Neur_chan_LBD domain-containing protein

Overview
NameNeur_chan_LBD domain-containing protein
Smed IDSMED30019205
Length (bp)1431
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Neur_chan_LBD domain-containing protein (SMED30019205) t-SNE clustered cells

Violin plots show distribution of expression levels for Neur_chan_LBD domain-containing protein (SMED30019205) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Neur_chan_LBD domain-containing protein (SMED30019205) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Neur_chan_LBD domain-containing protein (SMED30019205) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019205

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30019205SMESG000039749.1 SmedASXL_013856SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
gutSMED30019205SMESG000039749.1 dd_Smed_v4_15962_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30019205SMESG000039749.1 dd_Smed_v4_15962_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30019205SMESG000039749.1 dd_15962dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
neuronSMED30019205SMESG000039749.1 dd_15962dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30019205SMESG000039749.1 dd_Smed_v6_15962_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
enteric muscle cellSMED30019205SMESG000039749.1 dd_Smed_v4_15962_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Human
Match: GABRB2 (gamma-aminobutyric acid type A receptor beta2 subunit [Source:HGNC Symbol;Acc:HGNC:4082])

HSP 1 Score: 54.6842 bits (130), Expect = 1.405e-7
Identity = 58/271 (21.40%), Postives = 112/271 (41.33%), Query Frame = 2
Query:  320 LKIGEIDTIKE---QFTADIIVKAKWREPSLDFHIDGLNYDWS-----KCWTPKLYVENTVGDPREHVYQMITFNEF----GHAFLCEKRRVSGVFLENLELNHFPFDVQDLTI-IVATTLSSSEIRLVNDPDEPHRINKQSFVDEQEWFLYKNIESE--QKDMIFEYADPLSVRPALLVQCRAARRPAYFLWNLFLVTFLICSLSLVTFAVDKDLPQNRLQLSYTLVLTLIAFKFVVNQCLPKISYLTYLDKYIISNLFFLTLVCAWHGL 1087
            + I  ID + E    +T  +  +  WR+  L +++  LN         + W P  Y  N   D +  V+ +   N          +    R++      ++L  +P D Q+ T+ I +   ++ +I      D+    N  + V + E   +  ++ +   K ++F         P L +  +  R   YF+   ++ + LI  LS V+F ++ D    R+ L  T VLT+      + + LPKI Y+  +D Y++    F+ +    + L
Sbjct:    3 IDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYNVIPLNLTLDNRVADQLWVPDTYFLN---DKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGDD----NAVTGVTKIELPQFSIVDYKLITKKVVFSTGS----YPRLSLSFKLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFMALLEYAL 262          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Human
Match: GABRB2 (gamma-aminobutyric acid type A receptor beta2 subunit [Source:HGNC Symbol;Acc:HGNC:4082])

HSP 1 Score: 55.0694 bits (131), Expect = 1.615e-7
Identity = 57/268 (21.27%), Postives = 114/268 (42.54%), Query Frame = 2
Query:  320 LKIGEIDTIKE---QFTADIIVKAKWREPSLDFHIDGLNYDWSKCWTPKLYVENT--VGDPREHVYQMITFNEF----GHAFLCEKRRVSGVFLENLELNHFPFDVQDLTI-IVATTLSSSEIRLVNDPDEPHRINKQSFVDEQEWFLYKNIESE--QKDMIFEYADPLSVRPALLVQCRAARRPAYFLWNLFLVTFLICSLSLVTFAVDKDLPQNRLQLSYTLVLTLIAFKFVVNQCLPKISYLTYLDKYIISNLFFLTLVCAWHGL 1087
            + I  ID + E    +T  +  +  WR+  L +++  LN         +L+V +T  + D +  V+ +   N          +    R++      ++L  +P D Q+ T+ I +   ++ +I      D+    N  + V + E   +  ++ +   K ++F         P L +  +  R   YF+   ++ + LI  LS V+F ++ D    R+ L  T VLT+      + + LPKI Y+  +D Y++    F+ +    + L
Sbjct:   66 IDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYNVIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGDD----NAVTGVTKIELPQFSIVDYKLITKKVVFSTGS----YPRLSLSFKLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFMALLEYAL 325          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Human
Match: GABRB2 (gamma-aminobutyric acid type A receptor beta2 subunit [Source:HGNC Symbol;Acc:HGNC:4082])

