SMED30019226

Overview
NameSMED30019226
Smed IDSMED30019226
Length (bp)1531
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30019226 (SMED30019226) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30019226 (SMED30019226) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30019226 (SMED30019226) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30019226 (SMED30019226) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019226

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30019226h1SMcG0000747 PL08004B1F04smed_ncbi_20240424PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30019226h1SMcG0000747 dd_Smed_v4_12313_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30019226h1SMcG0000747 dd_Smed_v4_12313_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30019226h1SMcG0000747 dd_Smed_v4_12313_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30019226 vs. Ensembl Human
Match: MDGA1 (MAM domain containing glycosylphosphatidylinositol anchor 1 [Source:HGNC Symbol;Acc:HGNC:19267])

HSP 1 Score: 51.9878 bits (123), Expect = 2.239e-6
Identity = 39/146 (26.71%), Postives = 63/146 (43.15%), Query Frame = 2
Query:  296 QLYDTGYYRCTATDALNNALNHSIFVYFLLINENRNLT--LVPDKSIPKSDYKIGNDLSFSCEAKSFKPNKAVSIQWLHSKLNSYKNISRSHFISNIIQTGFNETLESNPDAVRVFSNFSISHLQLVDNGTYKCKIEQDGTTVEQI 727
            Q  D+GYY CTAT+ + N    ++    LL+   +N T  + PD      + ++G DL  SC   +  P + V+ QW       +KN   +     ++ T       ++P+   V S+  +  L   D GTY C     G  V  +
Sbjct:  299 QARDSGYYNCTATNNVGNPAKKTV---NLLVRSMKNATFQITPDVIKESENIQLGQDLKLSCHVDAV-PQEKVTYQW-------FKNGKPARMSKRLLVT------RNDPELPAVTSSLELIDLHFSDYGTYLCMASFPGAPVPDL 427          
BLAST of SMED30019226 vs. Ensembl Human
Match: MDGA1 (MAM domain containing glycosylphosphatidylinositol anchor 1 [Source:HGNC Symbol;Acc:HGNC:19267])

HSP 1 Score: 51.9878 bits (123), Expect = 2.367e-6
Identity = 39/146 (26.71%), Postives = 63/146 (43.15%), Query Frame = 2
Query:  296 QLYDTGYYRCTATDALNNALNHSIFVYFLLINENRNLT--LVPDKSIPKSDYKIGNDLSFSCEAKSFKPNKAVSIQWLHSKLNSYKNISRSHFISNIIQTGFNETLESNPDAVRVFSNFSISHLQLVDNGTYKCKIEQDGTTVEQI 727
            Q  D+GYY CTAT+ + N    ++    LL+   +N T  + PD      + ++G DL  SC   +  P + V+ QW       +KN   +     ++ T       ++P+   V S+  +  L   D GTY C     G  V  +
Sbjct:  299 QARDSGYYNCTATNNVGNPAKKTV---NLLVRSMKNATFQITPDVIKESENIQLGQDLKLSCHVDAV-PQEKVTYQW-------FKNGKPARMSKRLLVT------RNDPELPAVTSSLELIDLHFSDYGTYLCMASFPGAPVPDL 427          
BLAST of SMED30019226 vs. Ensembl Human
Match: MDGA1 (MAM domain containing glycosylphosphatidylinositol anchor 1 [Source:HGNC Symbol;Acc:HGNC:19267])

