    + S  + +  + D +C +++  D
Sbjct:   34 SVLSQTQLSIWYSRPSVLIASYKESAKATAQFGNYKQAEWRPDSSMIVI-TANGYILFFDIIPVGED---KYLYEPVYPKGSPHIKLNPHYKEEQCAPALNLETKKVMDLQASITSIQSMMEDLLVATEDGLLHIIHWEGMTNGRKAINLTTIPFSIDFQPSRGSFLDFGDVHIRDMEYCATLDGFAVVFNDGRVGFITPGSNRLTADQIHGVWAPDVVDGTCVAVNNKYRLMAFGCVGGSVLVFTIDNTTGALQLSHKLELTPKQYPDMWNKTGAVKLIRWSPDCSVVMVTWECGGLSLWSVFGAHLICTLGGDFDYRADGTKKEALRICSMSWGTEGYHLWAITADSSQNTGYEMSDKSVPQQSGILQFQFIKSALTVNPCMSNQEQVLLQGEDRLYLNCGDATQTQNARNGSSQSEHKPLRDRSPFPGSSGNSQGLSTLLGHRHWHVVQHLIIFFFFPLQYTAIDKVGQNVAVVGKFGFAHYSLLTKKWKLFGNITQEQNMVVSGGLSWWKEFIVLACFNLSEQQEELRVYLRTSNLDNAFAHVIKVQLETLLLSIFRDMVIIFRADCSICLYSIERKKEGPNPSVCLQVLQEVSMSRYIPHPSLVVSVTLTSVRTETGISLKMPQQACDAESILLNLAGQLIMLQRDRS--GPQIREKDAKTHQHKL--------------LPFCAPVVLAQSVENVWSTC--RANKQKRHLLE-----------ALWLSCGGAGMKVWLPLFPR-------DHRKPHSFLSKRIMLPFHI-NIYPLAVLFEDALVLGAINETVAYDCLNNLSTSSEHLEVHFPFCIVERTSQIYLHHILRQLLVRNLGEQALLLAQSCAALPYFPHVLELMLHEVLEEEATSREPIPDPLLPTVAKFITEFPLFLQTVVHCARKTEYALWNYLFAAVGNPKDLFEECLMAQDLETAASYLIILQNMEAAAVSRQHATLLFNTALEQGKWDLCRHMIRFLKAI-----------GSGEMETPPATPTTQEPSSTGGFEFFRHRS---ISLSQSAENFPSGKFNLQKTHSMPSGAAGKRWSKDSDCAENMYID 1054          
BLAST of RIC1 domain-containing protein vs. Ensembl Mouse
Match: Ric1 (RAB6A GEF complex partner 1 [Source:MGI Symbol;Acc:MGI:1924893])

HSP 1 Score: 531.946 bits (1369), Expect = 1.301e-162
Identity = 348/1027 (33.89%), Postives = 535/1027 (52.09%), Query Frame = 3
Query:   21 MYYFFNCPKRI-----SRHFVPSNITGIISSKSFALCAIFNSSQIIVFENKNNSIVAYYCRCEESLDIYGNSINLEWNSDGSLIAIGTDKGFLLIFSVKTVSQEVNVGYQNEKEFLEEGFINRQLSLFGE--------IILLDVISFPYKISCICLYRDDLLVAIEDGTLSRIKWNGSLLYNQEFNLTSISFFSDLEFSK-ASNLSKNEAICRNIEWLPSLSGVIVLFKNGKSAFLHIPNHKLLSEQITGVWAENLRNVTCSAVNVKFRSIAYGLKIGEAVIYKTDEETGALRLQHRLKILSNEYPDADKVTGAVTYLKWSPDNFCLALCWEYIGFSLWSVQGSLLFSSLGNKAGI--------DMSLLSLDWGCEGYSLWLI----------EKPDKSG--KPAILIFQMAKSVLVVNPTKNNHEHXXXXXXXHIIFGPRKLLSS-----SETNLEYIPYPE------------------------------NYVTWNWPIKYAAIDLNGSRLVISGKHGFALYFFVSKKWRLFGNETQERTIEVSGGIVWYNHIVGLACFDNKEGKFEIRLYDSLQKIDNSLSTNHPVNSQILLMNIFDNTLVVLSIDGSIGLFEITLNEKSHDI--SMEYIQTIPLENYIEFAACIVSFNLSSLHTEIGHNKDVDELIR-YQSLLINYSGHLLLFQRDKSFSAPRTSDKSLNSQENSFFKLAFKNTLIAKQKITFTGPLVVAYNVEIMWTPIIDEEFQSKRLKLDDWNAKIYTMENSLWLNCGSQGLRVWLPLNGGSNVTQVGEKKSKYSFLSKRIMLTFKIRNFYPLVVLNNEALLMSPMNE-------FSNDFVNTPTCLNLSFSSINKNRHIFLQHIVKELLRINLGIHALDLTFELKKLPYFNHSXXXXXXXXXXXXATSKEPIPDPLLPRVVAFIQEFPNFLRTVVQCARKTELALWSYLFESAGNPKDLFESCLMNNELDTAASYLIILQNIEHPLISQKQAILLLDAALNRSNWGLVSNLIRFLKNI 2864
            MY+    PKR+     S    P ++    S    A  A+   +++ ++ ++ + ++  Y    +S   +G+    EW  D ++IA+ T  G++L F + +   +    Y  E  + +     + +  F E        + +  ++     I  +    +DLLVA  DG L  I W G     +  NL+++ F  DL+ S+  S L   +   +++E+  +L G  V+F +GK  F+   + +  +EQ+ GVW +++ + TC AVN K+R +A+G   G   +Y  D  TGA+ L H+L++ + +YPD    TGAV  ++WSPDN  + + WEY G SLWSV G+ L  +LG              + + S+ WG EGY LW+I          E   +S   +P+IL+FQ  KSVL VNP  +N E +LL     +     +   +     S    E +P  E                               Y+  NWPI+++AID  G  + ++GK GFA Y  ++KKW+LFGN TQE+ + V+GG+ W++  + LAC++  + + E+R+Y     +DN+ +       + LL+++F + +VV   D SI L+ I       +   S++ +Q + +  YI     +VS  L+S+ TE G +  + +  R  +S+++N +G L++ QRD+S    R  D   N                 ++ + F  P+V+A +VE +WT       + KR  L+           +LWL+CG  G++VWLPL          + +  +SFLS+RIML F I N YPL VL  +AL++  +N+       ++         +   F  + +   I+L HI+++LL  NLG  AL L      LPYF H LEL+LHEVLEEEATS+EPIPDPLLP V  FI EFP FL+TVV CARKTE ALW+YLF + GNPKDLFE CLM  +LDTAASYLIILQN+E P +S++ A LL + AL +  W L  ++IRFLK I
Sbjct:    1 MYFLSGWPKRLLCAPRSPAEAPLHVQ---SDPRRAFFAVLAPARLSIWYSRPSVLIVTYKEPAKSSTQFGSYKQAEWRPDSTMIAVSTANGYILFFHITSSRGD---KYLYEPVYPKGSPQMKGIPHFKEEHCAPALNLEMKKILDLQAPIMSLQSVLEDLLVATSDGLLHLIHWEGMTNGRKAINLSTVPFSVDLQSSRVGSFLGFADVHIKDMEYCATLDGFAVVFNDGKVGFITPVSSRFTAEQLHGVWPQDVIDGTCVAVNNKYRLMAFGCASGCVQVYTIDNTTGAMLLSHKLELTAKQYPDIWNKTGAVKLIRWSPDNSAVIVTWEYGGLSLWSVFGAQLICTLGGDFAYRSDGTKKDPLKINSMSWGAEGYHLWVISGLGSQHTQIETDLRSTVKEPSILLFQFIKSVLTVNPCMSNQEQVLLQGEDRLYLNCGEASQAQNPKYSSARAERMPRHEKSPFADGGLEAPGLSTLLGHRHWHVVQISSTYLESNWPIRFSAIDKLGQNIAVAGKFGFAHYSLLTKKWKLFGNITQEQNMIVTGGLAWWDDFMVLACYNLSDRQEELRIYLRTSNLDNAFAHVTKAPMETLLLSVFRDMVVVFRADCSICLYSIERKSDGSNTTASVQVLQEVSMSRYIPHPFLVVSVTLTSVSTENGISLKMPQQARDAESIMLNLAGQLIMMQRDRSGPQIREKDSHPNQ----------------RKLLPFCPPVVLAQSVENVWTTC--RANKQKRHLLE-----------ALWLSCGGAGMKVWLPLFPR-------DHRKPHSFLSQRIMLPFHI-NIYPLAVLFEDALVLGAVNDTLLYDSLYTRSSAREQLEVLFPFCVVERTSQIYLHHILRQLLVRNLGEQALLLAQSCAALPYFPHVLELMLHEVLEEEATSREPIPDPLLPTVAKFITEFPLFLQTVVHCARKTEYALWNYLFAAVGNPKDLFEECLMAQDLDTAASYLIILQNMEVPAVSRQHATLLFNTALEQGKWDLCRHMIRFLKAI 984          
BLAST of RIC1 domain-containing protein vs. Ensembl Mouse
Match: Ric1 (RAB6A GEF complex partner 1 [Source:MGI Symbol;Acc:MGI:1924893])

HSP 1 Score: 475.707 bits (1223), Expect = 4.591e-143
Identity = 315/925 (34.05%), Postives = 484/925 (52.32%), Query Frame = 3
Query:  231 EWNSDGSLIAIGTDKGFLLIFSVKTVSQEVNVGYQNEKEFLEEGFINRQLSLFGE--------IILLDVISFPYKISCICLYRDDLLVAIEDGTLSRIKWNGSLLYNQEFNLTSISFFSDLEFSK-ASNLSKNEAICRNIEWLPSLSGVIVLFKNGKSAFLHIPNHKLLSEQITGVWAENLRNVTCSAVNVKFRSIAYGLKIGEAVIYKTDEETGALRLQHRLKILSNEYPDADKVTGAVTYLKWSPDNFCLALCWEYIGFSLWSVQGSLLFSSLGNKAGI--------DMSLLSLDWGCEGYSLWLI----------EKPDKSG--KPAILIFQMAKSVLVVNPTKNNHEHXXXXXXXHIIFGPRKLLSS-----SETNLEYIPYPENYVTWNWPIKYAAIDLNGSRLVISGKHGFALYF---FVSKKWRLFGNETQERTIEVSGGIVWYNHIVGLACFDNKEGKFEIRLYDSLQKIDNSLSTNHPVNSQILLMNIFDNTLVVLSIDGSIGLFEITLNEKSHDI--SMEYIQTIPLENYIEFAACIVSFNLSSLHTEIGHNKDVDELIR-YQSLLINYSGHLLLFQRDKSFSAPRTSDKSLNSQENSFFKLAFKNTLIAKQKITFTGPLVVAYNVEIMWTPIIDEEFQSKRLKLDDWNAKIYTMENSLWLNCGSQGLRVWLPLNGGSNVTQVGEKKSKYSFLSKRIMLTFKIRNFYPLVVLNNEALLMSPMNE-------FSNDFVNTPTCLNLSFSSINKNRHIFLQHIVKELLRINLGIHALDLTFELKKLPYFNHSXXXXXXXXXXXXATSKEPIPDPLLPRVVAFIQEFPNFLRTVVQCARKTELALWSYLFESAGNPKDLFESCLMNNELDTAASYLIILQNIEHPLISQKQAILLLDAALNRSNWGLVSNLIRFLKNI 2864
            EW  D ++IA+ T  G++L F + +   +    Y  E  + +     + +  F E        + +  ++     I  +    +DLLVA  DG L  I W G     +  NL+++ F  DL+ S+  S L   +   +++E+  +L G  V+F +GK  F+   + +  +EQ+ GVW +++ + TC AVN K+R +A+G   G   +Y  D  TGA+ L H+L++ + +YPD    TGAV  ++WSPDN  + + WEY G SLWSV G+ L  +LG              + + S+ WG EGY LW+I          E   +S   +P+IL+FQ  KSVL VNP  +N E +LL     +     +   +     S    E +P  E       P     ++  G   ++  +H   +     ++   W +     +E+ + V+GG+ W++  + LAC++  + + E+R+Y     +DN+ +       + LL+++F + +VV   D SI L+ I       +   S++ +Q + +  YI     +VS  L+S+ TE G +  + +  R  +S+++N +G L++ QRD+S    R  D   N                 ++ + F  P+V+A +VE +WT       + KR  L+           +LWL+CG  G++VWLPL          + +  +SFLS+RIML F I N YPL VL  +AL++  +N+       ++         +   F  + +   I+L HI+++LL  NLG  AL L      LPYF H LEL+LHEVLEEEATS+EPIPDPLLP V  FI EFP FL+TVV CARKTE ALW+YLF + GNPKDLFE CLM  +LDTAASYLIILQN+E P +S++ A LL + AL +  W L  ++IRFLK I
Sbjct:    2 EWRPDSTMIAVSTANGYILFFHITSSRGD---KYLYEPVYPKGSPQMKGIPHFKEEHCAPALNLEMKKILDLQAPIMSLQSVLEDLLVATSDGLLHLIHWEGMTNGRKAINLSTVPFSVDLQSSRVGSFLGFADVHIKDMEYCATLDGFAVVFNDGKVGFITPVSSRFTAEQLHGVWPQDVIDGTCVAVNNKYRLMAFGCASGCVQVYTIDNTTGAMLLSHKLELTAKQYPDIWNKTGAVKLIRWSPDNSAVIVTWEYGGLSLWSVFGAQLICTLGGDFAYRSDGTKKDPLKINSMSWGAEGYHLWVISGLGSQHTQIETDLRSTVKEPSILLFQFIKSVLTVNPCMSNQEQVLLQGEDRLYLNCGEASQAQNPKYSSARAERMPRHEKS-----PFADGGLEAPGLSTLLGHRHWHVVQISSTYLESNWPI-----REQNMIVTGGLAWWDDFMVLACYNLSDRQEELRIYLRTSNLDNAFAHVTKAPMETLLLSVFRDMVVVFRADCSICLYSIERKSDGSNTTASVQVLQEVSMSRYIPHPFLVVSVTLTSVSTENGISLKMPQQARDAESIMLNLAGQLIMMQRDRSGPQIREKDSHPNQ----------------RKLLPFCPPVVLAQSVENVWTTC--RANKQKRHLLE-----------ALWLSCGGAGMKVWLPLFPR-------DHRKPHSFLSQRIMLPFHI-NIYPLAVLFEDALVLGAVNDTLLYDSLYTRSSAREQLEVLFPFCVVERTSQIYLHHILRQLLVRNLGEQALLLAQSCAALPYFPHVLELMLHEVLEEEATSREPIPDPLLPTVAKFITEFPLFLQTVVHCARKTEYALWNYLFAAVGNPKDLFEECLMAQDLDTAASYLIILQNMEVPAVSRQHATLLFNTALEQGKWDLCRHMIRFLKAI 876          
BLAST of RIC1 domain-containing protein vs. Ensembl Mouse
Match: Ric1 (RAB6A GEF complex partner 1 [Source:MGI Symbol;Acc:MGI:1924893])

HSP 1 Score: 154.836 bits (390), Expect = 1.073e-42
Identity = 87/131 (66.41%), Postives = 99/131 (75.57%), Query Frame = 3
Query: 2358 FSSINKNRHIFLQHIVKELLRINLGIHALDLTFELKKLPYFNHSXXXXXXXXXXXXATSKEPIPDPLLPRVVAFIQEFPNFLRTVVQCARKTELALWSYLFESAGNPKDLFESCLMNNELDTAASYLIILQ 2750
            F  + +   I+L HI+++LL  NLG  AL L      LPYF H LEL+LHEVLEEEATS+EPIPDPLLP V  FI EFP FL+TVV CARKTE ALW+YLF + GNPKDLFE CLM  +LDTAASYLIILQ
Sbjct:   28 FCVVERTSQIYLHHILRQLLVRNLGEQALLLAQSCAALPYFPHVLELMLHEVLEEEATSREPIPDPLLPTVAKFITEFPLFLQTVVHCARKTEYALWNYLFAAVGNPKDLFEECLMAQDLDTAASYLIILQ 158          
BLAST of RIC1 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q4ADV7|RIC1_HUMAN (RAB6A-GEF complex partner protein 1 OS=Homo sapiens OX=9606 GN=RIC1 PE=1 SV=2)