HSP 1 Score: 55.0694 bits (131), Expect = 1.615e-7
Identity = 57/268 (21.27%), Postives = 114/268 (42.54%), Query Frame = 2
Query:  320 LKIGEIDTIKE---QFTADIIVKAKWREPSLDFHIDGLNYDWSKCWTPKLYVENT--VGDPREHVYQMITFNEF----GHAFLCEKRRVSGVFLENLELNHFPFDVQDLTI-IVATTLSSSEIRLVNDPDEPHRINKQSFVDEQEWFLYKNIESE--QKDMIFEYADPLSVRPALLVQCRAARRPAYFLWNLFLVTFLICSLSLVTFAVDKDLPQNRLQLSYTLVLTLIAFKFVVNQCLPKISYLTYLDKYIISNLFFLTLVCAWHGL 1087
            + I  ID + E    +T  +  +  WR+  L +++  LN         +L+V +T  + D +  V+ +   N          +    R++      ++L  +P D Q+ T+ I +   ++ +I      D+    N  + V + E   +  ++ +   K ++F         P L +  +  R   YF+   ++ + LI  LS V+F ++ D    R+ L  T VLT+      + + LPKI Y+  +D Y++    F+ +    + L
Sbjct:   66 IDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYNVIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGDD----NAVTGVTKIELPQFSIVDYKLITKKVVFSTGS----YPRLSLSFKLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFMALLEYAL 325          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Human
Match: GABRB2 (gamma-aminobutyric acid type A receptor beta2 subunit [Source:HGNC Symbol;Acc:HGNC:4082])

HSP 1 Score: 55.0694 bits (131), Expect = 1.735e-7
Identity = 58/271 (21.40%), Postives = 112/271 (41.33%), Query Frame = 2
Query:  320 LKIGEIDTIKE---QFTADIIVKAKWREPSLDFHIDGLNYDWS-----KCWTPKLYVENTVGDPREHVYQMITFNEF----GHAFLCEKRRVSGVFLENLELNHFPFDVQDLTI-IVATTLSSSEIRLVNDPDEPHRINKQSFVDEQEWFLYKNIESE--QKDMIFEYADPLSVRPALLVQCRAARRPAYFLWNLFLVTFLICSLSLVTFAVDKDLPQNRLQLSYTLVLTLIAFKFVVNQCLPKISYLTYLDKYIISNLFFLTLVCAWHGL 1087
            + I  ID + E    +T  +  +  WR+  L +++  LN         + W P  Y  N   D +  V+ +   N          +    R++      ++L  +P D Q+ T+ I +   ++ +I      D+    N  + V + E   +  ++ +   K ++F         P L +  +  R   YF+   ++ + LI  LS V+F ++ D    R+ L  T VLT+      + + LPKI Y+  +D Y++    F+ +    + L
Sbjct:   66 IDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYNVIPLNLTLDNRVADQLWVPDTYFLN---DKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGDD----NAVTGVTKIELPQFSIVDYKLITKKVVFSTGS----YPRLSLSFKLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFMALLEYAL 325          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Human
Match: GABRB2 (gamma-aminobutyric acid type A receptor beta2 subunit [Source:HGNC Symbol;Acc:HGNC:4082])

