SMED30019224

Overview
NameSMED30019224
Smed IDSMED30019224
Length (bp)1611
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30019224 (SMED30019224) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30019224 (SMED30019224) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019224

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30019224SMESG000008279.1 SMESG000008247.1 SMESG000008244.1 SMESG000008241.1 dd_Smed_v4_23424_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30019224SMESG000008279.1 SMESG000008247.1 SMESG000008244.1 SMESG000008241.1 dd_Smed_v4_23424_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30019224 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.007297:3981..5590 +7942
v31.000098:16470..18079 +7933
Homology
BLAST of SMED30019224 vs. Ensembl Human
Match: PAPOLG (poly(A) polymerase gamma [Source:HGNC Symbol;Acc:HGNC:14982])

HSP 1 Score: 351.673 bits (901), Expect = 2.076e-112
Identity = 189/483 (39.13%), Postives = 279/483 (57.76%), Query Frame = -3
Query:  125 GITGFVTLEKSTEKDIKLSNELELTLINTKEFMSKLEIEHRKETLNKLEELCNSWIYEKALQNYYPKKTASKIKGKLFAFGSYRLNTDFIGADIDTLLVCPQFISREEFFKELYEYLRNCSLVKDILVLPDAFVPLMTMKLCDVEMDLLFASIDESTVPGNLNLNNNTEQLMRRMDEKNIRSINGVRVTDDLLTLVYNKNAFRTALRTIKLWSKRCGIYSNAMGFLGGVSWAILVARVCQLWPTASSFTIVTKFFYFFGIKWKWPTPILLRKITSSSVLSLPQWNPQTNPKDSYHVFPIITPSYPCQNSTYNVTESHKTIIINHMKNAHELCQQIANGNKKLSDLFESKFFFT-YQHYLMVTIKDSDESQFNKNSSLIESKLRIFARYLEKNESIAFVHINVQTFNCHEMDKSGKTSQYVNRWFLGF---EVLMKSKKSLSVADEISKFESLV------------KIEIEVIHVKKSNVPQYL 1525
            GIT  ++L    E D   + +L   +     F  + E+ HR   L KL  L   WI + +     P    + + GK+F FGSYRL     GADID L V P+ + R +FF+  +E L++   ++++  + DAFVP++  +   +E+DL+FA +   T+  NL+L +++   +R +D + IRS+NG RVTD++L LV NK  FR  LR +KLW+KR GIYSN +GFLGGVSWA+LVAR CQL+P A++ T+V KFF  F  KW+WP P+LL++   S+ L+LP W+P+ NP D YH+ PIITP+YP QNSTYNV+ S +T+++   K    +  +I  G    S L E   FF  Y+HY+++T   S E    +   L+ESK+R+    LE+NE I   H+N Q+F  ++  +  K + YV+ WFLG     V      ++ +  +I  F   V             ++IE  HVKK  +  YL
Sbjct:   20 GITSPISLASPKEIDHIYTQKLIDAMKPFGVFEDEEELNHRLVVLGKLNNLVKEWISDVSESKNLPPSVVATVGGKIFTFGSYRLGVHTKGADIDALCVAPRHVERSDFFQSFFEKLKHQDGIRNLRAVEDAFVPVIKFEFDGIEIDLVFARLAIQTISDNLDLRDDSR--LRSLDIRCIRSLNGCRVTDEILHLVPNKETFRLTLRAVKLWAKRRGIYSNMLGFLGGVSWAMLVARTCQLYPNAAASTLVHKFFLVFS-KWEWPNPVLLKQPEESN-LNLPVWDPRVNPSDRYHLMPIITPAYPQQNSTYNVSTSTRTVMVEEFKQGLAVTDEILQGKSDWSKLLEPPNFFQKYRHYIVLTASASTEENHLEWVGLVESKIRVLVGNLERNEFITLAHVNPQSFPGNK--EHHKDNNYVSMWFLGIIFRRVENAESVNIDLTYDIQSFTDTVYRQANNINMLKEGMKIEATHVKKKQLHHYL 496          
BLAST of SMED30019224 vs. Ensembl Human
Match: PAPOLA (poly(A) polymerase alpha [Source:HGNC Symbol;Acc:HGNC:14981])

HSP 1 Score: 322.398 bits (825), Expect = 3.033e-101
Identity = 188/496 (37.90%), Postives = 280/496 (56.45%), Query Frame = -3
Query:  119 KEADIPPECLGITGFVTLEKSTEKDIKLSNELELTLINTKEFMSKLEIEHRKETLNKLEELCNSWIYEKALQNYYPKKTASKIKGKLFAFGSYRLNTDFIGADIDTLLVCPQFISREEFFKELYEYLRNCSLVKDILVLPDAFVPLMTMKLCDVEMDLLFASIDESTVPGNLNLNNNTEQLMRRMDEKNIRSINGVRVTDDLLTLVYNKNAFRTALRTIKLWSKRCGIYSNAMGFLGGVSWAILVARVCQLWPTASSFTIVTKFFYFFGIKWKWPTPILLRKITSSSVLSLPQWNPQTNPKDSYHVFPIITPSYPCQNSTYNVTESHKTIIINHMKNAHELCQQIANGNKKLSDLFESKFFFT-YQHYLMVTIKDSDESQFNKNSSLIESKLRIFARYLEKNESIAFVHINVQTFNCHEMDKSGKTSQYVNRWFLGFEVLMKSKK----SLSVADEISKFESL------------VKIEIEVIHVKKSNVPQYLSD 1555
            ++   P +  GIT  ++L    E D  L+ +L  TL     F  + E++ R   L KL  L   WI E +     P+     + GK+F FGSYRL     GADID L V P+ + R +FF   Y+ L+    VKD+  + +AFVP++ +    +E+D+LFA +   T+P +L+L    + L++ +D + IRS+NG RVTD++L LV N + FR  LR IKLW+KR  IYSN +GFLGGVSWA+LVAR CQL+P A + T+V KFF  F  KW+WP P+LL++    + L+LP W+P+ NP D YH+ PIITP+YP QNSTYNV+ S + +++   K    +  +I     + S LFE+  FF  Y+HY+++      E Q  +   L+ESK+RI    LEKNE I   H+N Q+F   + +   +  ++   W +G  V  K++     S+ +  +I  F               V ++I  +HVK+  + Q L +
Sbjct:   11 QQTQPPQKHYGITSPISLAAPKETDCVLTQKLIETLKPFGVFEEEEELQRRILILGKLNNLVKEWIREISESKNLPQSVIENVGGKIFTFGSYRLGVHTKGADIDALCVAPRHVDRSDFFTSFYDKLKLQEEVKDLRAVEEAFVPVIKLCFDGIEIDILFARLALQTIPEDLDLR--DDSLLKNLDIRCIRSLNGCRVTDEILHLVPNIDNFRLTLRAIKLWAKRHNIYSNILGFLGGVSWAMLVARTCQLYPNAIASTLVHKFFLVFS-KWEWPNPVLLKQPEECN-LNLPVWDPRVNPSDRYHLMPIITPAYPQQNSTYNVSVSTRMVMVEEFKQGLAITDEILLSKAEWSKLFEAPNFFQKYKHYIVLLASAPTEKQRLEWVGLVESKIRILVGSLEKNEFITLAHVNPQSFPAPKENPDKE--EFRTMWVIGL-VFKKTENSENLSVDLTYDIQSFTDTVYRQAINSKMFEVDMKIAAMHVKRKQLHQLLPN 499          
BLAST of SMED30019224 vs. Ensembl Human
Match: PAPOLA (poly(A) polymerase alpha [Source:HGNC Symbol;Acc:HGNC:14981])

HSP 1 Score: 322.398 bits (825), Expect = 4.798e-101
Identity = 188/496 (37.90%), Postives = 280/496 (56.45%), Query Frame = -3
Query:  119 KEADIPPECLGITGFVTLEKSTEKDIKLSNELELTLINTKEFMSKLEIEHRKETLNKLEELCNSWIYEKALQNYYPKKTASKIKGKLFAFGSYRLNTDFIGADIDTLLVCPQFISREEFFKELYEYLRNCSLVKDILVLPDAFVPLMTMKLCDVEMDLLFASIDESTVPGNLNLNNNTEQLMRRMDEKNIRSINGVRVTDDLLTLVYNKNAFRTALRTIKLWSKRCGIYSNAMGFLGGVSWAILVARVCQLWPTASSFTIVTKFFYFFGIKWKWPTPILLRKITSSSVLSLPQWNPQTNPKDSYHVFPIITPSYPCQNSTYNVTESHKTIIINHMKNAHELCQQIANGNKKLSDLFESKFFFT-YQHYLMVTIKDSDESQFNKNSSLIESKLRIFARYLEKNESIAFVHINVQTFNCHEMDKSGKTSQYVNRWFLGFEVLMKSKK----SLSVADEISKFESL------------VKIEIEVIHVKKSNVPQYLSD 1555
            ++   P +  GIT  ++L    E D  L+ +L  TL     F  + E++ R   L KL  L   WI E +     P+     + GK+F FGSYRL     GADID L V P+ + R +FF   Y+ L+    VKD+  + +AFVP++ +    +E+D+LFA +   T+P +L+L    + L++ +D + IRS+NG RVTD++L LV N + FR  LR IKLW+KR  IYSN +GFLGGVSWA+LVAR CQL+P A + T+V KFF  F  KW+WP P+LL++    + L+LP W+P+ NP D YH+ PIITP+YP QNSTYNV+ S + +++   K    +  +I     + S LFE+  FF  Y+HY+++      E Q  +   L+ESK+RI    LEKNE I   H+N Q+F   + +   +  ++   W +G  V  K++     S+ +  +I  F               V ++I  +HVK+  + Q L +
Sbjct:   11 QQTQPPQKHYGITSPISLAAPKETDCVLTQKLIETLKPFGVFEEEEELQRRILILGKLNNLVKEWIREISESKNLPQSVIENVGGKIFTFGSYRLGVHTKGADIDALCVAPRHVDRSDFFTSFYDKLKLQEEVKDLRAVEEAFVPVIKLCFDGIEIDILFARLALQTIPEDLDLR--DDSLLKNLDIRCIRSLNGCRVTDEILHLVPNIDNFRLTLRAIKLWAKRHNIYSNILGFLGGVSWAMLVARTCQLYPNAIASTLVHKFFLVFS-KWEWPNPVLLKQPEECN-LNLPVWDPRVNPSDRYHLMPIITPAYPQQNSTYNVSVSTRMVMVEEFKQGLAITDEILLSKAEWSKLFEAPNFFQKYKHYIVLLASAPTEKQRLEWVGLVESKIRILVGSLEKNEFITLAHVNPQSFPAPKENPDKE--EFRTMWVIGL-VFKKTENSENLSVDLTYDIQSFTDTVYRQAINSKMFEVDMKIAAMHVKRKQLHQLLPN 499          
BLAST of SMED30019224 vs. Ensembl Human
Match: PAPOLB (poly(A) polymerase beta [Source:HGNC Symbol;Acc:HGNC:15970])

HSP 1 Score: 314.694 bits (805), Expect = 3.575e-99
Identity = 172/427 (40.28%), Postives = 249/427 (58.31%), Query Frame = -3
Query:  248 GITGFVTLEKSTEKDIKLSNELELTLINTKEFMSKLEIEHRKETLNKLEELCNSWIYEKALQNYYPKKTASKIKGKLFAFGSYRLNTDFIGADIDTLLVCPQFISREEFFKELYEYLRNCSLVKDILVLPDAFVPLMTMKLCDVEMDLLFASIDESTVPGNLNLNNNTEQLMRRMDEKNIRSINGVRVTDDLLTLVYNKNAFRTALRTIKLWSKRCGIYSNAMGFLGGVSWAILVARVCQLWPTASSFTIVTKFFYFFGIKWKWPTPILLRKITSSSVLSLPQWNPQTNPKDSYHVFPIITPSYPCQNSTYNVTESHKTIIINHMKNAHELCQQIANGNKKLSDLFESKFFFT-YQHYLMVTIKDSDESQFNKNSSLIESKLRIFARYLEKNESIAFVHINVQTFNCHEMDKSGKTSQYVNRWFLGF 1525
            G++  ++L    E D  L+  L  TL     F  + E++ R   L KL  L   WI E +     P+     + GK+F FGSYRL     GADID L V P  + R +FF   Y  L+    VKD+  + +AFVP++ +    +E+D+LFA +   T+P +L+     + L++ +D + IRS+NG RVTD++L LV N + FR  LR IKLW+K   IYSN +GFLGGVSWA+LVAR CQL+P A + T+V KFF  F  +W+WP P+LL++    + L+LP W+P+ NP D YH+ PIITP+YP QNSTYNV+ S + ++I   K    +  +I     + S LFE+  FF  Y+HY+++    S E Q  +   L+ESK+RI    LEKNE I   H+N Q+F   +  ++    ++   W +G 
Sbjct:   22 GVSSPISLAVPKETDCLLTQRLIETLRPFGVFEEEEELQRRILVLEKLNNLVKEWIREISESKSLPQSVIENVGGKIFTFGSYRLGVHTKGADIDALCVAPSHVDRSDFFTSFYAKLKLQEEVKDLRAVEEAFVPVIKLCFDGIEIDILFARLALQTIPEDLD--LRDDSLLKNLDIRCIRSLNGCRVTDEILHLVPNIDNFRLTLRAIKLWAKCHNIYSNILGFLGGVSWAMLVARTCQLYPNAVASTLVRKFFLVFS-EWEWPNPVLLKEPEERN-LNLPVWDPRVNPSDRYHLMPIITPAYPQQNSTYNVSISTRMVMIEEFKQGLAITHEILLSKAEWSKLFEAPSFFQKYKHYIVLLASASTEKQHLEWVGLVESKIRILVGSLEKNEFITLAHVNPQSFPAPK--ENPDMEEFRTMWVIGL 442          
BLAST of SMED30019224 vs. Ensembl Human
Match: PAPOLG (poly(A) polymerase gamma [Source:HGNC Symbol;Acc:HGNC:14982])

HSP 1 Score: 211.46 bits (537), Expect = 1.351e-64
Identity = 103/231 (44.59%), Postives = 148/231 (64.07%), Query Frame = -3
Query:  740 FMSKLEIEHRKETLNKLEELCNSWIYEKALQNYYPKKTASKIKGKLFAFGSYRLNTDFIGADIDTLLVCPQFISREEFFKELYEYLRNCSLVKDILVLPDAFVPLMTMKLCDVEMDLLFASIDESTVPGNLNLNNNTEQLMRRMDEKNIRSINGVRVTDDLLTLVYNKNAFRTALRTIKLWSKRCGIYSNAMGFLGGVSWAILVARVCQLWPTASSFTIVTKFFYFFGIKW 1432
            F  + E+ HR   L KL  L   WI + +     P    + + GK+F FGSYRL     GADID L V P+ + R +FF+  +E L++   ++++  + DAFVP++  +   +E+DL+FA +   T+  NL+L +++   +R +D + IRS+NG RVTD++L LV NK  FR  LR +KLW+KR GIYSN +GFLGGVSWA+LVAR CQL+P A++ T+V KFF  F  KW
Sbjct:    7 FEDEEELNHRLVVLGKLNNLVKEWISDVSESKNLPPSVVATVGGKIFTFGSYRLGVHTKGADIDALCVAPRHVERSDFFQSFFEKLKHQDGIRNLRAVEDAFVPVIKFEFDGIEIDLVFARLAIQTISDNLDLRDDSR--LRSLDIRCIRSLNGCRVTDEILHLVPNKETFRLTLRAVKLWAKRRGIYSNMLGFLGGVSWAMLVARTCQLYPNAAASTLVHKFFLVFS-KW 234          
BLAST of SMED30019224 vs. Ensembl Celegans
Match: pap-1 (Poly-A Polymerase [Source:UniProtKB/TrEMBL;Acc:Q9U2P3])

HSP 1 Score: 312.768 bits (800), Expect = 1.104e-98
Identity = 181/504 (35.91%), Postives = 279/504 (55.36%), Query Frame = -3
Query:  113 EADIPPECLGITGFVTLEKSTEKDIKLSNELELTLINTKEFMSKLEIEHRKETLNKLEELCNSWIYEKALQNYYPKKTASKIKGKLFAFGSYRLNTDFIGADIDTLLVCPQFISREEFFKELYEYLRNCSLVKDILVLPDAFVPLMTMKLCDVEMDLLFASIDESTVPGNLNLNNNTEQLMRRMDEKNIRSINGVRVTDDLLTLVYNKNAFRTALRTIKLWSKRCGIYSNAMGFLGGVSWAILVARVCQLWPTASSFTIVTKFFYFFGIKWKWPTPILLRKITS--SSVLSLPQ--WNPQTNPKDSYHVFPIITPSYPCQNSTYNVTESHKTIIINHMKNAHELCQQIANGNKKLSDLFES-KFFFTYQHYLMVTIKDSDESQFNKNSSLIESKLRIFARYLEKNESIAFVHINVQTFNCHEMDKSGK-----TSQYVNRWFLGFEVLMKSKKSLSVADEISKFESLV--------------KIEIEVIHVKKSNVPQYLSDKD 1552
            E D  P  LG++  ++L     KDI  +  L  TL     +  K E E R E L  L  L   W+ +       P        GKLF FGSYRL     GADIDTL V P+ I R +FF    E L N   V ++  + +AFVP+M +K   VE+D+LFA +    VP    L++  + L+R +D++++RS+NG RV + LL LV  +  F   LR IKLW+K  GIYSN+MGF GG++WAILVAR CQL+P AS   +V + F+ F   W WP P++L ++ +  + + +L +  W+P+    D +HV PIITP++P QNST+NVT S  T+I N +  A E+C+ I+ G  K + LFE   FF  Y+H++ + +   +E +       +ES++R+  + LE+N+ I   H +    N H+   + K      ++ V  WF+G E   +  K+L + +EI +F++ V              +++I++ +VK++++ Q +S  D
Sbjct:    5 EKDKTP-LLGVSQPISLAHPDSKDIAQTTLLIETLKKFGSYEPKEETEQRMEVLRNLNRLVKEWV-KNVTAMKIPNGEGVNAGGKLFTFGSYRLGVHSSGADIDTLAVVPRHIDRSDFFTSFKEMLNNDPNVTELHGVEEAFVPVMKLKYSGVELDILFARLALKEVPDTQELSD--DNLLRNLDQESVRSLNGCRVAEQLLKLVPRQKEFCVTLRAIKLWAKNHGIYSNSMGFFGGITWAILVARACQLYPNASPSRLVHRMFFIFST-WTWPHPVVLNEMNNDRNDIPTLCELVWDPRRKNTDRFHVMPIITPAFPEQNSTHNVTRSTATVIKNEICEALEICRDISEGKSKWTALFEEVNFFSRYKHFIALIMAAPNEEEELNYGGFLESRIRLLVQSLERNQDIIIAHNDP---NKHKPSPNAKFDVNPENKRVTVWFIGLE-FAEHAKTLDLTNEIQRFKTNVELQASNVKGIGPNCQVQIDMFYVKRNSLIQVISAAD 499          
BLAST of SMED30019224 vs. Ensembl Celegans
Match: pap-1 (Poly-A Polymerase [Source:UniProtKB/TrEMBL;Acc:Q9U2P3])

HSP 1 Score: 312.768 bits (800), Expect = 1.104e-98
Identity = 181/504 (35.91%), Postives = 279/504 (55.36%), Query Frame = -3
Query:  113 EADIPPECLGITGFVTLEKSTEKDIKLSNELELTLINTKEFMSKLEIEHRKETLNKLEELCNSWIYEKALQNYYPKKTASKIKGKLFAFGSYRLNTDFIGADIDTLLVCPQFISREEFFKELYEYLRNCSLVKDILVLPDAFVPLMTMKLCDVEMDLLFASIDESTVPGNLNLNNNTEQLMRRMDEKNIRSINGVRVTDDLLTLVYNKNAFRTALRTIKLWSKRCGIYSNAMGFLGGVSWAILVARVCQLWPTASSFTIVTKFFYFFGIKWKWPTPILLRKITS--SSVLSLPQ--WNPQTNPKDSYHVFPIITPSYPCQNSTYNVTESHKTIIINHMKNAHELCQQIANGNKKLSDLFES-KFFFTYQHYLMVTIKDSDESQFNKNSSLIESKLRIFARYLEKNESIAFVHINVQTFNCHEMDKSGK-----TSQYVNRWFLGFEVLMKSKKSLSVADEISKFESLV--------------KIEIEVIHVKKSNVPQYLSDKD 1552
            E D  P  LG++  ++L     KDI  +  L  TL     +  K E E R E L  L  L   W+ +       P        GKLF FGSYRL     GADIDTL V P+ I R +FF    E L N   V ++  + +AFVP+M +K   VE+D+LFA +    VP    L++  + L+R +D++++RS+NG RV + LL LV  +  F   LR IKLW+K  GIYSN+MGF GG++WAILVAR CQL+P AS   +V + F+ F   W WP P++L ++ +  + + +L +  W+P+    D +HV PIITP++P QNST+NVT S  T+I N +  A E+C+ I+ G  K + LFE   FF  Y+H++ + +   +E +       +ES++R+  + LE+N+ I   H +    N H+   + K      ++ V  WF+G E   +  K+L + +EI +F++ V              +++I++ +VK++++ Q +S  D
Sbjct:    5 EKDKTP-LLGVSQPISLAHPDSKDIAQTTLLIETLKKFGSYEPKEETEQRMEVLRNLNRLVKEWV-KNVTAMKIPNGEGVNAGGKLFTFGSYRLGVHSSGADIDTLAVVPRHIDRSDFFTSFKEMLNNDPNVTELHGVEEAFVPVMKLKYSGVELDILFARLALKEVPDTQELSD--DNLLRNLDQESVRSLNGCRVAEQLLKLVPRQKEFCVTLRAIKLWAKNHGIYSNSMGFFGGITWAILVARACQLYPNASPSRLVHRMFFIFST-WTWPHPVVLNEMNNDRNDIPTLCELVWDPRRKNTDRFHVMPIITPAFPEQNSTHNVTRSTATVIKNEICEALEICRDISEGKSKWTALFEEVNFFSRYKHFIALIMAAPNEEEELNYGGFLESRIRLLVQSLERNQDIIIAHNDP---NKHKPSPNAKFDVNPENKRVTVWFIGLE-FAEHAKTLDLTNEIQRFKTNVELQASNVKGIGPNCQVQIDMFYVKRNSLIQVISAAD 499          
BLAST of SMED30019224 vs. Ensembl Celegans
Match: F43G6.5 (pep chromosome:WBcel235:II:11814839:11816706:-1 gene:WBGene00009658.1 transcript:F43G6.5.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F43G6.5)