HSP 1 Score: 543.502 bits (1399), Expect = 4.793e-166
Identity = 354/1033 (34.27%), Postives = 541/1033 (52.37%), Query Frame = 3
Query:   21 MYYFFNCPKRI-----SRHFVPSNITGIISSKSFALCAIFNSSQIIVFENKNNSIVAYYCRCEESLDIYGNSINLEWNSDGSLIAIGTDKGFLLIFSVKT----------VSQEVNVGYQNEKEFLEEGFINRQLSLFGEIILLDVISFPYKISCICLYRDDLLVAIEDGTLSRIKWNGSLLYNQEFNLTSISFFSDLEFSK-ASNLSKNEAICRNIEWLPSLSGVIVLFKNGKSAFLHIPNHKLLSEQITGVWAENLRNVTCSAVNVKFRSIAYGLKIGEAVIYKTDEETGALRLQHRLKILSNEYPDADKVTGAVTYLKWSPDNFCLALCWEYIGFSLWSVQGSLLFSSLGNKAGI--------DMSLLSLDWGCEGYSLWLI----------EKPDKS--GKPAILIFQMAKSVLVVNPTKNNHEHXXXXXXXHIIFG---------PRKLLSSSETNLEYIPYPE------------------------------NYVTWNWPIKYAAIDLNGSRLVISGKHGFALYFFVSKKWRLFGNETQERTIEVSGGIVWYNHIVGLACFDNKEGKFEIRLYDSLQKIDNSLSTNHPVNSQILLMNIFDNTLVVLSIDGSIGLFEITLNEKSHDIS--MEYIQTIPLENYIEFAACIVSFNLSSLHTEIGHNKDVDELIR-YQSLLINYSGHLLLFQRDKSFSAPRTSDKSLNSQENSFFKLAFKNTLIAKQKITFTGPLVVAYNVEIMWTPIIDEEFQSKRLKLDDWNAKIYTMENSLWLNCGSQGLRVWLPLNGGSNVTQVGEKKSKYSFLSKRIMLTFKIRNFYPLVVLNNEALLMSPMNE-------FSNDFVNTPTCLNLSFSSINKNRHIFLQHIVKELLRINLGIHALDLTFELKKLPYFNHSXXXXXXXXXXXXATSKEPIPDPLLPRVVAFIQEFPNFLRTVVQCARKTELALWSYLFESAGNPKDLFESCLMNNELDTAASYLIILQNIEHPLISQKQAILLLDAALNRSNWGLVSNLIRFLKNI 2864
            MY+    PKR+     S    P ++    S    A  A+  ++++ ++ ++ + ++  Y    +S   +G+    EW  D ++IA+ T  G++L F + +          V  + +   +    F EE     Q +    + +  ++     I  +    +DLLVA  DG L  I W G     +  NL ++ F  DL+ S+  S L   +   R++E+  +L G  V+F +GK  F+   + +  +EQ+ GVW +++ + TC AVN K+R +A+G   G   +Y  D  TGA+ L H+L++ + +YPD    TGAV  ++WSPDN  + + WEY G SLWSV G+ L  +LG              + + S+ WG EGY LW+I          E   +S   +P+IL+FQ  KSVL VNP  +N E +LL     +            PR    SS T+ E+ P  E                               Y+  NWPI+++AID  G  + + GK GFA Y  ++KKW+LFGN TQE+ + V+GG+ W+N  + LAC++  + + E+R+Y     +DN+ +      ++ LL+++F + ++V   D SI L+ I       + +  ++ +Q + +  YI     +VS  L+S+ TE G    + +  R  +S+++N +G L++ QRD+S    R  D + N+Q               ++ + F  P+V+A +VE +WT       + KR  L+           +LWL+CG  G++VWLPL          + +  +SFLS+RIML F I N YPL VL  +AL++  +N+       ++ +       +   F  + +   I+L HI+++LL  NLG  AL L      LPYF H LEL+LHEVLEEEATS+EPIPDPLLP V  FI EFP FL+TVV CARKTE ALW+YLF + GNPKDLFE CLM  +LDTAASYLIILQN+E P +S++ A LL + AL +  W L  ++IRFLK I
Sbjct:    1 MYFLSGWPKRLLCPLGSPAEAPFHVQ---SDPQRAFFAVLAAARLSIWYSRPSVLIVTYKEPAKSSTQFGSYKQAEWRPDSTMIAVSTANGYILFFHITSTRGDKYLYEPVYPKGSPQMKGTPHFKEE-----QCAPALNLEMRKILDLQAPIMSLQSVLEDLLVATSDGLLHLIHWEGMTNGRKAINLCTVPFSVDLQSSRVGSFLGFTDVHIRDMEYCATLDGFAVVFNDGKVGFITPVSSRFTAEQLHGVWPQDVVDGTCVAVNNKYRLMAFGCVSGSVQVYTIDNSTGAMLLSHKLELTAKQYPDIWNKTGAVKLMRWSPDNSVVIVTWEYGGLSLWSVFGAQLICTLGGDFAYRSDGTKKDPLKINSMSWGAEGYHLWVISGFGSQNTEIESDLRSVVKQPSILLFQFIKSVLTVNPCMSNQEQVLLQGEDRLYLNCGEASQTQNPR----SSSTHSEHKPSREKSPFADGGLESQGLSTLLGHRHWHVVQISSTYLESNWPIRFSAIDKLGQNIAVVGKFGFAHYSLLTKKWKLFGNITQEQNMIVTGGLAWWNDFMVLACYNINDRQEELRVYLRTSNLDNAFAHVTKAQAETLLLSVFQDMVIVFRADCSICLYSIERKSDGPNTTAGIQVLQEVSMSRYIPHPFLVVSVTLTSVSTENGITLKMPQQARGAESIMLNLAGQLIMMQRDRSGPQIREKDSNPNNQ---------------RKLLPFCPPVVLAQSVENVWTTC--RANKQKRHLLE-----------ALWLSCGGAGMKVWLPLFPR-------DHRKPHSFLSQRIMLPFHI-NIYPLAVLFEDALVLGAVNDTLLYDSLYTRNNAREQLEVLFPFCVVERTSQIYLHHILRQLLVRNLGEQALLLAQSCATLPYFPHVLELMLHEVLEEEATSREPIPDPLLPTVAKFITEFPLFLQTVVHCARKTEYALWNYLFAAVGNPKDLFEECLMAQDLDTAASYLIILQNMEVPAVSRQHATLLFNTALEQGKWDLCRHMIRFLKAI 985          
BLAST of RIC1 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q69ZJ7|RIC1_MOUSE (RAB6A-GEF complex partner protein 1 OS=Mus musculus OX=10090 GN=Ric1 PE=1 SV=2)

HSP 1 Score: 531.946 bits (1369), Expect = 7.975e-162
Identity = 348/1027 (33.89%), Postives = 535/1027 (52.09%), Query Frame = 3
Query:   21 MYYFFNCPKRI-----SRHFVPSNITGIISSKSFALCAIFNSSQIIVFENKNNSIVAYYCRCEESLDIYGNSINLEWNSDGSLIAIGTDKGFLLIFSVKTVSQEVNVGYQNEKEFLEEGFINRQLSLFGE--------IILLDVISFPYKISCICLYRDDLLVAIEDGTLSRIKWNGSLLYNQEFNLTSISFFSDLEFSK-ASNLSKNEAICRNIEWLPSLSGVIVLFKNGKSAFLHIPNHKLLSEQITGVWAENLRNVTCSAVNVKFRSIAYGLKIGEAVIYKTDEETGALRLQHRLKILSNEYPDADKVTGAVTYLKWSPDNFCLALCWEYIGFSLWSVQGSLLFSSLGNKAGI--------DMSLLSLDWGCEGYSLWLI----------EKPDKSG--KPAILIFQMAKSVLVVNPTKNNHEHXXXXXXXHIIFGPRKLLSS-----SETNLEYIPYPE------------------------------NYVTWNWPIKYAAIDLNGSRLVISGKHGFALYFFVSKKWRLFGNETQERTIEVSGGIVWYNHIVGLACFDNKEGKFEIRLYDSLQKIDNSLSTNHPVNSQILLMNIFDNTLVVLSIDGSIGLFEITLNEKSHDI--SMEYIQTIPLENYIEFAACIVSFNLSSLHTEIGHNKDVDELIR-YQSLLINYSGHLLLFQRDKSFSAPRTSDKSLNSQENSFFKLAFKNTLIAKQKITFTGPLVVAYNVEIMWTPIIDEEFQSKRLKLDDWNAKIYTMENSLWLNCGSQGLRVWLPLNGGSNVTQVGEKKSKYSFLSKRIMLTFKIRNFYPLVVLNNEALLMSPMNE-------FSNDFVNTPTCLNLSFSSINKNRHIFLQHIVKELLRINLGIHALDLTFELKKLPYFNHSXXXXXXXXXXXXATSKEPIPDPLLPRVVAFIQEFPNFLRTVVQCARKTELALWSYLFESAGNPKDLFESCLMNNELDTAASYLIILQNIEHPLISQKQAILLLDAALNRSNWGLVSNLIRFLKNI 2864
            MY+    PKR+     S    P ++    S    A  A+   +++ ++ ++ + ++  Y    +S   +G+    EW  D ++IA+ T  G++L F + +   +    Y  E  + +     + +  F E        + +  ++     I  +    +DLLVA  DG L  I W G     +  NL+++ F  DL+ S+  S L   +   +++E+  +L G  V+F +GK  F+   + +  +EQ+ GVW +++ + TC AVN K+R +A+G   G   +Y  D  TGA+ L H+L++ + +YPD    TGAV  ++WSPDN  + + WEY G SLWSV G+ L  +LG              + + S+ WG EGY LW+I          E   +S   +P+IL+FQ  KSVL VNP  +N E +LL     +     +   +     S    E +P  E                               Y+  NWPI+++AID  G  + ++GK GFA Y  ++KKW+LFGN TQE+ + V+GG+ W++  + LAC++  + + E+R+Y     +DN+ +       + LL+++F + +VV   D SI L+ I       +   S++ +Q + +  YI     +VS  L+S+ TE G +  + +  R  +S+++N +G L++ QRD+S    R  D   N                 ++ + F  P+V+A +VE +WT       + KR  L+           +LWL+CG  G++VWLPL          + +  +SFLS+RIML F I N YPL VL  +AL++  +N+       ++         +   F  + +   I+L HI+++LL  NLG  AL L      LPYF H LEL+LHEVLEEEATS+EPIPDPLLP V  FI EFP FL+TVV CARKTE ALW+YLF + GNPKDLFE CLM  +LDTAASYLIILQN+E P +S++ A LL + AL +  W L  ++IRFLK I
Sbjct:    1 MYFLSGWPKRLLCAPRSPAEAPLHVQ---SDPRRAFFAVLAPARLSIWYSRPSVLIVTYKEPAKSSTQFGSYKQAEWRPDSTMIAVSTANGYILFFHITSSRGD---KYLYEPVYPKGSPQMKGIPHFKEEHCAPALNLEMKKILDLQAPIMSLQSVLEDLLVATSDGLLHLIHWEGMTNGRKAINLSTVPFSVDLQSSRVGSFLGFADVHIKDMEYCATLDGFAVVFNDGKVGFITPVSSRFTAEQLHGVWPQDVIDGTCVAVNNKYRLMAFGCASGCVQVYTIDNTTGAMLLSHKLELTAKQYPDIWNKTGAVKLIRWSPDNSAVIVTWEYGGLSLWSVFGAQLICTLGGDFAYRSDGTKKDPLKINSMSWGAEGYHLWVISGLGSQHTQIETDLRSTVKEPSILLFQFIKSVLTVNPCMSNQEQVLLQGEDRLYLNCGEASQAQNPKYSSARAERMPRHEKSPFADGGLEAPGLSTLLGHRHWHVVQISSTYLESNWPIRFSAIDKLGQNIAVAGKFGFAHYSLLTKKWKLFGNITQEQNMIVTGGLAWWDDFMVLACYNLSDCQEELRIYLRTSNLDNAFAHVTKAPMETLLLSVFRDMVVVFRADCSICLYSIERKSDGSNTTASVQVLQEVSMSRYIPHPFLVVSVTLTSVSTENGISLKMPQQARDAESIMLNLAGQLIMMQRDRSGPQIREKDSHPNQ----------------RKLLPFCPPVVLAQSVENVWTTC--RANKQKRHLLE-----------ALWLSCGGAGMKVWLPLFPR-------DHRKPHSFLSQRIMLPFHI-NIYPLAVLFEDALVLGAVNDTLLYDSLYTRSSAREQLEVLFPFCVVERTSQIYLHHILRQLLVRNLGEQALLLAQSCAALPYFPHVLELMLHEVLEEEATSREPIPDPLLPTVAKFITEFPLFLQTVVHCARKTEYALWNYLFAAVGNPKDLFEECLMAQDLDTAASYLIILQNMEVPAVSRQHATLLFNTALEQGKWDLCRHMIRFLKAI 984          
BLAST of RIC1 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9V3C5|RIC1_DROME (Guanine nucleotide exchange factor subunit Rich OS=Drosophila melanogaster OX=7227 GN=Rich PE=1 SV=1)

HSP 1 Score: 465.307 bits (1196), Expect = 1.334e-137
Identity = 326/1031 (31.62%), Postives = 516/1031 (50.05%), Query Frame = 3
Query:   21 MYYFFNCPKRIS----------RHFVPSNITGIISSKSFALCAIFNSSQIIVFENKNNSIVAYYCRCEESLDIYGNSINLEWNSDGSLIAIGTDKGFLLIFSVK------TVSQEVNVGYQNEKEFLEEGFINRQLSLFGEIILLDVISFPYKISCICLYRDDLLVAIEDGTLSRIKWNGSLLYNQEFNLTSISF--FSDLEF-------SKASNLSK--NEAICRNIEWLPSLSGVIVLFKNGKSAFLHIPNH-KLLSEQITGVWAENLRNVTCSAVNVKFRSIAYGLKIGEAVIYKTDEETGALRLQHRLKILSNEYPDADKVTGAVTYLKWSPDNFCLALCWEYIGFSLWSVQGSLLFSSLGNKAGIDMSLLS--------LDWGCEGYSLWLIEKPDKSGKPAILIFQMAKSVLVVNPTKNNHEH-----------------XXXXXXXHIIFGPRKLLSSSET--------NLEYIPY----------------PENYVTWNWPIKYAAIDLNGSRLVISGKHGFALYFFVSKKWRLFGNETQERTIEVSGGIVWYNHIVGLACFDNKEGKFEIRLYDSLQKIDNSLSTNHPVNSQILLMNIFDNTLVVLSIDGSIGLFEITLNEKSHDISMEYIQTIPLENYIEFAACIVSFNLSSLHTEIGHNKDVDELIRYQSLLINYSGHLLLFQRDKSFSAPRTSDKSLNSQENSFFKLAFKNTLIAKQKITFTGPLVVAYNVEIMWTPIIDEEFQSKRLKLDDWNAKIYTMENSLWLNCGSQGLRVWLPLNGGSNVTQVGEKKSK---YSFLSKRIMLTFKIRNFYPLVVLNNEALLMSPMNE---FSNDFVNTPTCLNLSFSSINKNRHIFLQHIVKELLRINLGIHALDLTFELKKLPYFNHSXXXXXXXXXXXXATSKEPIPDPLLPRVVAFIQEFPNFLRTVVQCARKTELALWSYLFESAGNPKDLFESCLMNNELDTAASYLIILQNIEHPLISQKQAILLLDAALNRSNWGLVSNLIRFLKNI 2864
            MYY    PKR+           RH     +  ++++       I+ ++ +I         +AY+ R E+SL  YG +  + W  D   +A+ T  G LL++ +        + Q+++    + K    E FI   +       L  V       +  C+   +LL+A +   L R++W        +  L ++S     D+ F         A N+     ++   ++E+ P + G   +F + ++AFL I NH +  ++ + G W  ++ + +  +VN KFR +AYG +     +Y  D+ TG L   HRL +  N  PD+    G+V  LKWSPD   LA+ W   G SLWS  G+LL S+L    G+++ L+         L+W  EGY L++++   +  K  +L  Q  KS L +NP      H                  L  + SH  F P   L S E          L+  P+                P NY   NWPI+YAAID +G  L ++G+ G A Y  V+++W+LFGNE+QE+   VSGG++W++  V + C+   +   E+R Y +  K+DN       V + ++ +N F + L+VL+ DG + LF ++ N  ++ + +E    + +++     ACIVS  +++L  E+     +    + +++++N  G +L+ QRD     P                    NTL+A           +A  VE+ W                  + +   M + LWL  G+ G+RVWLP+       + GE+      +SF+SKRIML+F ++  YPLVVL +  +++   NE   ++N+ V+     +L F+ + +   I+L  ++++L++ NLG  A ++      LPYF H+LELLLHEVLEEEATSK+PIPD  LP ++ FI+EFP +L T+VQCARKTE+ALW YLF  AG PKDLF+ CL + +LDTAASYLIILQN+E  ++S++ A +LLD AL +  W L  +LIRFLK I
Sbjct:    1 MYYPVGWPKRVGLALPGESASIRHICCDAVKILVAAVGDDFLGIWYANPLIP--------IAYFRRTEDSLRQYGANQLIVWKPDSRQLALLTASGSLLLYQLDFEANGMGILQQIDPPAASLKRDSAELFIKENIPRLSLRELCSVTLGSVITTVCCISLSELLLATQSCELLRLQWTELEHAENDLELPALSSIKLRDIPFYVQQQPQQSARNVPPLNRDSYVASLEYSPFIGGCAAVFSDRRAAFL-IANHLRFETDHMHGFWVPDVEDASVCSVNHKFRLLAYGQESSAVKVYAIDDATGGLEFSHRLILTENILPDS---LGSVNELKWSPDGCVLAVSWTNGGLSLWSTFGALLMSTLSWDFGLNVDLVCQNPLKIRRLEWSTEGYQLFMLKLHPEKDKSNVLQLQFVKSALSMNPCMTTSPHILLQGDDCLYLNQGNNLELTYAGSHGTF-PSSGLGSDEDISGDGDCLELKQSPHTGSILTESKYWTVLQLPLNYAATNWPIRYAAIDPDGLHLAVAGRTGLAHYSLVTRRWKLFGNESQEKDFVVSGGLLWWHGFVVMGCYSLLDRTDELRCYPADCKLDNQYGHKLQVRAPVISLNSFRHQLIVLTADGIVSLFNMSKN-SAYALDIECAYELDVKSICIHPACIVSLTVTNLKNELKPQGQLGG-DQAETIIVNVCGRILMIQRDAGEQVP--------------------NTLLAT---------CLASCVEVFWL---------------SHSLERCAMRDCLWLYSGAHGMRVWLPILPPGRERREGEQGGAQRLHSFMSKRIMLSFPLK-LYPLVVLFDNVIVLGVENESTLYANEQVSH---FSLPFAVMERKSQIYLHKVLRQLIKRNLGYSAWEMAQSCCSLPYFPHALELLLHEVLEEEATSKQPIPDAQLPSILDFIREFPVYLETIVQCARKTEIALWPYLFSMAGKPKDLFQMCLQSEQLDTAASYLIILQNLEPSVVSKQYATMLLDIALQQRKWELAKDLIRFLKAI 968          
BLAST of RIC1 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q09417|RIC1_CAEEL (Guanine nucleotide exchange factor subunit R06F6.8 OS=Caenorhabditis elegans OX=6239 GN=R06F6.8 PE=3 SV=2)