HSP 1 Score: 55.0694 bits (131), Expect = 1.735e-7
Identity = 58/271 (21.40%), Postives = 112/271 (41.33%), Query Frame = 2
Query:  320 LKIGEIDTIKE---QFTADIIVKAKWREPSLDFHIDGLNYDWS-----KCWTPKLYVENTVGDPREHVYQMITFNEF----GHAFLCEKRRVSGVFLENLELNHFPFDVQDLTI-IVATTLSSSEIRLVNDPDEPHRINKQSFVDEQEWFLYKNIESE--QKDMIFEYADPLSVRPALLVQCRAARRPAYFLWNLFLVTFLICSLSLVTFAVDKDLPQNRLQLSYTLVLTLIAFKFVVNQCLPKISYLTYLDKYIISNLFFLTLVCAWHGL 1087
            + I  ID + E    +T  +  +  WR+  L +++  LN         + W P  Y  N   D +  V+ +   N          +    R++      ++L  +P D Q+ T+ I +   ++ +I      D+    N  + V + E   +  ++ +   K ++F         P L +  +  R   YF+   ++ + LI  LS V+F ++ D    R+ L  T VLT+      + + LPKI Y+  +D Y++    F+ +    + L
Sbjct:   66 IDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYNVIPLNLTLDNRVADQLWVPDTYFLN---DKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGDD----NAVTGVTKIELPQFSIVDYKLITKKVVFSTGS----YPRLSLSFKLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFMALLEYAL 325          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Celegans
Match: gab-1 (Gamma-aminobutyric acid receptor subunit beta [Source:UniProtKB/Swiss-Prot;Acc:O18276])

HSP 1 Score: 62.003 bits (149), Expect = 4.344e-10
Identity = 72/279 (25.81%), Postives = 125/279 (44.80%), Query Frame = 2
Query:  263 PTAGDDTLKKRQVYICVVFLKIGEIDTIKEQFTADIIVKAKWREPSL----DFHID--GLNYDWSK-CWTPKLYVENTVGDPREHVYQMITFNEFGHAFLCEK----RRVSGVFLENLELNHFPFDVQDLTI-IVATTLSSSEIRLV-NDPDEPHRINKQSFVDEQEWFLYKNIESEQKDMIFEYADPLSVRPALLVQCRAARRPAYFLWNLFLVTFLICSLSLVTFAVDKDLPQNRLQLSYTLVLTLIAFKFVVNQCLPKISYLTYLDKYIISNLFFL 1060
            P  G D L      I   F  I E+D     +T  + +   W +  L    +  ID   L+ ++S+  W P  ++ N   D   +++++   N+     +  K     R++     ++ L +FP D Q+ T+ I +   ++SE+ +  N P   H + +Q+ V +   F      +E  D I   A     R +L+ Q R  R   YF++  +L   LI  LS V+F ++ +    R+ L  T VLT+      V Q LP+ISY+  +D Y++    F+
Sbjct:   71 PGFGGDALLLTMDIIIASFDSISEVDM---DYTLTMYLHQYWTDERLRWSNEIPIDEMTLSGEFSQNIWVPDTFLAN---DKHSYLHEVTERNKMLRINVDGKVAYGMRLTSTLSCSMNLRNFPLDSQNCTVEIESYGYTTSEVLMKWNYPLAVHGV-EQADVPQ---FTITGFHTE--DSIVSTATGSYQRLSLVFQLR--RSVGYFIFQTYLPCVLIVMLSWVSFWINHEATSARVALGITTVLTMTTISTGVRQSLPRISYVKSIDIYLVMCFVFV 335          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Celegans
Match: lgc-18 (Ligand-Gated ion Channel [Source:UniProtKB/TrEMBL;Acc:Q22084])