HSP 1 Score: 305.064 bits (780), Expect = 6.215e-97
Identity = 178/492 (36.18%), Postives = 271/492 (55.08%), Query Frame = -3
Query:  113 LGITGFVTLEKSTEKDIKLSNELELTLINTKEFMSKLEIEHRKETLNKLEELCNSWIYEKALQNYYPKKTASKIKGKLFAFGSYRLNTDFIGADIDTLLVCPQFISREEFFKELYEYLRNCSLVKDILVLPDAFVPLMTMKLCDVEMDLLFASIDESTVPGNLNLNNNTEQLMRRMDEKNIRSINGVRVTDDLLTLVYNKNAFRTALRTIKLWSKRCGIYSNAMGFLGGVSWAILVARVCQLWPTASSFTIVTKFFYFFGIKWKWPTPILLRKITSSSVLSLPQ-----WNPQTNPKDSYHVFPIITPSYPCQNSTYNVTESHKTIIINHMKNAHELCQQIANGNKKLSDLFES-KFFFTYQHYLMVTIKDSDESQFNKNSSLIESKLRIFARYLEKNESIAFVHINVQTFNCHEMDKSGKTSQYVNRWFLGFEVLMKSKKSLSVADEISKF--------------ESLVKIEIEVIHVKKSNVPQYLSDKD 1528
             G++  ++      KD++L++ L+ TL     +  + E   R + L KL      WI +K  +  YPK       G+L AFGSYRL     GADIDTL++ P+  +R +FF    + L     V ++  + +AFVP+MTMK   +E+D LFA +    VP +L++    + L++ +D++++RS+NG RV ++LL LV N+  F   LR IKLW+K  GIYSN+MGF GG++WAILVAR CQL+P AS   ++ K F+ F   WKWP P+LL  I SS  + L Q     W+P+ N  D YH+ PI+TP++P QNST+NV+ S   +I   MK+A   C  I NG+    DL E   FF  Y+H++ +++    E          ES++R     LEKN+ I   HIN + F   +  K        + WF+G +   ++ K+L +  +I +F              E+   +E +  +VK+S++ Q +S KD
Sbjct:   19 FGVSQPISTALPNAKDLELTSSLQKTLNQYNSYEPQEETSQRVKVLQKLNGCVKQWI-QKITEARYPKDQLFNAGGQLMAFGSYRLGVHSSGADIDTLVLAPRHATRADFFSSFKQMLAKDPEVTNLCAVENAFVPIMTMKYSGIEIDFLFARLALKEVPEDLDIL--DDALLKNLDQESVRSLNGCRVAENLLKLVPNQENFCITLRAIKLWAKNHGIYSNSMGFFGGITWAILVARACQLYPNASPSKLIQKVFFIFST-WKWPAPVLLDFI-SSDRMDLAQLNQLVWDPRRNQSDRYHLMPIVTPAFPQQNSTHNVSRSSMKVIQEEMKDALITCDNIQNGSCNWMDLLEEINFFSRYKHFISLSMTAETEKDELAFGGFFESRIRQLVLILEKNQGIKLAHINPKKFKAAKDPKK-------SVWFIGLQ-FDENVKNLDLTKDIQQFKRNIDYQAKSVKDIEANCAVETDFSYVKRSDLAQTISVKD 497          
BLAST of SMED30019224 vs. Ensembl Celegans
Match: T15H9.6 (pep chromosome:WBcel235:II:9607533:9609396:-1 gene:WBGene00011791.1 transcript:T15H9.6.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T15H9.6)

HSP 1 Score: 298.901 bits (764), Expect = 1.684e-94
Identity = 174/505 (34.46%), Postives = 275/505 (54.46%), Query Frame = -3
Query:  113 MIEIKEADIPPECLGITGFVTLEKSTEKDIKLSNELELTLINTKEFMSKLEIEHRKETLNKLEELCNSWIYEKALQNYYPKKTASKIKGKLFAFGSYRLNTDFIGADIDTLLVCPQFISREEFFKELYEYLRNCSLVKDILVLPDAFVPLMTMKLCDVEMDLLFASIDESTVPGNLNLNNNTEQLMRRMDEKNIRSINGVRVTDDLLTLVYNKNAFRTALRTIKLWSKRCGIYSNAMGFLGGVSWAILVARVCQLWPTASSFTIVTKFFYFFGIKWKWPTPILLRKI----TSSSVLSLPQWNPQTNPKDSYHVFPIITPSYPCQNSTYNVTESHKTIIINHMKNAHELCQQIANGNKKLSDLFES-KFFFTYQHYLMVTIKDSDESQFNKNSSLIESKLRIFARYLEKNESIAFVHINVQTF-NCHEMDKSGKTSQYVNRWFLGFEVLMKSKKSLSVADEISKFE--------------SLVKIEIEVIHVKKSNVPQYLSDKD 1567
            M  +  A       G++  ++       D+ L++ L+ +L   K F SK E   R + L  L+ L   W+ +K   +  PK       GKL  FGSYRL     GADID+++V P+ I+R +FF    + L     V ++  +  AFVP+MT+K   V++D+LFA +   +VP +LN+ +++  L++ +DE+++RS+NG RV + LL LV ++  F   LR IKLW+K  GIYSN+MGF GG++WAILVAR+CQL+P A+   ++ K F+ F   W WP P+LL  I    T  + L+   W+P+ N  D YH+ PIITP++P QNST+NV+ S   +I + MK A  +C +I  G  +  DL E   FF  Y H++ + +K     +        ES++R   + LEKN+ I    IN + F +  +  KS         WF+G E  + + K++ +  +I +F+              +  ++E +  + K+SN+   +S KD
Sbjct:    1 MQSVNNATSSTPIFGVSQPISTAFPKANDVALTSSLQSSLEEFKSFESKQETLLRIKVLKNLDGLVKDWV-QKTTISRIPKDQMFNAGGKLIPFGSYRLGVHSSGADIDSIVVAPRHITRSDFFNSFKDILAKNPEVTELCAVEKAFVPIMTLKYSGVDIDILFARLALKSVPEDLNILDDS--LLKNLDEESVRSLNGCRVAEQLLKLVPHQKNFCITLRAIKLWAKNHGIYSNSMGFFGGITWAILVARICQLYPNAAPSRLIQKVFFIFST-WNWPAPVLLDYINCDRTDLAQLNQLVWDPRRNHADRYHLMPIITPAFPQQNSTHNVSRSSMKVIQDEMKKALIICDKIHEGTLEWRDLLEEINFFSKYHHFIALKLKAESVKEELAFGGFFESRIRQLVQILEKNQVIQVAQINPRKFKDVKDPKKS--------IWFIGLE-FVANVKNVDLTSDIQQFKMNIDRQSMSVKEIAAGCQVETDFTYEKRSNLINIISKKD 492          
BLAST of SMED30019224 vs. Ensembl Fly
Match: hrg (gene:FBgn0015949 transcript:FBtr0086484)

HSP 1 Score: 340.502 bits (872), Expect = 3.273e-109
Identity = 194/545 (35.60%), Postives = 301/545 (55.23%), Query Frame = -3
Query:   11 PPECLGITGFVTLEKSTEKDIKLSNELELTLINTKEFMSKLEIEHRKETLNKLEELCNSWIYEKALQNYYPKKTASKIKGKLFAFGSYRLNTDFIGADIDTLLVCPQFISREEFFKELYEYLRNCSLVKDILVLPDAFVPLMTMKLCDVEMDLLFASIDESTVPGNLNLNNNTEQLMRRMDEKNIRSINGVRVTDDLLTLVYNKNAFRTALRTIKLWSKRCGIYSNAMGFLGGVSWAILVARVCQLWPTASSFTIVTKFFYFFGIKWKWPTPILLRKITSSSVLSLPQWNPQTNPKDSYHVFPIITPSYPCQNSTYNVTESHKTIIINHMKNAHELCQQIANGNKKLSDLFES-KFFFTYQHYLMVTIKDSDESQFNKNSSLIESKLRIFARYLEKNESIAFVHINVQTFN-------CHEMDKSG-----KTSQ----------YVNRWFLGFEVLMKSKKSLSVADEISKFESLVKIE------------IEVIHVKKSNVPQYLSDKDKNKFLLFLPRKPRKRPTAGNELFNTSEAKRQKVA 1540
            P + LG+T  ++L +   +D++ ++EL  +L     F S+ E+ HR E L KL  L   W+ E ++    P+  A K+ GK++ FGSYRL     GADID L V P+ I R ++F+  +E L+    V +   + +AFVP++ M    +E+DLLFA +    +P + +L +  + L+R +D +++RS+NG RVTD++L LV N   FR ALRTIKLW+K+ GIYSN++G+ GGV+WA+LVAR CQL+P A++ T+V KFF  F  +WKWP P+LL+   + + L    W+P+ N  D YH+ PIITP+YP QNST+NV+ES K +I+        +  +I  G      LFE+  FF+ Y+H++++ +         +   L+ESK+R+    LE+N  IA  H+N + F         +  + SG     K SQ          + + WF+G E       ++ + + I  F   V +             I+  HVK+  +  YL D D      FL R+ RK   + N   NT  A R++++
Sbjct:   24 PAKQLGMTSAISLAEPRPEDLQRTDELRGSLEPYNVFESQDELNHRMEILAKLNTLVKQWVKEISVSKNMPESAAEKLGGKIYTFGSYRLGVHHKGADIDALCVAPRNIERTDYFQSFFEVLKKQPEVTECRSVEEAFVPVIKMNFDGIEIDLLFARLSLKEIPDDFDLRD--DNLLRNLDHRSVRSLNGCRVTDEILALVPNIENFRLALRTIKLWAKKHGIYSNSLGYFGGVTWAMLVARTCQLYPNAAAATLVHKFFLVFS-RWKWPNPVLLKHPDNVN-LRFQVWDPRVNASDRYHLMPIITPAYPQQNSTFNVSESTKKVILTEFNRGMNITDEIMLGRIPWERLFEAPSFFYRYRHFIVLLVNSQTADDHLEWCGLVESKVRLLIGNLERNPHIALAHVNPKCFEFKKGQSANNSQNNSGNEDDLKQSQGNQSAVTSAPFCSMWFIGLEFERSENLNVDLTESIQNFTEHVMMHGVNIKMLKEGMTIDARHVKRKQLSLYL-DSD------FLKRE-RKSMESHNNFNNTLLANRKRLS 556          
BLAST of SMED30019224 vs. Ensembl Fly
Match: hrg (gene:FBgn0015949 transcript:FBtr0086483)

HSP 1 Score: 340.502 bits (872), Expect = 3.273e-109
Identity = 194/545 (35.60%), Postives = 301/545 (55.23%), Query Frame = -3
Query:   11 PPECLGITGFVTLEKSTEKDIKLSNELELTLINTKEFMSKLEIEHRKETLNKLEELCNSWIYEKALQNYYPKKTASKIKGKLFAFGSYRLNTDFIGADIDTLLVCPQFISREEFFKELYEYLRNCSLVKDILVLPDAFVPLMTMKLCDVEMDLLFASIDESTVPGNLNLNNNTEQLMRRMDEKNIRSINGVRVTDDLLTLVYNKNAFRTALRTIKLWSKRCGIYSNAMGFLGGVSWAILVARVCQLWPTASSFTIVTKFFYFFGIKWKWPTPILLRKITSSSVLSLPQWNPQTNPKDSYHVFPIITPSYPCQNSTYNVTESHKTIIINHMKNAHELCQQIANGNKKLSDLFES-KFFFTYQHYLMVTIKDSDESQFNKNSSLIESKLRIFARYLEKNESIAFVHINVQTFN-------CHEMDKSG-----KTSQ----------YVNRWFLGFEVLMKSKKSLSVADEISKFESLVKIE------------IEVIHVKKSNVPQYLSDKDKNKFLLFLPRKPRKRPTAGNELFNTSEAKRQKVA 1540
            P + LG+T  ++L +   +D++ ++EL  +L     F S+ E+ HR E L KL  L   W+ E ++    P+  A K+ GK++ FGSYRL     GADID L V P+ I R ++F+  +E L+    V +   + +AFVP++ M    +E+DLLFA +    +P + +L +  + L+R +D +++RS+NG RVTD++L LV N   FR ALRTIKLW+K+ GIYSN++G+ GGV+WA+LVAR CQL+P A++ T+V KFF  F  +WKWP P+LL+   + + L    W+P+ N  D YH+ PIITP+YP QNST+NV+ES K +I+        +  +I  G      LFE+  FF+ Y+H++++ +         +   L+ESK+R+    LE+N  IA  H+N + F         +  + SG     K SQ          + + WF+G E       ++ + + I  F   V +             I+  HVK+  +  YL D D      FL R+ RK   + N   NT  A R++++
Sbjct:   24 PAKQLGMTSAISLAEPRPEDLQRTDELRGSLEPYNVFESQDELNHRMEILAKLNTLVKQWVKEISVSKNMPESAAEKLGGKIYTFGSYRLGVHHKGADIDALCVAPRNIERTDYFQSFFEVLKKQPEVTECRSVEEAFVPVIKMNFDGIEIDLLFARLSLKEIPDDFDLRD--DNLLRNLDHRSVRSLNGCRVTDEILALVPNIENFRLALRTIKLWAKKHGIYSNSLGYFGGVTWAMLVARTCQLYPNAAAATLVHKFFLVFS-RWKWPNPVLLKHPDNVN-LRFQVWDPRVNASDRYHLMPIITPAYPQQNSTFNVSESTKKVILTEFNRGMNITDEIMLGRIPWERLFEAPSFFYRYRHFIVLLVNSQTADDHLEWCGLVESKVRLLIGNLERNPHIALAHVNPKCFEFKKGQSANNSQNNSGNEDDLKQSQGNQSAVTSAPFCSMWFIGLEFERSENLNVDLTESIQNFTEHVMMHGVNIKMLKEGMTIDARHVKRKQLSLYL-DSD------FLKRE-RKSMESHNNFNNTLLANRKRLS 556          
BLAST of SMED30019224 vs. Ensembl Fly
Match: hrg (gene:FBgn0015949 transcript:FBtr0111010)

HSP 1 Score: 340.502 bits (872), Expect = 3.273e-109
Identity = 194/545 (35.60%), Postives = 301/545 (55.23%), Query Frame = -3
Query:   11 PPECLGITGFVTLEKSTEKDIKLSNELELTLINTKEFMSKLEIEHRKETLNKLEELCNSWIYEKALQNYYPKKTASKIKGKLFAFGSYRLNTDFIGADIDTLLVCPQFISREEFFKELYEYLRNCSLVKDILVLPDAFVPLMTMKLCDVEMDLLFASIDESTVPGNLNLNNNTEQLMRRMDEKNIRSINGVRVTDDLLTLVYNKNAFRTALRTIKLWSKRCGIYSNAMGFLGGVSWAILVARVCQLWPTASSFTIVTKFFYFFGIKWKWPTPILLRKITSSSVLSLPQWNPQTNPKDSYHVFPIITPSYPCQNSTYNVTESHKTIIINHMKNAHELCQQIANGNKKLSDLFES-KFFFTYQHYLMVTIKDSDESQFNKNSSLIESKLRIFARYLEKNESIAFVHINVQTFN-------CHEMDKSG-----KTSQ----------YVNRWFLGFEVLMKSKKSLSVADEISKFESLVKIE------------IEVIHVKKSNVPQYLSDKDKNKFLLFLPRKPRKRPTAGNELFNTSEAKRQKVA 1540
            P + LG+T  ++L +   +D++ ++EL  +L     F S+ E+ HR E L KL  L   W+ E ++    P+  A K+ GK++ FGSYRL     GADID L V P+ I R ++F+  +E L+    V +   + +AFVP++ M    +E+DLLFA +    +P + +L +  + L+R +D +++RS+NG RVTD++L LV N   FR ALRTIKLW+K+ GIYSN++G+ GGV+WA+LVAR CQL+P A++ T+V KFF  F  +WKWP P+LL+   + + L    W+P+ N  D YH+ PIITP+YP QNST+NV+ES K +I+        +  +I  G      LFE+  FF+ Y+H++++ +         +   L+ESK+R+    LE+N  IA  H+N + F         +  + SG     K SQ          + + WF+G E       ++ + + I  F   V +             I+  HVK+  +  YL D D      FL R+ RK   + N   NT  A R++++
Sbjct:   24 PAKQLGMTSAISLAEPRPEDLQRTDELRGSLEPYNVFESQDELNHRMEILAKLNTLVKQWVKEISVSKNMPESAAEKLGGKIYTFGSYRLGVHHKGADIDALCVAPRNIERTDYFQSFFEVLKKQPEVTECRSVEEAFVPVIKMNFDGIEIDLLFARLSLKEIPDDFDLRD--DNLLRNLDHRSVRSLNGCRVTDEILALVPNIENFRLALRTIKLWAKKHGIYSNSLGYFGGVTWAMLVARTCQLYPNAAAATLVHKFFLVFS-RWKWPNPVLLKHPDNVN-LRFQVWDPRVNASDRYHLMPIITPAYPQQNSTFNVSESTKKVILTEFNRGMNITDEIMLGRIPWERLFEAPSFFYRYRHFIVLLVNSQTADDHLEWCGLVESKVRLLIGNLERNPHIALAHVNPKCFEFKKGQSANNSQNNSGNEDDLKQSQGNQSAVTSAPFCSMWFIGLEFERSENLNVDLTESIQNFTEHVMMHGVNIKMLKEGMTIDARHVKRKQLSLYL-DSD------FLKRE-RKSMESHNNFNNTLLANRKRLS 556          
BLAST of SMED30019224 vs. Ensembl Fly
Match: hrg (gene:FBgn0015949 transcript:FBtr0330248)

HSP 1 Score: 340.502 bits (872), Expect = 1.809e-107
Identity = 194/545 (35.60%), Postives = 301/545 (55.23%), Query Frame = -3
Query:   11 PPECLGITGFVTLEKSTEKDIKLSNELELTLINTKEFMSKLEIEHRKETLNKLEELCNSWIYEKALQNYYPKKTASKIKGKLFAFGSYRLNTDFIGADIDTLLVCPQFISREEFFKELYEYLRNCSLVKDILVLPDAFVPLMTMKLCDVEMDLLFASIDESTVPGNLNLNNNTEQLMRRMDEKNIRSINGVRVTDDLLTLVYNKNAFRTALRTIKLWSKRCGIYSNAMGFLGGVSWAILVARVCQLWPTASSFTIVTKFFYFFGIKWKWPTPILLRKITSSSVLSLPQWNPQTNPKDSYHVFPIITPSYPCQNSTYNVTESHKTIIINHMKNAHELCQQIANGNKKLSDLFES-KFFFTYQHYLMVTIKDSDESQFNKNSSLIESKLRIFARYLEKNESIAFVHINVQTFN-------CHEMDKSG-----KTSQ----------YVNRWFLGFEVLMKSKKSLSVADEISKFESLVKIE------------IEVIHVKKSNVPQYLSDKDKNKFLLFLPRKPRKRPTAGNELFNTSEAKRQKVA 1540
            P + LG+T  ++L +   +D++ ++EL  +L     F S+ E+ HR E L KL  L   W+ E ++    P+  A K+ GK++ FGSYRL     GADID L V P+ I R ++F+  +E L+    V +   + +AFVP++ M    +E+DLLFA +    +P + +L +  + L+R +D +++RS+NG RVTD++L LV N   FR ALRTIKLW+K+ GIYSN++G+ GGV+WA+LVAR CQL+P A++ T+V KFF  F  +WKWP P+LL+   + + L    W+P+ N  D YH+ PIITP+YP QNST+NV+ES K +I+        +  +I  G      LFE+  FF+ Y+H++++ +         +   L+ESK+R+    LE+N  IA  H+N + F         +  + SG     K SQ          + + WF+G E       ++ + + I  F   V +             I+  HVK+  +  YL D D      FL R+ RK   + N   NT  A R++++
Sbjct:   24 PAKQLGMTSAISLAEPRPEDLQRTDELRGSLEPYNVFESQDELNHRMEILAKLNTLVKQWVKEISVSKNMPESAAEKLGGKIYTFGSYRLGVHHKGADIDALCVAPRNIERTDYFQSFFEVLKKQPEVTECRSVEEAFVPVIKMNFDGIEIDLLFARLSLKEIPDDFDLRD--DNLLRNLDHRSVRSLNGCRVTDEILALVPNIENFRLALRTIKLWAKKHGIYSNSLGYFGGVTWAMLVARTCQLYPNAAAATLVHKFFLVFS-RWKWPNPVLLKHPDNVN-LRFQVWDPRVNASDRYHLMPIITPAYPQQNSTFNVSESTKKVILTEFNRGMNITDEIMLGRIPWERLFEAPSFFYRYRHFIVLLVNSQTADDHLEWCGLVESKVRLLIGNLERNPHIALAHVNPKCFEFKKGQSANNSQNNSGNEDDLKQSQGNQSAVTSAPFCSMWFIGLEFERSENLNVDLTESIQNFTEHVMMHGVNIKMLKEGMTIDARHVKRKQLSLYL-DSD------FLKRE-RKSMESHNNFNNTLLANRKRLS 556          
BLAST of SMED30019224 vs. Ensembl Zebrafish
Match: papolg (poly(A) polymerase gamma [Source:ZFIN;Acc:ZDB-GENE-040426-1256])

HSP 1 Score: 356.681 bits (914), Expect = 2.200e-114
Identity = 197/483 (40.79%), Postives = 279/483 (57.76%), Query Frame = -3
Query:  125 GITGFVTLEKSTEKDIKLSNELELTLINTKEFMSKLEIEHRKETLNKLEELCNSWIYEKALQNYYPKKTASKIKGKLFAFGSYRLNTDFIGADIDTLLVCPQFISREEFFKELYEYLRNCSLVKDILVLPDAFVPLMTMKLCDVEMDLLFASIDESTVPGNLNLNNNTEQLMRRMDEKNIRSINGVRVTDDLLTLVYNKNAFRTALRTIKLWSKRCGIYSNAMGFLGGVSWAILVARVCQLWPTASSFTIVTKFFYFFGIKWKWPTPILLRKITSSSVLSLPQWNPQTNPKDSYHVFPIITPSYPCQNSTYNVTESHKTIIINHMKNAHELCQQIANGNKKLSDLFESK-FFFTYQHYLMVTIKDSDESQFNKNSSLIESKLRIFARYLEKNESIAFVHINVQTFNCHEMDKSGKTSQYVNRWFLG--FEVLMKSK-KSLSVADEISKFESLV------------KIEIEVIHVKKSNVPQYL 1525
            GIT  ++L    E D   + +L   +     F  + E+ HR   L KL      WI E +     P    + + GK+F FGSYRL     GADID L V P+ + R +FF   +E L+    +KD+  + DAFVP++  K   +E+DLLFA +   ++P NL+L  ++  L+R +D + IRS+NG RVTD++L LV NK  FR  LR IKLW+KR GIYSN +GFLGGVSWA+LVAR CQL+P A + T+V KFF  F  KW+WP P+LL++   S+ L+LP W+P+ NP D YH+ PIITP+YP QNSTYNV+ S +TI+    KN   +  +I  G    S LFE   FF  Y+HY+++T   S E    +   L+ESK+R+    LE+NE I   H+N Q+F   + +++   + +V+ WF+G  F+ L  S   ++ +  +I  F   V             + IE  HVKK  +  YL
Sbjct:   22 GITSSISLAFPREIDHIYTQKLTEAMKPFGVFEGEDELNHRLAVLGKLNSFVKEWISEISESKNLPPSAVANVGGKIFTFGSYRLGVHTKGADIDALCVAPRHVERTDFFSSFFEKLKRHDEIKDLRAVEDAFVPVIKFKFDGIEIDLLFARLALQSIPDNLDLRGDS--LLRNLDIRCIRSLNGCRVTDEILYLVPNKENFRLTLRAIKLWAKRRGIYSNMLGFLGGVSWAMLVARTCQLYPNAVAATLVHKFFLVFS-KWEWPNPVLLKQPEDSN-LNLPVWDPRVNPSDRYHLMPIITPAYPQQNSTYNVSTSTRTIMNEEFKNGLTVTDEILQGKADWSKLFEPPNFFQQYRHYIVLTASASTEENHLEWIGLVESKIRVLVGNLERNEYITLAHVNPQSFPGSKENRN--ENDFVSMWFIGISFKKLDNSDCVNIDLTYDIQSFTDTVYRQASNINMLKDGMTIEATHVKKKQLHHYL 498          
BLAST of SMED30019224 vs. Ensembl Zebrafish
Match: papola (poly(A) polymerase alpha [Source:ZFIN;Acc:ZDB-GENE-030131-3507])