HSP 1 Score: 51.9878 bits (123), Expect = 2.526e-6
Identity = 39/146 (26.71%), Postives = 63/146 (43.15%), Query Frame = 2
Query:  296 QLYDTGYYRCTATDALNNALNHSIFVYFLLINENRNLT--LVPDKSIPKSDYKIGNDLSFSCEAKSFKPNKAVSIQWLHSKLNSYKNISRSHFISNIIQTGFNETLESNPDAVRVFSNFSISHLQLVDNGTYKCKIEQDGTTVEQI 727
            Q  D+GYY CTAT+ + N    ++    LL+   +N T  + PD      + ++G DL  SC   +  P + V+ QW       +KN   +     ++ T       ++P+   V S+  +  L   D GTY C     G  V  +
Sbjct:  299 QARDSGYYNCTATNNVGNPAKKTV---NLLVRSMKNATFQITPDVIKESENIQLGQDLKLSCHVDAV-PQEKVTYQW-------FKNGKPARMSKRLLVT------RNDPELPAVTSSLELIDLHFSDYGTYLCMASFPGAPVPDL 427          
BLAST of SMED30019226 vs. Ensembl Mouse
Match: Mdga1 (MAM domain containing glycosylphosphatidylinositol anchor 1 [Source:MGI Symbol;Acc:MGI:1922012])

HSP 1 Score: 50.8322 bits (120), Expect = 3.619e-6
Identity = 39/146 (26.71%), Postives = 64/146 (43.84%), Query Frame = 2
Query:  296 QLYDTGYYRCTATDALNNALNHSIFVYFLLINENRNLT--LVPDKSIPKSDYKIGNDLSFSCEAKSFKPNKAVSIQWLHSKLNSYKNISRSHFISNIIQTGFNETLESNPDAVRVFSNFSISHLQLVDNGTYKCKIEQDGTTVEQI 727
            Q  D+GYY CTAT+ + N    ++    LL+   +N T  + PD      + ++G DL  SC   +  P + V+ QW       +KN   +     ++ T       ++P+   V S+  +  L   D GTY C     G+ V  +
Sbjct:  299 QARDSGYYNCTATNNVGNPAKKTV---NLLVRSLKNATFQITPDMIKESENIQLGQDLKLSCHVDAV-PQEKVNYQW-------FKNGKPARTSKRLLVT------RNDPELPAVTSSLELIDLHFSDYGTYLCMASFPGSPVPDL 427          
BLAST of SMED30019226 vs. Ensembl Mouse
Match: Mdga1 (MAM domain containing glycosylphosphatidylinositol anchor 1 [Source:MGI Symbol;Acc:MGI:1922012])

HSP 1 Score: 50.8322 bits (120), Expect = 3.770e-6
Identity = 39/146 (26.71%), Postives = 64/146 (43.84%), Query Frame = 2
Query:  296 QLYDTGYYRCTATDALNNALNHSIFVYFLLINENRNLT--LVPDKSIPKSDYKIGNDLSFSCEAKSFKPNKAVSIQWLHSKLNSYKNISRSHFISNIIQTGFNETLESNPDAVRVFSNFSISHLQLVDNGTYKCKIEQDGTTVEQI 727
            Q  D+GYY CTAT+ + N    ++    LL+   +N T  + PD      + ++G DL  SC   +  P + V+ QW       +KN   +     ++ T       ++P+   V S+  +  L   D GTY C     G+ V  +
Sbjct:  299 QARDSGYYNCTATNNVGNPAKKTV---NLLVRSLKNATFQITPDMIKESENIQLGQDLKLSCHVDAV-PQEKVNYQW-------FKNGKPARTSKRLLVT------RNDPELPAVTSSLELIDLHFSDYGTYLCMASFPGSPVPDL 427          
BLAST of SMED30019226 vs. Ensembl Mouse
Match: Mdga1 (MAM domain containing glycosylphosphatidylinositol anchor 1 [Source:MGI Symbol;Acc:MGI:1922012])