HSP 1 Score: 58.151 bits (139), Expect = 5.782e-9
Identity = 62/286 (21.68%), Postives = 120/286 (41.96%), Query Frame = 2
Query:  263 PTAGDDTLKKRQVY-ICVVFLKIGEIDTIKEQFTADIIVKAKWREP------SLDFHIDGLNYDWSKCWTP--KLYVENTVGDPREHVYQMITFNEFGHAFLCEKRRVSGVFLENLELNHFPFDVQDLTIIVATTLS-SSEIRLVNDPDEPHRINKQSFVDEQEWFLYKNIESEQKDM-----IFEYADPLSVRPALLVQCRAARRPAYFLWNLFLVTFLICSLSLVTFAVDKDLPQNRLQLSYTLVLTLIAFKFVVNQCLPKISYLTYLDKYIISNLFFLTLVCA 1075
            P   +    KR  Y + + +LK+ E+   +E+ +  + +   W +P      SL   I  L+    K W+P   L+  N + D R+  ++M+     GH +     ++S      L+++ FP+D Q   I     L    ++ + +   E         ++   W    N E E  ++     +  Y D L        + R  R P Y+++ +   +F+I +LS++   + K    ++L +  T ++T+     V+   +PK   +  L  YII NLF + +   
Sbjct:   61 PIGYNPLAPKRFNYTVSLYYLKLVEVIEPEEKVSVVLEMAEYWYDPRIAWDSSLYGDIKMLHMRQDKVWSPTLSLFRINDIADFRDPDFRMVCVENTGHTYTTLSVKIS--LNCPLDVSMFPYDSQTCRIQFNMPLFFMQQVEMFSQIYE-------GILNSTVWEKMGNSEWELANLTHSVELLSYGDGLGDMQLATFEIRIRRNPMYYIYMIIFPSFIINALSIIGVFLKKTDKMSKLNVGLTNIMTMTFILGVMADKIPKTGSIPLLGIYIIVNLFIMIVAVG 337          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Celegans
Match: deg-3 (Acetylcholine receptor subunit alpha-type deg-3 [Source:UniProtKB/Swiss-Prot;Acc:P54244])

HSP 1 Score: 56.225 bits (134), Expect = 3.552e-8
Identity = 59/264 (22.35%), Postives = 115/264 (43.56%), Query Frame = 2
Query:  278 DTLKKRQVYICVVFLKIGEIDTIKEQFTADIIVKAKWREPSLDFH------IDGLNYDWSKCWTPKLYVENTVGDPREHVYQMITFNEFGHAFLCEKRR-----VSGVFLENLELN--HFPFDVQDLTIIVAT-TLSSSEIRLVNDPDEPHRINKQSFVDEQEWFLYKNIESEQKDMIFEYADPLSVRPALLVQCRAA--RRPAYFLWNLFLVTFLICSLSLVTF---AVDKDLPQNRLQLSYTLVLTLIAFKFVVNQCLPKIS 1012
            D  K  +V+I +   +I E+D   +    ++ +  KWR+  LD++      I+     +   W P  Y+ N+V   R+   + +      + +  EK          ++     LN   FP+D Q+ T+ +++ T S S +    D +    ++ QSF+  +EW + K+ +  +     EY       P +++Q      R+P Y+L NL + T +I  +++  F   A   D    ++ L  T +L +     +V+  +P  S
Sbjct:   73 DHKKSLKVHISISLYQIIEVDEPSQNIKLNVWMIQKWRDEYLDWNPNEYGMINSTIIPFHHLWIPDTYLYNSVKMSRDETERYMNIQATSNYWKGEKGAELSFLYPAIYTITCRLNIRFFPYDRQNCTLTISSWTNSKSALDYYADTE----VSMQSFIPNEEWQV-KSFKIHRH----EYKYACCAEPWVILQASLVIQRKPLYYLVNLIIPTSIITLVAITGFFTPASTDDDRTEKINLGITTLLAMSILMLMVSDQMPTTS 327          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Celegans
Match: deg-3 (Acetylcholine receptor subunit alpha-type deg-3 [Source:UniProtKB/Swiss-Prot;Acc:P54244])

HSP 1 Score: 56.225 bits (134), Expect = 3.552e-8
Identity = 59/264 (22.35%), Postives = 115/264 (43.56%), Query Frame = 2
Query:  278 DTLKKRQVYICVVFLKIGEIDTIKEQFTADIIVKAKWREPSLDFH------IDGLNYDWSKCWTPKLYVENTVGDPREHVYQMITFNEFGHAFLCEKRR-----VSGVFLENLELN--HFPFDVQDLTIIVAT-TLSSSEIRLVNDPDEPHRINKQSFVDEQEWFLYKNIESEQKDMIFEYADPLSVRPALLVQCRAA--RRPAYFLWNLFLVTFLICSLSLVTF---AVDKDLPQNRLQLSYTLVLTLIAFKFVVNQCLPKIS 1012
            D  K  +V+I +   +I E+D   +    ++ +  KWR+  LD++      I+     +   W P  Y+ N+V   R+   + +      + +  EK          ++     LN   FP+D Q+ T+ +++ T S S +    D +    ++ QSF+  +EW + K+ +  +     EY       P +++Q      R+P Y+L NL + T +I  +++  F   A   D    ++ L  T +L +     +V+  +P  S
Sbjct:   73 DHKKSLKVHISISLYQIIEVDEPSQNIKLNVWMIQKWRDEYLDWNPNEYGMINSTIIPFHHLWIPDTYLYNSVKMSRDETERYMNIQATSNYWKGEKGAELSFLYPAIYTITCRLNIRFFPYDRQNCTLTISSWTNSKSALDYYADTE----VSMQSFIPNEEWQV-KSFKIHRH----EYKYACCAEPWVILQASLVIQRKPLYYLVNLIIPTSIITLVAITGFFTPASTDDDRTEKINLGITTLLAMSILMLMVSDQMPTTS 327          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Celegans
Match: pbo-5 (Proton-gated ion channel subunit pbo-5 [Source:UniProtKB/Swiss-Prot;Acc:G5ECT0])