HSP 1 Score: 375.17 bits (962), Expect = 4.725e-106
Identity = 267/996 (26.81%), Postives = 466/996 (46.79%), Query Frame = 3
Query:  234 WNSDGSLIAIGTDKGFLLIFSVKTVSQEVNVGY---------QNEKEFLEEGFINRQLSLFGEIILLDVISFPYKISCICLYRDDLLVAIEDGTLSRIKWNGSLLYNQEFNLTSISFFSDLEFSKASNLSKNEAICRNIEWLPSLSGVIVLFKNGKSAFLHIPNHKLLSEQITGVWAENLRNVTCSAVNVKFRSIAYGLKIGEAVIYKTDEETGALRLQHRLKILSNEYPDADKVTGAVTYLKWSPDNFCLALCWEYIGFSLWSVQGSLLFSSLGNKAGIDMSLL----------SLDWGCEGYSLWLIEKPDKSGKPAILIFQ-MAKSVLVVNPTKNNHEHXXXXXXXHIIFGPRK----LLSSSETNLEYIPYPENYVTWNWPIKYAAIDLNGSRLVISGKHGFALYFFVSKKWRLFGNETQERTIEVSGGI-VWYNHIVGLACFDNKEGKFEIRLYDSLQKIDNSLSTNHPVNSQILLMNIFDNTLVVLSIDGSIGLFEITLN-EKSHD----ISMEYIQTIPLENYIEFAACIVSFNLSSLHTEIGHNKDVDELIRYQSLLINYSGHLLLFQRDKSFSAPRTSDKSLNSQENSFFKLAFKNTLIAKQKITFTGPLVVAYNVEIMW---------TPIIDEEFQSKRLKLDDWNAKIYT--------------------MENSLWLNCGSQGLRVWLPLNGGSNVTQVGEKKSKYSFLSKRIMLTFKIRNFYPLVVLNNEALLM---SPMNEFSNDFVNTPTCLNLSFSSINKNRHIFLQHIVKELLRINLGIHALDLTFELKKLPYFNHSXXXXXXXXXXXXATSKEPIPDPLLPRVVAFIQEFPNFLRTVVQCARKTELALWSYLFESAGNPKDLFESCLMNNELDTAASYLIILQNIEHPLISQKQAILLLDAALNRSNWGLVSNLIRFLKNI----VEEVFKYEHARNEFKMIEKGNYKSTKETYSSFNTKKRYRSGGGIGMATSRQYS 3023
            W  D + IA+ T++  +LI+++     E    +         +N  E   +G  +R  +     I++++   P   +C    RD+ LV +++G    + W G ++ +  F  +SI F  D   SK+ N++       +  + P L G  ++  +G+ A L   +       I GVWA N+++ TC  VN KF  I +G K G+   Y  DE  G+L    R+       PD     G V  +    + +     W  +  +    +   +F+S G ++  ++  +          +++WG EG+ LWL       G    L+ Q   +S    +P   + +  +L+S S ++    +       +  +  ++I     Y++ NWP++YA+ D N   LV++G  G A     +++W++FGNETQE+ + V+GG+ +W + ++G+        K  +  Y   Q++D+  ++   +  + ++  + D+   V  I   I L+++T + E   D    +S E +  I +   +    CIVS  ++ L+ ++             ++L+N SG L+                                TL   +      P+V+A  VE MW         T   +++   K  + +  N  I +                    + N+LW+ CG++G++VW+PL  G       E     +F++KRIML F++ + YP+V+   + L M   S +   +    N     +++   +++N  +F+ H++++LL+ NLG+ AL+L    + LP+F H+LELLLH VLEEEATS EPIPDPLLPR VAFI EFP FL+TV  CARKTELALW  LF+  G+P  LFE CL   +L+ AAS++I+LQN+E   +S  QA  L+  AL    W +   ++RF ++I    ++  F+      +  +  +    S     S+     R+++G   G     ++S
Sbjct:   78 WKPDSTSIAVTTNQCKILIYNLDLRDDEQCYNFTDSADPYFQRNSPELFIKG--SRPTAHLHPTIIINLADIP---TCCVPSRDEFLVCLQNGFTHHVTWTGEIIASLSFRASSIPFSVDQLQSKSENITSKSTYIFDAVYAPLLGGFAIVLSDGQGALLTSNDPNFAPNAILGVWAPNMKDATCCDVNHKFLLILFGCKNGDVCAYNIDELNGSLVQSFRVAPKVTNGPDLTNRLGPVHRITALANGYGFGAIWSPLSGAHALPRLVAVFTSFGAQSFCNLEGVVEEDQNDRYTAIEWGPEGFQLWL-------GTENELMMQPFVRSASCSSPAMEHCDRAVLMSDSQVLISAARDREAEACAPHSVWDHITVTHEYLSSNWPLRYASTDRNYKHLVVAGDQGMAYCSLSNRRWKIFGNETQEKNLLVTGGVFIWNDDVIGVVGVAADTDKSHLSFYPISQRLDSRYASVVDLEHKSVMSVLRDDVCAVFDISAQITLYKLTAHLETGRDAFTKVSTEIVTVIRINEIVPHPTCIVSLQMTQLNLDVRGKLSPAFYSSIDTVLVNISGRLI--------------------------------TLSVNEDGKLHQPMVIASYVEKMWHDRCQVSQSTQSQNQDLPWKNHRRNGSNVSIQSVSTSTTSEPSSPMNQSCSSHLSNALWIACGAKGIKVWMPLVPGKRNLATQE----MTFIAKRIMLPFEL-DIYPIVISAKDCLAMGVESQLQHVARASRNQGQMESITMYGLHRNSEVFVHHLLRQLLKRNLGVFALELAGACRSLPHFTHALELLLHGVLEEEATSSEPIPDPLLPRCVAFIHEFPEFLKTVAHCARKTELALWRTLFDVTGSPNALFEECLQLKQLENAASFVIVLQNLETTEVSMDQAARLVKEALEEKKWTIAKEMVRFARSIGSEDIDAFFRTPPPSAKTSLSRRPTVSSPSADSSTEFVINRFQAGAAGGRLNKVRHS 1024          
BLAST of RIC1 domain-containing protein vs. UniProt/SwissProt
Match: sp|O42656|RIC1_SCHPO (Guanine nucleotide exchange factor subunit ric1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ric1 PE=1 SV=2)

HSP 1 Score: 114.39 bits (285), Expect = 4.042e-24
Identity = 147/596 (24.66%), Postives = 254/596 (42.62%), Query Frame = 3
Query: 1278 IPYPENYVTWNWPIKYAAIDLNGSRLVISGKHGFALYFFVSKKWRLFGNETQERTIEVSGGIVWYNH--IVGLACFDNKEGKFEIRLYDSLQKIDNSLS-TNHPVNSQILLMNIFDN-TLVVLSIDGSIGLFEITLNEKSHDISMEYIQTIPLENYIEFAACIVSFNLSSLHTEIGHNKDVDELIRYQSLLINYSGHLLLFQRDKSFSAPRTSDKSLNSQENSFFKL--------AFKNTLIAKQK-----ITFTGPLVVAYNVEIMWTPIID--------------EEFQSKRLKLDDWNAKIYTMENSLWLNCGSQGLRVWLPLNGGSNVTQVGEKKSKYSFLSKRIMLTFKIRNFYPLVVLNNEALLMSPMNEFSNDFVNTPTCLNLSFSSINKNRHIFLQHIVKELLRINLGIHALDLTFELKKLPYFNHSXXXXXXXXXXXXATSKEPIPDPLLPRVVAF---IQEFPNFLRTVVQCARKTELALWSYLFESAGNPKDLFESCLMNNELDTAASYLIILQNIEHPLISQKQAILLLDAALNRSNWGLVSNLIRFLKNIVEEVFKYEHARNEFKMIEKGNYKSTKETYSSFN 2963
            + YP+ YV   WPI+Y +I  +GS + I+G HG A+Y    K W L+ +   E+ I V+  ++W +   + G+ C    E  FE+ LY +   +D+  +       S I+ M++ D  +LVV + D  +      +NE    + ++Y+ ++         + + S  L  L  +   N    +L+ Y  LL+  +G L+L    K  S       S+ + +  F+ +         F +  I   K     ++F+  L    +V I    +ID              E F   RL ++D  +  +  +N +  N  +  L     L    N+++  +K+      S+  +LT          VL+N  LL++   +   + VN      + ++ I    + FL  IV+ LL ++    A+DL      L Y N  LE LL   L    +S+    D LL  V      +QEF  F + V+ C RKTE   W  +F+  G PKDL + CL   ++ +AA  LII Q  +         + + + AL   NW + + L  +L ++  E       +   +++++G        Y  FN
Sbjct:  486 VEYPQPYVASEWPIRYVSIKDDGSLIAIAGLHGLAIYVCSKKTWFLYKDANMEQLISVTCPMIWCSQFLLAGVVC----ESNFELHLYKAKGPLDDRENLAKLSFTSTIVTMSVCDEYSLVVYTADNFLHHIRFDINELGR-LELDYLTSVNFAPIFTTPSRVRSITL--LLPKDLANIQPSDLLFYAVLLVLINGKLVLLSLKKQHSKELLYQCSMLAGDVEFYFINGSQEIPSLFHSIWIMTGKGLKLWLSFSEILS---SVLINTKNLIDGLPKFLNTSKRVSLENFH--RLSVEDLRSPSFVYKNGVDCNFDNTHLA---KLIKNVNISEKFQKEC-IDLESQGCLLT----------VLSNYGLLLTAYTQGHKNLVN-----KMEYAHIQIGVYPFLPEIVRALLLLDKREQAIDLVKTYGHLHYINFVLEKLLSSSLLTYNSSQR---DKLLYEVSLLFKDLQEFTTF-KIVLGCLRKTEAEYWPMIFKYFGEPKDLMKKCLETEDVKSAAECLIIWQIHQGSASCASTFLSIYEMALKIKNWDVCTELSSYLVSLDPE---KRLLKTALELLDEGPDSKDIRLYDQFN 1043          
BLAST of RIC1 domain-containing protein vs. TrEMBL
Match: A0A1S3JAU3 (RAB6A-GEF complex partner protein 1 OS=Lingula unguis OX=7574 GN=LOC106171633 PE=4 SV=1)

HSP 1 Score: 640.573 bits (1651), Expect = 0.000e+0
Identity = 387/1021 (37.90%), Postives = 571/1021 (55.93%), Query Frame = 3
Query:   21 MYYFFNCPKRIS---RHFVPSNITGIISSKSFALCAIFNSSQIIVFENKNNSIVAYYCRCEESLDIYGNSINLEWNSDGSLIAIGTDKGFLLIFSVKTVSQEVNVGYQNEKEFLEEGFINRQLS--------LFGE-IILLDVISFPY-----KISCICLYRDDLLVAIEDGTLSRIKWNGSLLYNQEFNLTSISFFSDLEFSKASNLSKNEAICRNIEWLPSLSGVIVLFKNGKSAFLHIPNHKLLSEQITGVWAENLRNVTCSAVNVKFRSIAYGLKIGEAVIYKTDEETGALRLQHRLKILSNEYPDADKVTGAVTYLKWSPDNFCLALCWEYIGFSLWSVQGSLLFSSLGNKAGI--------DMSLLSLDWGCEGYSLWLI-----------EKPD--------KSGKPAILIFQMAKSVLVVNPTKNNHEHXXXXXXXHIIF-----------GPRKLLSSSETNL---------------EYIPYPENYVTWNWPIKYAAIDLNGSRLVISGKHGFALYFFVSKKWRLFGNETQERTIEVSGGIVWYNHIVGLACFDNKEGKFEIRLYDSLQKIDNSLSTNHPVNSQILLMNIFDNTLVVLSIDGSIGLFEITLNEKSHDISMEY--IQTIPLENYIEFAACIVSFNLSSLHTEIGHNKDVDELIRYQSLLINYSGHLLLFQRDKSFSAPRTSDKSLNSQENSFFKLAFKNTLIAKQKITFTGPLVVAYNVEIMW-TPIIDEEFQSKRLKLDDWNAKIYTMENSLWLNCGSQGLRVWLPLNGGSNVTQVGEKKSKYSFLSKRIMLTFKIRNFYPLVVLNNEALLMSPMNEFSNDFVNTPTCLNLSFSSINKNRHIFLQHIVKELLRINLGIHALDLTFELKKLPYFNHSXXXXXXXXXXXXATSKEPIPDPLLPRVVAFIQEFPNFLRTVVQCARKTELALWSYLFESAGNPKDLFESCLMNNELDTAASYLIILQNIEHPLISQKQAILLLDAALNRSNWGLVSNLIRFLKNI 2864
            MY+    PK +S    H +P     I+S++  +L AI   + + ++  K    +  + R E S+  +G +   EW  D S+IAI T KG++L + V+   ++ NVG        ++G   R L         L GE I  L V    Y      ++C+   RDDLL++   G + RI+W+G        N+ ++ F +DL+FS+AS + +      ++E+ P L G   +  NG++AFL + + K    QI GVWA+ + N +C  VN K+R +A+GLK GE ++Y  DE TGAL++ HRL + S +YPDA  V G++T++KW+PD   LA  WE  GF++WSV G+LLF SLG   G+         + + S++WG EGY LW++           E P         K     IL  Q  KS L VNP  +NH+HL L     +              P++ L  S+                  + I  P NY+  NWPI+YAAID  G  + ++GK+G A Y   ++KW+LFGNETQE+ + VSGG+ W+   V +AC++    + EIRLY    K+DN  +T   V SQ+LL+N F + L+VL  D  I +F I       + ++E   IQ + +  +I   A + +  L+SL TE    +     +  +S+L+N +G LL+FQRD+S                    +A K+    +Q + FT P++VA  VE +W TP ++ E             K + +E +LWL CG+ G++VWLPL    +V       S + F+SKRIML F++ + YPL VL  +A+++   N+ +    +T    NL F ++ +   I+L HI+++LLR NLG HAL++     +LPYF H LELLLHEVLEEEATSK+PIPDPLLPRVVAFIQEFP FL+T+  CARKTE+ALW YLF + GNP+++FE C+++ +L TAASYLIILQN+E P++S++ A +LLD AL+ + W L  +L+RFLK I
Sbjct:    1 MYFPVGWPKYLSIPQDHPLPP--IYIVSNRDRSLFAILTGNSLCIWFCKPCVEILSFRRSENSVSEFGENRTAEWRPDSSMIAITTSKGYILFYKVE---EDENVGNHQSIYVQKDG--RRSLPPRKATGDLLNGEGIPALKVSQLSYIQIQGGVTCLLCVRDDLLLSTYTGYIQRIRWDGCSNGQMSVNVKTVPFSTDLQFSRASTVQEENVNIPHMEYSPLLGGFATVLSNGRAAFLTVTSAKFEPHQIQGVWAQEVNNASCVGVNHKYRLMAFGLKNGEGMVYSIDEITGALQVSHRLAVSSKDYPDASHVVGSMTHIKWTPDGCALAAAWENGGFAVWSVFGALLFCSLGGDYGLSEDSFKHHSLHIKSMEWGAEGYHLWVMASRCDTSQVNGELPSDTNCNGEIKEENQDILQLQFVKSSLTVNPCMSNHQHLFLQGEDRLYVNNGLERTIHQTSPKQQLHPSQPGYPSNQAPSFLMGSKQWQVITVPSNYLGSNWPIRYAAIDRAGQCVAVAGKYGLAHYALFNRKWKLFGNETQEKDMVVSGGLTWWRDFVCVACYNILGQRDEIRLYPRSSKLDNVFATVTKVPSQVLLLNTFRDILIVLCADSHIMMFSIDRKNTQPNPTVEINKIQEVAIGGFIPHPASVTAITLTSLRTETASVRSKQPAVEAESILLNVAGRLLMFQRDRS------------------LHVAVKDGSKQRQ-LPFTSPVMVASAVENVWSTPRLNSE-------------KKHLVE-ALWLGCGAHGMKVWLPLFPRDDV-------SAHGFMSKRIMLPFRV-DIYPLAVLFEDAVILGATNDAT--CYDTGPSDNLPFLTLERTSQIYLHHILRQLLRRNLGHHALEIAHCCTELPYFPHCLELLLHEVLEEEATSKDPIPDPLLPRVVAFIQEFPEFLQTIAHCARKTEIALWHYLFNTVGNPREMFEECMLSGKLKTAASYLIILQNLEKPIVSRQHATMLLDTALDHNEWELARDLVRFLKAI 971          
BLAST of RIC1 domain-containing protein vs. TrEMBL
Match: A0A210QAN5 (Protein RIC1-like OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT09064 PE=4 SV=1)

HSP 1 Score: 595.504 bits (1534), Expect = 0.000e+0
Identity = 373/1008 (37.00%), Postives = 555/1008 (55.06%), Query Frame = 3
Query:   21 MYYFFNCPKRI---SRHFVPSNITGIISSKSFALCAIFNSSQIIVFENKNNSIVAYYCRCEESLDIYGNSINLEWNSDGSLIAIGTDKGFLLIFSVKTVSQEVNVGYQNEKEFLEEGFINRQLSLFGEIILLDVIS-------FPYKIS-----CICLYRDDLLVAIEDGTLSRIKWNGSLLYNQEFNLTSISFFSDLEFSKASNLSKNEAICRNIEWLPSLSGVIVLFKNGKSAFLHIPNHKLLSEQITGVWAENLRNVTCSAVNVKFRSIAYGLKIGEAVIYKTDEETGALRLQHRLKILSNEYPDADKVTGAVTYLKWSPDNFCLALCWEYIGFSLWSVQGSLLFSSLGNK-----AGIDM---SLLSLDWGCEGYSLWLIEKPDKSGKPA------------ILIFQMAKSVLVVNPTKNNHEHXXXXXXXHIIFGP----RKLLSSSETNL-------EYIPYPENYVTWNWPIKYAAIDLNGSRLVISGKHGFALYFFVSKKWRLFGNETQERTIEVSGGIVWYNHIVGLACFDNKEGKFEIRLYDSLQKIDNSLSTNHPVNSQILLMNIFDNTLVVLSIDGSIGLFEITL-NEKSHDI-SMEYIQTIPLENYIEFAACIVSFNLSSLHTEIG----HNKDVDELIRYQSLLINYSGHLLLFQRDKSFSAPRTSDKSLNSQENSFFKLAFKNTLIAKQKITFTGPLVVAYNVEIMWTPIIDEEFQSKRLKLDDWNAKIYTMENSLWLNCGSQGLRVWLPLNGGSNVTQVGEKKSKYSFLSKRIMLTFKIRNFYPLVVLNNEALLMSPMNEFSNDFVNTPTCLN--------LSFSSINKNRHIFLQHIVKELLRINLGIHALDLTFELKKLPYFNHSXXXXXXXXXXXXATSKEPIPDPLLPRVVAFIQEFPNFLRTVVQCARKTELALWSYLFESAGNPKDLFESCLMNNELDTAASYLIILQNIEHPLISQKQAILLLDAALNRSNWGLVSNLIRFLKNI 2864
            MY+    PK +    R+  P  +  +IS+    L A+     + ++  K    +  Y + +  L   G     EW  D S+IA+ T K  ++ F V     +++V   +     +EG  +        I   D +        F  K+S     C+C+ R++L+VA  DG+L+R+KWNG+L       L  I    D + +KA+ L+ ++    ++E+ P + G I++  +G+  F+  P+ ++ +    GVW ++L++  C  VN ++R +A+G   G   +Y  +E  G L L H+L + S +YPDA +  G V  LKW+PD   LA+CW   GFSLWSV GSLL  SLG        G+ +    + SL+WG EGY LW++ +  ++ +              I+  Q  KS L VNP   NHEH+ L     +        +K    +E++L       + IP   +Y+  NWPI+YAA+D +G  L ++GK G A Y F+++KW+LFGNETQER + VSGG+ W+   + +AC++    + EI+ Y    K+DN+ + +  V SQ+LL+N F + L+V  ID  I L+ +   N +S+ +  +  +Q + L NY+    C+    L+SL TE G    HN    E     SLL++ +G LL+FQRD   S P+ +D+ LN  ++              +   F  P VVA NVE MWT        + R        K+  ME +LWL CG+QG++VWLPL          ++    SF+SKRIML F++ + YPL VL  +A+++    +      N+P+           L F  + +   I+L HI+++LLR NLG++ALDL     +L YF H LELLLHEVLE EAT+KEPIPDPLLPR+VAFIQEFP FL+TVV CARKTE+ALW YLF S GNPKDLF+ CL++  L+TAASYLIILQN+E P++S++ A LLLD++L +  W L  +L+RFLK I
Sbjct:    1 MYFPIGWPKYLKEAQRNSPP--LQYVISNCDRMLFAVLTEDTLSIWYCKPTVQIVNYTQSQRDLASLGGFCLAEWKPDSSMIAVMTTKQHVMFFKVDL---DISVANHHCLYVQQEGRAHPSKQDLNGIPDSDSVPAIKLTAVFQLKLSSQITWCLCV-REELVVATADGSLNRVKWNGTLNAKARLVLQDIPVSLDFQKTKAAKLTADDGHVVHMEYSPIIGGYIMVLSSGRGLFVMPPSSRVDNSVAQGVWVQDLKDANCLCVNHRYRLMAFGCCSGHGHVYVINELEGTLELSHKLTVSSRDYPDAAQTAGPVRCLKWTPDGTALAMCWRNGGFSLWSVFGSLLVCSLGGDYCFPNDGVRLFPPPIRSLEWGLEGYQLWMVCETVETEEEGYVGYHGHRDMSHIMQLQFVKSALTVNPCMANHEHVFLQGEDKLYMNTSDVSQKSTGRTESHLLVGNKHWQIIPISHSYLATNWPIRYAAVDRSGQYLAVAGKTGLAHYNFLNRKWKLFGNETQERDLVVSGGMAWWKDFICVACYNIVGQRDEIKCYPRSSKLDNTFAISTKVPSQVLLLNTFRDILIVFCIDSHIMLYNLERKNTQSNPLLDINKVQEVSLNNYVPHPVCVTGLALTSLKTEYGTRSHHNNKEAE-----SLLLSVAGKLLMFQRD--ISGPQVNDQKLNQTKH--------------KPPQFCPPSVVATNVENMWT--------TSRAN----QGKMQLME-ALWLGCGAQGMKVWLPL-------YPRDETKTLSFMSKRIMLPFRV-DIYPLAVLFEDAVILGAAGDALTYQHNSPSDAASPKKPTHYLPFCILERTSQIYLHHILRQLLRRNLGVNALDLARSCTELSYFPHVLELLLHEVLEAEATTKEPIPDPLLPRIVAFIQEFPEFLQTVVHCARKTEVALWPYLFSSVGNPKDLFQECLISGNLETAASYLIILQNLEKPIVSRQHATLLLDSSLEKGKWDLARDLVRFLKAI 960          
BLAST of RIC1 domain-containing protein vs. TrEMBL
Match: A0A433SRT5 (RIC1 domain-containing protein OS=Elysia chlorotica OX=188477 GN=EGW08_020296 PE=4 SV=1)