HSP 1 Score: 50.8322 bits (120), Expect = 4.433e-6
Identity = 41/146 (28.08%), Postives = 63/146 (43.15%), Query Frame = 2
Query:  296 QLYDTGYYRCTATDALNNALNHSIFVYFLLINENRNLT--LVPDKSIPKSDYKIGNDLSFSCEAKSFKPNKAVSIQWLHSKLNSYKNISRSHFISNIIQTGFNETLESNPDAVRVFSNFSISHLQLVDNGTYKCKIEQDGTTVEQI 727
            Q  D+GYY CTAT   NN  N +     LL+   +N T  + PD      + ++G DL  SC   +  P + V+ QW       +KN   +     ++ T       ++P+   V S+  +  L   D GTY C     G+ V  +
Sbjct:  573 QARDSGYYNCTAT---NNVGNPAKKTVNLLVRSLKNATFQITPDMIKESENIQLGQDLKLSCHVDAV-PQEKVNYQW-------FKNGKPARTSKRLLVT------RNDPELPAVTSSLELIDLHFSDYGTYLCMASFPGSPVPDL 701          
BLAST of SMED30019226 vs. Planmine SMEST
Match: SMESG000047314.1 (SMESG000047314.1)

HSP 1 Score: 858.981 bits (2218), Expect = 0.000e+0
Identity = 456/459 (99.35%), Postives = 457/459 (99.56%), Query Frame = 2
Query:    2 MNYLLNLIFPLFMLVIDFGVSANPCPNQSRSLNPTLLIEPPFTMSGIEGKYFCMKCCFDGFTKILWDFRKLRTTDWDSFYDAWRFENSNRTLCIKKPNQLYDTGYYRCTATDALNNALNHSIFVYFLLINENRNLTLVPDKSIPKSDYKIGNDLSFSCEAKSFKPNKAVSIQWLHSKLNSYKNISRSHFISNIIQTGFNETLESNPDAVRVFSNFSISHLQLVDNGTYKCKIEQDGTTVEQIYYALIIDVQIKWTXXXXXXXXXXXXXXXXXGIWHYRFDILVVYKTYFDMFPNNNTKEYDLSIIYQDDDFSSAQVAFKIVSFMECQNLHCWLFDRDKQYGQEILIDLSKILTHSHTVLILVXXXXXXXXXXXXXXXXXXXXPSVRRLYVWNPSKKAIVKTVRRFDSSAEKYLTRELNLQSFCHGFGFDWNSAENIKFYPLTSWIISSLPSLVIRKKFQ 1378
            MNYLLNLIFPLFMLVIDFGVSANPCPNQSRSLNPTLLIEPPFTMSGIEGKYFCM+CCFDGFTKILWDFRKLRTT WDSFYDAWRFENSNRTLCIKKPNQLYDTGYYRCTATDALNN LNHSIFVYFLLINENRNLTLVPDKSIPKSDYKIGNDLSFSCEAKSFKPNKAVSIQWLHSKLNSYKNISRSHFISNIIQTGFNETLESNPDAVRVFSNFSISHLQLVDNGTYKCKIEQDGTTVEQIYYALIIDVQIKWTLLLAILVVFLVLLSSAAGIWHYRFDILVVYKTYFDMFPNNNTKEYDLSIIYQDDDFSSAQVAFKIVSFMECQNLHCWLFDRDKQYGQEILIDLSKILTHSHTVLILVSLSSIQNDNLLSNLSSIQLNPSVRRLYVWNPSKKAIVKTVRRFDSSAEKYLTRELNLQSFCHGFGFDWNSAENIKFYPLTSWIISSLPSLVIRKKFQ
Sbjct:    1 MNYLLNLIFPLFMLVIDFGVSANPCPNQSRSLNPTLLIEPPFTMSGIEGKYFCMECCFDGFTKILWDFRKLRTTVWDSFYDAWRFENSNRTLCIKKPNQLYDTGYYRCTATDALNNGLNHSIFVYFLLINENRNLTLVPDKSIPKSDYKIGNDLSFSCEAKSFKPNKAVSIQWLHSKLNSYKNISRSHFISNIIQTGFNETLESNPDAVRVFSNFSISHLQLVDNGTYKCKIEQDGTTVEQIYYALIIDVQIKWTLLLAILVVFLVLLSSAAGIWHYRFDILVVYKTYFDMFPNNNTKEYDLSIIYQDDDFSSAQVAFKIVSFMECQNLHCWLFDRDKQYGQEILIDLSKILTHSHTVLILVSLSSIQNDNLLSNLSSIQLNPSVRRLYVWNPSKKAIVKTVRRFDSSAEKYLTRELNLQSFCHGFGFDWNSAENIKFYPLTSWIISSLPSLVIRKKFQ 459          
BLAST of SMED30019226 vs. Planmine SMEST
Match: SMESG000047314.1 (SMESG000047314.1)