HSP 1 Score: 345.125 bits (884), Expect = 3.968e-110
Identity = 197/525 (37.52%), Postives = 290/525 (55.24%), Query Frame = -3
Query:   35 EIKEADIPPECLGITGFVTLEKSTEKDIKLSNELELTLINTKEFMSKLEIEHRKETLNKLEELCNSWIYEKALQNYYPKKTASKIKGKLFAFGSYRLNTDFIGADIDTLLVCPQFISREEFFKELYEYLRNCSLVKDILVLPDAFVPLMTMKLCDVEMDLLFASIDESTVPGNLNLNNNTEQLMRRMDEKNIRSINGVRVTDDLLTLVYNKNAFRTALRTIKLWSKRCGIYSNAMGFLGGVSWAILVARVCQLWPTASSFTIVTKFFYFFGIKWKWPTPILLRKITSSSVLSLPQWNPQTNPKDSYHVFPIITPSYPCQNSTYNVTESHKTIIINHMKNAHELCQQIANGNKKLSDLFESKFFFT-YQHYLMVTIKDSDESQFNKNSSLIESKLRIFARYLEKNESIAFVHINVQTFNCHEMDKSGKTSQYVNRWFLG--FEVLMKSKK-SLSVADEISKFESLV------------KIEIEVIHVKKSNVPQYLSDKDKNKFLLFLPRKPRKRPTAGNELFNTS 1561
            +++ A   P+  GIT  ++L    E D+ L+ +L  TL     F  +LE++ R   L KL  L   WI E +     P      + GK+F FGSYRL     GADID L V P+ + R +FF   YE L+    VKD+  + +AFVP++ +    +E+D+LFA +   T+P NL+L ++   L++ +D + IRS+NG RVTD++L LV N   FR  LR IKLW+KR  IYSN +GFLGGVSWA+LVAR CQL+P A + T+V KFF  F  KW+WP P+LL++    + L+LP W+P+  P D YH+ PIITP+YP QNSTYNV+ S + I++   K    +  +I       S LFE+  FF  Y+HY+++      E Q  +   L+ESK+RI    LEKNE I   H+N Q+F   +  +     ++   W +G  F+ +  S+  ++ +  +I  F   V             ++I  +HVK+  + Q L +       + + R  RK  + G    N S
Sbjct:    8 QVQTAQPTPKHYGITSPISLAPPKEADLVLTRKLTETLRPFGVFEEELELQRRILVLGKLNTLVKFWIREVSEAKNIPASVIDSVGGKIFTFGSYRLGVHTKGADIDALCVAPRHVERTDFFSSFYEKLKEQEEVKDLRAVEEAFVPVIKLAFDGIEIDILFARLALQTIPENLDLRDDG--LLKNLDIRCIRSLNGCRVTDEILHLVPNIENFRLTLRAIKLWAKRHNIYSNILGFLGGVSWAMLVARTCQLYPNAVAATLVHKFFLVFS-KWEWPNPVLLKQPEDCN-LNLPVWDPRVTPSDRYHLMPIITPAYPQQNSTYNVSASTRAIMVEEFKRGLAITDEILQNKADWSKLFEAPNFFQKYKHYIVLLASAQTEKQHLEWVGLVESKIRILVGNLEKNEFITLAHVNPQSFPGPK--EGNDKEEFSTMWVIGIVFKKMEGSENLNVDLTFDIQSFTDTVYRQAITSKMFEQDMKITAMHVKRKQLHQLLPE-------VAIHRSKRKHSSDGVRAMNDS 519          
BLAST of SMED30019224 vs. Ensembl Zebrafish
Match: papola (poly(A) polymerase alpha [Source:ZFIN;Acc:ZDB-GENE-030131-3507])

HSP 1 Score: 306.605 bits (784), Expect = 1.298e-98
Identity = 159/374 (42.51%), Postives = 224/374 (59.89%), Query Frame = -3
Query:  440 EIKEADIPPECLGITGFVTLEKSTEKDIKLSNELELTLINTKEFMSKLEIEHRKETLNKLEELCNSWIYEKALQNYYPKKTASKIKGKLFAFGSYRLNTDFIGADIDTLLVCPQFISREEFFKELYEYLRNCSLVKDILVLPDAFVPLMTMKLCDVEMDLLFASIDESTVPGNLNLNNNTEQLMRRMDEKNIRSINGVRVTDDLLTLVYNKNAFRTALRTIKLWSKRCGIYSNAMGFLGGVSWAILVARVCQLWPTASSFTIVTKFFYFFGIKWKWPTPILLRKITSSSVLSLPQWNPQTNPKDSYHVFPIITPSYPCQNSTYNVTESHKTIIINHMKNAHELCQQIANGNKKLSDLFESKFFFTYQHYLMVTI 1561
            +++ A   P+  GIT  ++L    E D+ L+ +L  TL     F  +LE++ R   L KL  L   WI E +     P      + GK+F FGSYRL     GADID L V P+ + R +FF   YE L+    VKD+  + +AFVP++ +    +E+D+LFA +   T+P NL+L +  + L++ +D + IRS+NG RVTD++L LV N   FR  LR IKLW+KR  IYSN +GFLGGVSWA+LVAR CQL+P A + T+V KFF  F  KW+WP P+LL++    + L+LP W+P+  P D YH+ PIITP+YP QNSTYNV+ S + I++   K    +  +I       S LFE+  FF    Y++  I
Sbjct:    8 QVQTAQPTPKHYGITSPISLAPPKEADLVLTRKLTETLRPFGVFEEELELQRRILVLGKLNTLVKFWIREVSEAKNIPASVIDSVGGKIFTFGSYRLGVHTKGADIDALCVAPRHVERTDFFSSFYEKLKEQEEVKDLRAVEEAFVPVIKLAFDGIEIDILFARLALQTIPENLDLRD--DGLLKNLDIRCIRSLNGCRVTDEILHLVPNIENFRLTLRAIKLWAKRHNIYSNILGFLGGVSWAMLVARTCQLYPNAVAATLVHKFFLVFS-KWEWPNPVLLKQPEDCN-LNLPVWDPRVTPSDRYHLMPIITPAYPQQNSTYNVSASTRAIMVEEFKRGLAITDEILQNKADWSKLFEAPNFFQKYKYVLSCI 377          
BLAST of SMED30019224 vs. Ensembl Zebrafish
Match: papola (poly(A) polymerase alpha [Source:ZFIN;Acc:ZDB-GENE-030131-3507])

HSP 1 Score: 223.787 bits (569), Expect = 8.787e-69
Identity = 117/270 (43.33%), Postives = 163/270 (60.37%), Query Frame = -3
Query:  752 EIKEADIPPECLGITGFVTLEKSTEKDIKLSNELELTLINTKEFMSKLEIEHRKETLNKLEELCNSWIYEKALQNYYPKKTASKIKGKLFAFGSYRLNTDFIGADIDTLLVCPQFISREEFFKELYEYLRNCSLVKDILVLPDAFVPLMTMKLCDVEMDLLFASIDESTVPGNLNLNNNTEQLMRRMDEKNIRSINGVRVTDDLLTLVYNKNAFRTALRTIKLWSKRCGIYSNAMGFLGGVSWAILVARVCQLWPTASSFTIVTKFFYFF 1561
            +++ A   P+  GIT  ++L    E D+ L+ +L  TL     F  +LE++ R   L KL  L   WI E +     P      + GK+F FGSYRL     GADID L V P+ + R +FF   YE L+    VKD+  + +AFVP++ +    +E+D+LFA +   T+P NL+L ++   L++ +D + IRS+NG RVTD++L LV N   FR  LR IKLW+KR  IYSN +GFLGGVSWA+LVAR CQL+P A + T+V KFF  F
Sbjct:    8 QVQTAQPTPKHYGITSPISLAPPKEADLVLTRKLTETLRPFGVFEEELELQRRILVLGKLNTLVKFWIREVSEAKNIPASVIDSVGGKIFTFGSYRLGVHTKGADIDALCVAPRHVERTDFFSSFYEKLKEQEEVKDLRAVEEAFVPVIKLAFDGIEIDILFARLALQTIPENLDLRDDG--LLKNLDIRCIRSLNGCRVTDEILHLVPNIENFRLTLRAIKLWAKRHNIYSNILGFLGGVSWAMLVARTCQLYPNAVAATLVHKFFLVF 275          
BLAST of SMED30019224 vs. Ensembl Zebrafish
Match: papola (poly(A) polymerase alpha [Source:ZFIN;Acc:ZDB-GENE-030131-3507])

HSP 1 Score: 162.155 bits (409), Expect = 1.394e-46
Identity = 83/186 (44.62%), Postives = 113/186 (60.75%), Query Frame = -3
Query:  839 TLNKLEELCNSWIYEKALQNYYPKKTASKIKGKLFAFGSYRLNTDFIGADIDTLLVCPQFISREEFFKELYEYLRNCSLVKDILVLPDAFVPLMTMKLCDVEMDLLFASIDESTVPGNLNLNNNTEQLMRRMDEKNIRSINGVRVTDDLLTLVYNKNAFRTALRTIKLWSKRCGIYSNAMGFLGGV 1396
             L KL  L   WI E +     P      + GK+F FGSYRL     GADID L V P+ + R +FF   YE L+    VKD+  + +AFVP++ +    +E+D+LFA +   T+P NL+L ++   L++ +D + IRS+NG RVTD++L LV N   FR  LR IKLW+KR  IYSN +GFLGGV
Sbjct:    6 VLGKLNTLVKFWIREVSEAKNIPASVIDSVGGKIFTFGSYRLGVHTKGADIDALCVAPRHVERTDFFSSFYEKLKEQEEVKDLRAVEEAFVPVIKLAFDGIEIDILFARLALQTIPENLDLRDDG--LLKNLDIRCIRSLNGCRVTDEILHLVPNIENFRLTLRAIKLWAKRHNIYSNILGFLGGV 189          
BLAST of SMED30019224 vs. Ensembl Xenopus
Match: papolg (poly(A) polymerase gamma [Source:NCBI gene;Acc:448186])

HSP 1 Score: 354.755 bits (909), Expect = 1.502e-113
Identity = 192/490 (39.18%), Postives = 279/490 (56.94%), Query Frame = -3
Query:  125 DIPPECLGITGFVTLEKSTEKDIKLSNELELTLINTKEFMSKLEIEHRKETLNKLEELCNSWIYEKALQNYYPKKTASKIKGKLFAFGSYRLNTDFIGADIDTLLVCPQFISREEFFKELYEYLRNCSLVKDILVLPDAFVPLMTMKLCDVEMDLLFASIDESTVPGNLNLNNNTEQLMRRMDEKNIRSINGVRVTDDLLTLVYNKNAFRTALRTIKLWSKRCGIYSNAMGFLGGVSWAILVARVCQLWPTASSFTIVTKFFYFFGIKWKWPTPILLRKITSSSVLSLPQWNPQTNPKDSYHVFPIITPSYPCQNSTYNVTESHKTIIINHMKNAHELCQQIANGNKKLSDLFESK-FFFTYQHYLMVTIKDSDESQFNKNSSLIESKLRIFARYLEKNESIAFVHINVQTFNCHEMDKSGKTSQYVNRWFLGF---EVLMKSKKSLSVADEISKFESLV------------KIEIEVIHVKKSNVPQYL 1546
            ++PP+  GIT  ++L    + D   + +L   +     F    E+ HR   L KL  L   WI E   Q   P    S + GK+F FGSYRL     GADID+L V P+ + R +FF+   E L+    +K++  + DAFVP++  +  + E+DL+FA +    +P NL+L +++   +R +D + IRS+NG RVTD++L LV NK  FR  LR IKLW+KR GIYSN +GFLGGVSWA+LVAR CQL+P A + T+V KFF  F  KW+WP P+LL++   S+ L+LP W+P+ NP D  H+ PIITP+YP QNSTYNV+ S +++++   K    +  +I  G    S LFE   FF  Y+HY+++T   S E    +   L+ESK+R+    LE+N  I   H+N Q+F  +      K ++YV+ WFLG    +V      ++ +  +I  F   V             + IE  HVK+  +  YL
Sbjct:    4 NVPPKHYGITSPISLAGPKDTDHIYTQKLTEAMRPFGVFEDDAELSHRMVVLGKLNNLVKEWIGELGEQKSLPPSIISAVGGKIFTFGSYRLGVHTKGADIDSLCVAPRHVERSDFFQSFSEKLKQQDGIKNLRAVEDAFVPVIKFEFMNTEIDLVFARLPLQCIPDNLDLRDDSR--LRNLDIRCIRSLNGCRVTDEILHLVPNKENFRLTLRAIKLWAKRRGIYSNMLGFLGGVSWAMLVARTCQLYPNAIASTLVHKFFLVFS-KWEWPNPVLLKQPEDSN-LNLPVWDPRVNPADRCHLMPIITPAYPQQNSTYNVSISTRSVMVEEFKQGLSVTDEILLGRCDWSKLFEPPNFFHKYKHYIVLTASASTEEHHLEWVGLVESKIRVLVGNLERNSFITLAHVNPQSFPGNR--DHCKDNEYVSMWFLGIIFKKVENAESVNIDLTHDIQSFTDTVYRQANNINMLKKGMRIEATHVKRKQLHHYL 487          
BLAST of SMED30019224 vs. Ensembl Xenopus
Match: papolg (poly(A) polymerase gamma [Source:NCBI gene;Acc:448186])

HSP 1 Score: 352.829 bits (904), Expect = 3.755e-113
Identity = 192/488 (39.34%), Postives = 277/488 (56.76%), Query Frame = -3
Query:  125 PPECLGITGFVTLEKSTEKDIKLSNELELTLINTKEFMSKLEIEHRKETLNKLEELCNSWIYEKALQNYYPKKTASKIKGKLFAFGSYRLNTDFIGADIDTLLVCPQFISREEFFKELYEYLRNCSLVKDILVLPDAFVPLMTMKLCDVEMDLLFASIDESTVPGNLNLNNNTEQLMRRMDEKNIRSINGVRVTDDLLTLVYNKNAFRTALRTIKLWSKRCGIYSNAMGFLGGVSWAILVARVCQLWPTASSFTIVTKFFYFFGIKWKWPTPILLRKITSSSVLSLPQWNPQTNPKDSYHVFPIITPSYPCQNSTYNVTESHKTIIINHMKNAHELCQQIANGNKKLSDLFE-SKFFFTYQHYLMVTIKDSDESQFNKNSSLIESKLRIFARYLEKNESIAFVHINVQTFNCHEMDKSGKTSQYVNRWFLGF---EVLMKSKKSLSVADEISKFESLV------------KIEIEVIHVKKSNVPQYL 1540
            PP+  GIT  ++L    + D   + +L   +     F    E+ HR   L KL  L   WI E   Q   P    S + GK+F FGSYRL     GADID+L V P+ + R +FF+   E L+    +K++  + DAFVP++  +  + E+DL+FA +    +P NL+L +++   +R +D + IRS+NG RVTD++L LV NK  FR  LR IKLW+KR GIYSN +GFLGGVSWA+LVAR CQL+P A + T+V KFF  F  KW+WP P+LL++   S+ L+LP W+P+ NP D  H+ PIITP+YP QNSTYNV+ S +++++   K    +  +I  G    S LFE   FF  Y+HY+++T   S E    +   L+ESK+R+    LE+N  I   H+N Q+F  +      K ++YV+ WFLG    +V      ++ +  +I  F   V             + IE  HVK+  +  YL
Sbjct:    8 PPKHYGITSPISLAGPKDTDHIYTQKLTEAMRPFGVFEDDAELSHRMVVLGKLNNLVKEWIGELGEQKSLPPSIISAVGGKIFTFGSYRLGVHTKGADIDSLCVAPRHVERSDFFQSFSEKLKQQDGIKNLRAVEDAFVPVIKFEFMNTEIDLVFARLPLQCIPDNLDLRDDSR--LRNLDIRCIRSLNGCRVTDEILHLVPNKENFRLTLRAIKLWAKRRGIYSNMLGFLGGVSWAMLVARTCQLYPNAIASTLVHKFFLVFS-KWEWPNPVLLKQPEDSN-LNLPVWDPRVNPADRCHLMPIITPAYPQQNSTYNVSISTRSVMVEEFKQGLSVTDEILLGRCDWSKLFEPPNFFHKYKHYIVLTASASTEEHHLEWVGLVESKIRVLVGNLERNSFITLAHVNPQSFPGNR--DHCKDNEYVSMWFLGIIFKKVENAESVNIDLTHDIQSFTDTVYRQANNINMLKKGMRIEATHVKRKQLHHYL 489          
BLAST of SMED30019224 vs. Ensembl Xenopus
Match: papolg (poly(A) polymerase gamma [Source:NCBI gene;Acc:448186])

HSP 1 Score: 353.599 bits (906), Expect = 4.219e-113
Identity = 193/491 (39.31%), Postives = 278/491 (56.62%), Query Frame = -3
Query:  125 ADIPPECLGITGFVTLEKSTEKDIKLSNELELTLINTKEFMSKLEIEHRKETLNKLEELCNSWIYEKALQNYYPKKTASKIKGKLFAFGSYRLNTDFIGADIDTLLVCPQFISREEFFKELYEYLRNCSLVKDILVLPDAFVPLMTMKLCDVEMDLLFASIDESTVPGNLNLNNNTEQLMRRMDEKNIRSINGVRVTDDLLTLVYNKNAFRTALRTIKLWSKRCGIYSNAMGFLGGVSWAILVARVCQLWPTASSFTIVTKFFYFFGIKWKWPTPILLRKITSSSVLSLPQWNPQTNPKDSYHVFPIITPSYPCQNSTYNVTESHKTIIINHMKNAHELCQQIANGNKKLSDLFE-SKFFFTYQHYLMVTIKDSDESQFNKNSSLIESKLRIFARYLEKNESIAFVHINVQTFNCHEMDKSGKTSQYVNRWFLGF---EVLMKSKKSLSVADEISKFESLV------------KIEIEVIHVKKSNVPQYL 1549
            A  PP+  GIT  ++L    + D   + +L   +     F    E+ HR   L KL  L   WI E   Q   P    S + GK+F FGSYRL     GADID+L V P+ + R +FF+   E L+    +K++  + DAFVP++  +  + E+DL+FA +    +P NL+L +++   +R +D + IRS+NG RVTD++L LV NK  FR  LR IKLW+KR GIYSN +GFLGGVSWA+LVAR CQL+P A + T+V KFF  F  KW+WP P+LL++   S+ L+LP W+P+ NP D  H+ PIITP+YP QNSTYNV+ S +++++   K    +  +I  G    S LFE   FF  Y+HY+++T   S E    +   L+ESK+R+    LE+N  I   H+N Q+F  +      K ++YV+ WFLG    +V      ++ +  +I  F   V             + IE  HVK+  +  YL
Sbjct:   39 AGQPPKHYGITSPISLAGPKDTDHIYTQKLTEAMRPFGVFEDDAELSHRMVVLGKLNNLVKEWIGELGEQKSLPPSIISAVGGKIFTFGSYRLGVHTKGADIDSLCVAPRHVERSDFFQSFSEKLKQQDGIKNLRAVEDAFVPVIKFEFMNTEIDLVFARLPLQCIPDNLDLRDDSR--LRNLDIRCIRSLNGCRVTDEILHLVPNKENFRLTLRAIKLWAKRRGIYSNMLGFLGGVSWAMLVARTCQLYPNAIASTLVHKFFLVFS-KWEWPNPVLLKQPEDSN-LNLPVWDPRVNPADRCHLMPIITPAYPQQNSTYNVSISTRSVMVEEFKQGLSVTDEILLGRCDWSKLFEPPNFFHKYKHYIVLTASASTEEHHLEWVGLVESKIRVLVGNLERNSFITLAHVNPQSFPGNR--DHCKDNEYVSMWFLGIIFKKVENAESVNIDLTHDIQSFTDTVYRQANNINMLKKGMRIEATHVKRKQLHHYL 523          
BLAST of SMED30019224 vs. Ensembl Xenopus
Match: papolg (poly(A) polymerase gamma [Source:NCBI gene;Acc:448186])

HSP 1 Score: 353.984 bits (907), Expect = 4.677e-113
Identity = 193/491 (39.31%), Postives = 278/491 (56.62%), Query Frame = -3
Query:  125 ADIPPECLGITGFVTLEKSTEKDIKLSNELELTLINTKEFMSKLEIEHRKETLNKLEELCNSWIYEKALQNYYPKKTASKIKGKLFAFGSYRLNTDFIGADIDTLLVCPQFISREEFFKELYEYLRNCSLVKDILVLPDAFVPLMTMKLCDVEMDLLFASIDESTVPGNLNLNNNTEQLMRRMDEKNIRSINGVRVTDDLLTLVYNKNAFRTALRTIKLWSKRCGIYSNAMGFLGGVSWAILVARVCQLWPTASSFTIVTKFFYFFGIKWKWPTPILLRKITSSSVLSLPQWNPQTNPKDSYHVFPIITPSYPCQNSTYNVTESHKTIIINHMKNAHELCQQIANGNKKLSDLFESK-FFFTYQHYLMVTIKDSDESQFNKNSSLIESKLRIFARYLEKNESIAFVHINVQTFNCHEMDKSGKTSQYVNRWFLGF---EVLMKSKKSLSVADEISKFESLV------------KIEIEVIHVKKSNVPQYL 1549
            A  PP+  GIT  ++L    + D   + +L   +     F    E+ HR   L KL  L   WI E   Q   P    S + GK+F FGSYRL     GADID+L V P+ + R +FF+   E L+    +K++  + DAFVP++  +  + E+DL+FA +    +P NL+L +++   +R +D + IRS+NG RVTD++L LV NK  FR  LR IKLW+KR GIYSN +GFLGGVSWA+LVAR CQL+P A + T+V KFF  F  KW+WP P+LL++   S+ L+LP W+P+ NP D  H+ PIITP+YP QNSTYNV+ S +++++   K    +  +I  G    S LFE   FF  Y+HY+++T   S E    +   L+ESK+R+    LE+N  I   H+N Q+F  +      K ++YV+ WFLG    +V      ++ +  +I  F   V             + IE  HVK+  +  YL
Sbjct:   11 AGQPPKHYGITSPISLAGPKDTDHIYTQKLTEAMRPFGVFEDDAELSHRMVVLGKLNNLVKEWIGELGEQKSLPPSIISAVGGKIFTFGSYRLGVHTKGADIDSLCVAPRHVERSDFFQSFSEKLKQQDGIKNLRAVEDAFVPVIKFEFMNTEIDLVFARLPLQCIPDNLDLRDDSR--LRNLDIRCIRSLNGCRVTDEILHLVPNKENFRLTLRAIKLWAKRRGIYSNMLGFLGGVSWAMLVARTCQLYPNAIASTLVHKFFLVFS-KWEWPNPVLLKQPEDSN-LNLPVWDPRVNPADRCHLMPIITPAYPQQNSTYNVSISTRSVMVEEFKQGLSVTDEILLGRCDWSKLFEPPNFFHKYKHYIVLTASASTEEHHLEWVGLVESKIRVLVGNLERNSFITLAHVNPQSFPGNR--DHCKDNEYVSMWFLGIIFKKVENAESVNIDLTHDIQSFTDTVYRQANNINMLKKGMRIEATHVKRKQLHHYL 495          
BLAST of SMED30019224 vs. Ensembl Xenopus
Match: papolg (poly(A) polymerase gamma [Source:NCBI gene;Acc:448186])