HSP 1 Score: 594.734 bits (1532), Expect = 0.000e+0
Identity = 371/1036 (35.81%), Postives = 558/1036 (53.86%), Query Frame = 3
Query:   21 MYYFFNCPKRISRHFVPSN----ITGIISSKSFALCAIFNSSQIIVFENKNNSIVAYYCRCEESLDIYGNSINLEWNSDGSLIAIGTDKGFLLIFSVKTVSQEVNVGYQNEKEF--LEEG--FINRQLSLFG----------EIILLDVISFPYKISCICLYRDDLLVAIEDGTLSRIKWNGSLLYNQEFNLTSISFFSDLEFSKASNLSKNEAICRNIEWLPSLSGVIVLFKNGKSAFLHIPNHKLLSEQITGVWAENLRNVTCSAVNVKFRSIAYGLKIGEAVIYKTDEETGALRLQHRLKILSNEYPDADKVTGAVTYLKWSPDNFCLALCWEYIGFSLWSVQGSLLFSSLGN--KAGID------MSLLSLDWGCEGYSLWLIEKPDKSGK----PA----------------------ILIFQMAKSVLVVNPTKNNHEHXXXXXXXHIIFGPRKLLS-----------------SSETNL----------EYIPYPENYVTWNWPIKYAAIDLNGSRLVISGKHGFALYFFVSKKWRLFGNETQERTIEVSGGIVWYNHIVGLACFDNKEGKFEIRLYDSLQKIDNSLSTNHPVNSQILLMNIFDNTLVVLSIDGSIGLFEITLN--EKSHDISMEYIQTIPLENYIEFAACIVSFNLSSLHTEIGHNKDVDELIRYQSLLINYSGHLLLFQRDKSFSAPRTSDKSLNSQENSFFKLAFKNTLIAKQKITFTGPLVVAYNVEIMWTPIIDEEFQSKRLKLDDWNAKIYTMENSLWLNCGSQGLRVWLPLNGGSNVTQVGEKKSKYSFLSKRIMLTFKIRNFYPLVVLNNEALLMSPMNEF------SNDFVNTPTCLNLSFSSINKNRHIFLQHIVKELLRINLGIHALDLTFELKKLPYFNHSXXXXXXXXXXXXATSKEPIPDPLLPRVVAFIQEFPNFLRTVVQCARKTELALWSYLFESAGNPKDLFESCLMNNELDTAASYLIILQNIEHPLISQKQAILLLDAALNRSNWGLVSNLIRFLKNIV 2867
            MY+    PKR+     PS     I+ I+SS    L A+ +   + ++ +K    +  +  C++     G+    EW  D SL+AI T +  ++   V     EV+   +N      ++EG   I  ++++ G          ++  +  +S    ISC    RD+L+VA  DG L+R++W G+       +L  I   +DL+  +A+ LS   +    +E+ P+L G  ++  +G++ F+  P+ +       GVWA+ + +    AVN ++R IA+G   G+ ++Y  DE  GAL + HRL I S E+PDA  + G VT +KW+PD   LAL W+  G SLWSV GSLL  +LG    +  D        ++S++WG EGY LW++ K     K    P                       +L FQ  KS L VNP  +NHEH+ L     +       +S                 SS  N+          + IP   +Y+  NWPI+YA++D  G  + ++GK GFA Y   S+KW+LFGNETQER + VSGGI W+   V LACF+ +  + EIR Y    K+DN+ +    V SQ+LL+N F + L+    D  + +F +     + +  + +  +Q I L ++I    C+    L+SL +E  + K        +S+L++ SG LL+FQRD+S   P+  ++              KN     + + F  P VVA +VE +WT        + R  +     K+  ME ++WL CGS G++VWLPL          ++   ++F+S+RIML F++ + YPL VL  +A+++    +       S+ + N    +++ F ++ +   I+L HI+++LLR NLG++ALDL    K+L YF H LELLLHEVLE EATSKEPIPDPLLPRVVAFIQEFP FL+T+V CARKTE+ALW YLF + GNPKDLFE CL+N +L+TAA+YLIILQN+E P++S++ A +LLD+AL+R  W L  +L+RFLK I 
Sbjct:    1 MYFPLGWPKRLK---TPSGDSVLISHIVSSCDRMLFAVISKKTLSIWYSKPCVQIVTFTPCQKLFSEIGHFCKGEWKPDSSLVAITTQQNVVVFIKV-----EVDTSVKNHHCLYVMQEGKTPITPKININGILDSDSVPAIKLTYMAHVSLQSHISCFLSVRDELVVATIDGCLNRLRWTGNKNEKATLHLNDIPVSADLQQFRATRLSSGNSHVCEMEYSPTLGGYSMVLSSGRAVFVIPPSSRGEKTNAHGVWAQEVNDAATVAVNHRYRLIAFGCFSGDGIVYHLDEAVGALEISHRLVISSKEFPDAGLIAGQVTCMKWTPDGTALALAWKNGGLSLWSVFGSLLLCTLGGDYSSSTDSGSLYPAPIVSMEWGLEGYHLWMVSKSVAQTKNGSDPGDNKHREEGDSESINAETNYCTQLLQFQFVKSALTVNPCMSNHEHVFLQGEDKLYMSTGDTMSRSNLHHNHSQQQKPNSGSSSINMGAGYIGNKQWQVIPISHSYLASNWPIRYASVDRAGQCVAVAGKTGFAHYALFSRKWKLFGNETQERDMVVSGGITWWKDFVCLACFNIQGQRDEIRCYPRTAKLDNTFAKVLQVQSQVLLLNTFRDMLITFCADSHVAMFSLERKNVQSNPSVQITKVQEISLTSFIPHPLCVAGLTLTSLMSESVNPKLHPSSKEAESMLVSVSGKLLMFQRDRS--GPQIKEE--------------KN---KHRPVPFCNPSVVATSVENLWT--------TTRANV----GKVQLME-AMWLGCGSHGMKVWLPLFPR-------DEGKAHNFMSRRIMLPFRV-DIYPLAVLFEDAVILGAACDVVSYTFSSSSYKN----MDMPFCTLERTSQIYLHHILRQLLRRNLGVNALDLARSCKELTYFPHVLELLLHEVLEAEATSKEPIPDPLLPRVVAFIQEFPEFLQTIVHCARKTEVALWPYLFSTVGNPKDLFEMCLLNKDLETAATYLIILQNLEKPIVSRQLATILLDSALDRGTWELCRDLVRFLKAIA 984          
BLAST of RIC1 domain-containing protein vs. TrEMBL
Match: V4A9V7 (RIC1 domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_123886 PE=4 SV=1)

HSP 1 Score: 588.956 bits (1517), Expect = 1.007e-180
Identity = 399/1122 (35.56%), Postives = 587/1122 (52.32%), Query Frame = 3
Query:   21 MYYFFNCPKRISRHFVPSN-ITGIISSKSFALCAIFNSSQIIVFENKNNSIVAYYCRCEESLDIYGNSINLEWNSDGSLIAIGTDKGFLLIFSVK---TVSQEVNVGYQNE------KEFLEEGFINRQLSLFGEIILLDVISFPYKISCICLYRDDLLVAIEDGTLSRIKWNGSLLYNQEFNLTSISFFSDLEFSKASNLSKNEAICRNIEWLPSLSGVIVLFKNGKSAFLHIPNHKLLSEQITGVWAENLRNVTCSAVNVKFRSIAYGLKIGEAVIYKTDEETGALRLQHRLKILSNEYPDADKVTGAVTYLKWSPDNFCLALCWEYIGFSLWSVQGSLLFSSLGNKAGI--DMSLL------SLDWGCEGYSLWLIEKPDKSGKP----------------AILIFQMAKSVLVVNPTKNNHEHXXXXXXXHIIFGPRKL-LSSSET--------------------NLEYIPYPENYVTWNWPIKYAAIDLNGSRLVISGKHGFALYFFVSKKWRLFGNETQERTIEVSGGIVWYNHIVGLACFDNKEGKFEIRLYDSLQKIDNSLSTNHPVNSQILLMNIFDNTLVVLSIDGSIGLFEITL--NEKSHDISMEYIQTIPLENYIEFAACIVSFNLSSLHTEIGHNKDVDELIRYQSLLINYSGHLLLFQRDKSF-SAPRTSDKSLNSQENSFFKLAFKNTLIAKQKITFTGPLVVAYNVEIMWTPIIDEEFQSKRLKLDDWNAKIYTMENSLWLNCGSQGLRVWLPLNGGSNVTQVGEKKSKYSFLSKRIMLTFKIRNFYPLVVLNNEALLMSPMNE---FSNDFVNTPTC-------LNLSFSSINKNRHIFLQHIVKELLRINLGIHALDLTFELKKLPYFNHSXXXXXXXXXXXXATSKEPIPDPLLPRVVAFIQEFPNFLRTVVQCARKTELALWSYLFESAGNPKDLFESCL-MNNELDTAASYLIILQNIEHPLISQKQAILLLDAALNRSNWGLVSNLIRFLKNIVEEVFKYEHARNEFKMIEKGNYKSTKETYSSFNTKKRYRSGGGIGMATSRQYSTGK------IKDIEILKSSKSAQNGNIDENCYDDLVFDSVGSK-INTLLSPN 3158
            MY+    PK +    V S+ I  I+SS    L A+ +   + ++ +K    +  + + +++L  +G  +  EW  D S+IA+ T    ++ + V+   +V     +  Q+E        F   G ++       ++I    ++    I+C    RD++L++  DG L+R+KWNG+       +L+ I    DL+  +AS L++++    N+E+ P+L G  ++  +GK+ FL  P+ +        V A++L +    AVN ++R IA+G   GE ++Y  DE  GAL + H+L I S E+PD   + G+V+ LKW+PD   LAL W+  GFSLWSV G+LL  +LG       D SLL      SL+WG EGY LW++ +     K                  ++ FQ  KS L VNP   NHEH+        + G  KL +S+S+T                    N + IP   NY   NWPI+Y+A+D  G  + ++GK GFA Y    +KW+LFGNETQER + VSGGI W+   + LAC++    + EIR Y    K+DN+ +    V SQ+LL+N F +TL++   D  + LF I     + +  + +  IQ + L N+I    C+    L+SL +E    K        +S+L+N SG LL+FQRD+S  S P   D+          KL         + + F  P VVA +VE +W         SK       + K+  ME +LWL CG+ G++VWLPL   +      E K+ ++F+SKRIML F + + YPL VL  +A+++   ++   + N F  +P          +L F  + +   I+L HI+++LLR NLG HALDL     +LPYF H LELLLH VLE EATSK PIPDPLLPRVVAFIQEFP FL+TVV CARKTE+ALW YLF + GNPKDLFE CL +   L+TAASYLIILQN+E+P +S++ A LLL+A+L  + W L  +L+RFL+ I           +  +M    NY+S              R+    G A SR     K      + D +++ S K  Q    +E   + +  D + S+    LLS N
Sbjct:    1 MYFPIGWPKYLKIDEVSSSPIRYIVSSCDRMLFAVISDDCLSLWYSKPCVKIVTHSQSKKTLAKFGTYMAAEWKPDSSMIAVITSNHHVVFYRVEIDISVPNHHCLYVQHEGKTPQNPRFNINGILDSDSVPAIKLIFETSVTLTTDIACCLCVRDEILISTVDGFLNRLKWNGNKNEKATLHLSDIPVSVDLQQFRASKLTESDGHAVNMEYSPTLGGYSLVLSSGKALFLIPPSTRAERATAHAVRAQDLSDAVTVAVNHRYRLIAFGCLTGEGIVYTIDEAVGALEVSHKLIISSKEFPDVGNIAGSVSCLKWTPDGTALALTWKNGGFSLWSVFGALLVCTLGGDYVFQKDSSLLYPYPVTSLEWGLEGYHLWMVCESATDSKSHTEDDLPSSSIESSKSELIQFQFVKSALSVNPCVGNHEHV-------FLQGEDKLYMSTSDTVSRHSPQPKGEQSNIDIGNKNWQVIPISHNYTAANWPIRYSAVDRAGQCIAVAGKTGFAHYALFHRKWKLFGNETQERDMVVSGGITWWKDFICLACYNIPGQQDEIRFYPRNCKLDNTFAHVCKVPSQVLLLNTFKDTLIIFCADSHVMLFGIERKNTQPNPTVVVHKIQEVSLSNFIPHPLCVAGLTLTSLTSESLLTKAQHTAKEAESMLLNVSGKLLMFQRDRSAQSKPSKGDER---------KL---------KPLPFYSPSVVATSVENIWA-------TSKAN-----SGKVQLME-ALWLGCGAHGMKVWLPLYPRN------EGKA-HNFMSKRIMLPFNV-DIYPLAVLFEDAVILGAASDAVFYENSFSASPPSNLDGGKIAHLPFCILERTSQIYLHHILRQLLRRNLGFHALDLARCCTELPYFPHVLELLLHGVLEAEATSKAPIPDPLLPRVVAFIQEFPEFLQTVVHCARKTEVALWPYLFSTVGNPKDLFEECLKVGGNLETAASYLIILQNLENPKVSRQHATLLLEASLESNCWELCRDLVRFLQAIDPNDVDSPPHGSVNRMSGSSNYQSI-------------RTASVAGDAISRDVPKPKEKLKQTVSDSKVISSKKPLQRTKSNEASAEKVYIDMILSRHARKLLSTN 1063          
BLAST of RIC1 domain-containing protein vs. TrEMBL
Match: R7TQG5 (RIC1 domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_227272 PE=4 SV=1)