HSP 1 Score: 835.099 bits (2156), Expect = 0.000e+0
Identity = 444/447 (99.33%), Postives = 445/447 (99.55%), Query Frame = 2
Query:   38 MLVIDFGVSANPCPNQSRSLNPTLLIEPPFTMSGIEGKYFCMKCCFDGFTKILWDFRKLRTTDWDSFYDAWRFENSNRTLCIKKPNQLYDTGYYRCTATDALNNALNHSIFVYFLLINENRNLTLVPDKSIPKSDYKIGNDLSFSCEAKSFKPNKAVSIQWLHSKLNSYKNISRSHFISNIIQTGFNETLESNPDAVRVFSNFSISHLQLVDNGTYKCKIEQDGTTVEQIYYALIIDVQIKWTXXXXXXXXXXXXXXXXXGIWHYRFDILVVYKTYFDMFPNNNTKEYDLSIIYQDDDFSSAQVAFKIVSFMECQNLHCWLFDRDKQYGQEILIDLSKILTHSHTVLILVXXXXXXXXXXXXXXXXXXXXPSVRRLYVWNPSKKAIVKTVRRFDSSAEKYLTRELNLQSFCHGFGFDWNSAENIKFYPLTSWIISSLPSLVIRKKFQ 1378
            MLVIDFGVSANPCPNQSRSLNPTLLIEPPFTMSGIEGKYFCM+CCFDGFTKILWDFRKLRTT WDSFYDAWRFENSNRTLCIKKPNQLYDTGYYRCTATDALNN LNHSIFVYFLLINENRNLTLVPDKSIPKSDYKIGNDLSFSCEAKSFKPNKAVSIQWLHSKLNSYKNISRSHFISNIIQTGFNETLESNPDAVRVFSNFSISHLQLVDNGTYKCKIEQDGTTVEQIYYALIIDVQIKWTLLLAILVVFLVLLSSAAGIWHYRFDILVVYKTYFDMFPNNNTKEYDLSIIYQDDDFSSAQVAFKIVSFMECQNLHCWLFDRDKQYGQEILIDLSKILTHSHTVLILVSLSSIQNDNLLSNLSSIQLNPSVRRLYVWNPSKKAIVKTVRRFDSSAEKYLTRELNLQSFCHGFGFDWNSAENIKFYPLTSWIISSLPSLVIRKKFQ
Sbjct:    1 MLVIDFGVSANPCPNQSRSLNPTLLIEPPFTMSGIEGKYFCMECCFDGFTKILWDFRKLRTTVWDSFYDAWRFENSNRTLCIKKPNQLYDTGYYRCTATDALNNGLNHSIFVYFLLINENRNLTLVPDKSIPKSDYKIGNDLSFSCEAKSFKPNKAVSIQWLHSKLNSYKNISRSHFISNIIQTGFNETLESNPDAVRVFSNFSISHLQLVDNGTYKCKIEQDGTTVEQIYYALIIDVQIKWTLLLAILVVFLVLLSSAAGIWHYRFDILVVYKTYFDMFPNNNTKEYDLSIIYQDDDFSSAQVAFKIVSFMECQNLHCWLFDRDKQYGQEILIDLSKILTHSHTVLILVSLSSIQNDNLLSNLSSIQLNPSVRRLYVWNPSKKAIVKTVRRFDSSAEKYLTRELNLQSFCHGFGFDWNSAENIKFYPLTSWIISSLPSLVIRKKFQ 447          
BLAST of SMED30019226 vs. Planmine SMEST
Match: SMESG000047320.1 (SMESG000047320.1)