HSP 1 Score: 353.984 bits (907), Expect = 7.851e-113
Identity = 193/491 (39.31%), Postives = 278/491 (56.62%), Query Frame = -3
Query:  125 ADIPPECLGITGFVTLEKSTEKDIKLSNELELTLINTKEFMSKLEIEHRKETLNKLEELCNSWIYEKALQNYYPKKTASKIKGKLFAFGSYRLNTDFIGADIDTLLVCPQFISREEFFKELYEYLRNCSLVKDILVLPDAFVPLMTMKLCDVEMDLLFASIDESTVPGNLNLNNNTEQLMRRMDEKNIRSINGVRVTDDLLTLVYNKNAFRTALRTIKLWSKRCGIYSNAMGFLGGVSWAILVARVCQLWPTASSFTIVTKFFYFFGIKWKWPTPILLRKITSSSVLSLPQWNPQTNPKDSYHVFPIITPSYPCQNSTYNVTESHKTIIINHMKNAHELCQQIANGNKKLSDLFE-SKFFFTYQHYLMVTIKDSDESQFNKNSSLIESKLRIFARYLEKNESIAFVHINVQTFNCHEMDKSGKTSQYVNRWFLGF---EVLMKSKKSLSVADEISKFESLV------------KIEIEVIHVKKSNVPQYL 1549
            A  PP+  GIT  ++L    + D   + +L   +     F    E+ HR   L KL  L   WI E   Q   P    S + GK+F FGSYRL     GADID+L V P+ + R +FF+   E L+    +K++  + DAFVP++  +  + E+DL+FA +    +P NL+L +++   +R +D + IRS+NG RVTD++L LV NK  FR  LR IKLW+KR GIYSN +GFLGGVSWA+LVAR CQL+P A + T+V KFF  F  KW+WP P+LL++   S+ L+LP W+P+ NP D  H+ PIITP+YP QNSTYNV+ S +++++   K    +  +I  G    S LFE   FF  Y+HY+++T   S E    +   L+ESK+R+    LE+N  I   H+N Q+F  +      K ++YV+ WFLG    +V      ++ +  +I  F   V             + IE  HVK+  +  YL
Sbjct:   11 AGQPPKHYGITSPISLAGPKDTDHIYTQKLTEAMRPFGVFEDDAELSHRMVVLGKLNNLVKEWIGELGEQKSLPPSIISAVGGKIFTFGSYRLGVHTKGADIDSLCVAPRHVERSDFFQSFSEKLKQQDGIKNLRAVEDAFVPVIKFEFMNTEIDLVFARLPLQCIPDNLDLRDDSR--LRNLDIRCIRSLNGCRVTDEILHLVPNKENFRLTLRAIKLWAKRRGIYSNMLGFLGGVSWAMLVARTCQLYPNAIASTLVHKFFLVFS-KWEWPNPVLLKQPEDSN-LNLPVWDPRVNPADRCHLMPIITPAYPQQNSTYNVSISTRSVMVEEFKQGLSVTDEILLGRCDWSKLFEPPNFFHKYKHYIVLTASASTEEHHLEWVGLVESKIRVLVGNLERNSFITLAHVNPQSFPGNR--DHCKDNEYVSMWFLGIIFKKVENAESVNIDLTHDIQSFTDTVYRQANNINMLKKGMRIEATHVKRKQLHHYL 495          
BLAST of SMED30019224 vs. Ensembl Mouse
Match: Papolg (poly(A) polymerase gamma [Source:MGI Symbol;Acc:MGI:2442119])

HSP 1 Score: 351.288 bits (900), Expect = 2.377e-112
Identity = 189/483 (39.13%), Postives = 279/483 (57.76%), Query Frame = -3
Query:  125 GITGFVTLEKSTEKDIKLSNELELTLINTKEFMSKLEIEHRKETLNKLEELCNSWIYEKALQNYYPKKTASKIKGKLFAFGSYRLNTDFIGADIDTLLVCPQFISREEFFKELYEYLRNCSLVKDILVLPDAFVPLMTMKLCDVEMDLLFASIDESTVPGNLNLNNNTEQLMRRMDEKNIRSINGVRVTDDLLTLVYNKNAFRTALRTIKLWSKRCGIYSNAMGFLGGVSWAILVARVCQLWPTASSFTIVTKFFYFFGIKWKWPTPILLRKITSSSVLSLPQWNPQTNPKDSYHVFPIITPSYPCQNSTYNVTESHKTIIINHMKNAHELCQQIANGNKKLSDLFESKFFFT-YQHYLMVTIKDSDESQFNKNSSLIESKLRIFARYLEKNESIAFVHINVQTFNCHEMDKSGKTSQYVNRWFLGF---EVLMKSKKSLSVADEISKFESLV------------KIEIEVIHVKKSNVPQYL 1525
            GIT  ++L    E D   + +L   +     F  + E+ HR   L KL  L   WI + +     P    + + GK+F FGSYRL     GADID L V P+ + R +FF+  +E L++   ++++  + DAFVP++  +   +E+DL+FA +   T+  NL+L +++   +R +D + IRS+NG RVTD++L LV NK  FR  LR +KLW+KR GIYSN +GFLGGVSWA+LVAR CQL+P A++ T+V KFF  F  KW+WP P+LL++   S+ L+LP W+P+ NP D YH+ PIITP+YP QNSTYNV+ S +T+++   K    +  +I  G    S L E   FF  Y+HY+++T   S E    +   L+ESK+R+    LE+NE I   H+N Q+F  ++  +  K + YV+ WFLG     V      ++ +  +I  F   V             ++IE  HVKK  +  YL
Sbjct:   20 GITSPISLACPKEIDHIYTQKLIDAMKPFGVFEDEEELNHRLVVLGKLNNLVKEWISDISESKNLPPSVVATVGGKIFTFGSYRLGVHTKGADIDALCVAPRHVERSDFFQSFFEKLKHQDGIRNLRAVEDAFVPVIKFEFDGIEIDLVFARLAIQTISDNLDLRDDSR--LRSLDIRCIRSLNGCRVTDEILHLVPNKETFRLTLRAVKLWAKRRGIYSNMLGFLGGVSWAMLVARTCQLYPNAAASTLVHKFFLVFS-KWEWPNPVLLKQPEESN-LNLPVWDPRVNPSDRYHLMPIITPAYPQQNSTYNVSTSTRTVMVEEFKQGLAVTDEILQGKSDWSKLLEPPNFFQKYRHYIVLTASASTEENHLEWVGLVESKIRVLVGNLERNEFITLAHVNPQSFPGNK--EHHKANNYVSMWFLGIIFRRVENAESVNIDLTYDIQSFTDTVYRQANNINMLKDGMKIEATHVKKKQLHHYL 496          
BLAST of SMED30019224 vs. Ensembl Mouse
Match: Papolg (poly(A) polymerase gamma [Source:MGI Symbol;Acc:MGI:2442119])

HSP 1 Score: 336.65 bits (862), Expect = 1.672e-110
Identity = 170/405 (41.98%), Postives = 248/405 (61.23%), Query Frame = -3
Query:  314 GITGFVTLEKSTEKDIKLSNELELTLINTKEFMSKLEIEHRKETLNKLEELCNSWIYEKALQNYYPKKTASKIKGKLFAFGSYRLNTDFIGADIDTLLVCPQFISREEFFKELYEYLRNCSLVKDILVLPDAFVPLMTMKLCDVEMDLLFASIDESTVPGNLNLNNNTEQLMRRMDEKNIRSINGVRVTDDLLTLVYNKNAFRTALRTIKLWSKRCGIYSNAMGFLGGVSWAILVARVCQLWPTASSFTIVTKFFYFFGIKWKWPTPILLRKITSSSVLSLPQWNPQTNPKDSYHVFPIITPSYPCQNSTYNVTESHKTIIINHMKNAHELCQQIANGNKKLSDLFESKFFFT-YQHYLMVTIKDSDESQFNKNSSLIESKLRIFARYLEKNESIAFVHINVQTF 1525
            GIT  ++L    E D   + +L   +     F  + E+ HR   L KL  L   WI + +     P    + + GK+F FGSYRL     GADID L V P+ + R +FF+  +E L++   ++++  + DAFVP++  +   +E+DL+FA +   T+  NL+L +++   +R +D + IRS+NG RVTD++L LV NK  FR  LR +KLW+KR GIYSN +GFLGGVSWA+LVAR CQL+P A++ T+V KFF  F  KW+WP P+LL++   S+ L+LP W+P+ NP D YH+ PIITP+YP QNSTYNV+ S +T+++   K    +  +I  G    S L E   FF  Y+HY+++T   S E    +   L+ESK+R+    LE+NE I   H+N Q+F
Sbjct:   20 GITSPISLACPKEIDHIYTQKLIDAMKPFGVFEDEEELNHRLVVLGKLNNLVKEWISDISESKNLPPSVVATVGGKIFTFGSYRLGVHTKGADIDALCVAPRHVERSDFFQSFFEKLKHQDGIRNLRAVEDAFVPVIKFEFDGIEIDLVFARLAIQTISDNLDLRDDSR--LRSLDIRCIRSLNGCRVTDEILHLVPNKETFRLTLRAVKLWAKRRGIYSNMLGFLGGVSWAMLVARTCQLYPNAAASTLVHKFFLVFS-KWEWPNPVLLKQPEESN-LNLPVWDPRVNPSDRYHLMPIITPAYPQQNSTYNVSTSTRTVMVEEFKQGLAVTDEILQGKSDWSKLLEPPNFFQKYRHYIVLTASASTEENHLEWVGLVESKIRVLVGNLERNEFITLAHVNPQSF 420          
BLAST of SMED30019224 vs. Ensembl Mouse
Match: Papola (poly (A) polymerase alpha [Source:MGI Symbol;Acc:MGI:109301])

HSP 1 Score: 322.783 bits (826), Expect = 6.672e-102
Identity = 189/494 (38.26%), Postives = 278/494 (56.28%), Query Frame = -3
Query:  125 KEADIPPECLGITGFVTLEKSTEKDIKLSNELELTLINTKEFMSKLEIEHRKETLNKLEELCNSWIYEKALQNYYPKKTASKIKGKLFAFGSYRLNTDFIGADIDTLLVCPQFISREEFFKELYEYLRNCSLVKDILVLPDAFVPLMTMKLCDVEMDLLFASIDESTVPGNLNLNNNTEQLMRRMDEKNIRSINGVRVTDDLLTLVYNKNAFRTALRTIKLWSKRCGIYSNAMGFLGGVSWAILVARVCQLWPTASSFTIVTKFFYFFGIKWKWPTPILLRKITSSSVLSLPQWNPQTNPKDSYHVFPIITPSYPCQNSTYNVTESHKTIIINHMKNAHELCQQIANGNKKLSDLFESKFFFT-YQHYLMVTIKDSDESQFNKNSSLIESKLRIFARYLEKNESIAFVHINVQTFNCHEMDKSGKTSQYVNRWFLGFEVLMKSKK----SLSVADEISKFESLV------------KIEIEVIHVKKSNVPQYL 1555
            ++   P    GIT  ++L    E D  L+ +L  TL     F  + E++ R   L KL  L   WI E +     P+     + GK+F FGSYRL     GADID L V P+ + R +FF   Y+ L+    VKD+  + +AFVP++ +    +E+D+LFA +   T+P +L+L    + L++ +D + IRS+NG RVTD++L LV N + FR  LR IKLW+KR  IYSN +GFLGGVSWA+LVAR CQL+P A + T+V KFF  F  KW+WP P+LL++    + L+LP W+P+ NP D YH+ PIITP+YP QNSTYNV+ S + +++   K    +  +I     + S LFE+  FF  Y+HY+++      E Q  +   L+ESK+RI    LEKNE I   H+N Q+F   +  +S    ++   W +G  V  K++     S+ +  +I  F   V             ++I  +HVK+  + Q L
Sbjct:   11 QQTQPPQRHYGITSPISLAAPKETDCLLTQKLIETLKPFGVFEEEEELQRRILILGKLNNLVKEWIREISESKNLPQSVIENVGGKIFTFGSYRLGVHTKGADIDALCVAPRHVDRSDFFTSFYDKLKLQEEVKDLRAVEEAFVPVIKLCFDGIEIDILFARLALQTIPEDLDLR--DDSLLKNLDIRCIRSLNGCRVTDEILHLVPNIDNFRLTLRAIKLWAKRHNIYSNILGFLGGVSWAMLVARTCQLYPNAIASTLVHKFFLVFS-KWEWPNPVLLKQPEECN-LNLPVWDPRVNPSDRYHLMPIITPAYPQQNSTYNVSVSTRMVMVEEFKQGLAITDEILLSKAEWSKLFEAPNFFQKYKHYIVLLASAPTEKQRLEWVGLVESKIRILVGSLEKNEFITLAHVNPQSFPAPK--ESPDREEFRTMWVIGL-VFKKTENSENLSVDLTYDIQSFTDTVYRQAINSKMFELDMKIAAMHVKRKQLHQLL 497          
BLAST of SMED30019224 vs. Ensembl Mouse
Match: Papola (poly (A) polymerase alpha [Source:MGI Symbol;Acc:MGI:109301])

HSP 1 Score: 323.168 bits (827), Expect = 1.052e-101
Identity = 189/494 (38.26%), Postives = 278/494 (56.28%), Query Frame = -3
Query:  125 KEADIPPECLGITGFVTLEKSTEKDIKLSNELELTLINTKEFMSKLEIEHRKETLNKLEELCNSWIYEKALQNYYPKKTASKIKGKLFAFGSYRLNTDFIGADIDTLLVCPQFISREEFFKELYEYLRNCSLVKDILVLPDAFVPLMTMKLCDVEMDLLFASIDESTVPGNLNLNNNTEQLMRRMDEKNIRSINGVRVTDDLLTLVYNKNAFRTALRTIKLWSKRCGIYSNAMGFLGGVSWAILVARVCQLWPTASSFTIVTKFFYFFGIKWKWPTPILLRKITSSSVLSLPQWNPQTNPKDSYHVFPIITPSYPCQNSTYNVTESHKTIIINHMKNAHELCQQIANGNKKLSDLFESKFFFT-YQHYLMVTIKDSDESQFNKNSSLIESKLRIFARYLEKNESIAFVHINVQTFNCHEMDKSGKTSQYVNRWFLGFEVLMKSKK----SLSVADEISKFESLV------------KIEIEVIHVKKSNVPQYL 1555
            ++   P    GIT  ++L    E D  L+ +L  TL     F  + E++ R   L KL  L   WI E +     P+     + GK+F FGSYRL     GADID L V P+ + R +FF   Y+ L+    VKD+  + +AFVP++ +    +E+D+LFA +   T+P +L+L    + L++ +D + IRS+NG RVTD++L LV N + FR  LR IKLW+KR  IYSN +GFLGGVSWA+LVAR CQL+P A + T+V KFF  F  KW+WP P+LL++    + L+LP W+P+ NP D YH+ PIITP+YP QNSTYNV+ S + +++   K    +  +I     + S LFE+  FF  Y+HY+++      E Q  +   L+ESK+RI    LEKNE I   H+N Q+F   +  +S    ++   W +G  V  K++     S+ +  +I  F   V             ++I  +HVK+  + Q L
Sbjct:   11 QQTQPPQRHYGITSPISLAAPKETDCLLTQKLIETLKPFGVFEEEEELQRRILILGKLNNLVKEWIREISESKNLPQSVIENVGGKIFTFGSYRLGVHTKGADIDALCVAPRHVDRSDFFTSFYDKLKLQEEVKDLRAVEEAFVPVIKLCFDGIEIDILFARLALQTIPEDLDLR--DDSLLKNLDIRCIRSLNGCRVTDEILHLVPNIDNFRLTLRAIKLWAKRHNIYSNILGFLGGVSWAMLVARTCQLYPNAIASTLVHKFFLVFS-KWEWPNPVLLKQPEECN-LNLPVWDPRVNPSDRYHLMPIITPAYPQQNSTYNVSVSTRMVMVEEFKQGLAITDEILLSKAEWSKLFEAPNFFQKYKHYIVLLASAPTEKQRLEWVGLVESKIRILVGSLEKNEFITLAHVNPQSFPAPK--ESPDREEFRTMWVIGL-VFKKTENSENLSVDLTYDIQSFTDTVYRQAINSKMFELDMKIAAMHVKRKQLHQLL 497          
BLAST of SMED30019224 vs. Ensembl Mouse
Match: Papolb (poly (A) polymerase beta (testis specific) [Source:MGI Symbol;Acc:MGI:1932115])

HSP 1 Score: 320.857 bits (821), Expect = 1.235e-101
Identity = 176/440 (40.00%), Postives = 260/440 (59.09%), Query Frame = -3
Query:  221 PECLGITGFVTLEKSTEKDIKLSNELELTLINTKEFMSKLEIEHRKETLNKLEELCNSWIYEKALQNYYPKKTASKIKGKLFAFGSYRLNTDFIGADIDTLLVCPQFISREEFFKELYEYLRNCSLVKDILVLPDAFVPLMTMKLCDVEMDLLFASIDESTVPGNLNLNNNTEQLMRRMDEKNIRSINGVRVTDDLLTLVYNKNAFRTALRTIKLWSKRCGIYSNAMGFLGGVSWAILVARVCQLWPTASSFTIVTKFFYFFGIKWKWPTPILLRKITSSSVLSLPQWNPQTNPKDSYHVFPIITPSYPCQNSTYNVTESHKTIIINHMKNAHELCQQIANGNKKLSDLFESKFFFT-YQHYLMVTIKDSDESQFNKNSSLIESKLRIFARYLEKNESIAFVHINVQTFNCHEMDKSGKTSQYVNRWFLGFEVLMKSKKS 1537
            P+  GI+  ++L    + D +L+ +L  TL     F  + E++ R   L KL  L   WI E +     P+     + GK+F FGSYRL     GADID L V P+ + R +FF   Y+ L+    VKD+  + +AFVP++ +    +E+D+LFA +   T+P +L+     + L++ +D + IRS+NG RVTD++L LV N ++FR  LR IKLW+K   IYSN +GFLGGVSWA+LVAR CQL+P A + T+V KFF  F  +W+WP P+LL++    + L+LP W+P+ NP D YH+ PIITP+YP QNSTYNV+ S + ++I   K    +  +I     + S LFE+  FF  Y+HY+++      E Q  +   L+ESK+RI    LEKNE I   H+N Q+F   +  ++    ++   W +G  VL K + S
Sbjct:   18 PKQFGISSPISLAAPKDTDRELTQKLIETLQPFGVFEEEEELQRRILILQKLNNLVKEWIREISESRNLPQAVIENVGGKIFTFGSYRLGVHTKGADIDALCVAPRHVDRNDFFTSFYDKLKLQEEVKDLRAVEEAFVPVIKLCFDGIEIDILFARLALQTIPEDLD--LRDDSLLKNLDIRCIRSLNGCRVTDEILHLVPNIDSFRLTLRAIKLWAKCHNIYSNILGFLGGVSWAMLVARTCQLYPNAIASTLVRKFFLVFS-EWEWPNPVLLKEPEERN-LNLPVWDPRVNPSDRYHLMPIITPAYPQQNSTYNVSVSTRMVMIEEFKQGLAITHEILLNKAEWSKLFEAPSFFQKYKHYIVLLASAPTEKQHLEWVGLVESKIRILVGSLEKNEFITLAHVNPQSFPAPK--ETADKEEFRTMWVIGL-VLKKPENS 450          
BLAST of SMED30019224 vs. UniProt/SwissProt
Match: sp|Q9BWT3|PAPOG_HUMAN (Poly(A) polymerase gamma OS=Homo sapiens OX=9606 GN=PAPOLG PE=1 SV=2)

HSP 1 Score: 351.673 bits (901), Expect = 9.970e-112
Identity = 189/483 (39.13%), Postives = 279/483 (57.76%), Query Frame = -3
Query:  125 GITGFVTLEKSTEKDIKLSNELELTLINTKEFMSKLEIEHRKETLNKLEELCNSWIYEKALQNYYPKKTASKIKGKLFAFGSYRLNTDFIGADIDTLLVCPQFISREEFFKELYEYLRNCSLVKDILVLPDAFVPLMTMKLCDVEMDLLFASIDESTVPGNLNLNNNTEQLMRRMDEKNIRSINGVRVTDDLLTLVYNKNAFRTALRTIKLWSKRCGIYSNAMGFLGGVSWAILVARVCQLWPTASSFTIVTKFFYFFGIKWKWPTPILLRKITSSSVLSLPQWNPQTNPKDSYHVFPIITPSYPCQNSTYNVTESHKTIIINHMKNAHELCQQIANGNKKLSDLFESKFFFT-YQHYLMVTIKDSDESQFNKNSSLIESKLRIFARYLEKNESIAFVHINVQTFNCHEMDKSGKTSQYVNRWFLGF---EVLMKSKKSLSVADEISKFESLV------------KIEIEVIHVKKSNVPQYL 1525
            GIT  ++L    E D   + +L   +     F  + E+ HR   L KL  L   WI + +     P    + + GK+F FGSYRL     GADID L V P+ + R +FF+  +E L++   ++++  + DAFVP++  +   +E+DL+FA +   T+  NL+L +++   +R +D + IRS+NG RVTD++L LV NK  FR  LR +KLW+KR GIYSN +GFLGGVSWA+LVAR CQL+P A++ T+V KFF  F  KW+WP P+LL++   S+ L+LP W+P+ NP D YH+ PIITP+YP QNSTYNV+ S +T+++   K    +  +I  G    S L E   FF  Y+HY+++T   S E    +   L+ESK+R+    LE+NE I   H+N Q+F  ++  +  K + YV+ WFLG     V      ++ +  +I  F   V             ++IE  HVKK  +  YL
Sbjct:   20 GITSPISLASPKEIDHIYTQKLIDAMKPFGVFEDEEELNHRLVVLGKLNNLVKEWISDVSESKNLPPSVVATVGGKIFTFGSYRLGVHTKGADIDALCVAPRHVERSDFFQSFFEKLKHQDGIRNLRAVEDAFVPVIKFEFDGIEIDLVFARLAIQTISDNLDLRDDSR--LRSLDIRCIRSLNGCRVTDEILHLVPNKETFRLTLRAVKLWAKRRGIYSNMLGFLGGVSWAMLVARTCQLYPNAAASTLVHKFFLVFS-KWEWPNPVLLKQPEESN-LNLPVWDPRVNPSDRYHLMPIITPAYPQQNSTYNVSTSTRTVMVEEFKQGLAVTDEILQGKSDWSKLLEPPNFFQKYRHYIVLTASASTEENHLEWVGLVESKIRVLVGNLERNEFITLAHVNPQSFPGNK--EHHKDNNYVSMWFLGIIFRRVENAESVNIDLTYDIQSFTDTVYRQANNINMLKEGMKIEATHVKKKQLHHYL 496          
BLAST of SMED30019224 vs. UniProt/SwissProt
Match: sp|Q6PCL9|PAPOG_MOUSE (Poly(A) polymerase gamma OS=Mus musculus OX=10090 GN=Papolg PE=1 SV=1)