HSP 1 Score: 588.956 bits (1517), Expect = 2.464e-180
Identity = 361/984 (36.69%), Postives = 541/984 (54.98%), Query Frame = 3
Query:   87 IISSKSFALCAIFNSSQIIVFENKNNSIVAYYCRCEESLDIYGNSINLEWNSDGSLIAIGTDKGFLLIFSVKTVSQEVNVGYQNEKEFLEEGFINRQLSLFGEIILLDVI-----------SFPYKISCICLYRDDLLVAIEDGTLSRIKWNGSLLYNQEFNLTSISFFSDLEFSKASNLSKNEAICRNIEWLPSLSGVIVLFKNGKSAFLHIPNHKLLSEQITGVWAENLRNVTCSAVNVKFRSIAYGLKIGEAVIYKTDEETGALRLQHRLKILSNEYPDADKVTGAVTYLKWSPDNFCLALCWEYIGFSLWSVQGSLLFSSLGNKAGIDMS---------LLSLDWGCEGYSLWLI-EKPD-----------KSGKPAILIFQMAKSVLVVNPTKNNHEHXXXXXXXHIIFGPRK----LLSSSE--------------TNLEYIPYPENYVTWNWPIKYAAIDLNGSRLVISGKHGFALYFFVSKKWRLFGNETQERTIEVSGGIVWYNHIVGLACFDNKEGKFEIRLYDSLQKIDNSLSTNHPVNSQILLMNIFDNTLVVLSIDGSIGLFEI-TLN-EKSHDISMEYIQTIPLENYIEFAACIVSFNLSSLHTEIGHNKDVDELIRYQSLLINYSGHLLLFQRDKSFSAPRTSDKSLNSQENSFFKLAFKNTLIAKQK-ITFTGPLVVAYNVEIMWTPIIDEEFQSKRLKLDDWNAKIYTMENSLWLNCGSQGLRVWLPLNGGSNVTQVGEKKSKYSFLSKRIMLTFKIRNFYPLVVLNNEALLMSPMNE-----FSNDFVNTPTCLNLSFSSINKNRHIFLQHIVKELLRINLGIHALDLTFELKKLPYFNHSXXXXXXXXXXXXATSKEPIPDPLLPRVVAFIQEFPNFLRTVVQCARKTELALWSYLFESAGNPKDLFESCLMNNELDTAASYLIILQNIEHPLISQKQAILLLDAALNRSNWGLVSNLIRFLKNI 2864
            I S++   L A+   S I ++  K    +  + R + S+  +G ++  +W  D S+IAI T KG++L + V+    + N     +KE  E  F  +Q S+  E+   D I             P  ++ +   R++L+VA   G L RI W+G +  +    L+SI F +DL+ S+AS L          ++ P L G  V+  NG++AF+     K     I GVWA+ +   T +A+N K+  +A+G +  E ++Y  DE TGAL + HRL + S E+PDA  + GAV+ LKW+PD   LA+ W   GFSLWSV G+LL  S+G ++G  +S         + SL+WGCEGY LWL+ ++PD               PA+      KS L +NP   NHEHL L     +   P +    L  SS                  + +P P  Y+  NWPI++AA++  G  + I+GK G A Y   S+KW+LFGNETQER + V+GG++W+   V  AC++  + + EIR Y    K+DN+ +    V SQI+L+N F + L+VL  D  I ++ I  +N + +  + +  IQ + + N+I   A +V+  L+S+ T+ G      ++   +S+++N +G LLLFQRD+  S P+                  K+   AK + + F  P++VA  VE MW               +  N +   +  +LWL CG+ G++VWLPL       +  ++  K  F+SKRIM+ F + + YPL +L    +++   +E      SND +         +  + +  H++L HI+++LL+ +LG+HAL++      LPYF H LELLLHEVLEEEATSKEPIPDPLLPRVVAF++EF +FL+TV  CARK+E+ALW YLF   G PKDLFE CL+  +L+TAASYLIILQN+E P+++++ A LLLDAAL   +W L  +L+RFL  I
Sbjct:   26 ICSNQDRLLFAVLTHSSISIWYCKPAVQIVCFRRSDNSVVEFGMNVCAKWKPDSSMIAIVTSKGYILFYQVEVELSKKNASLYIQKE--ERSFGGKQDSI--ELNNSDCIPALKLSQVAYSQVPGGVTSLVCLREELMVATRRGLLQRIHWDGIVNSDMTIELSSIPFSADLQHSRASMLDDRGIYVSRQDYSPLLGGFAVVLSNGRAAFITANTLKFEPSNIVGVWAQEVTEATTAAINHKYTLMAFGCQNAEGIVYHLDELTGALLVSHRLVVSSKEFPDAQTICGAVSELKWTPDGTALAMVWRKGGFSLWSVFGALLVHSMGVESGGSISDDLNTQLLRIQSLEWGCEGYHLWLLTDRPDNPSPSPPGKPSADPHPALHQLNFVKSALALNPCAGNHEHLFLQGEDKLYLNPEEGMPHLHKSSALPDSLAAAAAFIGNKQWQIVPLPHTYLAHNWPIRFAAVNAAGHCVAIAGKTGLAHYALYSRKWKLFGNETQERDMIVTGGLIWWKDFVCTACYNLLDQRDEIRFYPRDSKLDNTFAHIVRVPSQIMLINTFRDLLIVLCADCHIMIYSILRVNVQPNPTVQVSKIQEVAIGNFIPHPANVVALTLTSIRTDTGPASAPSDIPDAESIVVNVAGRLLLFQRDR--SGPQ-----------------LKSPKEAKDRPLPFCSPVMVASAVESMWL-------------CNHRNGRKQHLTEALWLCCGAAGVKVWLPL-----YPKEEQQNKKRGFMSKRIMIPFHV-DIYPLALLFEAGIMLGASSESLSYNASNDEI-------WPYLQLERTSHVYLHHILRQLLKRHLGVHALEIARTCTDLPYFLHVLELLLHEVLEEEATSKEPIPDPLLPRVVAFVEEF-DFLQTVAHCARKSEVALWQYLFSIVGTPKDLFEECLLEGKLETAASYLIILQNLEQPIVARQHATLLLDAALEHRHWDLARDLVRFLGAI 959          
BLAST of RIC1 domain-containing protein vs. Ensembl Cavefish
Match: RIC1 (RIC1 homolog, RAB6A GEF complex partner 1 [Source:NCBI gene;Acc:103035554])

HSP 1 Score: 544.273 bits (1401), Expect = 2.094e-167
Identity = 337/985 (34.21%), Postives = 514/985 (52.18%), Query Frame = 3
Query:  117 AIFNSSQIIVFENKNNSIVAYYCRCEESLDIYGNSINLEWNSDGSLIAIGTDKGFLLIFSVKTVSQEVNVGYQNEKEFLEE-------------GFINRQLSLFGEIILLDVISFPYKISCICLYRDDLLVAIEDGTLSRIKWNGSLLYNQEFNLTSISFFSDLEFSKASN-LSKNEAICRNIEWLPSLSGVIVLFKNGKSAFLHIPNHKLLSEQITGVWAENLRNVTCSAVNVKFRSIAYGLKIGEAVIYKTDEETGALRLQHRLKILSNEYPDADKVTGAVTYLKWSPDNFCLALCWEYIGFSLWSVQGSLLFSSLGNKAGI--------DMSLLSLDWGCEGYSLWLIEKPDKS-------GKPAILIFQMAKSVLVVNPTKNNHEHXXXXXXXHI---------IFGP-RKLLSSSETNLEYIPYP--------------------ENYVTWNWPIKYAAIDLNGSRLVISGKHGFALYFFVSKKWRLFGNETQERTIEVSGGIVWYNHIVGLACFDNKEGKFEIRLYDSLQKIDNSLSTNHPVNSQILLMNIFDNTLVVLSIDGSIGLFEITLNEKSHD--ISMEYIQTIPLENYIEFAACIVSFNLSSLHTEIGHN-KDVDELIRYQSLLINYSGHLLLFQRDKSFSAPRTSDKSLNSQENSFFKLAFKNTLIAKQKITFTGPLVVAYNVEIMWTPIIDEEFQSKRLKLDDWNAKIYTMENSLWLNCGSQGLRVWLPLNGGSNVTQVGEKKSKYSFLSKRIMLTFKIRNFYPLVVLNNEALLMSPMNEF-------SNDFVNTPTCLNLSFSSINKNRHIFLQHIVKELLRINLGIHALDLTFELKKLPYFNHSXXXXXXXXXXXXATSKEPIPDPLLPRVVAFIQEFPNFLRTVVQCARKTELALWSYLFESAGNPKDLFESCLMNNELDTAASYLIILQNIEHPLISQKQAILLLDAALNRSNWGLVSNLIRFLKNI 2864
            A+   +Q+ ++ ++ + +V  Y    ++   +G     EW  D S+IA+    G++L+F +        +G  ++K   E              G+   Q +    + +   +     I+ +   ++DLLV   DG L  + W+G     +  NL +ISF  DL+ S+    L  N    R++E+  +L G  V+F +G+  F+     +  +E + GVWA ++ + TC AVN K+R +A+G   G  ++Y  D  TG+++L H+L++    YPD    TG V  ++WSPD   + + WE  G SLWSV G+ L  +LG              + + S+ WG EGY LW+I   +          + +IL FQ  KS L VNP  +N E +LL     +         +  P   L  SS  +  +   P                      Y+  NWPI++AAID  G  L ++G+ GFA Y   ++KW+LFGN TQE+++ V+GG+ W+N  V +AC++  + + E+RLY     +DN+ ++   ++++ LL+N+F N +++   D SI L+ I   + S +   S+E +Q + +  YI     +VS  L+S+ TE G + K   +    +S+L+N +G L++ QRD+S    R  D   N                 K+ + F  P+V+A  VE +WT                 N K   +  +LWL+CG  G++VWLPL          + +  +SFLS+RIML F + N YPL VL  +AL++   NE        ++     P      F ++ +   I+L H++++LL  NLG  AL L      LPYF+H LEL++H VLEEEATS+EPIPDPLLP V  FI EFP FLRT+V CARKTE ALW+YLF + GNPKDLFE CLM  +LDTAASYLIILQN+E P +S++ A LL + AL +  W L  ++IRFLK I
Sbjct:   34 AVLAHTQLSIWFSRPSVLVVSYIESAKAAAQFGFYQQAEWKPDDSMIAVAAANGYVLLFDI--------IGGGDDKYLYEPVYPKGSPRVKVTPGYKEEQCAPALSLEMKKPVDLEAPITSLQSLQEDLLVCTADGYLHMLHWDGVRNGRRAVNLCTISFSLDLQSSRGGPCLDLNGVHVRDMEYCSTLDGFAVVFDDGRLGFMTPTASRFSTEHLQGVWAADVTDGTCVAVNNKYRLMAFGCASGSVLVYMIDNTTGSMQLSHKLELTPKHYPDIWNKTGPVKMIRWSPDCSVVMVTWECGGLSLWSVFGAHLICTLGEDFAYRLDGTKKDPLKISSMSWGAEGYHLWVISSSEGGVDESTELRQASILQFQFIKSALTVNPCTSNQEQVLLHGEDRLFLTCGDAAQVHSPVEPLRDSSPMHRPHTTPPLSQGLSTLLGHKHWHVVQIHSTYLESNWPIRFAAIDSAGQCLAVAGRRGFAHYSLFTRKWKLFGNITQEQSMTVTGGLAWWNDFVVVACYNFIDQQEELRLYHRSCNLDNAFASITKLHAETLLLNVFKNMVILFRTDCSICLYSIEKKQDSPNPFASVELLQEVSMSRYIPHPGLVVSVTLTSVRTETGISLKAPQQACTAESILLNLAGQLIMLQRDRSGPQVREKDAVPNQ----------------KKLLPFCPPVVLAQCVENVWTTCRT-------------NRKKRHLVEALWLSCGEAGMKVWLPLFPR-------DHRKPHSFLSRRIMLPF-LLNIYPLAVLFEDALVLGATNETLLYDNLGAHSSSEEPLESMFPFCTVERTSQIYLHHLLRQLLVRNLGEQALMLAQSCSSLPYFSHVLELMVHVVLEEEATSREPIPDPLLPTVAKFITEFPLFLRTIVHCARKTEFALWNYLFAAVGNPKDLFEECLMAQDLDTAASYLIILQNMEVPAVSRQHATLLFNTALEQGKWDLCRHMIRFLKAI 973          
BLAST of RIC1 domain-containing protein vs. Ensembl Cavefish
Match: RIC1 (RIC1 homolog, RAB6A GEF complex partner 1 [Source:NCBI gene;Acc:103035554])

HSP 1 Score: 493.426 bits (1269), Expect = 3.283e-149
Identity = 320/955 (33.51%), Postives = 496/955 (51.94%), Query Frame = 3
Query:  117 AIFNSSQIIVFENKNNSIVAYYCRCEESLDIYGNSINLEWNSDGSLIAIGTDKGFLLIFSVKTVSQEVNVGYQNEKEFLEE-------------GFINRQLSLFGEIILLDVISFPYKISCICLYRDDLLVAIEDGTLSRIKWNGSLLYNQEFNLTSISFFSDLEFSKASN-LSKNEAICRNIEWLPSLSGVIVLFKNGKSAFLHIPNHKLLSEQITGVWAENLRNVTCSAVNVKFRSIAYGLKIGEAVIYKTDEETGALRLQHRLKILSNEYPDADKVTGAVTYLKWSPDNFCLALCWEYIGFSLWSVQGSLLFSSLGNKAGI--------DMSLLSLDWGCEGYSLWLIEKP----DKSG---KPAILIFQMAKSVLVVNPTKNNHEHXXXXXXXHIIF---GPRKLLSSSETNLEYIPYPENYVTWNWPIKYAAIDLNGSRLVISGKHGFALYF---FVSKKWRLFGNETQERTIEVSGGIVWYNHIVGLACFDNKEGKFEIRLYDSLQKIDNSLSTNHPVNSQILLMNIFDNTLVVLSIDGSIGLFEITLNEKSHD--ISMEYIQTIPLENYIEFAACIVSFNLSSLHTEIGHN-KDVDELIRYQSLLINYSGHLLLFQRDKSFSAPRTSDKSLNSQENSFFKLAFKNTLIAKQKITFTGPLVVAYNVEIMWTPIIDEEFQSKRLKLDDWNAKIYTMENSLWLNCGSQGLRVWLPLNGGSNVTQVGEKKSKYSFLSKRIMLTFKIRNFYPLVVLNNEALLMSPMNE-FSNDFVNTPTCLNLSFSSINKNRHIFLQHIVKELLRINLGIHALDLTFELKKLPYFNHSXXXXXXXXXXXXATSKEPIPDPLLPRVVAFIQEFPNFLRTVVQCARKTELALWSYLFESAGNPKDLFESCLMNNELDTAASYLIILQNIEHPLISQKQAILLLDAALNRSNWGLVSNLIRFLKNI 2864
            A+   +Q+ ++ ++ + +V  Y    ++   +G     EW  D S+IA+    G++L+F +        +G  ++K   E              G+   Q +    + +   +     I+ +   ++DLLV   DG L  + W+G     +  NL +ISF  DL+ S+    L  N    R++E+  +L G  V+F +G+  F+     +  +E + GVWA ++ + TC AVN K+R +A+G   G  ++Y  D  TG+++L H+L++    YPD    TG V  ++WSPD   + + WE  G SLWSV G+ L  +LG              + + S+ WG EGY LW+I       D+S    + +IL FQ  KS L VNP  +N E +LL     +        ++ S  E   +  P    + T   P+        G   ++  KH   +     ++   W +     +E+++ V+GG+ W+N  V +AC++  + + E+RLY     +DN+ ++   ++++ LL+N+F N +++   D SI L+ I   + S +   S+E +Q + +  YI     +VS  L+S+ TE G + K   +    +S+L+N +G L++ QRD+S    R  D   N                 K+ + F  P+V+A  VE +WT                 N K   +  +LWL+CG  G++VWLPL          + +  +SFLS+RIML F + N YPL VL  +AL++   NE    D +  P      F ++ +   I+L H++++LL  NLG  AL L      LPYF+H LEL++H VLEEEATS+EPIPDPLLP V  FI EFP FLRT+V CARKTE ALW+YLF + GNPKDLFE CLM  +LDTAASYLIILQN+E P +S++ A LL + AL +  W L  ++IRFLK I
Sbjct:   34 AVLAHTQLSIWFSRPSVLVVSYIESAKAAAQFGFYQQAEWKPDDSMIAVAAANGYVLLFDI--------IGGGDDKYLYEPVYPKGSPRVKVTPGYKEEQCAPALSLEMKKPVDLEAPITSLQSLQEDLLVCTADGYLHMLHWDGVRNGRRAVNLCTISFSLDLQSSRGGPCLDLNGVHVRDMEYCSTLDGFAVVFDDGRLGFMTPTASRFSTEHLQGVWAADVTDGTCVAVNNKYRLMAFGCASGSVLVYMIDNTTGSMQLSHKLELTPKHYPDIWNKTGPVKMIRWSPDCSVVMVTWECGGLSLWSVFGAHLICTLGEDFAYRLDGTKKDPLKISSMSWGAEGYHLWVISSSEGGVDESTELRQASILQFQFIKSALTVNPCTSNQEQVLLHGEDRLFLTCGDAAQVHSPVEPLRDSSPMHRPHTTP--PLS------QGLSTLLGHKHWHVVQIHSTYLESNWPI-----REQSMTVTGGLAWWNDFVVVACYNFIDQQEELRLYHRSCNLDNAFASITKLHAETLLLNVFKNMVILFRTDCSICLYSIEKKQDSPNPFASVELLQEVSMSRYIPHPGLVVSVTLTSVRTETGISLKAPQQACTAESILLNLAGQLIMLQRDRSGPQVREKDAVPNQ----------------KKLLPFCPPVVLAQCVENVWTTCRT-------------NRKKRHLVEALWLSCGEAGMKVWLPLFPR-------DHRKPHSFLSRRIMLPF-LLNIYPLAVLFEDALVLGATNETLLYDNLGEPLESMFPFCTVERTSQIYLHHLLRQLLVRNLGEQALMLAQSCSSLPYFSHVLELMVHVVLEEEATSREPIPDPLLPTVAKFITEFPLFLRTIVHCARKTEFALWNYLFAAVGNPKDLFEECLMAQDLDTAASYLIILQNMEVPAVSRQHATLLFNTALEQGKWDLCRHMIRFLKAI 930          
BLAST of RIC1 domain-containing protein vs. Ensembl Nematostella
Match: EDO36179 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJG9])