HSP 1 Score: 80.1073 bits (196), Expect = 7.439e-16
Identity = 74/363 (20.39%), Postives = 156/363 (42.98%), Query Frame = 2
Query:   32 LFMLVIDFGVSANPCPNQSRSLNPTLLIEPPFTMSGIEGKYFCMKCCFDGFTKILWDFRKLRTTDWD-SFYDAWRFENSNRTLCIKKPNQLYDTGYYRCTATDALNNALNHSIFVYFLLINENRNLTLVPDKSIPKSDYKIGNDLSFSCEAKSFKPNKAVSIQWLHSKLNSYKNISRSHFISNIIQTG-------FNETLESNP--DAVRVFSNFSISHLQLVDNGTYKCKIEQDGTTVEQIYYALIIDVQIKWTXXXXXXXXXXXXXXXXXGIWHYRFDILVVYKTYFDMFPNNNTKEYDLS--IIYQDDDFSSAQVAFKIVSFMECQNLHCWLFDRDKQYGQEILIDLSKILTHSHTVLIL 1084
            + +L I F    +  PN +     T       + + I  KY  + CC  GFT I W+FR+ ++ +W  +    +   + NR +      +  DTGYY+CTA +  ++ +     +       N  + ++ ++++  + +++G      C   +    +A+ + W++   NS     + + +S  I +         N  +  +P  + ++V + F I  LQ  D+G   C+        ++    ++ DV      +   + +   ++     +W + +D++++      +   + +K + ++  IIY D D  S   A KI   +  +    +LFDRDK++G E   D    +  S+ +L L
Sbjct:    7 ILLLTIYFCACEDCPPNVNDQF--TFASNMSVSQAAIYHKYAEITCCVVGFTDIKWEFRRNKSQNWSYTIPGNYDLSDENRKISFSAV-EFEDTGYYKCTAKNYDDDIIYGETLLVVGCSKPNTKM-IITNRTLETNFHELGTG-RLCCSLSTINWAEAIFVFWIYKNSNSTIRTWQFNIMSEFITSKSGRISIYVNPKITKSPCEEYIKVDTCFEIERLQKTDSGNCTCRFSSFDMVEQEFTLRVLSDVTNTILYIYCSVSIGSAIVLLFLLLWIFYYDLMIIST----LIVGSKSKNFSIAVLIIYDDQDQLSFSTAVKISEILSRKGFSTYLFDRDKKFGCEFHSDYLSSMAESNQILFL 360          
BLAST of SMED30019226 vs. Planmine SMEST
Match: SMESG000016701.1 (SMESG000016701.1)