HSP 1 Score: 351.288 bits (900), Expect = 1.663e-111
Identity = 189/483 (39.13%), Postives = 279/483 (57.76%), Query Frame = -3
Query:  125 GITGFVTLEKSTEKDIKLSNELELTLINTKEFMSKLEIEHRKETLNKLEELCNSWIYEKALQNYYPKKTASKIKGKLFAFGSYRLNTDFIGADIDTLLVCPQFISREEFFKELYEYLRNCSLVKDILVLPDAFVPLMTMKLCDVEMDLLFASIDESTVPGNLNLNNNTEQLMRRMDEKNIRSINGVRVTDDLLTLVYNKNAFRTALRTIKLWSKRCGIYSNAMGFLGGVSWAILVARVCQLWPTASSFTIVTKFFYFFGIKWKWPTPILLRKITSSSVLSLPQWNPQTNPKDSYHVFPIITPSYPCQNSTYNVTESHKTIIINHMKNAHELCQQIANGNKKLSDLFESKFFFT-YQHYLMVTIKDSDESQFNKNSSLIESKLRIFARYLEKNESIAFVHINVQTFNCHEMDKSGKTSQYVNRWFLGF---EVLMKSKKSLSVADEISKFESLV------------KIEIEVIHVKKSNVPQYL 1525
            GIT  ++L    E D   + +L   +     F  + E+ HR   L KL  L   WI + +     P    + + GK+F FGSYRL     GADID L V P+ + R +FF+  +E L++   ++++  + DAFVP++  +   +E+DL+FA +   T+  NL+L +++   +R +D + IRS+NG RVTD++L LV NK  FR  LR +KLW+KR GIYSN +GFLGGVSWA+LVAR CQL+P A++ T+V KFF  F  KW+WP P+LL++   S+ L+LP W+P+ NP D YH+ PIITP+YP QNSTYNV+ S +T+++   K    +  +I  G    S L E   FF  Y+HY+++T   S E    +   L+ESK+R+    LE+NE I   H+N Q+F  ++  +  K + YV+ WFLG     V      ++ +  +I  F   V             ++IE  HVKK  +  YL
Sbjct:   20 GITSPISLACPKEIDHIYTQKLIDAMKPFGVFEDEEELNHRLVVLGKLNNLVKEWISDISESKNLPPSVVATVGGKIFTFGSYRLGVHTKGADIDALCVAPRHVERSDFFQSFFEKLKHQDGIRNLRAVEDAFVPVIKFEFDGIEIDLVFARLAIQTISDNLDLRDDSR--LRSLDIRCIRSLNGCRVTDEILHLVPNKETFRLTLRAVKLWAKRRGIYSNMLGFLGGVSWAMLVARTCQLYPNAAASTLVHKFFLVFS-KWEWPNPVLLKQPEESN-LNLPVWDPRVNPSDRYHLMPIITPAYPQQNSTYNVSTSTRTVMVEEFKQGLAVTDEILQGKSDWSKLLEPPNFFQKYRHYIVLTASASTEENHLEWVGLVESKIRVLVGNLERNEFITLAHVNPQSFPGNK--EHHKANNYVSMWFLGIIFRRVENAESVNIDLTYDIQSFTDTVYRQANNINMLKDGMKIEATHVKKKQLHHYL 496          
BLAST of SMED30019224 vs. UniProt/SwissProt
Match: sp|P51004|PAPO1_XENLA (Poly(A) polymerase alpha-A (Fragment) OS=Xenopus laevis OX=8355 GN=papola-a PE=2 SV=1)

HSP 1 Score: 326.25 bits (835), Expect = 4.246e-102
Identity = 190/498 (38.15%), Postives = 286/498 (57.43%), Query Frame = -3
Query:  110 PECLGITGFVTLEKSTEKDIKLSNELELTLINTKEFMSKLEIEHRKETLNKLEELCNSWIYEKALQNYYPKKTASKIKGKLFAFGSYRLNTDFIGADIDTLLVCPQFISREEFFKELYEYLRNCSLVKDILVLPDAFVPLMTMKLCDVEMDLLFASIDESTVPGNLNLNNNTEQLMRRMDEKNIRSINGVRVTDDLLTLVYNKNAFRTALRTIKLWSKRCGIYSNAMGFLGGVSWAILVARVCQLWPTASSFTIVTKFFYFFGIKWKWPTPILLRKITSSSVLSLPQWNPQTNPKDSYHVFPIITPSYPCQNSTYNVTESHKTIIINHMKNAHELCQQIANGNKKLSDLFESKFFFT-YQHYLMVTIKDSDESQFNKNSSLIESKLRIFARYLEKNESIAFVHINVQTFNC--HEMDKSGKTSQYVNRWFLG--FEVLMKSKK-SLSVADEISKFESLV------------KIEIEVIHVKKSNV----PQYLSDKDK 1537
            P+  GIT  ++L  + + D  L  +L  TL     F  + +++HR   L KL  L   WI E +   + P+     + GK+F FG YRL     GADID L V P+ + R +FF   Y+ L+    VKD+  + +AFVP++ +    +E+D+LFA +   T+P +L+L    + L++ +D + IRS+NG RVTD++L LV N ++FR  LR IKLW+KR  IYSN +GFLGGVSWA+LVAR CQL+P A + T+V KFF  F  KW+WP P+LL++    + L+LP W+P+ NP D YH+ PIITP+YP QNSTYNV+ S + ++I   K    +  +I  G  + S LF++  FF  Y+HY+++      E Q  +   L+ESK+RI    LEKNE I   H+N ++F      M+K     ++   W +G  F+ +  S+  S+ +  +I  F   V            +++I  +HVK+  +    P ++S K K
Sbjct:    1 PKTFGITSPISLAAAKDTDCTLMQKLIETLKPYGVFEEEEQLQHR--ILGKLNNLVKEWIREISELKHLPQSVIENVGGKIFTFGPYRLGVHTKGADIDALCVAPRHVDRSDFFSSFYDKLKQQEEVKDLRSVEEAFVPVIKLCFDGIEIDILFARLALQTIPEDLDLR--DDSLLKNLDIRCIRSLNGCRVTDEILHLVPNIDSFRLTLRAIKLWAKRHNIYSNILGFLGGVSWAMLVARTCQLYPNAIASTLVHKFFLVFS-KWEWPNPVLLKQPEECN-LNLPVWDPRVNPSDRYHLMPIITPAYPQQNSTYNVSVSTRAVMIEEFKQGLAITDEILLGKAEWSKLFDAPNFFQKYKHYILLLASAPTEKQRLEWVGLVESKIRILVGSLEKNEFITLAHVNPRSFPAPSENMEK----EEFRTMWVIGLVFKKMENSENLSVDLTYDIQSFTDTVDRQAINSKMFETEMKIAAMHVKRKQLHQLQPSHVSPKKK 488          
BLAST of SMED30019224 vs. UniProt/SwissProt
Match: sp|Q9WVP6|PAPOB_MOUSE (Poly(A) polymerase beta OS=Mus musculus OX=10090 GN=Papolb PE=1 SV=2)

HSP 1 Score: 320.472 bits (820), Expect = 1.064e-100
Identity = 176/440 (40.00%), Postives = 260/440 (59.09%), Query Frame = -3
Query:  221 PECLGITGFVTLEKSTEKDIKLSNELELTLINTKEFMSKLEIEHRKETLNKLEELCNSWIYEKALQNYYPKKTASKIKGKLFAFGSYRLNTDFIGADIDTLLVCPQFISREEFFKELYEYLRNCSLVKDILVLPDAFVPLMTMKLCDVEMDLLFASIDESTVPGNLNLNNNTEQLMRRMDEKNIRSINGVRVTDDLLTLVYNKNAFRTALRTIKLWSKRCGIYSNAMGFLGGVSWAILVARVCQLWPTASSFTIVTKFFYFFGIKWKWPTPILLRKITSSSVLSLPQWNPQTNPKDSYHVFPIITPSYPCQNSTYNVTESHKTIIINHMKNAHELCQQIANGNKKLSDLFESKFFFT-YQHYLMVTIKDSDESQFNKNSSLIESKLRIFARYLEKNESIAFVHINVQTFNCHEMDKSGKTSQYVNRWFLGFEVLMKSKKS 1537
            P+  GI+  ++L    + D +L+ +L  TL     F  + E++ R   L KL  L   WI E +     P+     + GK+F FGSYRL     GADID L V P+ + R +FF   Y+ L+    VKD+  + +AFVP++ +    +E+D+LFA +   T+P +L+     + L++ +D + IRS+NG RVTD++L LV N ++FR  LR IKLW+K   IYSN +GFLGGVSWA+LVAR CQL+P A + T+V KFF  F  +W+WP P+LL++    + L+LP W+P+ NP D YH+ PIITP+YP QNSTYNV+ S + ++I   K    +  +I     + S LFE+  FF  Y+HY+++      E Q  +   L+ESK+RI    LEKNE I   H+N Q+F   +  ++    ++   W +G  VL K + S
Sbjct:   17 PKQFGISSPISLAAPKDTDRELTQKLIETLQPFGVFEEEEELQRRILILQKLNNLVKEWIREISESRNLPQAVIENVGGKIFTFGSYRLGVHTKGADIDALCVAPRHVDRNDFFTSFYDKLKLQEEVKDLRAVEEAFVPVIKLCFDGIEIDILFARLALQTIPEDLD--LRDDSLLKNLDIRCIRSLNGCRVTDEILHLVPNIDSFRLTLRAIKLWAKCHNIYSNILGFLGGVSWAMLVARTCQLYPNAIASTLVRKFFLVFS-EWEWPNPVLLKEPEERN-LNLPVWDPRVNPSDRYHLMPIITPAYPQQNSTYNVSVSTRMVMIEEFKQGLAITHEILLNKAEWSKLFEAPSFFQKYKHYIVLLASAPTEKQHLEWVGLVESKIRILVGSLEKNEFITLAHVNPQSFPAPK--ETADKEEFRTMWVIGL-VLKKPENS 449          
BLAST of SMED30019224 vs. UniProt/SwissProt
Match: sp|Q61183|PAPOA_MOUSE (Poly(A) polymerase alpha OS=Mus musculus OX=10090 GN=Papola PE=1 SV=4)

HSP 1 Score: 322.783 bits (826), Expect = 1.523e-100
Identity = 189/494 (38.26%), Postives = 278/494 (56.28%), Query Frame = -3
Query:  125 KEADIPPECLGITGFVTLEKSTEKDIKLSNELELTLINTKEFMSKLEIEHRKETLNKLEELCNSWIYEKALQNYYPKKTASKIKGKLFAFGSYRLNTDFIGADIDTLLVCPQFISREEFFKELYEYLRNCSLVKDILVLPDAFVPLMTMKLCDVEMDLLFASIDESTVPGNLNLNNNTEQLMRRMDEKNIRSINGVRVTDDLLTLVYNKNAFRTALRTIKLWSKRCGIYSNAMGFLGGVSWAILVARVCQLWPTASSFTIVTKFFYFFGIKWKWPTPILLRKITSSSVLSLPQWNPQTNPKDSYHVFPIITPSYPCQNSTYNVTESHKTIIINHMKNAHELCQQIANGNKKLSDLFESKFFFT-YQHYLMVTIKDSDESQFNKNSSLIESKLRIFARYLEKNESIAFVHINVQTFNCHEMDKSGKTSQYVNRWFLGFEVLMKSKK----SLSVADEISKFESLV------------KIEIEVIHVKKSNVPQYL 1555
            ++   P    GIT  ++L    E D  L+ +L  TL     F  + E++ R   L KL  L   WI E +     P+     + GK+F FGSYRL     GADID L V P+ + R +FF   Y+ L+    VKD+  + +AFVP++ +    +E+D+LFA +   T+P +L+L    + L++ +D + IRS+NG RVTD++L LV N + FR  LR IKLW+KR  IYSN +GFLGGVSWA+LVAR CQL+P A + T+V KFF  F  KW+WP P+LL++    + L+LP W+P+ NP D YH+ PIITP+YP QNSTYNV+ S + +++   K    +  +I     + S LFE+  FF  Y+HY+++      E Q  +   L+ESK+RI    LEKNE I   H+N Q+F   +  +S    ++   W +G  V  K++     S+ +  +I  F   V             ++I  +HVK+  + Q L
Sbjct:   11 QQTQPPQRHYGITSPISLAAPKETDCLLTQKLIETLKPFGVFEEEEELQRRILILGKLNNLVKEWIREISESKNLPQSVIENVGGKIFTFGSYRLGVHTKGADIDALCVAPRHVDRSDFFTSFYDKLKLQEEVKDLRAVEEAFVPVIKLCFDGIEIDILFARLALQTIPEDLDLR--DDSLLKNLDIRCIRSLNGCRVTDEILHLVPNIDNFRLTLRAIKLWAKRHNIYSNILGFLGGVSWAMLVARTCQLYPNAIASTLVHKFFLVFS-KWEWPNPVLLKQPEECN-LNLPVWDPRVNPSDRYHLMPIITPAYPQQNSTYNVSVSTRMVMVEEFKQGLAITDEILLSKAEWSKLFEAPNFFQKYKHYIVLLASAPTEKQRLEWVGLVESKIRILVGSLEKNEFITLAHVNPQSFPAPK--ESPDREEFRTMWVIGL-VFKKTENSENLSVDLTYDIQSFTDTVYRQAINSKMFELDMKIAAMHVKRKQLHQLL 497          
BLAST of SMED30019224 vs. TrEMBL
Match: A0A5K3FGS5 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 437.958 bits (1125), Expect = 6.123e-143
Identity = 208/438 (47.49%), Postives = 286/438 (65.30%), Query Frame = -3
Query:  245 IKEADIPPECLGITGFVTLEKSTEKDIKLSNELELTLINTKEFMSKLEIEHRKETLNKLEELCNSWIYEKALQNYYPKKTASKIKGKLFAFGSYRLNTDFIGADIDTLLVCPQFISREEFFKELYEYLRNCSLVKDILVLPDAFVPLMTMKLCDVEMDLLFASIDESTVPGNLNLNNNTEQLMRRMDEKNIRSINGVRVTDDLLTLVYNKNAFRTALRTIKLWSKRCGIYSNAMGFLGGVSWAILVARVCQLWPTASSFTIVTKFFYFFGIKWKWPTPILLRKITSSSVLSLPQWNPQTNPKDSYHVFPIITPSYPCQNSTYNVTESHKTIIINHMKNAHELCQQIANGNKKLSDLFESKFFFTYQHYLMVTIKDSDESQFNKNSSLIESKLRIFARYLEKNESIAFVHINVQTFNCHEMDKSGKTSQYVNRWFLGFE 1558
            I  +DIPP+CLG TG +  +  TE+D+K S  LE  L     F ++ EI  R+E L KL+E+ N WIY+KAL+   P+  A    GK+F FGSYRL  +F GADID LLV P+FI+REEFF +    L     V+D+  +PDAFVP++ +K   VE+DLLFA ID  +V  + NL+ N+EQL+R MDE+++RS+NGVRVT+D+L LVY K+ F+TAL+ I+LW+KR  IYSNA+GFLGGVSWAIL  R+CQL+P AS  TIV  FF  F  +W WP P+ LR+      L+LP W+P+ NP D YH+ PI+TPSYP QNSTYNV  S++ II   +K    + ++I    +  SDLFE  FFFTY+HY++V +   ++  F +   L+ES+LR+     E N  +   H+N + +     D     + +V +WF+G E
Sbjct:    5 ISPSDIPPQCLGETGALNFKPPTEQDLKDSAALEEALAQMNIFETQEEIHQRREALIKLQEISNRWIYKKALEQNLPEHNALSTTGKIFTFGSYRLGVNFRGADIDALLVVPRFITREEFFSDFQALLSEEDSVEDLHAVPDAFVPVLKLKFMGVEIDLLFAQIDMMSVRSDFNLSENSEQLLRNMDERDVRSVNGVRVTEDMLNLVYPKDVFKTALKVIRLWAKRKNIYSNAIGFLGGVSWAILTCRICQLYPCASPSTIVYLFFTIFS-QWPWPKPVRLRESEYIPTLNLPVWDPRHNPTDQYHLMPILTPSYPSQNSTYNVQRSNRIIIEREIKQGLAVVKEILLRKRTWSDLFEPAFFFTYRHYVVVIVSGEEKRCFMERCGLVESRLRVLVSNAESNRYVKIAHVNCRAYGKGPQDGD---AAFVKKWFIGME 438          
BLAST of SMED30019224 vs. TrEMBL
Match: A0A0R3WPI8 (Poly(A) polymerase OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS2663 PE=3 SV=1)

HSP 1 Score: 436.417 bits (1121), Expect = 1.546e-142
Identity = 207/434 (47.70%), Postives = 290/434 (66.82%), Query Frame = -3
Query:  245 DIPPECLGITGFVTLEKSTEKDIKLSNELELTLINTKEFMSKLEIEHRKETLNKLEELCNSWIYEKALQNYYPKKTASKIKGKLFAFGSYRLNTDFIGADIDTLLVCPQFISREEFFKELYEYLRNCSLVKDILVLPDAFVPLMTMKLCDVEMDLLFASIDESTVPGNLNLNNNTEQLMRRMDEKNIRSINGVRVTDDLLTLVYNKNAFRTALRTIKLWSKRCGIYSNAMGFLGGVSWAILVARVCQLWPTASSFTIVTKFFYFFGIKWKWPTPILLRKITSSSVLSLPQWNPQTNPKDSYHVFPIITPSYPCQNSTYNVTESHKTIIINHMKNAHELCQQIANGNKKLSDLFESKFFFTYQHYLMVTIKDSDESQFNKNSSLIESKLRIFARYLEKNESIAFVHINVQTFNCHEMDKSGKTSQYVNRWFLGFE 1546
            DIP +CLG TG ++    +E+++K S  LE TL     F ++ EI  R+E L KL+E+ N WIY+KAL+   P+  AS   GK+F FGSYRL  +FIGADID LLV P+FI+REEFF +    L     V+D+  + DA+VPL+ MKL  VE+DLLFA +D  +V  + NL++N+EQL+R MDE+++RS+NGVRVT+D+L LVY K+AF+TAL+ I+LW+KR  IYSNA+GFLGGVSWAIL  R+CQL+P A   TIV  FF  +  +W WP P+ LR+    + L+LP W+P+ NP D YH+ PI+TPSYP QNSTYNV  S++ II   +K+   + ++I    +  SDLFE  FFFTY+HY++V +   ++  F +   L+ES+LRI     E N  +   H+N  ++    +D     + +V +WF+G E
Sbjct:    9 DIPAQCLGETGPLSNRPPSEQELKDSVALEETLAQMNIFETQEEIHQRREALIKLQEISNHWIYKKALEQNLPEHNASSTTGKIFTFGSYRLGVNFIGADIDALLVVPRFITREEFFSDFQAVLAAEESVEDLQAVQDAYVPLLKMKLMGVEIDLLFAQVDLMSVRSDFNLSDNSEQLLRNMDERDVRSVNGVRVTEDMLNLVYPKDAFKTALKVIRLWAKRKNIYSNAIGFLGGVSWAILTCRICQLYPFAPPSTIVHLFFIIYS-QWPWPKPVRLRESEYIASLNLPVWDPRHNPTDQYHLMPILTPSYPSQNSTYNVQRSNRIIIDREIKHGLSVVKEILLQKRPWSDLFEPAFFFTYRHYVVVIVTGEEKRPFKERCGLVESRLRILVSSAENNRYVKLAHVNCHSYGKGPLDGD---APFVKKWFIGME 438          
BLAST of SMED30019224 vs. TrEMBL
Match: G4LZL5 (Poly(A) polymerase OS=Schistosoma mansoni OX=6183 GN=Smp_178850 PE=3 SV=1)