HSP 1 Score: 494.967 bits (1273), Expect = 3.807e-154
Identity = 309/863 (35.81%), Postives = 461/863 (53.42%), Query Frame = 3
Query:  453 RDDLLVAIEDGTLSRIKWNGSLLYNQEFNLTSISFFSDLEFSKASNLSKNEAIC-RNIEWLPSLSGVIVLFKNGKSAFLHIPNHKLLSEQITGVWAENLRNVTCSAVNVKFRSIAYGLKIGEAVIYKTDEETGALRLQHRLKILSNEYPDADKVTGAVTYLKWSPDNFCLALCWEYI---GFSLWSVQGSLLFSSLGNKAGIDMSLL--------SLDWGCEGYSLWLIEKPDKSGKPA----------ILIFQMAKSVLVVNPTKNNHEHXXXXXXXHIIFGPRKLLSSSETNLE-----------------------------YIPYPENYVTWNWPIKYAAIDLNGSRLVISGKHGFALYFFVSKKWRLFGNETQERTIEVSGGIVWYNHIVGLACFDNKEGKFEIRLYDSLQKIDNSLSTNHPVNSQILLMNIFDNTLVVLSIDGSIGLFEITLNE---KSHDISMEYIQTIPLENYIEFAACIVSFNLSSLHTEIGHNKDVDELIRYQSLLINYSGHLLLFQRDKSFSAPRTSDKSLNSQENSFFKLAFKNTLIAKQKITFTGPLVVAYNVEIMWTPIIDEEFQSKRLKLDDWNAKIYTMENSLWLNCGSQGLRVWLPLNGGSNVTQVGEKKSKYSFLSKRIMLTFKIRNFYPLVVLNNEALLMSPMNEFSNDFVNTPTCLNLS-----FSSINKNRHIFLQHIVKELLRINLGIHALDLTFELKKLPYFNHSXXXXXXXXXXXXATSKEPIPDPLLPRVVAFIQEFPNFLRTVVQCARKTELALWSYLFESAGNPKDLFESCLMNNELDTAASYLIILQNIEHPLISQKQAILLLDAALNRSNWGLVSNLIRFLKNI 2864
            RD+L V   +G L R  W+G +   +   + SI F +D E ++A  L  +E +C R +E+ P L G  V+  +G+  FL   +      ++ GVWA++L   TC AVN ++R I +G   GE+ +Y  D+ TG L L H+L + S +YPDA   TG V  L W+PD   +A+ W +    G +LWSV GSLL  +LG   G              S+ WG EGY+L ++   + +G  A          I+  Q  KS L VNP  +NH HL L S   +      ++S S  N                                I  P +Y+  NWP++YAA+D +G  + ++GK G A Y   +++W+LFGN +QE++I   GG+ W+   + + C++      E+R Y  +  +DN+ +T+  + +   L+N+F + L+V S D  +  + +  ++    S  I +  +Q   L N++     ++   L+S          VD L   ++L+ N  G LL+ Q+DK+ +     DK   S++                 ++F+ P+V+A  VE  WT               D   K + ME +LWL CG+QG++VWLPL  G++       +   +FLSKRIML F++ N YPL VL  +A+++   NE       +P   +LS     F ++ +   ++L H++++LLR NLG  AL +      LPYF H LEL+LHEVLEEEAT+ EPIPD LLPRVV FIQEFP +L TVV CARKTE+ALWSYLF + GNP+DLF+ CL +  L+TAASYLIILQN+E P +S++ A +LLD AL  S W +  +L+RFL+ I
Sbjct:    6 RDELFVCSGNGLLQRFTWDGLIEAEETIPIHSIPFTNDFESARAVPL-DHEGVCFRAMEYSPLLGGFAVVLADGRGGFLSAESANFEPSEVIGVWAKDLTCATCCAVNHRYRLIVFGCTNGESHVYGFDDLTGGLILSHKLLLSSKDYPDAIHSTGGVQCLAWTPDGSAIAVSWSWASHGGLALWSVFGSLLMCTLGGDYGKSQEAFLHNPFHVKSMAWGAEGYNLVMVSAEEDNGSTAHSVILLHPGDIMQLQFVKSTLAVNPCMSNHNHLFLQSEECLYLNTGDMVSDSAENFRNCQGTGGSTSPLMTSSVGPSTLVSNKQWVVIQIPMSYLEANWPVRYAAVDKSGIHVAVAGKAGVAHYALNTRRWKLFGNISQEQSITCRGGLAWWKDFLIVPCYNFNSTNDEVRFYPRINNLDNAFATHVRLAAPAFLVNVFRDLLLVYSSDCRVLFYSMERSQTGPSSASIQVTRLQEFSLVNHVPHPLSVIHLTLTS------QVDGVDGLGGVEALIANVGGWLLMLQKDKAIA-----DKDKKSKQ-----------------VSFSSPVVLASCVENCWT---------SSTSCPD---KRHLME-ALWLGCGAQGMKVWLPLFPGND-------QRPPNFLSKRIMLPFQL-NIYPLAVLFQDAVVLGAANEPMPLDCLSPNPASLSPQPFPFCTLERTTQVYLHHVLRQLLRRNLGQQALKIANTCTDLPYFPHVLELMLHEVLEEEATASEPIPDALLPRVVEFIQEFPQYLETVVHCARKTEVALWSYLFSAVGNPRDLFKECLSSGRLETAASYLIILQNLEKPSVSKQHATILLDKALELSRWEISKDLVRFLRCI 818          
BLAST of RIC1 domain-containing protein vs. Ensembl Medaka
Match: RIC1 (RIC1 homolog, RAB6A GEF complex partner 1 [Source:NCBI gene;Acc:101155531])

HSP 1 Score: 531.176 bits (1367), Expect = 4.335e-163
Identity = 355/1116 (31.81%), Postives = 565/1116 (50.63%), Query Frame = 3
Query:   21 MYYFFNCPKRI----SRHFVPSNITGIISSKSFALCAIFNSSQIIVFENKNNSIVAYYCRCEESLDIYGNSINLEWNSDGSLIAIGTDKGFLLIFSVKTVSQEVNVGYQ------NEKEFLEEGFINRQLSLFGEIILLDVISFPYKISCICLYRDDLLVAIEDGTLSRIKWNGSLLYNQE-FNLTSISFFSDLEFSKAS-NLSKNEAICRNIEWLPSLSGVIVLFKNGKSAFLHIPNHKLLSEQITGVWAENLRNVTCSAVNVKFRSIAYGLKIGEAVIYKTDEETGALRLQHRLKILSNEYPDADKVTGAVTYLKWSPDNFCLALCWEYIGFSLWSVQGSLLFSSLG--------NKAGIDMSLLSLDWGCEGYSLWLI-----------------EKPDKSGKPAILIFQMAKSVLVVNPTKNNHEHXXXXXXXHIIF---GPRKLLSSSETNLEYIPYPEN-----------------------------------YVTWNWPIKYAAIDLNGSRLVISGKHGFALYFFVSKKWRLFGNETQERTIEVSGGIVWYNHIVGLACFDNKEGKFEIRLYDSLQKIDNSLSTNHPVNSQILLMNIFDNTLVVLSIDGSIGLFEITLNEKS--HDISMEYIQTIPLENYIEFAACIVSFNLSSLHTEIGHN-KDVDELIRYQSLLINYSGHLLLFQRDKSFSAPRTSDKSLNSQENSFFKLAFKNTLIAKQKITFTGPLVVAYNVEIMWTPIIDEEFQSKRLKLDDWNAKIYTMENSLWLNCGSQGLRVWLPLNGGSNVTQVGEKKSKYSFLSKRIMLTFKIRNFYPLVVLNNEALLMSPMNEF----SNDFVNTPTCLNLSFSSINKNRHIFLQHIVKELLRINLGIHALDLTFELKKLPYFNHSXXXXXXXXXXXXATSKEPIPDPLLPRVVAFIQEFPNFLRTVVQCARKTELALWSYLFESAGNPKDLFESCLMNNELDTAASYLIILQNIEHPLISQKQAILLLDAALNRSNWGLVSNLIRFLKNIVEEVFKYEHARNEFKMIEKGNYKSTKETYSSFNTKKRYRSGGGIGMATSRQYSTGK--IKDIEILKSSKSAQNGNIDENCYDDLVF 3116
            MY+    P+R+         P  I    SS+ F   A+ + +QI ++ ++ + ++  Y    ++   +G     EW  D S+IA+ T KG++L+F V     E N+ Y+      + +  +  G+   Q +    + +   +     I+ +   +++LLV   DG L  + W+G     ++   L++I    DL+ ++A  +L       R +E+  +L G  V+  +G+  F+   ++ ++++Q+ GVWA ++ + TC AVN K+R +A+G   G  ++Y  D  TG+++L H+L++    YPD    TGAV  + WSPD     + WE  G SLWSV G+ L  +LG              + + S+ WG EGY LW++                   P    +  IL F   KS L VNP  +N EH+LL     +      P ++ S+S+ +     +P +                                   Y+  NWPI++AAID  G  + ++G+ GFA Y   ++KW+LFGN TQE+ + V+GG+ W+N  V +AC++  + + ++RLY     +DN+ ++   +++  LL+N+F + +++   D SI L+ I    +      S+E +Q + +  YI   A +VS  L+S+ TE G   K   +    +S+++N +G L++ QRD+S   P+  +K              +   I K+ + F+ P+V+A  VE +WT                 N K   +  +LWL+CG  G++VWLPL          + +  +SFLS+RIML F I N YPL VL  +AL++   NE          + P      + ++ +   I+L HI+++LL  NLG  AL L      LPYF H +EL++H VLEEEATS+EPIPDPLLP V  FI EFP FL+T+V CARKTE ALW+YLF + GNPKDLFE CLM  +LDTAASYLIILQN+E P +S++ A LL + AL +  W L  ++IRFLK I              +M       ST+E  SS    + +R+       ++   STGK  ++    + +  SA+  +  EN Y D++ 
Sbjct:    1 MYFLTGWPRRLLCPLRSEEEPFQIQP--SSQRFYF-ALVSETQISIWFSRPSVLIVSYIESVKAAAQFGIYQKAEWKPDDSMIAVATAKGYILLFDVLGGGDERNL-YEPVYPKGSPRVKVTPGYKEEQCAPALSLEMKKPVDLEAPITSLQSLQENLLVCTADGYLHVLHWDGQGSNGRKAICLSTIPLSLDLQSARAGPSLDLEGVYIRCMEYCVTLDGFAVVLSDGRLGFITPLSNTIIADQLQGVWAADVSDGTCVAVNNKYRLMAFGCASGSVLVYMIDTTTGSMQLSHKLELTPKHYPDIYNKTGAVKVICWSPDCSVAMVTWECGGLSLWSVFGAHLICTLGEDFAHRSDGTKKEPLRISSMSWGAEGYHLWVLPSNQARRRKEEHSMEEDSPPHPFLRAGILQFHFIKSALTVNPCTSNQEHVLLHGEDRLYLTCGDPTQIHSTSDAHPRAHLHPHDGSPLHQPAHPDSSLSQGLSTLLGHKHWHVVQIHSTYLESNWPIRFAAIDTAGQCMAVAGRRGFAHYSLFTRKWKLFGNITQEQNMTVTGGLAWWNDFVVVACYNFTDQQEQLRLYQRSSNLDNAFASVTKLHADTLLLNVFRDMIILFRADCSICLYSIEKRNEGINQSASVELLQEVSMSRYIPHPALVVSVTLTSVRTETGITLKAPQQACTAESIMLNLAGQLIMLQRDRS--GPQVREK--------------ETPAINKKLLPFSPPVVLAQCVENVWTTCRS-------------NKKKRHLLEALWLSCGEAGMKVWLPLFPR-------DHRKPHSFLSRRIMLPFHI-NIYPLAVLFEDALVLGATNETVLYDGLQGSSEPLEALFPYCTVERTSQIYLHHILRQLLVRNLGEQALMLAQSCASLPYFPHVMELMVHVVLEEEATSREPIPDPLLPTVAKFITEFPLFLQTIVHCARKTEYALWNYLFAAVGNPKDLFEECLMAQDLDTAASYLIILQNMEVPAVSRQHATLLFNTALEKGKWDLCRHMIRFLKAI-----------GSGEMDTPPPTPSTQEP-SSTGAFEFFRNRSISLSQSADSISTGKFNLQKTFSMPTGSSAKGADCAENMYIDMML 1063          
BLAST of RIC1 domain-containing protein vs. Ensembl Medaka
Match: RIC1 (RIC1 homolog, RAB6A GEF complex partner 1 [Source:NCBI gene;Acc:101155531])

HSP 1 Score: 476.093 bits (1224), Expect = 1.042e-142
Identity = 331/1078 (30.71%), Postives = 535/1078 (49.63%), Query Frame = 3
Query:   21 MYYFFNCPKRI----SRHFVPSNITGIISSKSFALCAIFNSSQIIVFENKNNSIVAYYCRCEESLDIYGNSINLEWNSDGSLIAIGTDKGFLLIFSVKTVSQEVNVGYQNEKEFLEEGFINRQLSLFGEIILLDVISFPYKISCICLYRDDLLVAIEDGTLSRIKWNGSLLYNQE-FNLTSISFFSDLEFSKASNLSKNEAI-CRNIEWLPSLSGVIVLFKNGKSAFLHIPNHKLLSEQITGVWAENLRNVTCSAVNVKFRSIAYGLKIGEAVIYKTDEETGALRLQHRLKILSNEYPDADKVTGAVTYLKWSPDNFCLALCWEYIGFSLWSVQGSLLFSSLG--------NKAGIDMSLLSLDWGCEGYSLWLIE-----------------KPDKSGKPAILIFQMAKSVLVVNPTKNNHEHXXXXXXXHIIF---GPRKLLSSSETNLEYIPYPENYVTWNWPIKYAAIDLNGSRLVISGKHGFALYF---FVSKKWRLFGNETQERTIEVSGGIVWYNHIVGLACFDNKEGKFEIRLYDSLQKIDNSLSTNHPVNSQILLMNIFDNTLVVLSIDGSIGLFEITLNEKS--HDISMEYIQTIPLENYIEFAACIVSFNLSSLHTEIGHN-KDVDELIRYQSLLINYSGHLLLFQRDKSFSAPRTSDKSLNSQENSFFKLAFKNTLIAKQKITFTGPLVVAYNVEIMWTPIIDEEFQSKRLKLDDWNAKIYTMENSLWLNCGSQGLRVWLPLNGGSNVTQVGEKKSKYSFLSKRIMLTFKIRNFYPLVVLNNEALLMSPMNEF----SNDFVNTPTCLNLSFSSINKNRHIFLQHIVKELLRINLGIHALDLTFELKKLPYFNHSXXXXXXXXXXXXATSKEPIPDPLLPRVVAFIQEFPNFLRTVVQCARKTELALWSYLFESAGNPKDLFESCLMNNELDTAASYLIILQNIEHPLISQKQAILLLDAALNRSNWGLVSNLIRFLKNIVEEVFKYEHARNEFKMIEKGNYKSTKETYSSFNTKKRYRSGGGIGMATSRQYSTGK--IKDIEILKSSKSAQNGNIDENCYDDLVF 3116
            MY+    P+R+         P  I    SS+ F   A+ + +QI ++ ++ + ++  Y    ++   +G     EW  D S+IA+        I        E  V   + +  +  G+   Q +    + +   +     I+ +   +++LLV   DG L  + W+G     ++   L++I    DL+ ++A      E +  R +E+  +L G  V+  +G+  F+   ++ ++++Q+ GVWA ++ + TC AVN K+R +A+G   G  ++Y  D  TG+++L H+L++    YPD    TGAV  + WSPD     + WE  G SLWSV G+ L  +LG              + + S+ WG EGY LW++                   P    +  IL F   KS L VNP  +N EH+LL     +      P ++ S+S+ +     +P +    + P    +    G   ++  KH   +     ++   W +     +E+ + V+GG+ W+N  V +AC++  + + ++RLY     +DN+ ++   +++  LL+N+F + +++   D SI L+ I    +      S+E +Q + +  YI   A +VS  L+S+ TE G   K   +    +S+++N +G L++ QRD+S   P+  +K              +   I K+ + F+ P+V+A  VE +WT                 N K   +  +LWL+CG  G++VWLPL          + +  +SFLS+RIML F I N YPL VL  +AL++   NE          + P      + ++ +   I+L HI+++LL  NLG  AL L      LPYF H +EL++H VLEEEATS+EPIPDPLLP V  FI EFP FL+T+V CARKTE ALW+YLF + GNPKDLFE CLM  +LDTAASYLIILQN+E P +S++ A LL + AL +  W L  ++IRFLK I              +M       ST+E  SS    + +R+       ++   STGK  ++    + +  SA+  +  EN Y D++ 
Sbjct:    1 MYFLTGWPRRLLCPLRSEEEPFQIQP--SSQRFYF-ALVSETQISIWFSRPSVLIVSYIESVKAAAQFGIYQKAEWKPDDSMIAVAVSVYIFEITRGDKCEYECGVCRGSPRVKVTPGYKEEQCAPALSLEMKKPVDLEAPITSLQSLQENLLVCTADGYLHVLHWDGQGSNGRKAICLSTIPLSLDLQSARAGPSLDLEGVYIRCMEYCVTLDGFAVVLSDGRLGFITPLSNTIIADQLQGVWAADVSDGTCVAVNNKYRLMAFGCASGSVLVYMIDTTTGSMQLSHKLELTPKHYPDIYNKTGAVKVICWSPDCSVAMVTWECGGLSLWSVFGAHLICTLGEDFAHRSDGTKKEPLRISSMSWGAEGYHLWVLPSNQARRRKEEHSMEEDSPPHPFLRAGILQFHFIKSALTVNPCTSNQEHVLLHGEDRLYLTCGDPTQIHSTSDAHPRAHLHPHDGSPLHQPAHPDSSLSQGLSTLLGHKHWHVVQIHSTYLESNWPI-----REQNMTVTGGLAWWNDFVVVACYNFTDQQEQLRLYQRSSNLDNAFASVTKLHADTLLLNVFRDMIILFRADCSICLYSIEKRNEGINQSASVELLQEVSMSRYIPHPALVVSVTLTSVRTETGITLKAPQQACTAESIMLNLAGQLIMLQRDRS--GPQVREK--------------ETPAINKKLLPFSPPVVLAQCVENVWTTCRS-------------NKKKRHLLEALWLSCGEAGMKVWLPLFPR-------DHRKPHSFLSRRIMLPFHI-NIYPLAVLFEDALVLGATNETVLYDGLQGSSEPLEALFPYCTVERTSQIYLHHILRQLLVRNLGEQALMLAQSCASLPYFPHVMELMVHVVLEEEATSREPIPDPLLPTVAKFITEFPLFLQTIVHCARKTEYALWNYLFAAVGNPKDLFEECLMAQDLDTAASYLIILQNMEVPAVSRQHATLLFNTALEKGKWDLCRHMIRFLKAI-----------GSGEMDTPPPTPSTQEP-SSTGAFEFFRNRSISLSQSADSISTGKFNLQKTFSMPTGSSAKGADCAENMYIDMML 1021          
BLAST of RIC1 domain-containing protein vs. Planmine SMEST
Match: SMESG000044023.1 (SMESG000044023.1)