HSP 1 Score: 66.2402 bits (160), Expect = 2.647e-11
Identity = 101/473 (21.35%), Postives = 197/473 (41.65%), Query Frame = 2
Query:   17 NLIFPLFMLVIDFGV-SANPCPN-QSRSLNPTLLIEPPFTMSGIEGKYFCMK------CCFDGFTKILWDFRKLRTTDWDSFYDA--WRFENSNRTLCIKKPNQLYDTGYYRCTATDALNNALNHSIFVYFLLINENRNLTLVPDKSIPKSDYKIGNDLSFSCEAKSFKPNKAVSIQWLHSK------LNSYKNISRSHFISNIIQ--TGFNETLESNPDAVRVFSNF----SISHLQLVDNGTYKCKIEQDGTTVEQIYYALIIDVQIKWTXXXXXXXXXXXXXXXXXGIWHYRFDILVVYKTYFDMFPNNNTKEYDLSIIYQDDDFSSAQVAFKIVSFMECQNLHCWLFDRDKQYGQEILIDLSKILTHSHTVLILVXXXX-XXXXXXXXXXXXXXXXPSVRRLYVWNPSKKAIVKTVRRFDSSAEKYLTRELNLQSFCHGFGFDWNSAENI-----KFYPLTSWIISSLP 1351
            N I  + +LV+  G+ S   CP  +S  LN     +P FT    E     +       CC  G + I W F+   +  +        ++ EN+NR L +   ++    G Y+C   +   N+L++  FV  +    N+++ +V    I +  +   ++ +F C  K F P    +  W   K      + ++ N+++      +++  +G+++  E N      F NF     I ++Q    G Y C +E      E+++   +  +  +   + + +V   +L+   A  + Y   IL+     F      N   Y+   +Y  DD  + Q   K+V  +E +    + + RD+ YG+ +  +L + L  S  ++  VS        +       I+  P   RLY+   +K+  ++       SA+        ++S+     + WN  ++      +++ L+SW+ISSLP
Sbjct:   29 NWILIINVLVLTLGLESDGKCPEPRSEQLNQN---QPFFTRDMYESSVMSVSMIGYVHCCIYGVSNINWWFKNSDSKHFTQIIKGKDYQLENNNRKLIVLNVSK-NSKGIYKCVGNNEKGNSLSNQTFVIVVQSTYNKDIEIVDASDITELTFVPYSNYTFYCLVKVF-PGSICNFSWNRKKNGKRTSILAHSNLTKKRTYDTLVEGYSGYSQLKELNKQGN--FRNFLFELIIFNIQTSHEGEYSCLVEDRFEKDERVFNVYVKLLGKEHIYIASGIVGCFILIFILAYEFQYDCKILLKKSLQFLTIKEKNFGSYNFFFLYDFDDEYTFQTIAKVVKKIESRYCTVYFYHRDQIYGKIMFEELYEKLQRSDVIVFWVSQKIWKNPISSFCIQMLIRNYPKKTRLYIMTSNKQNAMENCNSSMISAD--------IKSWILSNIYFWNIKKSKFSKLWRWHNLSSWLISSLP 486          
BLAST of SMED30019226 vs. Planmine SMEST
Match: SMESG000016701.1 (SMESG000016701.1)