HSP 1 Score: 426.017 bits (1094), Expect = 4.521e-141
Identity = 204/436 (46.79%), Postives = 286/436 (65.60%), Query Frame = -3
Query:  245 DIPPECLGITGFVTLEKSTEKDIKLSNELELTLINTKEFMSKLEIEHRKETLNKLEELCNSWIYEKALQNYYPKKTASKIKGKLFAFGSYRLNTDFIGADIDTLLVCPQFISREEFFKELYEYLRNCSLVKDILVLPDAFVPLMTMKLCDVEMDLLFASIDESTVPGNLNLNNNTEQLMRRMDEKNIRSINGVRVTDDLLTLVYNKNAFRTALRTIKLWSKRCGIYSNAMGFLGGVSWAILVARVCQLWPTASSFTIVTKFFYFFGIKWKWPTPILLRKITSSSVLSLPQWNPQTNPKDSYHVFPIITPSYPCQNSTYNVTESHKTIIINHMKNAHELCQQIANGNKKLSDLFESKFFFTYQHYLMVTIKDSDESQFNKNSSLIESKLRIFARYLEKNESIAFVHINVQTFNCHEMDK--SGKTSQYVNRWFLGFE 1546
            +IP  CLG TG ++ +K TE+D + + ELE +L     F ++ EI  R+E L +L+E+ N+WI +KAL+   P   A+   GK+F FGSYRL  +F GADID+LLV P+FI+REEFF +    L   S V+D+  + DAFVP++ MK   VE+DLLFA ID+ ++P N +L  NTE LMR MDE+++RSINGVRVT+D+L LVYNKN+F+ AL+ I++W+KR  +YSNA+GFLGGVSWAILV+R+CQL+P A+   IV  FF  F  +W WP P+ LR+    + L LP W+P+ NP D YH+ PI+TPSYP QNSTYNV  S++ II   +K    + +         S+LFE+ FFF Y+HY++V +  + +  F +   L+ES+LR+     E N  +   H+     NCH   K  S   + +V +WF+G E
Sbjct:   10 EIPARCLGETGALSFKKPTEQDFRDTQELEASLAQLNIFETQEEISQRREALVRLQEISNAWIRQKALEQNLPAHVANSTTGKIFTFGSYRLGVNFRGADIDSLLVVPRFITREEFFSDFQTVLAENSNVEDLHAVVDAFVPVLKMKFMGVEIDLLFAQIDQMSIPENFSLCENTEVLMRNMDERDVRSINGVRVTEDILNLVYNKNSFKVALKVIRIWAKRRNVYSNALGFLGGVSWAILVSRICQLYPYATPSMIVYLFFTIFS-QWPWPKPVRLRECEYIASLCLPVWDPRLNPSDQYHLMPILTPSYPSQNSTYNVQRSNRIIIERELKQGLNVVRASMMHKGSWSNLFEAAFFFQYRHYVVVIVVGNTKHTFIELCGLVESRLRVLVSNFEVNRYVKMAHV-----NCHAYGKGPSDDDANFVRKWFIGME 439          
BLAST of SMED30019224 vs. TrEMBL
Match: A0A3Q0KTL7 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 432.565 bits (1111), Expect = 8.255e-141
Identity = 224/532 (42.11%), Postives = 323/532 (60.71%), Query Frame = -3
Query:   29 DIPPECLGITGFVTLEKSTEKDIKLSNELELTLINTKEFMSKLEIEHRKETLNKLEELCNSWIYEKALQNYYPKKTASKIKGKLFAFGSYRLNTDFIGADIDTLLVCPQFISREEFFKELYEYLRNCSLVKDILVLPDAFVPLMTMKLCDVEMDLLFASIDESTVPGNLNLNNNTEQLMRRMDEKNIRSINGVRVTDDLLTLVYNKNAFRTALRTIKLWSKRCGIYSNAMGFLGGVSWAILVARVCQLWPTASSFTIVTKFFYFFGIKWKWPTPILLRKITSSSVLSLPQWNPQTNPKDSYHVFPIITPSYPCQNSTYNVTESHKTIIINHMKNAHELCQQIANGNKKLSDLFESKFFFTYQHYLMVTIKDSDESQFNKNSSLIESKLRIFARYLEKNESIAFVHINVQTFNCHEMDK--SGKTSQYVNRWFLGFEV---------------LMKSKKSLSV--ADEISKFESLVK-------IEIEVIHVKKSNVPQYLSDKDKNKFLLFLPRKPRKRPTAGNELFNTSEA 1546
            +IP  CLG TG ++ +K TE+D + + ELE +L     F ++ EI  R+E L +L+E+ N+WI +KAL+   P   A+   GK+F FGSYRL  +F GADID+LLV P+FI+REEFF +    L   S V+D+  + DAFVP++ MK   VE+DLLFA ID+ ++P N +L  NTE LMR MDE+++RSINGVRVT+D+L LVYNKN+F+ AL+ I++W+KR  +YSNA+GFLGGVSWAILV+R+CQL+P A+   IV  FF  F  +W WP P+ LR+    + L LP W+P+ NP D YH+ PI+TPSYP QNSTYNV  S++ II   +K    + +         S+LFE+ FFF Y+HY++V +  + +  F +   L+ES+LR+     E N  +   H+     NCH   K  S   + +V +WF+G E                    K +L+V  ++ IS FE  ++       + + V +VKKS + Q++S +D ++          KR  A   L N + +
Sbjct:    6 EIPARCLGETGALSFKKPTEQDFRDTQELEASLAQLNIFETQEEISQRREALVRLQEISNAWIRQKALEQNLPAHVANSTTGKIFTFGSYRLGVNFRGADIDSLLVVPRFITREEFFSDFQTVLAENSNVEDLHAVVDAFVPVLKMKFMGVEIDLLFAQIDQMSIPENFSLCENTEVLMRNMDERDVRSINGVRVTEDILNLVYNKNSFKVALKVIRIWAKRRNVYSNALGFLGGVSWAILVSRICQLYPYATPSMIVYLFFTIFS-QWPWPKPVRLRECEYIASLCLPVWDPRLNPSDQYHLMPILTPSYPSQNSTYNVQRSNRIIIERELKQGLNVVRASMMHKGSWSNLFEAAFFFQYRHYVVVIVVGNTKHTFIELCGLVESRLRVLVSNFEVNRYVKMAHV-----NCHAYGKGPSDDDANFVRKWFIGMEFDRNTNSLTSTVHNSNTSNEKPTLNVDLSENISSFEKSIERGLSSEDLSVTVKYVKKSQLAQFISSEDMDEI---------KRQAAAAALSNVNNS 522          
BLAST of SMED30019224 vs. TrEMBL
Match: W6UX92 (Poly(A) polymerase OS=Echinococcus granulosus OX=6210 GN=EGR_07054 PE=3 SV=1)

HSP 1 Score: 431.024 bits (1107), Expect = 1.689e-140
Identity = 203/434 (46.77%), Postives = 286/434 (65.90%), Query Frame = -3
Query:  245 DIPPECLGITGFVTLEKSTEKDIKLSNELELTLINTKEFMSKLEIEHRKETLNKLEELCNSWIYEKALQNYYPKKTASKIKGKLFAFGSYRLNTDFIGADIDTLLVCPQFISREEFFKELYEYLRNCSLVKDILVLPDAFVPLMTMKLCDVEMDLLFASIDESTVPGNLNLNNNTEQLMRRMDEKNIRSINGVRVTDDLLTLVYNKNAFRTALRTIKLWSKRCGIYSNAMGFLGGVSWAILVARVCQLWPTASSFTIVTKFFYFFGIKWKWPTPILLRKITSSSVLSLPQWNPQTNPKDSYHVFPIITPSYPCQNSTYNVTESHKTIIINHMKNAHELCQQIANGNKKLSDLFESKFFFTYQHYLMVTIKDSDESQFNKNSSLIESKLRIFARYLEKNESIAFVHINVQTFNCHEMDKSGKTSQYVNRWFLGFE 1546
            DIP +CLG TG ++    TE+++K S  LE TL     F ++ EI  R+E L KL+E+ N WIY+KAL+   P+  AS   GK+F FGSYRL  +FIGADID LLV P+F++REEFF +    L     V+D+  + DA+VPL+ MK   VE+DLLFA +D  +V  + NL++N+EQL+R MDE+++RS+NGVRVT+D+L LVY K+ F+TAL+ I+LW+KR  IYSNA+GFLGGVSWAIL  R+CQL+P A   TIV  FF  +  +W WP P+ LR+      L+LP W+P+ NP D YH+ P++TPSYP QNSTYNV  S++ II   +K+   + ++I    +  SDLFE  FFFTY+HY++V +   ++  F +   L+ES+LR+     E N  +   H+N  ++    +D       +V +WF+G E
Sbjct:    9 DIPAQCLGETGPLSNRPPTEQELKDSVALEETLAQMNIFETQEEIHQRREALIKLQEISNHWIYKKALEQNLPEHNASSTTGKIFTFGSYRLGVNFIGADIDALLVVPRFVTREEFFTDFQTVLAEEESVEDLQAVQDAYVPLLKMKFMGVEIDLLFAQVDLMSVRSDFNLSDNSEQLLRNMDERDVRSVNGVRVTEDMLNLVYPKDVFKTALKVIRLWAKRKNIYSNAIGFLGGVSWAILTCRICQLYPFAPPSTIVHLFFIIYS-QWPWPKPVRLRESEYIPSLNLPVWDPRHNPTDQYHLMPVLTPSYPSQNSTYNVQRSNRIIIDREIKHGLSIVKEILLQKRPWSDLFEPAFFFTYRHYVVVIVTGEEKRPFKERCGLVESRLRVLVSSAENNRYVKLAHVNCHSYGKGPLDGD---VPFVKKWFIGME 438          
BLAST of SMED30019224 vs. Ensembl Cavefish
Match: papolg (poly(A) polymerase gamma [Source:NCBI gene;Acc:103027219])

HSP 1 Score: 348.977 bits (894), Expect = 1.633e-111
Identity = 196/493 (39.76%), Postives = 277/493 (56.19%), Query Frame = -3
Query:  125 PPECLGITGFVTLEKSTEKDIKLSNELELTLINTKEFMSKLEIEHRKETLNKLEELCNSWIYEKALQNYYPKKTASKIKGKLFAFGSYRLNTDFIGADIDTLLVCPQFISREEFFKELYEYLRNCSLVKDILVLPDAFVPLMTMKLCDVEMDLLFASIDESTVPGNLNLNNNTEQLMRRMDEKNIRSINGVRVTDDLLTLVYNKNAFRTALRTIKLWSKRCGIYSNAMGFLGGVSWAILVARVCQLWPTASSFTIVTKFFYFFGIKWKWPTPILLRKITSSSVLSLPQWNPQTNPKDSYHVFPIITPSYPCQNSTYNVTESHKTIIINHMKNAHELCQQIANGNKKLSDLFESKFFFT-YQHYLMVTIKDSDESQFNKNSSLIESKLRIFARYLEKNESIAFVHINVQTFNCHEMDKSGKTSQYVNRWFLGFEVLMKSKKSLSVAD--------EISKFESLV------------KIEIEVIHVKKSNVPQYL 1540
            P +  GIT  ++L    E D   + +L   +     F  + E+ HR   L KL      WI E +     P      + GK+F FGSYRL     GADID L V P+ + R +FF   +E L+    ++D+  + DAFVP++  K   +E+DLLFA +   ++P NL+L  ++  L+R +D + IRS+NG RVTD++L LV +K  FR  LR IKLW+K  GIYSN +GFLGGVSWA+LVAR CQL+P A + T+V KFF  F  KW+WP P+LL++   S+ L+LP W+P+ NP D YH+ PIITP+YP QNSTYNV+ S +TI+    K    +  +I  G    S LFE   FF  Y+HY+++T   S E    +   L+ESK+R+    LE+NE I   H+N Q+F   + +++   +++V+ WF+G        K L  AD        +I  F   V             + IE  HVKK  + QYL
Sbjct:   17 PQKHYGITSSISLAFPREIDRLYTQKLIEAMKPFGVFEDEDELNHRLAVLGKLNSFVKEWISEISETKNLPPSALMNVGGKIFTFGSYRLGVHTKGADIDALCVAPRHVERSDFFSSFFEKLKQHDEIRDLRAVEDAFVPVIKFKFDGIEIDLLFARLALQSIPDNLDLRGDS--LLRNLDIRCIRSLNGCRVTDEILHLVPDKENFRLTLRAIKLWAKSRGIYSNMLGFLGGVSWAMLVARTCQLYPNAVAATLVHKFFLVFS-KWEWPNPVLLKQPEDSN-LNLPVWDPRVNPSDRYHLMPIITPAYPQQNSTYNVSTSTRTIMSEEFKYGLTITDEILQGKADWSKLFEPPNFFQKYKHYIVLTASASTEENHLEWVGLVESKIRVLVGNLERNEYITLAHVNPQSFPWSKENRN--ENEFVSMWFIGINF-----KKLENADCVNIDLTYDIQSFTDTVYRQASNINMLKDGMTIEATHVKKKQLHQYL 498          
BLAST of SMED30019224 vs. Ensembl Cavefish
Match: papola (poly(A) polymerase alpha [Source:NCBI gene;Acc:103028065])

HSP 1 Score: 342.813 bits (878), Expect = 2.668e-111
Identity = 202/525 (38.48%), Postives = 291/525 (55.43%), Query Frame = -3
Query:   35 IKEADIPPECLGITGFVTLEKSTEKDIKLSNELELTLINTKEFMSKLEIEHRKETLNKLEELCNSWIYEKALQNYYPKKTASKIKGKLFAFGSYRLNTDFIGADIDTLLVCPQFISREEFFKELYEYLRNCSLVKDILVLPDAFVPLMTMKLCDVEMDLLFASIDESTVPGNLNLNNNTEQLMRRMDEKNIRSINGVRVTDDLLTLVYNKNAFRTALRTIKLWSKRCGIYSNAMGFLGGVSWAILVARVCQLWPTASSFTIVTKFFYFFGIKWKWPTPILLRKITSSSVLSLPQWNPQTNPKDSYHVFPIITPSYPCQNSTYNVTESHKTIIINHMKNAHELCQQIANGNKKLSDLFES-KFFFTYQHYLMVTIKDSDESQFNKNSSLIESKLRIFARYLEKNESIAFVHINVQTFNCHEMDKSG-KTSQYVNRWFLGFEV-LMKSKKSLSV--ADEISKFESLV------------KIEIEVIHVKKSNVPQYLSDKDKNKFLLFLPRKPRKRPTAGNELFNTS 1558
            ++ A   P+  GIT  ++L    E D+ L+ +L   L     F  +LE++ R   L KL  L   WI+E +     P      + GK+F FGSYRL     GADID L V P+ + R +FF   Y+ L+    VKD+  + +AFVP++ +    +E+D+LFA +   T+P NL+L ++   L++ +D + IRS+NG RVTD++L LV N   FR  LR IKLW+KR  IYSN +GFLGGVSWA+LVAR CQL+P A + T+V KFF  F  KW+WP P+LL++    + L+LP W+P+  P D YH+ PIITP+YP QNSTYNV+ S + I++   K    +  +I       S LFE+  FF  Y+HY+++      E Q  +   L+ESK+RI    LEKNE I   H+N Q+F      K G    ++   W +G +   M++ + L+V    +I  F   V             ++I V+HVK+  + Q L D      L+ + R  RK  T G    N S
Sbjct:   11 VQTAQQTPKHYGITSPISLVLPKELDLVLTQKLTEALKPFGVFEEELELQRRILVLGKLNTLVKEWIHEISESKNIPASLIENVGGKIFTFGSYRLGVHTKGADIDALCVAPRHVERSDFFTSFYDKLKEQEEVKDLRAVEEAFVPVIKLSFDGIEIDILFARLALQTIPENLDLRDDG--LLKNLDIRCIRSLNGCRVTDEILHLVPNIENFRLTLRAIKLWAKRHNIYSNILGFLGGVSWAMLVARTCQLYPNAVASTLVHKFFLVFS-KWEWPNPVLLKQPEDCN-LNLPVWDPRVTPSDRYHLMPIITPAYPQQNSTYNVSVSTRNIMVEEFKQGLAITDEILQNKADWSKLFEAPNFFQKYKHYIVLLASAPTEKQHLEWVGLVESKIRILVGNLEKNEFITLAHVNPQSFPG---PKEGIDKEEFSTMWVIGIDFKKMEASEHLNVDLTFDIQSFTDTVYRQAITSKMFEPDMKITVMHVKRKQLHQLLPD------LVIVKR--RKHSTEGLRGMNDS 520          
BLAST of SMED30019224 vs. Ensembl Cavefish
Match: papola (poly(A) polymerase alpha [Source:NCBI gene;Acc:103028065])

HSP 1 Score: 343.199 bits (879), Expect = 7.191e-110
Identity = 202/526 (38.40%), Postives = 293/526 (55.70%), Query Frame = -3
Query:   35 IKEADIPPECLGITGFVTLEKSTEKDIKLSNELELTLINTKEFMSKLEIEHRKETLNKLEELCNSWIYEKALQNYYPKKTASKIKGKLFAFGSYRLNTDFIGADIDTLLVCPQFISREEFFKELYEYLRNCSLVKDILVLPDAFVPLMTMKLCDVEMDLLFASIDESTVPGNLNLNNNTEQLMRRMDEKNIRSINGVRVTDDLLTLVYNKNAFRTALRTIKLWSKRCGIYSNAMGFLGGVSWAILVARVCQLWPTASSFTIVTKFFYFFGIKWKWPTPILLRKITSSSVLSLPQWNPQTNPKDSYHVFPIITPSYPCQNSTYNVTESHKTIIINHMKNAHELCQQIANGNKKLSDLFESKFFFT-YQHYLMVTIKDSDESQFNKNSSLIESKLRIFARYLEKNESIAFVHINVQTFNCHE--MDKSGKTSQYVNRWFLGFEV-LMKSKKSLSV--ADEISKFESLV------------KIEIEVIHVKKSNVPQYLSDKDKNKFLLFLPRKPRKRPTAGNELFNTS 1558
            ++ A   P+  GIT  ++L    E D+ L+ +L   L     F  +LE++ R   L KL  L   WI+E +     P      + GK+F FGSYRL     GADID L V P+ + R +FF   Y+ L+    VKD+  + +AFVP++ +    +E+D+LFA +   T+P NL+L ++   L++ +D + IRS+NG RVTD++L LV N   FR  LR IKLW+KR  IYSN +GFLGGVSWA+LVAR CQL+P A + T+V KFF  F  KW+WP P+LL++    + L+LP W+P+  P D YH+ PIITP+YP QNSTYNV+ S + I++   K    +  +I       S LFE+  FF  Y+HY+++      E Q  +   L+ESK+RI    LEKNE I   H+N Q+F   +  +DK     ++   W +G +   M++ + L+V    +I  F   V             ++I V+HVK+  + Q L D      L+ + R  RK  T G    N S
Sbjct:    9 VQTAQQTPKHYGITSPISLVLPKELDLVLTQKLTEALKPFGVFEEELELQRRILVLGKLNTLVKEWIHEISESKNIPASLIENVGGKIFTFGSYRLGVHTKGADIDALCVAPRHVERSDFFTSFYDKLKEQEEVKDLRAVEEAFVPVIKLSFDGIEIDILFARLALQTIPENLDLRDDG--LLKNLDIRCIRSLNGCRVTDEILHLVPNIENFRLTLRAIKLWAKRHNIYSNILGFLGGVSWAMLVARTCQLYPNAVASTLVHKFFLVFS-KWEWPNPVLLKQPEDCN-LNLPVWDPRVTPSDRYHLMPIITPAYPQQNSTYNVSVSTRNIMVEEFKQGLAITDEILQNKADWSKLFEAPNFFQKYKHYIVLLASAPTEKQHLEWVGLVESKIRILVGNLEKNEFITLAHVNPQSFPGPKEGIDK----EEFSTMWVIGIDFKKMEASEHLNVDLTFDIQSFTDTVYRQAITSKMFEPDMKITVMHVKRKQLHQLLPD------LVIVKR--RKHSTEGLRGMNDS 518          
BLAST of SMED30019224 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005362.1 (pep scaffold:Pmarinus_7.0:GL481270:231683:246917:-1 gene:ENSPMAG00000004864.1 transcript:ENSPMAT00000005362.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 338.191 bits (866), Expect = 7.173e-111
Identity = 186/486 (38.27%), Postives = 281/486 (57.82%), Query Frame = -3
Query:   86 LGITGFVTLEKSTEKDIKLSNELELTLINTKEFMSKLEIEHRKETLNKLEELCNSWIYEKALQNYYPKKTASKIKGKLFAFGSYRLNTDFIGADIDTLLVCPQFISREEFFKELYEYLRNCSLVKDILVLPDAFVPLMTMKLCDVEMDLLFASIDESTVPGNLNLNNNTEQLMRRMDEKNIRSINGVRVTDDLLTLVYNKNAFRTALRTIKLWSKRCGIYSNAMGFLGGVSWAILVARVCQLWPTASSFTIVTKFFYFFGIKWKWPTPILLRKITSSSVLSLPQWNPQTNPKDSYHVFPIITPSYPCQNSTYNVTESHKTIIINHMKNAHELCQQIANGNKKLSDLFE-SKFFFTYQHYLMVTIKDSDESQFNKNSSLIESKLRIFARYLEKNESIAFVHINVQTFNCHEMDKSGKTSQYVNRWFLGFEVLMKSKK----SLSVADEISKFESLVKIEIEVIHVKKSNVPQYLSDKDKNKFLLFLP 1528
            LGIT  ++L   TE++++ S+ L+  +   + F   +E+E R   L KL  + N W+ + A            I  K+  FGS+RL      ADID L V PQ + R +FF    E L+  + V  I  + DAFVPL+  K   +E+DLLFA ++  ++P  L+L N+   ++R +D + IRS+NG RVTD++L LV N   FR AL  +KLW+K  G+YSN +GFLGGVSW++LVAR+CQL+P A++ T++ KFF  F  +W+WP P+LL++    S L+LP W+P+ NP D  H+ PIITPSYP QNSTYNVT S + I+   ++    +  QI  G      LFE   FF  Y+H++++T   + + Q  +   L+ESK+RI    LE+N+ I+ VHIN + F     +++G    +V RWF+G  V  KS+     S+ +  +I  F   V  +   ++V K ++    +   + +   FLP
Sbjct:   22 LGITSPISLATPTEEELRSSDLLQEVMQQLQVFEEVVELEQRLAVLGKLNHMVNRWVRDFAEAKDLSPSIIENISAKICTFGSFRLGVHNKDADIDALCVAPQHVDRTDFFTSFCELLKETNGVTSIRAVEDAFVPLIRFKFDGIEIDLLFARLNMQSIPKKLDLRNDN--ILRNLDIRCIRSLNGCRVTDEILHLVPNVETFRLALHAVKLWAKHHGLYSNILGFLGGVSWSMLVARICQLYPCATASTLLHKFFLVFS-QWEWPKPVLLKQ-PEFSRLNLPVWDPRVNPTDRCHLMPIITPSYPQQNSTYNVTVSSRAIVTAALRPGLVVTHQILLGQAGWDKLFEIPNFFQKYKHFIVLTSHAAKQKQHLEWVGLVESKIRILLANLERNDFISLVHINPKAFPDPVKNEAG--GDHVQRWFIGI-VFKKSESSPNISVDLTQDIHSFMDTVYKQAATMNVSKGDMKIEAAHLKRKQLCPFLP 500          
BLAST of SMED30019224 vs. Ensembl Sea Lamprey
Match: papola (poly(A) polymerase alpha [Source:ZFIN;Acc:ZDB-GENE-030131-3507])