HSP 1 Score: 2805.01 bits (7270), Expect = 0.000e+0
Identity = 1412/1427 (98.95%), Postives = 1414/1427 (99.09%), Query Frame = 3
Query:   21 MYYFFNCPKRISRHFVPSNITGIISSKSFALCAIFNSSQIIVFENKNNSIVAYYCRCEESLDIYGNSINLEWNSDGSLIAIGTDKGFLLIFSVKTVSQEVNVGYQNEKEFLEEGFINRQLSLFGEIILLDVISFPYKISCICLYRDDLLVAIEDGTLSRIKWNGSLLYNQEFNLTSISFFSDLEFSKASNLSKNEAICRNIEWLPSLSGVIVLFKNGKSAFLHIPNHKLLSEQITGVWAENLRNVTCSAVNVKFRSIAYGLKIGEAVIYKTDEETGALRLQHRLKILSNEYPDADKVTGAVTYLKWSPDNFCLALCWEYIGFSLWSVQGSLLFSSLGNKAGIDMSLLSLDWGCEGYSLWLIEKPDKSGKPAILIFQMAKSVLVVNPTKNNHEHXXXXXXXHIIFGPRKLLSSSETNLEYIPYPENYVTWNWPIKYAAIDLNGSRLVISGKHGFALYFFVSKKWRLFGNETQERTIEVSGGIVWYNHIVGLACFDNKEGKFEIRLYDSLQKIDNSLSTNHPVNSQILLMNIFDNTLVVLSIDGSIGLFEITLNEKSHDISMEYIQTIPLENYIEFAACIVSFNLSSLHTEIGHNKDVDELIRYQSLLINYSGHLLLFQRDKSFSAPRTSDKSLNSQENSFFKLAFKNTLIAKQKITFTGPLVVAYNVEIMWTPIIDEEFQSKRLKLDDWNAKIYTMENSLWLNCGSQGLRVWLPLNGGSNVTQVGEKKSKYSFLSKRIMLTFKIRNFYPLVVLNNEALLMSPMNEFSNDFVNTPTCLNLSFSSINKNRHIFLQHIVKELLRINLGIHALDLTFELKKLPYFNHSXXXXXXXXXXXXATSKEPIPDPLLPRVVAFIQEFPNFLRTVVQCARKTELALWSYLFESAGNPKDLFESCLMNNELDTAASYLIILQNIEHPLISQKQAILLLDAALNRSNWGLVSNLIRFLKNIVEEVFKYEHARNEFKMIEKGNYKSTKETYSSFNTKKRYRSGGGIGMATSRQYSTGKIKDIEILKSSKSAQNGNIDENCYDDLVFDSVGSKINTLLSPNLNVDDNNDGLSFMCNQMHLIEENPDLNLSRKQIELSDLLFECSKNSVFEKEVDIILTQFALKNFQEYHLHNVMEFFVNIQLTEFQFVSWMIRERSCSKIQDPIQAFVNLHIDFKWPLTRESEDFNKMQSYTEFASKGDFFEVLCKIRNNKVMGLNRKKLRYLATMLIKADYYEWSFLVLLMLDDYEEILSIFKCFLMNVDKISKLFEIKDFINTIMNWNFDEKTTYMAXXXXXXXXXXXXYEEKISEMQIPKVDIISERSLSEVSPKTKEDLLILSPVSKHSSIALGQLIIDPVNIKENDLNHYFKQSESVDCKLDQISGNKQIKKVYFSKTKLTANDCKISENLRSAYGFSNSIQTVKTLDPLISSELEEKSFASSCFIS 4301
            MYYFFNCPKRISRHFV SNITGIISSKSFALCAIFNSSQIIVFENKNNSIVAYYCRCEESLDIYGNSINLEWNSDGSLIAIGTDKGFLLIFSVKTVSQEVNVGYQNEKEFLEEGFINRQLSLFGEIILLD +          LYRDDLLVAIEDGTLSRIKWNGSLLYNQEFNLTSISFFSDLEFSKASNLSKNEAICRNIEWLPSLSGVIVLFKNGKSAFLHIPNHKLLSEQITGVWAENLRNVTCSAVNVKFRSIAYGLKIGEAVIYKTDEETGALRLQHRLKILSNEYPDADKVTGAVTYLKWSPDNFCLALCWEYIGFSLWSVQGSLLFSSLGNKAGIDMSLLSLDWGCEGYSLWLIEKPDKSGKPAILIFQMAKSVLVVNPTKNNHEHLLLLSSSHIIFGPRKLLSSSETNLEYIPYPENYVTWNWPIKYAAIDLNGSRLVISGKHGFALYFFVSKKWRLFGNETQERTIEVSGGIVWYNHIVGLACFDNKEGKFEIRLYDSLQKIDNSLSTNHPVNSQILLMNIFDNTLVVLSIDGSIGLFEITLNEKSHDISMEYIQTIPLENYIEFAACIVSFNLSSLHTEIGHNKDVDELIRYQSLLINYSGHLLLFQRDKSFSAPRTSDKSLNSQENSFFKLAFKNTLIAKQKITFTGPLVVAYNVEIMWTPIIDEEFQSK LKLDDWNAKIYTMENSLWLNCGSQGLRVWLPLNGGSNVTQVGEKKSKYSFLSKRIMLTFKIRNFYPLVVLNNEALLMSPMNEFSNDFVNTPTCLNLSFSSINKNRHIFLQHIVKELLRINLGIHALDLTFELKKLPYFNHSLELLLHEVLEEEATSKEPIPDPLLPRVVAFIQEFPNFLRTVVQCARKTELALWSYLFESAGNPKDLFESCLMNNELDTAASYLIILQNIEHPLISQKQAILLLDAALNRSNWGLVSNLIRFLKNIVEEVFKYEHARNEFKMIEKGNYKSTKETYSSFNTKKRYRSGGGIGMATSRQYSTGKIKDIEILKSSKSAQNGNIDENCYDDLVFDSVGSKINTLLSPNLNVDDNNDGLSFMCNQMHLIEENPDLNLSRKQIELSDLLFECSKNSVFEKEVDIILTQFALKNFQEYHLHNVMEFFVNIQLTEFQFVSWMIRERSCSKIQDPIQAFVNLHIDFKWPLTRESEDFNKMQSYTEFASKGDFFEVLCKIRNNKVMGLNRKKLRYLATMLIKADYYEWSFLVLLMLDDYEEILSIFKCFLMNVDKISKLFEIKDFINTIMNWNFDEKTTYMAILSKIKSSIILLYEEKISEMQIPKVDIISERSLSEVSPKTKEDLLILSPVSKHSSIALGQLIIDPVNIKENDLNHYFKQSES+DCKLDQISGNKQIKKVYFSKTKLTANDCKISENLRSAYGFSNSIQTVKTLDPLISSELEEKSFASSCFIS
Sbjct:    1 MYYFFNCPKRISRHFVQSNITGIISSKSFALCAIFNSSQIIVFENKNNSIVAYYCRCEESLDIYGNSINLEWNSDGSLIAIGTDKGFLLIFSVKTVSQEVNVGYQNEKEFLEEGFINRQLSLFGEIILLDYM----------LYRDDLLVAIEDGTLSRIKWNGSLLYNQEFNLTSISFFSDLEFSKASNLSKNEAICRNIEWLPSLSGVIVLFKNGKSAFLHIPNHKLLSEQITGVWAENLRNVTCSAVNVKFRSIAYGLKIGEAVIYKTDEETGALRLQHRLKILSNEYPDADKVTGAVTYLKWSPDNFCLALCWEYIGFSLWSVQGSLLFSSLGNKAGIDMSLLSLDWGCEGYSLWLIEKPDKSGKPAILIFQMAKSVLVVNPTKNNHEHLLLLSSSHIIFGPRKLLSSSETNLEYIPYPENYVTWNWPIKYAAIDLNGSRLVISGKHGFALYFFVSKKWRLFGNETQERTIEVSGGIVWYNHIVGLACFDNKEGKFEIRLYDSLQKIDNSLSTNHPVNSQILLMNIFDNTLVVLSIDGSIGLFEITLNEKSHDISMEYIQTIPLENYIEFAACIVSFNLSSLHTEIGHNKDVDELIRYQSLLINYSGHLLLFQRDKSFSAPRTSDKSLNSQENSFFKLAFKNTLIAKQKITFTGPLVVAYNVEIMWTPIIDEEFQSKMLKLDDWNAKIYTMENSLWLNCGSQGLRVWLPLNGGSNVTQVGEKKSKYSFLSKRIMLTFKIRNFYPLVVLNNEALLMSPMNEFSNDFVNTPTCLNLSFSSINKNRHIFLQHIVKELLRINLGIHALDLTFELKKLPYFNHSLELLLHEVLEEEATSKEPIPDPLLPRVVAFIQEFPNFLRTVVQCARKTELALWSYLFESAGNPKDLFESCLMNNELDTAASYLIILQNIEHPLISQKQAILLLDAALNRSNWGLVSNLIRFLKNIVEEVFKYEHARNEFKMIEKGNYKSTKETYSSFNTKKRYRSGGGIGMATSRQYSTGKIKDIEILKSSKSAQNGNIDENCYDDLVFDSVGSKINTLLSPNLNVDDNNDGLSFMCNQMHLIEENPDLNLSRKQIELSDLLFECSKNSVFEKEVDIILTQFALKNFQEYHLHNVMEFFVNIQLTEFQFVSWMIRERSCSKIQDPIQAFVNLHIDFKWPLTRESEDFNKMQSYTEFASKGDFFEVLCKIRNNKVMGLNRKKLRYLATMLIKADYYEWSFLVLLMLDDYEEILSIFKCFLMNVDKISKLFEIKDFINTIMNWNFDEKTTYMAILSKIKSSIILLYEEKISEMQIPKVDIISERSLSEVSPKTKEDLLILSPVSKHSSIALGQLIIDPVNIKENDLNHYFKQSESIDCKLDQISGNKQIKKVYFSKTKLTANDCKISENLRSAYGFSNSIQTVKTLDPLISSELEEKSFASSCFIS 1417          
BLAST of RIC1 domain-containing protein vs. Planmine SMEST
Match: SMESG000044023.1 (SMESG000044023.1)