HSP 1 Score: 55.4546 bits (132), Expect = 5.384e-8
Identity = 64/275 (23.27%), Postives = 113/275 (41.09%), Query Frame = 2
Query:  335 IDTIKEQFTADIIVKAKWREPSLDFHIDGLNYDWSKCWTP--KLYVENTVGDPREHVYQMITFNEFGHAFLCEKRRVSG--------------VFLENLELN--HFPFDVQDLTIIVAT-TLSSSEIRLVNDPDEPHRINKQSFVDEQEWFLYKNIESEQKDMIFEYADPLSVRPALLVQCRAARRPAYFLWNLFLVTFLICSLSLVT----FAVDKDLPQNRLQLSYTLVLTLIAFKFVVNQCLPKIS-YLTYLDKYIISNLFFLTLVCAWHGL 1087
            ID +K+  T  I V   W +PSL +    L    +K W P  K++V + +      V+ M+  N   H  L    R                 V   + E+N  HFP D Q   I +A+      +IRL    D     + + +   +EW L     SE+K     Y         +  +    RRP +++  L   ++++C++S+V     F+   +  + R  L  T +LT+     VV++ +P  S ++  L  Y + N+  +++     G+
Sbjct:  102 IDELKQTMTVLIYVDEHWVDPSLTWD-PALFGGITKTWIPLDKIWVPDII------VFNMVKSNRLAHEDLLSAVRAPARIHYNGTIVASHPAVHTVSCEINIRHFPLDDQRCAIEIASWAYGQEKIRLHAHTDH----SLEHYKRNEEWHLLNLNVSEEK-----YEHEGVEVSEVKFEISLKRRPLFYMVTLTFPSYIMCAISVVGLFARFSTTGER-EERFTLGVTAILTMAVLSLVVSEKVPHSSTHVPLLVAYFLFNMVIVSIAAMTTGI 359          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Fly
Match: Lcch3 (gene:FBgn0010240 transcript:FBtr0074129)

HSP 1 Score: 60.077 bits (144), Expect = 2.510e-9
Identity = 64/272 (23.53%), Postives = 112/272 (41.18%), Query Frame = 2
Query:  320 LKIGEIDTIKE---QFTADIIVKAKWREPSLDFHIDGLNYD-----------------WSKCWTPKLYVENTVGDPREHVYQMITFNEF----GHAFLCEKRRVSGVFLENLELNHFPFDVQDLTI-IVATTLSSSEIRLVNDPDEPHRINKQSFVDEQEWFLYKNIESEQKDMIFEYADPLSVRPALLVQCRAARRPAYFLWNLFLVTFLICSLSLVTFAVDKDLPQNRLQLSYTLVLTLIAFKFVVNQCLPKISYLTYLDKYIISNLFFL 1060
            L I   D I E    +T  + +   WR+  L F+I G  +D                   K W P  +  N   D    ++ +   N+     G   +    R +      ++L+++P D Q+ T+ I +   + S++ +   P  P R      V++ E   +  I  E  D     A  +  R +L  + +  R   YF++  +L + LI  LS V+F ++ +    R+ L  T VLT+      V   LP+ISY+  +D Y++    F+
Sbjct:   70 LTIASFDAISEVNMDYTITMYLNQYWRDERLAFNIFGQYFDDENDDGISDVLTLSGDFAEKIWVPDTFFAN---DKNSFLHDVTERNKLVRLGGDGAVTYGMRFTTTLACMMDLHYYPLDSQNCTVEIESYGYTVSDVVMYWKP-TPVR-----GVEDAELPQFTIIGYETNDRKERLATGVYQRLSLSFKLQ--RNIGYFVFQTYLPSILIVMLSWVSFWINHEATSARVALGITTVLTMTTISTGVRSSLPRISYVKAIDIYLVMCFVFV 330          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Zebrafish
Match: glra1 (glycine receptor, alpha 1 [Source:NCBI gene;Acc:30676])