HSP 1 Score: 298.516 bits (763), Expect = 2.208e-97
Identity = 157/352 (44.60%), Postives = 211/352 (59.94%), Query Frame = -3
Query:  470 GITGFVTLEKSTEKDIKLSNELELTLINTKEFMSKLEIEHRKETLNKLEELCNSWIYEKALQNYYPKKTASKIKGKLFAFGSYRLNTDFIGADIDTLLVCPQFISREEFFKELYEYLRNCSLVKDILVLPDAFVPLMTMKLCDVEMDLLFASIDESTVPGNLNLNNNTEQLMRRMDEKNIRSINGVRVTDDLLTLVYNKNAFRTALRTIKLWSKRCGIYSNAMGFLGGVSWAILVARVCQLWPTASSFTIVTKFFYFFGIKWKWPTPILLRKITSSSVLSLPQWNPQTNPKDSYHVFPIITPSYPCQNSTYNVTESHKTIIINHMKNAHELCQQIANGNKKLSDLFESKFFF 1525
            GIT  ++L +  E D  L+  L  TL+    F  + E+ HR   L KL  L  +W+ E       P        GK+F FGSYRL     GADID L V P+ + R +FF    E L+N   VKD+  + DAFVP++ +    +E+D+LFA +    +P NLNL +N   L++ +D + IRS+NG RVTD++L LV N   FR  LR IKLW+KR GIYSN +GFLGGVSWA+LVAR CQL+P A + T+V KFF  F  KW+WP P+LL++    + L+LP W+P+ NP D YHV PIITP+YP QNS      S +T+++   K    +  +I  G  + S LFES  FF
Sbjct:   17 GITSPISLAEPREADRVLTRHLMNTLLPFGVFEEEEELNHRMVVLGKLNNLAKAWVREVGESKNLPPAILENGGGKIFTFGSYRLGVHTKGADIDALCVSPRHVERIDFFSTFIEMLKNQEGVKDLRSVEDAFVPVIKLTFDHIEIDVLFARLALQVIPDNLNLRDNA--LLKNLDIRCIRSLNGCRVTDEILHLVPNVEHFRMTLRAIKLWAKRRGIYSNMLGFLGGVSWAMLVARTCQLYPNAIASTLVHKFFLVFS-KWEWPKPVLLKQPEECN-LNLPVWDPRVNPTDRYHVMPIITPAYPHQNSM-----STRTVMVEEFKQGLAITDEILMGKAEWSKLFESPNFF 359          
BLAST of SMED30019224 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003282.1 (pep scaffold:Pmarinus_7.0:GL477473:7119:24582:-1 gene:ENSPMAG00000002961.1 transcript:ENSPMAT00000003282.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 266.929 bits (681), Expect = 4.200e-81
Identity = 180/500 (36.00%), Postives = 251/500 (50.20%), Query Frame = -3
Query:  125 GITGFVTLEKSTEKDIKLSNELELTLINTKEFMSKLEIEHRKETLNKLEELCNSWIYEKALQNYYPKKTASKIKGKLFAFGSYRLNTDFIGADIDTLLVCPQFISREEFFKELYEYLRNCSLVKDILVLPDAFVPLMTMKLCDVEMDLLFASIDESTVPGNLNLNNNTEQLMRRMDEKNIRSINGVRVTDDLLTLVYNKNAFRTALRTI----------KLWSKRC-----GIYSNAMGFLGGVSWAILVARVCQLWPTASSFTIVTKFFYFFGIKWKWPTPILLRKITSSSVLSLPQWNPQTNPKDSYHVFPIITPSYPCQNSTYNVTESHKTIIINHMKNAHELCQQIANGNKKLSDLFESK-FFFTYQHYLMVTIKDSDESQFNKNSSLIESKLRIFARYLEKNESIAFVHINVQTFNCHE--MDKSGKTSQYVNRWFLG--FEVLMKSKK-SLSVADEISKFESLV------------KIEIEVIHVKKSNVPQYL 1525
            GIT  ++L +  E D  L+  L  TL+    F  + E+ HR   L KL  L  +W+ E       P        GK+F FGSYRL     GADID L V P+ + R +FF    E L+N   VKD+ + P A               +LF SI+    P  L +    +Q    +D   I + +       L + +Y        L  I          ++ S  C     GIYSN +GFLGGVSWA+LVAR CQL+P A + T+V KFF  F  KW+WP P+LL++    + L+LP W+P+ NP D YHV PIITP+YP QNSTYNVT S +T+++   K    +  +I  G  + S LFES  FF  Y+HY+++T     E Q  +   L+ESK+RI    LE+NE I   HIN Q++   +   DK G T+     WF+G  F+ L   +  ++ +  +I  F   V             ++IE IHVKK  + Q+L
Sbjct:   16 GITSPISLAEPREADRVLTRHLMNTLLPFGVFEEEEELNHRMVVLGKLNNLAKAWVREVGESKNLPPAILENGGGKIFTFGSYRLGVHTKGADIDALCVSPRHVERIDFFSTFIEMLKNQEGVKDLRLHPQAHT-------------VLFLSIEVHLFPFTLLIIK--QQKCLDLDVSLIMNCSASMPVFKLFSTLYTCPTHTNLLFLITYLTLNTSYDEIPSIPCIHQCRGIYSNMLGFLGGVSWAMLVARTCQLYPNAIASTLVHKFFLVFS-KWEWPKPVLLKQPEECN-LNLPVWDPRVNPTDRYHVMPIITPAYPHQNSTYNVTMSTRTVMVEEFKQGLAITDEILMGKAEWSKLFESPNFFLKYKHYIVLTASALTEEQHLEWVGLVESKIRILVGNLERNEYITLAHINPQSYPGPKDNPDKQGVTTV----WFIGIIFKKLENPENVNVDLTLDIQSFTDTVYRQAAHISMLKEGMQIEAIHVKKKQLSQFL 494          
BLAST of SMED30019224 vs. Ensembl Yeast
Match: PAP1 (Poly(A) polymerase; one of three factors required for mRNA 3'-end polyadenylation, forms multiprotein complex with polyadenylation factor I (PF I), also required for mRNA nuclear export; may also polyadenylate rRNAs; required for gene looping [Source:SGD;Acc:S000001710])

HSP 1 Score: 297.745 bits (761), Expect = 1.017e-94
Identity = 157/404 (38.86%), Postives = 239/404 (59.16%), Query Frame = -3
Query:  332 ECLGITGFVTLEKSTEKDIKLSNELELTLINTKEFMSKLEIEHRKETLNKLEELCNSWIYEKALQNYYPKKTASKIKGKLFAFGSYRLNTDFIGADIDTLLVCPQFISREEFFKELYEYLRNCSLVKDILVLPDAFVPLMTMKLCDVEMDLLFASIDESTVPGNLNLNNNTEQLMRRMDEKNIRSINGVRVTDDLLTLVYNKNAFRTALRTIKLWSKRCGIYSNAMGFLGGVSWAILVARVCQLWPTASSFTIVTKFFYFFGIKWKWPTPILLRKITSSSVLSLPQWNPQTNPKDSYHVFPIITPSYPCQNSTYNVTESHKTIIINHMKNAHELCQQIANGNKKLSDLFE-SKFFFTYQHYLMVT--IKDSDESQFNKNSSLIESKLRIFARYLEKNESIAFVH 1534
            +  GITG V+   +T  + KL++ L   L     F ++ E  +R + L  L+EL   ++YE + +       A    GK+F +GSYRL     G+DIDTL+V P+ ++RE+FF      LR    + +I  +PDAFVP++ +K   + +DL+ A +D+  VP +L L++  + L+R +DEK++R++NG RVTD++L LV   N FR ALR IKLW++R  +Y+N  GF GGV+WA+LVAR+CQL+P A S  I+ +FF     +W WP P++L+ I     L +  WNP+   +D  H  P+ITP+YP   +T+N+TES K +I+       ++   I +  K  ++LFE + FFF Y+ YL +T   + SDE    K S L+ESK+R+    LE    I   H
Sbjct:    5 KVFGITGPVSTVGATAAENKLNDSLIQELKKEGSFETEQETANRVQVLKILQELAQRFVYEVSKKKNMSDGMARDAGGKIFTYGSYRLGVHGPGSDIDTLVVVPKHVTREDFFTVFDSLLRERKELDEIAPVPDAFVPIIKIKFSGISIDLICARLDQPQVPLSLTLSD--KNLLRNLDEKDLRALNGTRVTDEILELVPKPNVFRIALRAIKLWAQRRAVYANIFGFPGGVAWAMLVARICQLYPNACSAVILNRFFIILS-EWNWPQPVILKPIEDGP-LQVRVWNPKIYAQDRSHRMPVITPAYPSMCATHNITESTKKVILQEFVRGVQITNDIFSNKKSWANLFEKNDFFFRYKFYLEITAYTRGSDEQHL-KWSGLVESKVRLLVMKLEVLAGIKIAH 403          
BLAST of SMED30019224 vs. Ensembl Nematostella
Match: EDO48505 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJ31])

HSP 1 Score: 339.347 bits (869), Expect = 2.751e-111
Identity = 184/481 (38.25%), Postives = 286/481 (59.46%), Query Frame = -3
Query:  107 PPECLGITGFVTLEKSTEKDIKLSNELELTLINTKEFMSKLEIEHRKETLNKLEELCNSWIYEKALQNYYPKKTASKIKGKLFAFGSYRLNTDFIGADIDTLLVCPQFISREEFFKELYEYLRNCSLVKDILVLPDAFVPLMTMKLCDVEMDLLFASIDESTVPGNLNLNNNTEQLMRRMDEKNIRSINGVRVTDDLLTLVYNKNAFRTALRTIKLWSKRCGIYSNAMGFLGGVSWAILVARVCQLWPTASSFTIVTKFFYFFGIKWKWPTPILLRKITSSSV--LSLPQWNPQTNPKDSYHVFPIITPSYPCQNSTYNVTESHKTIIINHMKNAHELCQQIANGNKKLSDLF-ESKFFFTYQHYLMVTIKDSDESQFNKNSSLIESKLRIFARYLEKNESIAFVHINVQTFNCHEMDKSGKTSQYVNRWFLGFEVLMKSKKSLSVADEISKFESLVKIEIEVIHVKKSNVPQYLSDKDKN 1540
            P +  G+T  ++      +D++L+  LE  LI    F S+ E++ R   L KL EL   WI E +++   P+  A  + GK+F FGS+RL     GADIDTLLV P+ I R +FF   Y+ L+N   V+++  + +AFVP++ +  CD+E+DLLFA +    +P   NL+   E L++ +D K +RS+NG RVTD++L  V N  +FR  LR +KLW+K+ G+YSN +GFLGGVSWAILVAR CQL+P A++ T++ KFF  F  +W+WP P+LL+ I + S   L    W+P+TNP D YH+ PIITP+YP QN +++V+ S + I+ +      +  + + +G      LF    FF  Y+HY++++   + E +  +   L+ESK+R+   YLE NE I   H+N +++    +D  G+  ++V RWF+G         ++++  EI  FE+ V  +   I + K    Q LS  ++N
Sbjct:   12 PQKSFGVTSAISHAGPKPRDLELTKRLEEALIPYGVFESEDELQQRMIVLAKLNELVKEWIVEVSIKKNMPENVAKTVGGKIFTFGSFRLGVHTKGADIDTLLVAPRHIDRADFFSSFYDLLKNHPDVRELRAVENAFVPVIKLIFCDIEVDLLFARLASPEIP--DNLDLLDENLLKNLDPKCVRSLNGCRVTDEILRQVPNIESFRLTLRAVKLWAKKHGVYSNVLGFLGGVSWAILVARTCQLYPNAAASTLLQKFFLVFS-RWEWPNPVLLKNIPTPSENKLGFQIWDPRTNPGDRYHLMPIITPAYPQQNFSFSVSMSTRKIMCDEFFIRLKNTEDVISGKANWDILFTPPNFFHKYKHYIVLSASSNTEEEHLEWIGLVESKVRLLISYLENNEYIKLAHVNPKSYG--PLDSEGE--KHVTRWFIGLMCEKLENVNINLTYEIQMFENKVHTQAVKIMMLKKEWLQRLSMLEEN 485          
BLAST of SMED30019224 vs. Ensembl Nematostella
Match: EDO28875 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T589])

HSP 1 Score: 327.791 bits (839), Expect = 8.459e-107
Identity = 175/460 (38.04%), Postives = 273/460 (59.35%), Query Frame = -3
Query:  170 PPECLGITGFVTLEKSTEKDIKLSNELELTLINTKEFMSKLEIEHRKETLNKLEELCNSWIYEKALQNYYPKKTASKIKGKLFAFGSYRLNTDFIGADIDTLLVCPQFISREEFFKELYEYLRNCSLVKDILVLPDAFVPLMTMKLCDVEMDLLFASIDESTVPGNLNLNNNTEQLMRRMDEKNIRSINGVRVTDDLLTLVYNKNAFRTALRTIKLWSKRCGIYSNAMGFLGGVSWAILVARVCQLWPTASSFTIVTKFFYFFGIKWKWPTPILLRKITSSS--VLSLPQWNPQTNPKDSYHVFPIITPSYPCQNSTYNVTESHKTIIINHMKNAHELCQQIANGNKKLSDLF-ESKFFFTYQHYLMVTIKDSDESQFNKNSSLIESKLRIFARYLEKNESIAFVHINVQTFNCHEMDKSGKTSQYVNRWFLGFEVLMKSKKSLSVADEISKFESLVKIE 1540
            P +  G+T  ++      +D++L+  LE  LI    F S+ E++ R   L KL EL   WI E +++   P+  A  + GK+F FGS+ L     GAD  TLLV P  I R +FF   Y+ L+N   V+++  + +AFVP++ +  CD+E+DLLFA +    +P   NL+   E L++ +D K +RS+NG RVTD++L  V N  +FR  L  +KLW+K+ G+YSN +GFLGGVSWA+LVAR CQL+P A++ T++ KFF  F  +W+WP P+LL+ I + S   L    W+P+TNP D YH+ PIITP+YP QNST+NV+ S + I+ +      +  + + +G      LF    FF  Y+HY++++   + E +  +   L+ESK+R+   YLE NE I   H+N +++    +D  G+  ++V RWF+G         ++++  EI  F++ V  +
Sbjct:   12 PQKSFGVTSAISHAGPKPRDLELTKRLEEALIPYGVFESEDELQQRMIVLAKLNELVKEWIVEVSIKKKMPENVAKTVGGKIFTFGSFILGVHTKGAD--TLLVAPHHIDRADFFSSFYDLLKNHPDVRELRAVENAFVPVIKLIFCDIEVDLLFARLASPEIP--DNLDLLDENLLKNLDPKCVRSLNGCRVTDEILRQVPNIESFRLTLNAVKLWAKKHGVYSNVLGFLGGVSWAMLVARTCQLYPNAAASTLLQKFFLVFS-RWEWPNPVLLKNIPTPSENKLGFKNWDPRTNPGDRYHLMPIITPAYPQQNSTFNVSMSTRKIMCDEFFIGLKNTEDVISGKANWDRLFTPPNFFHKYRHYIVLSASSNTEEEHLEWIGLVESKVRLLISYLENNEYIKLAHVNPKSYG--PLDSEGE--KHVTRWFIGLMFEKLENVNINLTYEIQMFKNKVHAQ 462          
BLAST of SMED30019224 vs. Ensembl Medaka
Match: papolg (poly(A) polymerase gamma [Source:NCBI gene;Acc:101157478])

HSP 1 Score: 357.066 bits (915), Expect = 1.217e-113
Identity = 196/503 (38.97%), Postives = 287/503 (57.06%), Query Frame = -3
Query:  125 LKQIYRMIEIKEADIPPECLGITGFVTLEKSTEKDIKLSNELELTLINTKEFMSKLEIEHRKETLNKLEELCNSWIYEKALQNYYPKKTASKIKGKLFAFGSYRLNTDFIGADIDTLLVCPQFISREEFFKELYEYLRNCSLVKDILVLPDAFVPLMTMKLCDVEMDLLFASIDESTVPGNLNLNNNTEQLMRRMDEKNIRSINGVRVTDDLLTLVYNKNAFRTALRTIKLWSKRCGIYSNAMGFLGGVSWAILVARVCQLWPTASSFTIVTKFFYFFGIKWKWPTPILLRKITSSSVLSLPQWNPQTNPKDSYHVFPIITPSYPCQNSTYNVTESHKTIIINHMKNAHELCQQIANGNKKLSDLFESKFFFT-YQHYLMVTIKDSDESQFNKNSSLIESKLRIFARYLEKNESIAFVHINVQTFNCHEMDKSGKTSQYVNRWFLGF---EVLMKSKKSLSVADEISKFESLV------------KIEIEVIHVKKSNVPQYL 1585
            +K++   +   +   P +  GIT  ++L    E D + + +L   +     F  + E+ HR   L KL      WI E +     P    S + GK+F FGSYRL     GADID L V P+ + R +FF+  +E L+    +KD+  + DAFVP++  K   +E+DLLFA +   ++P NL+L  ++  +++ +D + IRS+NG RVTD++L LV NK  FR  LR IKLW+KR GIYSN +GFLGGVSWA+LVAR CQL+P A + T+V KFF  F  KW+WP P+LL++   S+ L+LP W+P+ NP D YH+ PIITP+YP QNSTYNV+ S +TI+    K    +  +I  G  +   LFE   FF  Y+HY+++T   S E    +   L+ESK+R+    LE+NE I   H+N Q+F   + ++S   + +V  WF+G    +V      ++ +  +I  F   V             ++IE  HVKK  + QYL
Sbjct:    1 MKEMSSAMPSGQQQPPQKHYGITSAISLAPPREIDHEYTRKLCEAMQPFGVFEDEEELNHRLAVLGKLNNFVKEWIAEISELKNLPPSAISCVGGKIFTFGSYRLGVHTKGADIDALCVAPRHVDRSDFFQSFFEKLKQHEEIKDLRAVEDAFVPVIKFKFDGIEIDLLFARLALQSIPDNLDLRGDS--ILKNLDIRCIRSLNGCRVTDEILYLVPNKENFRLTLRAIKLWAKRRGIYSNMLGFLGGVSWAMLVARTCQLYPNAVAATLVHKFFLVFS-KWEWPNPVLLKQPEDSN-LNLPVWDPRVNPSDRYHLMPIITPAYPQQNSTYNVSTSTRTIMSEEFKYGLSVTDEILQGKAEWPKLFEPPSFFQKYKHYIVLTASASTEENHLEWVGLVESKIRVLVGNLERNEYITLAHVNPQSFPGSKENRS--ENDFVCMWFIGIIFKKVENAESVNIDLTYDIQSFTDTVYRQANNINMLKDGMKIEATHVKKKQLHQYL 497          
BLAST of SMED30019224 vs. Planmine SMEST
Match: SMESG000008247.1 (SMESG000008247.1)

HSP 1 Score: 1058.9 bits (2737), Expect = 0.000e+0
Identity = 512/519 (98.65%), Postives = 516/519 (99.42%), Query Frame = -3
Query:   11 MIEIKEADIPPECLGITGFVTLEKSTEKDIKLSNELELTLINTKEFMSKLEIEHRKETLNKLEELCNSWIYEKALQNYYPKKTASKIKGKLFAFGSYRLNTDFIGADIDTLLVCPQFISREEFFKELYEYLRNCSLVKDILVLPDAFVPLMTMKLCDVEMDLLFASIDESTVPGNLNLNNNTEQLMRRMDEKNIRSINGVRVTDDLLTLVYNKNAFRTALRTIKLWSKRCGIYSNAMGFLGGVSWAILVARVCQLWPTASSFTIVTKFFYFFGIKWKWPTPILLRKITSSSVLSLPQWNPQTNPKDSYHVFPIITPSYPCQNSTYNVTESHKTIIINHMKNAHELCQQIANGNKKLSDLFESKFFFTYQHYLMVTIKDSDESQFNKNSSLIESKLRIFARYLEKNESIAFVHINVQTFNCHEMDKSGKTSQYVNRWFLGFEVLMKSKKSLSVADEISKFESLVKIEIEVIHVKKSNVPQYLSDKDKNKFLLFLPRKPRKRPTAGNELFNTSEAKRQKVA 1567
            MIEIKEADIPPECLGITGFVTLEKSTEKDIKLSNELELTLINTKEFMSKLEIEHRKETLNKLEELCN WIYEKALQNYYPKKTASKIKGKLFAFGSYRLNTDFIGADIDTLLVCPQFISREEFFKELYEYL+NCSLVKDILVLPDAFVPLMTMKLCDVE+DLLFASIDESTVPGNLNLN+NTEQLMRRMDEKNIRSINGVRVTDDLLTLVYNKNAFRTALRTIKLWSKRCGIYSNAMGFLGGVSWAILVARVCQLWPTASSFTIVTKFFYFFGIKWKWPTPILLRKITSSSVLSLPQWNPQTNPKDSYHVFPIITPSYPCQNSTYNVTESHKTIIINHMKNAHELCQQIANGNKKLSDLFESKFFFTYQHYLMVTIKDSDESQFNKNSSLIESKLRIFARYLEKNESIA VHINVQTFNCHEMDKSGKTSQYVNRWFLGFEVLMKSKKSLSVADEISKFESLVKIEIEV+HVKKSNVPQYLSDKDKNKFLLFLPRK RKRPTAGNELFNTSEAKRQKVA
Sbjct:    1 MIEIKEADIPPECLGITGFVTLEKSTEKDIKLSNELELTLINTKEFMSKLEIEHRKETLNKLEELCNLWIYEKALQNYYPKKTASKIKGKLFAFGSYRLNTDFIGADIDTLLVCPQFISREEFFKELYEYLQNCSLVKDILVLPDAFVPLMTMKLCDVEIDLLFASIDESTVPGNLNLNDNTEQLMRRMDEKNIRSINGVRVTDDLLTLVYNKNAFRTALRTIKLWSKRCGIYSNAMGFLGGVSWAILVARVCQLWPTASSFTIVTKFFYFFGIKWKWPTPILLRKITSSSVLSLPQWNPQTNPKDSYHVFPIITPSYPCQNSTYNVTESHKTIIINHMKNAHELCQQIANGNKKLSDLFESKFFFTYQHYLMVTIKDSDESQFNKNSSLIESKLRIFARYLEKNESIALVHINVQTFNCHEMDKSGKTSQYVNRWFLGFEVLMKSKKSLSVADEISKFESLVKIEIEVVHVKKSNVPQYLSDKDKNKFLLFLPRKSRKRPTAGNELFNTSEAKRQKVA 519          
BLAST of SMED30019224 vs. Planmine SMEST
Match: SMESG000008244.1 (SMESG000008244.1)

HSP 1 Score: 1058.9 bits (2737), Expect = 0.000e+0
Identity = 512/519 (98.65%), Postives = 516/519 (99.42%), Query Frame = -3
Query:   11 MIEIKEADIPPECLGITGFVTLEKSTEKDIKLSNELELTLINTKEFMSKLEIEHRKETLNKLEELCNSWIYEKALQNYYPKKTASKIKGKLFAFGSYRLNTDFIGADIDTLLVCPQFISREEFFKELYEYLRNCSLVKDILVLPDAFVPLMTMKLCDVEMDLLFASIDESTVPGNLNLNNNTEQLMRRMDEKNIRSINGVRVTDDLLTLVYNKNAFRTALRTIKLWSKRCGIYSNAMGFLGGVSWAILVARVCQLWPTASSFTIVTKFFYFFGIKWKWPTPILLRKITSSSVLSLPQWNPQTNPKDSYHVFPIITPSYPCQNSTYNVTESHKTIIINHMKNAHELCQQIANGNKKLSDLFESKFFFTYQHYLMVTIKDSDESQFNKNSSLIESKLRIFARYLEKNESIAFVHINVQTFNCHEMDKSGKTSQYVNRWFLGFEVLMKSKKSLSVADEISKFESLVKIEIEVIHVKKSNVPQYLSDKDKNKFLLFLPRKPRKRPTAGNELFNTSEAKRQKVA 1567
            MIEIKEADIPPECLGITGFVTLEKSTEKDIKLSNELELTLINTKEFMSKLEIEHRKETLNKLEELCN WIYEKALQNYYPKKTASKIKGKLFAFGSYRLNTDFIGADIDTLLVCPQFISREEFFKELYEYL+NCSLVKDILVLPDAFVPLMTMKLCDVE+DLLFASIDESTVPGNLNLN+NTEQLMRRMDEKNIRSINGVRVTDDLLTLVYNKNAFRTALRTIKLWSKRCGIYSNAMGFLGGVSWAILVARVCQLWPTASSFTIVTKFFYFFGIKWKWPTPILLRKITSSSVLSLPQWNPQTNPKDSYHVFPIITPSYPCQNSTYNVTESHKTIIINHMKNAHELCQQIANGNKKLSDLFESKFFFTYQHYLMVTIKDSDESQFNKNSSLIESKLRIFARYLEKNESIA VHINVQTFNCHEMDKSGKTSQYVNRWFLGFEVLMKSKKSLSVADEISKFESLVKIEIEV+HVKKSNVPQYLSDKDKNKFLLFLPRK RKRPTAGNELFNTSEAKRQKVA
Sbjct:    1 MIEIKEADIPPECLGITGFVTLEKSTEKDIKLSNELELTLINTKEFMSKLEIEHRKETLNKLEELCNLWIYEKALQNYYPKKTASKIKGKLFAFGSYRLNTDFIGADIDTLLVCPQFISREEFFKELYEYLQNCSLVKDILVLPDAFVPLMTMKLCDVEIDLLFASIDESTVPGNLNLNDNTEQLMRRMDEKNIRSINGVRVTDDLLTLVYNKNAFRTALRTIKLWSKRCGIYSNAMGFLGGVSWAILVARVCQLWPTASSFTIVTKFFYFFGIKWKWPTPILLRKITSSSVLSLPQWNPQTNPKDSYHVFPIITPSYPCQNSTYNVTESHKTIIINHMKNAHELCQQIANGNKKLSDLFESKFFFTYQHYLMVTIKDSDESQFNKNSSLIESKLRIFARYLEKNESIALVHINVQTFNCHEMDKSGKTSQYVNRWFLGFEVLMKSKKSLSVADEISKFESLVKIEIEVVHVKKSNVPQYLSDKDKNKFLLFLPRKSRKRPTAGNELFNTSEAKRQKVA 519          
BLAST of SMED30019224 vs. Planmine SMEST
Match: SMESG000008241.1 (SMESG000008241.1)