HSP 1 Score: 65.855 bits (159), Expect = 2.951e-11
Identity = 101/473 (21.35%), Postives = 197/473 (41.65%), Query Frame = 2
Query:   17 NLIFPLFMLVIDFGV-SANPCPN-QSRSLNPTLLIEPPFTMSGIEGKYFCMK------CCFDGFTKILWDFRKLRTTDWDSFYDA--WRFENSNRTLCIKKPNQLYDTGYYRCTATDALNNALNHSIFVYFLLINENRNLTLVPDKSIPKSDYKIGNDLSFSCEAKSFKPNKAVSIQWLHSK------LNSYKNISRSHFISNIIQ--TGFNETLESNPDAVRVFSNF----SISHLQLVDNGTYKCKIEQDGTTVEQIYYALIIDVQIKWTXXXXXXXXXXXXXXXXXGIWHYRFDILVVYKTYFDMFPNNNTKEYDLSIIYQDDDFSSAQVAFKIVSFMECQNLHCWLFDRDKQYGQEILIDLSKILTHSHTVLILVXXXX-XXXXXXXXXXXXXXXXPSVRRLYVWNPSKKAIVKTVRRFDSSAEKYLTRELNLQSFCHGFGFDWNSAENI-----KFYPLTSWIISSLP 1351
            N I  + +LV+  G+ S   CP  +S  LN     +P FT    E     +       CC  G + I W F+   +  +        ++ EN+NR L +   ++    G Y+C   +   N+L++  FV  +    N+++ +V    I +  +   ++ +F C  K F P    +  W   K      + ++ N+++      +++  +G+++  E N      F NF     I ++Q    G Y C +E      E+++   +  +  +   + + +V   +L+   A  + Y   IL+     F      N   Y+   +Y  DD  + Q   K+V  +E +    + + RD+ YG+ +  +L + L  S  ++  VS        +       I+  P   RLY+   +K+  ++       SA+        ++S+     + WN  ++      +++ L+SW+ISSLP
Sbjct:    7 NWILIINVLVLTLGLESDGKCPEPRSEQLNQN---QPFFTRDMYESSVMSVSMIGYVHCCIYGVSNINWWFKNSDSKHFTQIIKGKDYQLENNNRKLIVLNVSK-NSKGIYKCVGNNEKGNSLSNQTFVIVVQSTYNKDIEIVDASDITELTFVPYSNYTFYCLVKVF-PGSICNFSWNRKKNGKRTSILAHSNLTKKRTYDTLVEGYSGYSQLKELNKQGN--FRNFLFELIIFNIQTSHEGEYSCLVEDRFEKDERVFNVYVKLLGKEHIYIASGIVGCFILIFILAYEFQYDCKILLKKSLQFLTIKEKNFGSYNFFFLYDFDDEYTFQTIAKVVKKIESRYCTVYFYHRDQIYGKIMFEELYEKLQRSDVIVFWVSQKIWKNPISSFCIQMLIRNYPKKTRLYIMTSNKQNAMENCNSSMISAD--------IKSWILSNIYFWNIKKSKFSKLWRWHNLSSWLISSLP 464          
The following BLAST results are available for this feature:
BLAST of SMED30019226 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
MDGA12.239e-626.71MAM domain containing glycosylphosphatidylinositol... [more]
MDGA12.367e-626.71MAM domain containing glycosylphosphatidylinositol... [more]
MDGA12.526e-626.71MAM domain containing glycosylphosphatidylinositol... [more]
back to top
BLAST of SMED30019226 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30019226 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30019226 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30019226 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30019226 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Mdga13.619e-626.71MAM domain containing glycosylphosphatidylinositol... [more]
Mdga13.770e-626.71MAM domain containing glycosylphosphatidylinositol... [more]
Mdga14.433e-628.08MAM domain containing glycosylphosphatidylinositol... [more]
back to top
BLAST of SMED30019226 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30019226 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30019226 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30019226 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30019226 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30019226 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30019226 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30019226 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000047314.10.000e+099.35SMESG000047314.1[more]
SMESG000047314.10.000e+099.33SMESG000047314.1[more]
SMESG000047320.17.439e-1620.39SMESG000047320.1[more]
SMESG000016701.12.647e-1121.35SMESG000016701.1[more]
SMESG000016701.12.951e-1121.35SMESG000016701.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019226 ID=SMED30019226|Name=SMED30019226|organism=Schmidtea mediterranea sexual|type=transcript|length=1531bp
AATGAATTATCTATTGAATTTGATATTCCCGCTATTTATGCTTGTTATTG
ATTTTGGGGTTTCGGCGAATCCGTGTCCAAATCAATCTAGATCTCTTAAC
CCAACATTGTTAATTGAGCCCCCCTTCACAATGTCAGGTATTGAAGGAAA
ATATTTTTGCATGAAATGCTGCTTTGATGGATTTACAAAAATTTTATGGG
ATTTCAGAAAACTCAGAACAACTGACTGGGATTCATTTTATGATGCATGG
AGATTTGAAAATTCAAATCGGACGTTATGTATTAAAAAGCCCAATCAGCT
GTACGACACGGGCTACTATCGGTGCACGGCTACAGACGCACTGAATAACG
CATTAAATCATTCAATTTTTGTTTATTTTCTTTTGATAAATGAGAACAGA
AATTTGACATTGGTTCCCGATAAATCTATTCCGAAATCAGACTACAAAAT
AGGAAATGATCTAAGTTTTTCATGTGAAGCTAAAAGTTTCAAACCCAATA
AAGCTGTTTCCATTCAGTGGCTTCATAGTAAATTAAATTCCTATAAAAAT
ATATCTAGATCCCATTTTATCTCAAATATCATCCAAACAGGCTTCAATGA
AACATTAGAAAGCAACCCGGACGCAGTACGAGTATTTTCGAACTTTTCTA
TATCTCATTTACAATTAGTGGACAACGGAACGTATAAATGTAAGATTGAG
CAAGACGGAACAACCGTAGAACAAATATATTATGCATTAATAATTGACGT
TCAAATAAAATGGACCTTACTACTAGCGATACTAGTTGTCTTTTTAGTCC
TACTCTCTAGTGCAGCTGGGATATGGCATTACCGCTTTGATATTTTAGTA
GTGTATAAAACCTATTTCGATATGTTTCCAAATAACAATACCAAAGAATA
TGATTTATCAATTATATATCAAGATGATGACTTCAGTAGCGCTCAAGTAG
CATTCAAAATTGTATCTTTTATGGAATGTCAAAATTTACATTGCTGGTTA
TTTGACAGAGATAAACAATATGGACAGGAAATTCTGATTGACCTTTCTAA
AATTCTAACTCACTCTCATACGGTACTAATACTTGTGTCCCTTTCATCTA
TTCAGAACGATAATTTATTGTCGAATTTGTCATCTATTCAACTTAATCCA
TCAGTTCGACGTCTTTATGTTTGGAATCCATCAAAAAAAGCTATTGTCAA
AACAGTTCGACGATTCGATTCATCCGCAGAAAAATATCTGACACGAGAAT
TAAATCTTCAATCATTTTGTCATGGTTTTGGTTTTGATTGGAATTCGGCA
GAGAATATTAAATTTTACCCTCTTACTTCCTGGATTATTTCATCTCTTCC
ATCTTTGGTGATTCGAAAGAAATTTCAGTGACCGATAAATATTTCTGTAT
AACTGTTTAGATATTTTTTATTTTTATTTCTGTTATAATCCTTTTTTGAA
TTTAGCATTAACTTAGCTCGTTATGGAACAAGTAATTTTTTACGTCTTTT
TTTATTGCACAGATCATGCGAGATCGGAAGA
back to top