HSP 1 Score: 55.0694 bits (131), Expect = 9.843e-8
Identity = 60/264 (22.73%), Postives = 116/264 (43.94%), Query Frame = 2
Query:  308 CVVFL-KIGEIDTIKEQFTADIIVKAKWREPSL---DFHIDGLNYDWS---KCWTPKLYVENTVGDPREHVYQMITFNEF----GHAFLCEKRRVSGVFLENLELNHFPFDVQDLTIIVATTLSSSEIRLVNDPDEPHRINKQSFVDEQEWFLYKNIESEQKDMIFEYADPLSVRPALLVQCR--AARRPAYFLWNLFLVTFLICSLSLVTFAVDKDLPQNRLQLSYTLVLTLIAFKFVVNQCLPKISYLTYLDKYIISNLFFL 1060
            C +F+   G I      +  +I ++ +W +P L   ++  D L+ D S     W P L+  N  G    + +++ T N+      +  +    R++ V    ++L +FP DVQ   I+   +   +   L+ + DE   +     +   ++ L      E+KD+ +      +      ++ R    R+  Y+L  +++ + LI  LS V+F ++ D    R+ L  T VLT+          LPK+SY+  +D ++   L F+
Sbjct:   80 CNIFINSFGSIAETTMDYRVNIFLRQQWNDPRLAYSEYPDDSLDLDPSMLDSIWKPDLFFANEKG---ANFHEVTTDNKLLRISKNGNVLYSIRITLVLACPMDLKNFPMDVQT-CIMQLESFGYTMNDLIFEWDEKGAVQVADGLTLPQFIL-----KEEKDLRY-CTKHYNTGKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFV 333          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Zebrafish
Match: glra1 (glycine receptor, alpha 1 [Source:NCBI gene;Acc:30676])

HSP 1 Score: 55.0694 bits (131), Expect = 9.895e-8
Identity = 60/264 (22.73%), Postives = 116/264 (43.94%), Query Frame = 2
Query:  308 CVVFL-KIGEIDTIKEQFTADIIVKAKWREPSL---DFHIDGLNYDWS---KCWTPKLYVENTVGDPREHVYQMITFNEF----GHAFLCEKRRVSGVFLENLELNHFPFDVQDLTIIVATTLSSSEIRLVNDPDEPHRINKQSFVDEQEWFLYKNIESEQKDMIFEYADPLSVRPALLVQCR--AARRPAYFLWNLFLVTFLICSLSLVTFAVDKDLPQNRLQLSYTLVLTLIAFKFVVNQCLPKISYLTYLDKYIISNLFFL 1060
            C +F+   G I      +  +I ++ +W +P L   ++  D L+ D S     W P L+  N  G    + +++ T N+      +  +    R++ V    ++L +FP DVQ   I+   +   +   L+ + DE   +     +   ++ L      E+KD+ +      +      ++ R    R+  Y+L  +++ + LI  LS V+F ++ D    R+ L  T VLT+          LPK+SY+  +D ++   L F+
Sbjct:   78 CNIFINSFGSIAETTMDYRVNIFLRQQWNDPRLAYSEYPDDSLDLDPSMLDSIWKPDLFFANEKG---ANFHEVTTDNKLLRISKNGNVLYSIRITLVLACPMDLKNFPMDVQT-CIMQLESFGYTMNDLIFEWDEKGAVQVADGLTLPQFIL-----KEEKDLRY-CTKHYNTGKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFV 331          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Zebrafish
Match: glra1 (glycine receptor, alpha 1 [Source:NCBI gene;Acc:30676])