HSP 1 Score: 2777.27 bits (7198), Expect = 0.000e+0
Identity = 1403/1427 (98.32%), Postives = 1405/1427 (98.46%), Query Frame = 3
Query:   21 MYYFFNCPKRISRHFVPSNITGIISSKSFALCAIFNSSQIIVFENKNNSIVAYYCRCEESLDIYGNSINLEWNSDGSLIAIGTDKGFLLIFSVKTVSQEVNVGYQNEKEFLEEGFINRQLSLFGEIILLDVISFPYKISCICLYRDDLLVAIEDGTLSRIKWNGSLLYNQEFNLTSISFFSDLEFSKASNLSKNEAICRNIEWLPSLSGVIVLFKNGKSAFLHIPNHKLLSEQITGVWAENLRNVTCSAVNVKFRSIAYGLKIGEAVIYKTDEETGALRLQHRLKILSNEYPDADKVTGAVTYLKWSPDNFCLALCWEYIGFSLWSVQGSLLFSSLGNKAGIDMSLLSLDWGCEGYSLWLIEKPDKSGKPAILIFQMAKSVLVVNPTKNNHEHXXXXXXXHIIFGPRKLLSSSETNLEYIPYPENYVTWNWPIKYAAIDLNGSRLVISGKHGFALYFFVSKKWRLFGNETQERTIEVSGGIVWYNHIVGLACFDNKEGKFEIRLYDSLQKIDNSLSTNHPVNSQILLMNIFDNTLVVLSIDGSIGLFEITLNEKSHDISMEYIQTIPLENYIEFAACIVSFNLSSLHTEIGHNKDVDELIRYQSLLINYSGHLLLFQRDKSFSAPRTSDKSLNSQENSFFKLAFKNTLIAKQKITFTGPLVVAYNVEIMWTPIIDEEFQSKRLKLDDWNAKIYTMENSLWLNCGSQGLRVWLPLNGGSNVTQVGEKKSKYSFLSKRIMLTFKIRNFYPLVVLNNEALLMSPMNEFSNDFVNTPTCLNLSFSSINKNRHIFLQHIVKELLRINLGIHALDLTFELKKLPYFNHSXXXXXXXXXXXXATSKEPIPDPLLPRVVAFIQEFPNFLRTVVQCARKTELALWSYLFESAGNPKDLFESCLMNNELDTAASYLIILQNIEHPLISQKQAILLLDAALNRSNWGLVSNLIRFLKNIVEEVFKYEHARNEFKMIEKGNYKSTKETYSSFNTKKRYRSGGGIGMATSRQYSTGKIKDIEILKSSKSAQNGNIDENCYDDLVFDSVGSKINTLLSPNLNVDDNNDGLSFMCNQMHLIEENPDLNLSRKQIELSDLLFECSKNSVFEKEVDIILTQFALKNFQEYHLHNVMEFFVNIQLTEFQFVSWMIRERSCSKIQDPIQAFVNLHIDFKWPLTRESEDFNKMQSYTEFASKGDFFEVLCKIRNNKVMGLNRKKLRYLATMLIKADYYEWSFLVLLMLDDYEEILSIFKCFLMNVDKISKLFEIKDFINTIMNWNFDEKTTYMAXXXXXXXXXXXXYEEKISEMQIPKVDIISERSLSEVSPKTKEDLLILSPVSKHSSIALGQLIIDPVNIKENDLNHYFKQSESVDCKLDQISGNKQIKKVYFSKTKLTANDCKISENLRSAYGFSNSIQTVKTLDPLISSELEEKSFASSCFIS 4301
            MYYFFNCPKRISRHFV SNITGIISSKSFALCAIFNSSQIIVFENKNNSIVAYYCRCEESLDIYGNSINLEWNSDGSLIAIGTDKGFLLIFSVKTVSQEVNVGYQNEKEFLEEGFINRQLSLFGEIILLD +          LYRDDLLVAIEDGTLSRIKWNGSLLYNQEFNLTSISFFSDLEFSKASNLSKNEAICRNIEWLPSLSGVIVLFKNGKSAFLHIPNHKLLSEQITGVWAENLRNVTCSAVNVKFRSIAYGLKIGEAVIYKTDEETGALRLQHRLKILSNEYPDADKVTGAVTYLKWSPDNFCLALCWEYIGFSLWSVQGSLLFSSLGNKAGIDMSLLSLDWGCEGYSLWLIEKPDKSGKPAILIFQMAKSVLVVNPTKNNHEHLLLLSSSHIIFGPRKLLSSSETNLEYIPYPENYVTWNWPIKYAAIDLNGSRLVISGKHGFALYFFVSKKWRLFGNETQERTIEVSGGIVWYNHIVGLACFDNKEGKFEIRLYDSLQKIDNSLSTNHPVNSQILLMNIFDNTLVVLSIDGSIGLFEITLNEKSHDISMEYIQTIPLENYIEFAACIVSFNLSSLHTEIGHNKDVDELIRYQSLLINYSGHLLLFQRDKSFSAPRTSDKSLNSQENSFFKLAFKNTLIAKQKITFTGPLVVAYNVEIMWTPIIDEEFQSK LKLDDWNAKIYTMENSLWLNCGSQGLRVWLPLNGGSNVTQVGEKKSKYSFLSKRIMLTFKIRNFYPLVVLNNEALLMSPMNEFSNDFVNTPTCLNLSFSSINKNRHIFLQHIVKELLRINLGIHALDLTFELKKLPYFNHSLELLLHEVLEEEATSKEPIPDPLLPRVVAFIQEFPNFLRTVVQCARKTELALWSYLFESAGNPKDLFESCLMNNELDTAASYLIILQNIEHPLISQKQAILLLDAALNRSNWGLVSNLIRFLKNI         ARNEFKMIEKGNYKSTKETYSSFNTKKRYRSGGGIGMATSRQYSTGKIKDIEILKSSKSAQNGNIDENCYDDLVFDSVGSKINTLLSPNLNVDDNNDGLSFMCNQMHLIEENPDLNLSRKQIELSDLLFECSKNSVFEKEVDIILTQFALKNFQEYHLHNVMEFFVNIQLTEFQFVSWMIRERSCSKIQDPIQAFVNLHIDFKWPLTRESEDFNKMQSYTEFASKGDFFEVLCKIRNNKVMGLNRKKLRYLATMLIKADYYEWSFLVLLMLDDYEEILSIFKCFLMNVDKISKLFEIKDFINTIMNWNFDEKTTYMAILSKIKSSIILLYEEKISEMQIPKVDIISERSLSEVSPKTKEDLLILSPVSKHSSIALGQLIIDPVNIKENDLNHYFKQSES+DCKLDQISGNKQIKKVYFSKTKLTANDCKISENLRSAYGFSNSIQTVKTLDPLISSELEEKSFASSCFIS
Sbjct:    1 MYYFFNCPKRISRHFVQSNITGIISSKSFALCAIFNSSQIIVFENKNNSIVAYYCRCEESLDIYGNSINLEWNSDGSLIAIGTDKGFLLIFSVKTVSQEVNVGYQNEKEFLEEGFINRQLSLFGEIILLDYM----------LYRDDLLVAIEDGTLSRIKWNGSLLYNQEFNLTSISFFSDLEFSKASNLSKNEAICRNIEWLPSLSGVIVLFKNGKSAFLHIPNHKLLSEQITGVWAENLRNVTCSAVNVKFRSIAYGLKIGEAVIYKTDEETGALRLQHRLKILSNEYPDADKVTGAVTYLKWSPDNFCLALCWEYIGFSLWSVQGSLLFSSLGNKAGIDMSLLSLDWGCEGYSLWLIEKPDKSGKPAILIFQMAKSVLVVNPTKNNHEHLLLLSSSHIIFGPRKLLSSSETNLEYIPYPENYVTWNWPIKYAAIDLNGSRLVISGKHGFALYFFVSKKWRLFGNETQERTIEVSGGIVWYNHIVGLACFDNKEGKFEIRLYDSLQKIDNSLSTNHPVNSQILLMNIFDNTLVVLSIDGSIGLFEITLNEKSHDISMEYIQTIPLENYIEFAACIVSFNLSSLHTEIGHNKDVDELIRYQSLLINYSGHLLLFQRDKSFSAPRTSDKSLNSQENSFFKLAFKNTLIAKQKITFTGPLVVAYNVEIMWTPIIDEEFQSKMLKLDDWNAKIYTMENSLWLNCGSQGLRVWLPLNGGSNVTQVGEKKSKYSFLSKRIMLTFKIRNFYPLVVLNNEALLMSPMNEFSNDFVNTPTCLNLSFSSINKNRHIFLQHIVKELLRINLGIHALDLTFELKKLPYFNHSLELLLHEVLEEEATSKEPIPDPLLPRVVAFIQEFPNFLRTVVQCARKTELALWSYLFESAGNPKDLFESCLMNNELDTAASYLIILQNIEHPLISQKQAILLLDAALNRSNWGLVSNLIRFLKNI---------ARNEFKMIEKGNYKSTKETYSSFNTKKRYRSGGGIGMATSRQYSTGKIKDIEILKSSKSAQNGNIDENCYDDLVFDSVGSKINTLLSPNLNVDDNNDGLSFMCNQMHLIEENPDLNLSRKQIELSDLLFECSKNSVFEKEVDIILTQFALKNFQEYHLHNVMEFFVNIQLTEFQFVSWMIRERSCSKIQDPIQAFVNLHIDFKWPLTRESEDFNKMQSYTEFASKGDFFEVLCKIRNNKVMGLNRKKLRYLATMLIKADYYEWSFLVLLMLDDYEEILSIFKCFLMNVDKISKLFEIKDFINTIMNWNFDEKTTYMAILSKIKSSIILLYEEKISEMQIPKVDIISERSLSEVSPKTKEDLLILSPVSKHSSIALGQLIIDPVNIKENDLNHYFKQSESIDCKLDQISGNKQIKKVYFSKTKLTANDCKISENLRSAYGFSNSIQTVKTLDPLISSELEEKSFASSCFIS 1408          
The following BLAST results are available for this feature:
BLAST of RIC1 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RIC11.287e-16834.27RIC1 homolog, RAB6A GEF complex partner 1 [Source:... [more]
RIC19.980e-16734.27RIC1 homolog, RAB6A GEF complex partner 1 [Source:... [more]
RIC12.542e-15033.20RIC1 homolog, RAB6A GEF complex partner 1 [Source:... [more]
RIC11.912e-14734.48RIC1 homolog, RAB6A GEF complex partner 1 [Source:... [more]
RIC13.079e-4266.41RIC1 homolog, RAB6A GEF complex partner 1 [Source:... [more]
back to top
BLAST of RIC1 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
R06F6.83.715e-10726.81Guanine nucleotide exchange factor subunit R06F6.8... [more]
R06F6.81.150e-10627.71Guanine nucleotide exchange factor subunit R06F6.8... [more]
back to top
BLAST of RIC1 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Rich1.330e-13831.62gene:FBgn0028500 transcript:FBtr0078512[more]
Rich1.330e-13831.62gene:FBgn0028500 transcript:FBtr0334751[more]
back to top
BLAST of RIC1 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
RIC17.855e-14432.99RIC1 homolog, RAB6A GEF complex partner 1 [Source:... [more]
back to top
BLAST of RIC1 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nsun31.787e-16734.01NOP2/Sun RNA methyltransferase family member 3 [So... [more]
nsun35.619e-16633.99NOP2/Sun RNA methyltransferase family member 3 [So... [more]
nsun31.617e-16534.01NOP2/Sun RNA methyltransferase family member 3 [So... [more]
nsun36.789e-16435.54NOP2/Sun RNA methyltransferase family member 3 [So... [more]
nsun31.286e-16333.64NOP2/Sun RNA methyltransferase family member 3 [So... [more]
back to top
BLAST of RIC1 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Ric11.301e-16233.89RAB6A GEF complex partner 1 [Source:MGI Symbol;Acc... [more]
Ric14.591e-14334.05RAB6A GEF complex partner 1 [Source:MGI Symbol;Acc... [more]
Ric11.073e-4266.41RAB6A GEF complex partner 1 [Source:MGI Symbol;Acc... [more]
back to top
BLAST of RIC1 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q4ADV7|RIC1_HUMAN4.793e-16634.27RAB6A-GEF complex partner protein 1 OS=Homo sapien... [more]
sp|Q69ZJ7|RIC1_MOUSE7.975e-16233.89RAB6A-GEF complex partner protein 1 OS=Mus musculu... [more]
sp|Q9V3C5|RIC1_DROME1.334e-13731.62Guanine nucleotide exchange factor subunit Rich OS... [more]
sp|Q09417|RIC1_CAEEL4.725e-10626.81Guanine nucleotide exchange factor subunit R06F6.8... [more]
sp|O42656|RIC1_SCHPO4.042e-2424.66Guanine nucleotide exchange factor subunit ric1 OS... [more]
back to top
BLAST of RIC1 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3JAU30.000e+037.90RAB6A-GEF complex partner protein 1 OS=Lingula ung... [more]
A0A210QAN50.000e+037.00Protein RIC1-like OS=Mizuhopecten yessoensis OX=65... [more]
A0A433SRT50.000e+035.81RIC1 domain-containing protein OS=Elysia chlorotic... [more]
V4A9V71.007e-18035.56RIC1 domain-containing protein OS=Lottia gigantea ... [more]
R7TQG52.464e-18036.69RIC1 domain-containing protein OS=Capitella teleta... [more]
back to top
BLAST of RIC1 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
RIC12.094e-16734.21RIC1 homolog, RAB6A GEF complex partner 1 [Source:... [more]
RIC13.283e-14933.51RIC1 homolog, RAB6A GEF complex partner 1 [Source:... [more]
back to top
BLAST of RIC1 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RIC1 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RIC1 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO361793.807e-15435.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of RIC1 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
RIC14.335e-16331.81RIC1 homolog, RAB6A GEF complex partner 1 [Source:... [more]
RIC11.042e-14230.71RIC1 homolog, RAB6A GEF complex partner 1 [Source:... [more]
back to top
BLAST of RIC1 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000044023.10.000e+098.95SMESG000044023.1[more]
SMESG000044023.10.000e+098.32SMESG000044023.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019230 ID=SMED30019230|Name=RIC1 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=4721bp
TTTAAACTAATTGTTGTAAAATGTATTATTTCTTCAACTGCCCTAAAAGG
ATTTCAAGACATTTTGTTCCGTCTAATATTACTGGTATAATAAGTTCTAA
AAGTTTTGCCCTTTGTGCAATTTTTAATTCTAGTCAAATAATAGTATTTG
AAAACAAGAATAATTCAATTGTAGCTTATTATTGCAGATGTGAGGAATCA
TTAGATATATATGGTAATTCTATTAACTTAGAATGGAATTCAGATGGCTC
TCTTATTGCAATAGGAACTGATAAGGGGTTTCTTTTAATCTTTTCAGTGA
AAACTGTTTCTCAAGAAGTTAATGTAGGATATCAAAATGAAAAAGAATTT
TTGGAAGAAGGATTTATAAACCGACAATTGTCTTTATTTGGTGAAATAAT
TCTTTTAGATGTAATATCTTTTCCCTATAAAATTTCTTGTATATGCCTAT
ATCGTGATGATTTATTAGTTGCTATTGAAGATGGAACCCTATCTCGTATT
AAATGGAATGGAAGCTTGTTGTATAATCAAGAATTTAACTTAACAAGCAT
TTCGTTTTTCAGTGATTTAGAGTTTTCAAAAGCTAGTAATTTATCTAAGA
ATGAAGCAATTTGCAGAAATATTGAGTGGTTACCAAGCTTGAGTGGAGTT
ATCGTTTTATTCAAAAATGGAAAATCAGCATTTCTCCACATACCTAATCA
TAAATTATTGAGTGAACAAATAACTGGGGTTTGGGCTGAAAACCTCAGAA
ATGTAACATGTTCTGCAGTTAATGTTAAATTTCGTTCCATAGCTTACGGC
TTAAAAATCGGAGAAGCTGTTATTTATAAAACGGACGAGGAAACAGGAGC
TTTGCGCCTTCAACACAGATTAAAAATATTATCCAATGAATATCCTGATG
CGGATAAAGTGACTGGCGCAGTTACTTATTTGAAATGGAGCCCCGATAAC
TTCTGCCTTGCTCTGTGTTGGGAATATATAGGTTTTAGTTTGTGGTCAGT
TCAAGGCTCGTTGCTATTTAGTTCTCTGGGTAATAAAGCCGGGATCGATA
TGAGTCTTTTAAGTCTAGATTGGGGTTGTGAAGGCTATTCTCTGTGGCTT
ATCGAGAAACCCGATAAATCCGGCAAGCCAGCAATTCTCATTTTTCAGAT
GGCTAAAAGTGTGCTTGTAGTCAATCCAACAAAAAATAATCATGAGCACT
TGTTGCTTTTATCGTCATCACACATCATTTTTGGACCTAGAAAGCTTTTG
TCGAGTTCAGAAACTAATTTGGAATATATTCCCTATCCAGAAAATTACGT
AACTTGGAATTGGCCGATTAAATATGCAGCAATTGATTTAAATGGTAGTC
GACTAGTAATTTCTGGCAAACATGGATTTGCACTTTATTTTTTCGTTTCT
AAAAAATGGAGACTTTTTGGAAATGAAACTCAAGAACGAACTATTGAGGT
TTCCGGTGGAATTGTCTGGTATAATCATATTGTCGGTTTAGCATGCTTCG
ATAACAAAGAAGGGAAATTTGAAATTCGATTGTATGATTCCTTACAAAAA
ATTGACAACAGTCTTTCTACTAATCATCCTGTAAATTCACAGATATTATT
GATGAATATTTTCGATAATACTCTAGTTGTATTATCCATTGATGGTTCTA
TCGGTTTGTTTGAAATAACTTTAAACGAAAAATCACATGACATTTCAATG
GAATATATTCAGACGATTCCGTTGGAAAATTATATTGAATTTGCTGCATG
TATTGTTTCTTTTAATTTATCATCGCTGCATACAGAAATCGGACACAATA
AAGACGTGGATGAACTAATTAGATATCAAAGCCTACTTATAAACTACAGT
GGGCATCTATTGCTGTTTCAACGGGATAAATCATTTTCAGCACCAAGAAC
ATCCGACAAGTCATTAAATTCTCAAGAAAATTCATTTTTCAAATTAGCAT
TTAAAAATACATTAATTGCTAAGCAGAAAATTACTTTTACTGGCCCATTA
GTTGTTGCATACAATGTAGAAATAATGTGGACGCCAATTATAGATGAAGA
ATTTCAATCTAAAAGGCTCAAACTTGATGACTGGAATGCAAAAATTTATA
CAATGGAAAATTCTCTATGGTTAAACTGTGGATCTCAGGGATTGAGGGTC
TGGCTTCCCCTTAATGGCGGCAGCAATGTTACTCAAGTTGGCGAAAAAAA
ATCAAAGTATTCATTTTTATCGAAAAGGATCATGTTAACTTTTAAAATCC
GAAATTTTTATCCATTGGTGGTACTAAATAATGAAGCATTGCTAATGTCT
CCGATGAATGAATTTTCCAATGATTTTGTCAATACTCCAACTTGTCTAAA
TTTATCATTTTCAAGCATCAATAAAAATCGACATATATTCTTACAGCATA
TTGTAAAAGAATTACTGAGAATCAACCTTGGTATACACGCGTTGGATTTG
ACTTTTGAATTAAAGAAATTGCCATATTTTAATCATTCACTTGAATTATT
ATTGCATGAAGTGCTTGAAGAAGAAGCGACATCAAAAGAGCCAATTCCAG
ATCCATTGTTACCGAGAGTCGTAGCTTTTATTCAAGAATTCCCAAATTTT
CTAAGAACAGTTGTTCAATGTGCAAGAAAAACTGAGTTAGCTTTATGGTC
TTATCTATTTGAAAGTGCAGGAAATCCAAAGGACTTATTCGAGAGTTGTC
TAATGAATAATGAATTAGATACAGCCGCTTCATACTTAATAATTCTTCAA
AATATCGAACATCCGTTAATCAGTCAAAAACAAGCTATTTTATTACTAGA
TGCAGCTCTCAATCGTTCTAATTGGGGTTTAGTCAGTAATTTGATTCGGT
TTTTAAAAAACATTGTCGAGGAAGTTTTTAAATACGAACATGCAAGAAAT
GAATTTAAAATGATTGAAAAAGGCAATTACAAATCAACTAAAGAAACGTA
CAGCTCTTTTAATACGAAAAAACGTTATAGATCAGGTGGCGGTATAGGAA
TGGCTACGTCTAGGCAATATTCCACCGGTAAAATTAAAGACATCGAAATT
TTGAAATCGTCAAAATCTGCTCAAAATGGAAATATTGATGAAAATTGTTA
CGATGATTTGGTATTTGATAGTGTGGGATCAAAGATAAACACATTACTTT
CACCAAATCTTAATGTTGATGACAATAATGACGGTCTTTCATTTATGTGC
AACCAAATGCACTTGATAGAAGAAAATCCCGATCTTAATCTATCTCGTAA
ACAGATTGAATTATCCGATTTGCTATTCGAGTGCAGTAAAAATAGTGTTT
TTGAAAAAGAAGTTGATATTATTTTGACTCAATTTGCTTTGAAAAACTTT
CAAGAATACCATTTACATAATGTTATGGAGTTTTTTGTTAATATTCAACT
CACTGAATTTCAATTTGTATCGTGGATGATTAGAGAGAGATCCTGTAGCA
AAATACAAGATCCTATTCAAGCCTTTGTGAATCTACATATTGATTTTAAA
TGGCCTTTAACAAGGGAATCCGAGGACTTTAACAAAATGCAATCTTACAC
AGAGTTTGCATCTAAAGGTGATTTTTTTGAGGTTTTGTGTAAAATTCGAA
ATAATAAAGTTATGGGGCTGAATAGAAAAAAACTAAGATATTTAGCAACT
ATGCTAATTAAAGCGGATTATTATGAATGGAGTTTCCTTGTGTTGCTGAT
GCTAGATGATTATGAAGAGATTTTATCAATATTTAAATGTTTCTTGATGA
ATGTTGATAAAATATCTAAGTTATTTGAAATAAAAGATTTTATAAATACA
ATTATGAATTGGAATTTCGATGAAAAAACTACATATATGGCTATTCTCAG
TAAAATTAAATCTTCAATAATATTATTGTATGAAGAAAAAATATCCGAAA
TGCAAATTCCCAAAGTAGATATCATTTCTGAAAGAAGTCTATCTGAAGTC
TCACCTAAAACTAAAGAGGATCTACTAATTTTATCTCCTGTTTCAAAACA
CTCCTCCATTGCATTGGGTCAATTAATAATTGATCCTGTTAATATTAAAG
AAAATGACTTGAACCATTATTTTAAACAAAGTGAATCAGTCGATTGTAAA
TTAGATCAGATTTCAGGTAATAAACAAATAAAAAAAGTCTACTTTTCAAA
AACCAAACTGACTGCCAATGATTGCAAAATCTCGGAAAATCTTAGAAGTG
CTTATGGGTTTTCTAATAGTATCCAGACCGTCAAAACACTAGATCCTTTG
ATATCTTCAGAATTAGAGGAAAAAAGCTTTGCCTCTAGTTGCTTTATTTC
TTGAATTCTTTAATAAATGAAATTCAGTGAGGATTTTTATTGTTTTGTTA
GTATTTTTATTTTGGTACAATCGACTTCCGGACTTATTGGGAATATTAAA
GGATTTGTTTTTCTGGATAATGATGAGTACAAACACCAATTTCTTGTACA
TAAACTAGGAAAAGGCGTTGGAATGCAACGGCTTCCTGTTTGTTATGAAG
TCGAATTTTAAATTCAAATTCACAATGCGGTTTAGCGTGCAGTGGCTTCT
TACTGACTATCATATGTATATCTATTCATATAATCATTATACTCTATATT
GCGAGGCTGTGATAAAACACACCAAAGCATTCAATTTTTATACACTGAGT
AGTAAACAGCATGTTATGTCAATAATTAAACTGAGTGGCGTCTCACAAAT
GCAATGCGGATAACAAAAGGC
back to top

protein sequence of SMED30019230-orf-1

>SMED30019230-orf-1 ID=SMED30019230-orf-1|Name=SMED30019230-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1428bp
MYYFFNCPKRISRHFVPSNITGIISSKSFALCAIFNSSQIIVFENKNNSI
VAYYCRCEESLDIYGNSINLEWNSDGSLIAIGTDKGFLLIFSVKTVSQEV
NVGYQNEKEFLEEGFINRQLSLFGEIILLDVISFPYKISCICLYRDDLLV
AIEDGTLSRIKWNGSLLYNQEFNLTSISFFSDLEFSKASNLSKNEAICRN
IEWLPSLSGVIVLFKNGKSAFLHIPNHKLLSEQITGVWAENLRNVTCSAV
NVKFRSIAYGLKIGEAVIYKTDEETGALRLQHRLKILSNEYPDADKVTGA
VTYLKWSPDNFCLALCWEYIGFSLWSVQGSLLFSSLGNKAGIDMSLLSLD
WGCEGYSLWLIEKPDKSGKPAILIFQMAKSVLVVNPTKNNHEHLLLLSSS
HIIFGPRKLLSSSETNLEYIPYPENYVTWNWPIKYAAIDLNGSRLVISGK
HGFALYFFVSKKWRLFGNETQERTIEVSGGIVWYNHIVGLACFDNKEGKF
EIRLYDSLQKIDNSLSTNHPVNSQILLMNIFDNTLVVLSIDGSIGLFEIT
LNEKSHDISMEYIQTIPLENYIEFAACIVSFNLSSLHTEIGHNKDVDELI
RYQSLLINYSGHLLLFQRDKSFSAPRTSDKSLNSQENSFFKLAFKNTLIA
KQKITFTGPLVVAYNVEIMWTPIIDEEFQSKRLKLDDWNAKIYTMENSLW
LNCGSQGLRVWLPLNGGSNVTQVGEKKSKYSFLSKRIMLTFKIRNFYPLV
VLNNEALLMSPMNEFSNDFVNTPTCLNLSFSSINKNRHIFLQHIVKELLR
INLGIHALDLTFELKKLPYFNHSLELLLHEVLEEEATSKEPIPDPLLPRV
VAFIQEFPNFLRTVVQCARKTELALWSYLFESAGNPKDLFESCLMNNELD
TAASYLIILQNIEHPLISQKQAILLLDAALNRSNWGLVSNLIRFLKNIVE
EVFKYEHARNEFKMIEKGNYKSTKETYSSFNTKKRYRSGGGIGMATSRQY
STGKIKDIEILKSSKSAQNGNIDENCYDDLVFDSVGSKINTLLSPNLNVD
DNNDGLSFMCNQMHLIEENPDLNLSRKQIELSDLLFECSKNSVFEKEVDI
ILTQFALKNFQEYHLHNVMEFFVNIQLTEFQFVSWMIRERSCSKIQDPIQ
AFVNLHIDFKWPLTRESEDFNKMQSYTEFASKGDFFEVLCKIRNNKVMGL
NRKKLRYLATMLIKADYYEWSFLVLLMLDDYEEILSIFKCFLMNVDKISK
LFEIKDFINTIMNWNFDEKTTYMAILSKIKSSIILLYEEKISEMQIPKVD
IISERSLSEVSPKTKEDLLILSPVSKHSSIALGQLIIDPVNIKENDLNHY
FKQSESVDCKLDQISGNKQIKKVYFSKTKLTANDCKISENLRSAYGFSNS
IQTVKTLDPLISSELEEKSFASSCFIS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006886intracellular protein transport
GO:0042147retrograde transport, endosome to Golgi
GO:0043547positive regulation of GTPase activity
GO:1903363negative regulation of cellular protein catabolic process
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR009771Ribosome_control_1
IPR017986WD40_repeat_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0017112Rab guanyl-nucleotide exchange factor activity
GO:0017137Rab GTPase binding
Vocabulary: cellular component
TermDefinition
GO:0005829cytosol
GO:0016020membrane
GO:0034066RIC1-RGP1 guanyl-nucleotide exchange factor complex
GO:0043234protein complex