protein sequence of SMED30019226-orf-1

>SMED30019226-orf-1 ID=SMED30019226-orf-1|Name=SMED30019226-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=460bp
MNYLLNLIFPLFMLVIDFGVSANPCPNQSRSLNPTLLIEPPFTMSGIEGK
YFCMKCCFDGFTKILWDFRKLRTTDWDSFYDAWRFENSNRTLCIKKPNQL
YDTGYYRCTATDALNNALNHSIFVYFLLINENRNLTLVPDKSIPKSDYKI
GNDLSFSCEAKSFKPNKAVSIQWLHSKLNSYKNISRSHFISNIIQTGFNE
TLESNPDAVRVFSNFSISHLQLVDNGTYKCKIEQDGTTVEQIYYALIIDV
QIKWTLLLAILVVFLVLLSSAAGIWHYRFDILVVYKTYFDMFPNNNTKEY
DLSIIYQDDDFSSAQVAFKIVSFMECQNLHCWLFDRDKQYGQEILIDLSK
ILTHSHTVLILVSLSSIQNDNLLSNLSSIQLNPSVRRLYVWNPSKKAIVK
TVRRFDSSAEKYLTRELNLQSFCHGFGFDWNSAENIKFYPLTSWIISSLP
SLVIRKKFQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR035897Toll_tir_struct_dom_sf
IPR015621IL-1_rcpt_fam
IPR036179Ig-like_dom_sf
IPR000157TIR_dom
IPR013783Ig-like_fold
IPR007110Ig-like_dom
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 138..251
e-value: 7.2E-8
score: 34.4
IPR035897Toll/interleukin-1 receptor homology (TIR) domain superfamilyGENE3DG3DSA:3.40.50.10140coord: 293..401
e-value: 2.3E-7
score: 32.6
IPR035897Toll/interleukin-1 receptor homology (TIR) domain superfamilySUPERFAMILYSSF52200Toll/Interleukin receptor TIR domaincoord: 296..379
IPR015621Interleukin-1 receptor familyPANTHERPTHR11890INTERLEUKIN-1 RECEPTORcoord: 87..374
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 34..119
score: 7.377
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 139..240
score: 9.446
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..22
score: 0.832
NoneNo IPR availableTMHMMTMhelixcoord: 254..276
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 34..116
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 145..243