HSP 1 Score: 55.0694 bits (131), Expect = 1.122e-7
Identity = 60/264 (22.73%), Postives = 116/264 (43.94%), Query Frame = 2
Query:  308 CVVFL-KIGEIDTIKEQFTADIIVKAKWREPSL---DFHIDGLNYDWS---KCWTPKLYVENTVGDPREHVYQMITFNEF----GHAFLCEKRRVSGVFLENLELNHFPFDVQDLTIIVATTLSSSEIRLVNDPDEPHRINKQSFVDEQEWFLYKNIESEQKDMIFEYADPLSVRPALLVQCR--AARRPAYFLWNLFLVTFLICSLSLVTFAVDKDLPQNRLQLSYTLVLTLIAFKFVVNQCLPKISYLTYLDKYIISNLFFL 1060
            C +F+   G I      +  +I ++ +W +P L   ++  D L+ D S     W P L+  N  G    + +++ T N+      +  +    R++ V    ++L +FP DVQ   I+   +   +   L+ + DE   +     +   ++ L      E+KD+ +      +      ++ R    R+  Y+L  +++ + LI  LS V+F ++ D    R+ L  T VLT+          LPK+SY+  +D ++   L F+
Sbjct:   65 CNIFINSFGSIAETTMDYRVNIFLRQQWNDPRLAYSEYPDDSLDLDPSMLDSIWKPDLFFANEKG---ANFHEVTTDNKLLRISKNGNVLYSIRITLVLACPMDLKNFPMDVQT-CIMQLESFGYTMNDLIFEWDEKGAVQVADGLTLPQFIL-----KEEKDLRY-CTKHYNTGKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFV 318          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Zebrafish
Match: glra4a (glycine receptor, alpha 4a [Source:ZFIN;Acc:ZDB-GENE-010410-3])

HSP 1 Score: 52.373 bits (124), Expect = 8.623e-7
Identity = 58/274 (21.17%), Postives = 118/274 (43.07%), Query Frame = 2
Query:  308 CVVFL-KIGEIDTIKEQFTADIIVKAKWREPSL---DFHIDGLNYDWS---KCWTPKLYVENTVGDPREHVYQMITFNE----FGHAFLCEKRRVSGVFLENLELNHFPFDVQDLTI-----------IVATTLSSSEIRLVNDPDEPHRINKQSFVDEQEWFLYKNIESEQKDMIFEYADPLSVR-PALLVQCRAARRPAYFLWNLFLVTFLICSLSLVTFAVDKDLPQNRLQLSYTLVLTLIAFKFVVNQCLPKISYLTYLDKYIISNLFFL 1060
            C +F+   G I      +  ++ ++ +W +P L   ++    L+ D S     W P L+  N  G    + +++ T N+    F +  +    R++ +    ++L +FP D+Q  T+           ++   LS + +++ +D   P  + K                 E+KD+ +      + +   + V+    R+  Y+L  +++ + LI  LS V+F ++ D    R+ L  T VLT+          LPK+SY+  +D ++   L F+
Sbjct:   75 CNIFINSFGSITETTMDYRLNVFLRQQWNDPRLAYSEYPDASLDLDPSMLDSIWKPDLFFANEKG---ANFHEVTTDNKLLRIFQNGNVLYSIRLTLILSCPMDLKNFPMDIQTCTMQLESFGYTMNDLIFEWLSDNPVQVADDLTLPQFVLK-----------------EEKDLGYCTKHYNTGKFTCIEVKFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFV 328          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Zebrafish
Match: glra4a (glycine receptor, alpha 4a [Source:ZFIN;Acc:ZDB-GENE-010410-3])