HSP 1 Score: 1056.2 bits (2730), Expect = 0.000e+0
Identity = 510/519 (98.27%), Postives = 516/519 (99.42%), Query Frame = -3
Query:   11 MIEIKEADIPPECLGITGFVTLEKSTEKDIKLSNELELTLINTKEFMSKLEIEHRKETLNKLEELCNSWIYEKALQNYYPKKTASKIKGKLFAFGSYRLNTDFIGADIDTLLVCPQFISREEFFKELYEYLRNCSLVKDILVLPDAFVPLMTMKLCDVEMDLLFASIDESTVPGNLNLNNNTEQLMRRMDEKNIRSINGVRVTDDLLTLVYNKNAFRTALRTIKLWSKRCGIYSNAMGFLGGVSWAILVARVCQLWPTASSFTIVTKFFYFFGIKWKWPTPILLRKITSSSVLSLPQWNPQTNPKDSYHVFPIITPSYPCQNSTYNVTESHKTIIINHMKNAHELCQQIANGNKKLSDLFESKFFFTYQHYLMVTIKDSDESQFNKNSSLIESKLRIFARYLEKNESIAFVHINVQTFNCHEMDKSGKTSQYVNRWFLGFEVLMKSKKSLSVADEISKFESLVKIEIEVIHVKKSNVPQYLSDKDKNKFLLFLPRKPRKRPTAGNELFNTSEAKRQKVA 1567
            MIEIKEADIPPECLGITGFVTLEKSTEKDIKLSNELELTLINTKEFMSKLEIEHRKETLNKLEELCNSWIYEKALQNYYPKKTASKIKGK FAFGSYRLNTDFIGADIDTLLVCPQFISREEFFKELYEYL+NCSLVKDILVLPDAFVPLMTMKLCDVE+DLLFASIDESTVPGNLNLN+NTEQLMRRMDEKNIRSINGVRVTDDLLTLVYNKNAFRTALRTIKLWSKRCGIYSNAMGFLGGVSWAILVARVCQLWPTASSFTIVTKFFYFFGIKWKWPTPILLRKITSSSVLSLPQWNPQTNPKDSYH+FPIITPSYPCQNSTYNVTESHKTIIINHMKNAHELCQQIANGNKKLSDLF+SKFFFTYQHYLMVTIKDSDESQFNKNSSLIESKLRIFARYLEKNESIA VHINVQTFNCHEMDKSGKTSQYVNRWFLGFEVLMKSKKSLSVADEISKFESLVKIEIEV+HVKKSNVPQYLSDKDKNKFLLFLPRKPRKRPTAGNELFNTSEAKRQK A
Sbjct:    1 MIEIKEADIPPECLGITGFVTLEKSTEKDIKLSNELELTLINTKEFMSKLEIEHRKETLNKLEELCNSWIYEKALQNYYPKKTASKIKGKRFAFGSYRLNTDFIGADIDTLLVCPQFISREEFFKELYEYLQNCSLVKDILVLPDAFVPLMTMKLCDVEIDLLFASIDESTVPGNLNLNDNTEQLMRRMDEKNIRSINGVRVTDDLLTLVYNKNAFRTALRTIKLWSKRCGIYSNAMGFLGGVSWAILVARVCQLWPTASSFTIVTKFFYFFGIKWKWPTPILLRKITSSSVLSLPQWNPQTNPKDSYHMFPIITPSYPCQNSTYNVTESHKTIIINHMKNAHELCQQIANGNKKLSDLFKSKFFFTYQHYLMVTIKDSDESQFNKNSSLIESKLRIFARYLEKNESIALVHINVQTFNCHEMDKSGKTSQYVNRWFLGFEVLMKSKKSLSVADEISKFESLVKIEIEVVHVKKSNVPQYLSDKDKNKFLLFLPRKPRKRPTAGNELFNTSEAKRQKFA 519          
BLAST of SMED30019224 vs. Planmine SMEST
Match: SMESG000008279.1 (SMESG000008279.1)

HSP 1 Score: 940.643 bits (2430), Expect = 0.000e+0
Identity = 467/519 (89.98%), Postives = 470/519 (90.56%), Query Frame = -3
Query:   11 MIEIKEADIPPECLGITGFVTLEKSTEKDIKLSNELELTLINTKEFMSKLEIEHRKETLNKLEELCNSWIYEKALQNYYPKKTASKIKGKLFAFGSYRLNTDFIGADIDTLLVCPQFISREEFFKELYEYLRNCSLVKDILVLPDAFVPLMTMKLCDVEMDLLFASIDESTVPGNLNLNNNTEQLMRRMDEKNIRSINGVRVTDDLLTLVYNKNAFRTALRTIKLWSKRCGIYSNAMGFLGGVSWAILVARVCQLWPTASSFTIVTKFFYFFGIKWKWPTPILLRKITSSSVLSLPQWNPQTNPKDSYHVFPIITPSYPCQNSTYNVTESHKTIIINHMKNAHELCQQIANGNKKLSDLFESKFFFTYQHYLMVTIKDSDESQFNKNSSLIESKLRIFARYLEKNESIAFVHINVQTFNCHEMDKSGKTSQYVNRWFLGFEVLMKSKKSLSVADEISKFESLVKIEIEVIHVKKSNVPQYLSDKDKNKFLLFLPRKPRKRPTAGNELFNTSEAKRQKVA 1567
            MIEIKEADIPPECLGITGFVTLEKSTEKDIKLSNELELTLINTKEFMSKLEIEHRKETLNKLEELCNSWIYEKALQNYYPKKTASKIKGKLFAFGSYRLNTDFIGADIDTLLVCPQFISREEFFKELYEYLRNCSLVKDILVLPDAFVPLMTMKLCD+EMDLLFASIDESTVPGNLNLN+NTEQLMRRMDEKNIRSINGVRVTDDLLTLVYNKNAFRTALRTIKLWSKR GIYSNAMGFLGGVSWAILVAR                                               NPQTNPKDSYHVFPIITPSYPCQNSTYNVTESHKTIIINHMKNAHELCQQIANGNKKLSDLFESKFFFTYQHYLMVTIKDSDESQFNKNSSLIESKLRIFARYLEKN+SIA VHINVQTFNCHEMDKSGKTSQYVNRWFLGFEVLMKSKKSLSVADEISKFESLVKIEIEVIHVKKSNVPQYLSDKDKNKFLLFLPRKPRKRPTAGNELFNTSEAKRQKVA
Sbjct:    1 MIEIKEADIPPECLGITGFVTLEKSTEKDIKLSNELELTLINTKEFMSKLEIEHRKETLNKLEELCNSWIYEKALQNYYPKKTASKIKGKLFAFGSYRLNTDFIGADIDTLLVCPQFISREEFFKELYEYLRNCSLVKDILVLPDAFVPLMTMKLCDIEMDLLFASIDESTVPGNLNLNDNTEQLMRRMDEKNIRSINGVRVTDDLLTLVYNKNAFRTALRTIKLWSKRSGIYSNAMGFLGGVSWAILVARCS---------------------------------------------NPQTNPKDSYHVFPIITPSYPCQNSTYNVTESHKTIIINHMKNAHELCQQIANGNKKLSDLFESKFFFTYQHYLMVTIKDSDESQFNKNSSLIESKLRIFARYLEKNKSIALVHINVQTFNCHEMDKSGKTSQYVNRWFLGFEVLMKSKKSLSVADEISKFESLVKIEIEVIHVKKSNVPQYLSDKDKNKFLLFLPRKPRKRPTAGNELFNTSEAKRQKVA 474          
BLAST of SMED30019224 vs. Planmine SMEST
Match: SMESG000072012.1 (SMESG000072012.1)

HSP 1 Score: 494.967 bits (1273), Expect = 1.311e-168
Identity = 248/525 (47.24%), Postives = 357/525 (68.00%), Query Frame = -3
Query:   29 MIEIKEADIPPECLGITGFVTLEKSTEKDIKLSNELELTLINTKEFMSKLEIEHRKETLNKLEELCNSWIYEKALQNYYPKKTASKIKGKLFAFGSYRLNTDFIGADIDTLLVCPQFISREEFFKELYEYLRNCSLVKDILVLPDAFVPLMTMKLCDVEMDLLFASIDESTVPGNLNLNNNTEQLMRRMDEKNIRSINGVRVTDDLLTLVYNKNAFRTALRTIKLWSKRCGIYSNAMGFLGGVSWAILVARVCQLWPTASSFTIVTKFFYFFGIKWKWPTPILLRKITSSSVLSLPQWNPQTNPKDSYHVFPIITPSYPCQNSTYNVTESHKTIIINHMKNAHELCQQIANGNKKLSDLFESKFFFTYQHYLMVTIKDSDESQFNKNSSLIESKLRIFARYLEKNESIAFVHINVQTFNCHEMDKSGKTSQY-----------VNRWFLGFEVLMKSKKSLSVADEISKFESLVKIEIEVIHVKKSNVPQYLSDKDKNKFL-LFLPRKPRKRPTAGNELFNTSEA 1567
            M+   E +IP ECLG++G V   K  ++++ L+ +LEL + N   F S  E   R+E L +L++ CN+WIY+KA+   YP+  A  IKGK+F FGSYRL  +F GADID LLV P+FISREEFF +   +L      ++I  +P AFVP++ MK C+VE+DLLFAS+D  ++P +  L+ N++QL+R MDE+++RS+NGVRVTDD+L LVY+K  F++AL+ I++W+KR  IYSNAMGF GGVSWAILVARVCQLWP AS  TIV  FF F+G KW+WP+P++L+ +  SSVL L QW+P+ NP D  HV PI+TPSYP QNSTYNV ESHK  +++ M+ A  + QQI+   K   DLF+  FFFTY+HYL+VT + +D+ QF ++SSLIESKLR+  +Y+E N  + F  + ++++   E     KT+             V RWF+G E L K +K+L + +EI++F++LVK++++V + +++N+  +L  ++  K     L    RKR + G  +  T+ A
Sbjct:    1 MMPTDEHNIPTECLGVSGAVNFLKPDKQELLLTQQLELAIKNLNIFESVEETRQRREALIELQDFCNTWIYKKAIDYMYPESIAKSIKGKIFTFGSYRLGVNFSGADIDALLVGPKFISREEFFDDFVTFLLENPQAQEIHSVPKAFVPVLKMKFCNVEIDLLFASVDLMSIPHDFCLSENSDQLLRNMDERDVRSVNGVRVTDDILRLVYDKKIFKSALKIIRIWAKRRCIYSNAMGFCGGVSWAILVARVCQLWPLASVSTIVINFFKFYGTKWRWPSPVVLKDVEESSVLHLMQWDPRINPSDQNHVMPILTPSYPSQNSTYNVCESHKKFMVDQMQKAFRIIQQISLKEKTFQDLFKPLFFFTYRHYLVVTFRCADKKQFREDSSLIESKLRLLVQYVESNPFVEFALLYLRSYERMEPSTVSKTTSTTIATATDDKCNVRRWFVGLE-LKKVEKNLYLIEEINRFKNLVKVDVDVSYYRRANLAVFLPSEEVEKIREKMLAVNLRKRNSEGGNIGATAAA 524          
The following BLAST results are available for this feature:
BLAST of SMED30019224 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PAPOLG2.076e-11239.13poly(A) polymerase gamma [Source:HGNC Symbol;Acc:H... [more]
PAPOLA3.033e-10137.90poly(A) polymerase alpha [Source:HGNC Symbol;Acc:H... [more]
PAPOLA4.798e-10137.90poly(A) polymerase alpha [Source:HGNC Symbol;Acc:H... [more]
PAPOLB3.575e-9940.28poly(A) polymerase beta [Source:HGNC Symbol;Acc:HG... [more]
PAPOLG1.351e-6444.59poly(A) polymerase gamma [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of SMED30019224 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
pap-11.104e-9835.91Poly-A Polymerase [Source:UniProtKB/TrEMBL;Acc:Q9... [more]
pap-11.104e-9835.91Poly-A Polymerase [Source:UniProtKB/TrEMBL;Acc:Q9... [more]
F43G6.56.215e-9736.18pep chromosome:WBcel235:II:11814839:11816706:-1 ge... [more]
T15H9.61.684e-9434.46pep chromosome:WBcel235:II:9607533:9609396:-1 gene... [more]
back to top
BLAST of SMED30019224 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
hrg3.273e-10935.60gene:FBgn0015949 transcript:FBtr0086484[more]
hrg3.273e-10935.60gene:FBgn0015949 transcript:FBtr0086483[more]
hrg3.273e-10935.60gene:FBgn0015949 transcript:FBtr0111010[more]
hrg1.809e-10735.60gene:FBgn0015949 transcript:FBtr0330248[more]
back to top
BLAST of SMED30019224 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
papolg2.200e-11440.79poly(A) polymerase gamma [Source:ZFIN;Acc:ZDB-GENE... [more]
papola3.968e-11037.52poly(A) polymerase alpha [Source:ZFIN;Acc:ZDB-GENE... [more]
papola1.298e-9842.51poly(A) polymerase alpha [Source:ZFIN;Acc:ZDB-GENE... [more]
papola8.787e-6943.33poly(A) polymerase alpha [Source:ZFIN;Acc:ZDB-GENE... [more]
papola1.394e-4644.62poly(A) polymerase alpha [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of SMED30019224 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
papolg1.502e-11339.18poly(A) polymerase gamma [Source:NCBI gene;Acc:448... [more]
papolg3.755e-11339.34poly(A) polymerase gamma [Source:NCBI gene;Acc:448... [more]
papolg4.219e-11339.31poly(A) polymerase gamma [Source:NCBI gene;Acc:448... [more]
papolg4.677e-11339.31poly(A) polymerase gamma [Source:NCBI gene;Acc:448... [more]
papolg7.851e-11339.31poly(A) polymerase gamma [Source:NCBI gene;Acc:448... [more]
back to top
BLAST of SMED30019224 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Papolg2.377e-11239.13poly(A) polymerase gamma [Source:MGI Symbol;Acc:MG... [more]
Papolg1.672e-11041.98poly(A) polymerase gamma [Source:MGI Symbol;Acc:MG... [more]
Papola6.672e-10238.26poly (A) polymerase alpha [Source:MGI Symbol;Acc:M... [more]
Papola1.052e-10138.26poly (A) polymerase alpha [Source:MGI Symbol;Acc:M... [more]
Papolb1.235e-10140.00poly (A) polymerase beta (testis specific) [Source... [more]
back to top
BLAST of SMED30019224 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9BWT3|PAPOG_HUMAN9.970e-11239.13Poly(A) polymerase gamma OS=Homo sapiens OX=9606 G... [more]
sp|Q6PCL9|PAPOG_MOUSE1.663e-11139.13Poly(A) polymerase gamma OS=Mus musculus OX=10090 ... [more]
sp|P51004|PAPO1_XENLA4.246e-10238.15Poly(A) polymerase alpha-A (Fragment) OS=Xenopus l... [more]
sp|Q9WVP6|PAPOB_MOUSE1.064e-10040.00Poly(A) polymerase beta OS=Mus musculus OX=10090 G... [more]
sp|Q61183|PAPOA_MOUSE1.523e-10038.26Poly(A) polymerase alpha OS=Mus musculus OX=10090 ... [more]
back to top
BLAST of SMED30019224 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K3FGS56.123e-14347.49Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0R3WPI81.546e-14247.70Poly(A) polymerase OS=Hydatigena taeniaeformis OX=... [more]
G4LZL54.521e-14146.79Poly(A) polymerase OS=Schistosoma mansoni OX=6183 ... [more]
A0A3Q0KTL78.255e-14142.11Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
W6UX921.689e-14046.77Poly(A) polymerase OS=Echinococcus granulosus OX=6... [more]
back to top
BLAST of SMED30019224 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
papolg1.633e-11139.76poly(A) polymerase gamma [Source:NCBI gene;Acc:103... [more]
papola2.668e-11138.48poly(A) polymerase alpha [Source:NCBI gene;Acc:103... [more]
papola7.191e-11038.40poly(A) polymerase alpha [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of SMED30019224 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000005362.17.173e-11138.27pep scaffold:Pmarinus_7.0:GL481270:231683:246917:-... [more]
papola2.208e-9744.60poly(A) polymerase alpha [Source:ZFIN;Acc:ZDB-GENE... [more]
ENSPMAT00000003282.14.200e-8136.00pep scaffold:Pmarinus_7.0:GL477473:7119:24582:-1 g... [more]
back to top
BLAST of SMED30019224 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
PAP11.017e-9438.86Poly(A) polymerase; one of three factors required ... [more]
back to top
BLAST of SMED30019224 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO485052.751e-11138.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO288758.459e-10738.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30019224 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
papolg1.217e-11338.97poly(A) polymerase gamma [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of SMED30019224 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000008247.10.000e+098.65SMESG000008247.1[more]
SMESG000008244.10.000e+098.65SMESG000008244.1[more]
SMESG000008241.10.000e+098.27SMESG000008241.1[more]
SMESG000008279.10.000e+089.98SMESG000008279.1[more]
SMESG000072012.11.311e-16847.24SMESG000072012.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019224 ID=SMED30019224|Name=SMED30019224|organism=Schmidtea mediterranea sexual|type=transcript|length=1611bp
CCAATAATTATGCGACTTTTTGCCGCTTGGCCTCTGAAGTGTTAAAAAGT
TCATTTCCTGCTGTTGGTCGTTTCCTTGGTTTCCTTGGAAGAAATAGCAA
AAATTTGTTTTTATCTTTATCTGACAAATATTGTGGCACATTTGATTTTT
TGACATGAATAACTTCAATTTCTATTTTAACCAAGCTTTCAAATTTTGAG
ATTTCGTCAGCAACGGACAGACTCTTCTTACTCTTCATTAGCACTTCAAA
TCCCAGAAACCATCGGTTAACGTATTGAGATGTTTTACCAGACTTGTCCA
TTTCATGGCAATTGAAAGTCTGAACATTTATGTGCACAAACGCAATAGAT
TCGTTCTTCTCCAGATATCGCGCAAATATTCTCAATTTTGATTCGATTAG
ACTTGAGTTTTTATTGAATTGGCTTTCATCGGAATCTTTTATAGTAACCA
TCAAATAATGCTGATAAGTAAAAAAGAATTTGGATTCAAACAAATCCGAA
AGCTTTTTATTTCCATTTGCAATTTGTTGACATAATTCATGGGCATTTTT
CATGTGATTGATGATGATCGTTTTGTGACTTTCTGTGACATTGTATGTTG
AATTTTGACATGGATAACTTGGCGTAATTATCGGAAACACATGATATGAA
TCCTTCGGATTAGTTTGTGGATTCCATTGGGGCAAGGACAAAACACTTGA
AGATGTTATTTTTCTTAAAAGAATTGGAGTAGGCCATTTCCATTTGATTC
CAAAGAAGTAAAAGAATTTCGTTACTATCGTAAAAGAAGACGCAGTTGGC
CATAGTTGACATACCCTTGCCACCAATATTGCCCAACTGACACCTCCCAG
AAATCCCATGGCATTTGAATATATCCCACATCGTTTCGACCACAACTTTA
TTGTTCTTAGAGCAGTTCGAAATGCATTTTTATTGTAAACAAGAGTTAGT
AGGTCATCAGTTACTCTAACACCGTTGATGCTACGGATGTTCTTTTCGTC
CATTCTACGCATCAACTGTTCAGTATTATTGTTGAGATTCAAGTTACCAG
GAACTGTCGATTCATCAATACTTGCAAATAGCAAGTCCATTTCGACATCA
CAAAGTTTCATTGTCATTAAAGGAACAAATGCATCAGGAAGCACTAGAAT
ATCTTTTACTAAAGAGCAATTTCGAAGATATTCATAAAGTTCTTTAAAGA
ATTCTTCTCTTGAAATAAATTGAGGACAAACGAGCAAAGTGTCGATATCA
GCTCCAATGAAATCCGTATTCAACCGATAAGAACCAAATGCAAAAAGTTT
TCCTTTGATTTTGCTTGCAGTTTTCTTCGGATAATAATTTTGAAGAGCTT
TTTCATAGATCCACGAATTGCAGAGTTCTTCTAATTTATTAAGTGTTTCT
TTTCGATGCTCTATTTCTAATTTTGACATGAATTCTTTTGTGTTTATAAG
AGTTAATTCCAACTCATTTGATAATTTTATATCTTTTTCCGTAGATTTCT
CTAAAGTGACAAACCCCGTAATTCCGAGACATTCTGGTGGAATATCTGCT
TCTTTAATTTCTATCATTCTGTAAATTTGTTTTAATTATATTTATTAAAG
CCAATTTAAAT
back to top

protein sequence of SMED30019224-orf-1

>SMED30019224-orf-1 ID=SMED30019224-orf-1|Name=SMED30019224-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=520bp
MIEIKEADIPPECLGITGFVTLEKSTEKDIKLSNELELTLINTKEFMSKL
EIEHRKETLNKLEELCNSWIYEKALQNYYPKKTASKIKGKLFAFGSYRLN
TDFIGADIDTLLVCPQFISREEFFKELYEYLRNCSLVKDILVLPDAFVPL
MTMKLCDVEMDLLFASIDESTVPGNLNLNNNTEQLMRRMDEKNIRSINGV
RVTDDLLTLVYNKNAFRTALRTIKLWSKRCGIYSNAMGFLGGVSWAILVA
RVCQLWPTASSFTIVTKFFYFFGIKWKWPTPILLRKITSSSVLSLPQWNP
QTNPKDSYHVFPIITPSYPCQNSTYNVTESHKTIIINHMKNAHELCQQIA
NGNKKLSDLFESKFFFTYQHYLMVTIKDSDESQFNKNSSLIESKLRIFAR
YLEKNESIAFVHINVQTFNCHEMDKSGKTSQYVNRWFLGFEVLMKSKKSL
SVADEISKFESLVKIEIEVIHVKKSNVPQYLSDKDKNKFLLFLPRKPRKR
PTAGNELFNTSEAKRQKVA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR014492PolyA_polymerase
IPR007010PolA_pol_RNA-bd_dom
IPR002934Polymerase_NTP_transf_dom
IPR007012PolA_pol_cen_dom
IPR011068NuclTrfase_I-like_C
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
Vocabulary: molecular function
TermDefinition
GO:0004652polynucleotide adenylyltransferase activity
GO:0003723RNA binding
GO:0016779nucleotidyltransferase activity
Vocabulary: biological process
TermDefinition
GO:0043631RNA polyadenylation
GO:0031123RNA 3'-end processing