HSP 1 Score: 52.373 bits (124), Expect = 8.930e-7
Identity = 58/274 (21.17%), Postives = 118/274 (43.07%), Query Frame = 2
Query:  308 CVVFL-KIGEIDTIKEQFTADIIVKAKWREPSL---DFHIDGLNYDWS---KCWTPKLYVENTVGDPREHVYQMITFNE----FGHAFLCEKRRVSGVFLENLELNHFPFDVQDLTI-----------IVATTLSSSEIRLVNDPDEPHRINKQSFVDEQEWFLYKNIESEQKDMIFEYADPLSVR-PALLVQCRAARRPAYFLWNLFLVTFLICSLSLVTFAVDKDLPQNRLQLSYTLVLTLIAFKFVVNQCLPKISYLTYLDKYIISNLFFL 1060
            C +F+   G I      +  ++ ++ +W +P L   ++    L+ D S     W P L+  N  G    + +++ T N+    F +  +    R++ +    ++L +FP D+Q  T+           ++   LS + +++ +D   P  + K                 E+KD+ +      + +   + V+    R+  Y+L  +++ + LI  LS V+F ++ D    R+ L  T VLT+          LPK+SY+  +D ++   L F+
Sbjct:   75 CNIFINSFGSITETTMDYRLNVFLRQQWNDPRLAYSEYPDASLDLDPSMLDSIWKPDLFFANEKG---ANFHEVTTDNKLLRIFQNGNVLYSIRLTLILSCPMDLKNFPMDIQTCTMQLESFGYTMNDLIFEWLSDNPVQVADDLTLPQFVLK-----------------EEKDLGYCTKHYNTGKFTCIEVKFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFV 328          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000020832.1 (gamma-aminobutyric acid type A receptor theta subunit [Source:NCBI gene;Acc:100496398])

HSP 1 Score: 55.4546 bits (132), Expect = 1.342e-7
Identity = 60/281 (21.35%), Postives = 114/281 (40.57%), Query Frame = 2
Query:  263 PTAGDDTLKKRQVYICVVFLKIGEIDTIKEQFTADIIVKAKWREPSLDFHIDGLNYDWS-----KCWTPKLYVENTVGDPREHVYQMITFNEF----GHAFLCEKRRVSGVFLENLELNHFPFDVQDLTI-IVATTLSSSEIRLVNDPDEPHRINKQSFVDEQEWFLYKNIESE--QKDMIFEYADPLSVRPALLVQCRAARRPAYFLWNLFLVTFLICSLSLVTFAVDKDLPQNRLQLSYTLVLTLIAFKFVVNQCLPKISYLTYLDKYIISNLFFLTLV 1069
            P  G D +    V + +    I +I  +   +T  +  +  WR+  L +    LN         + W P  Y  N   D +  ++ +   N          +    R++      ++L  +P D Q+ T+ I +   +  +I+      E   +   S ++  ++ +   IE+    K+++F         P L +  R  R   YF+   ++ + LI  LS V+F ++ D    R+ L  T VLT+      + + LPKI Y+  +D Y++    F+ L 
Sbjct:   59 PDFGGDPV---SVGMSIHISSIDQISEVNMDYTITMYFQQSWRDKRLAYTALPLNLTLDNRVADQLWLPDTYFLN---DKKSFLHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDQQNCTLEIESYGYTIDDIKFFWQGGEEAAVTGVSALELPQFTI---IETRLVSKNVVFTTGS----YPRLSLSFRIKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGVTTVLTMTTINTHLRETLPKIPYVKAIDVYLMGCFVFVFLA 326          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000020814.1 (gamma-aminobutyric acid type A receptor theta subunit [Source:NCBI gene;Acc:100496398])

HSP 1 Score: 55.0694 bits (131), Expect = 1.701e-7
Identity = 60/281 (21.35%), Postives = 114/281 (40.57%), Query Frame = 2
Query:  263 PTAGDDTLKKRQVYICVVFLKIGEIDTIKEQFTADIIVKAKWREPSLDFHIDGLNYDWS-----KCWTPKLYVENTVGDPREHVYQMITFNEF----GHAFLCEKRRVSGVFLENLELNHFPFDVQDLTI-IVATTLSSSEIRLVNDPDEPHRINKQSFVDEQEWFLYKNIESE--QKDMIFEYADPLSVRPALLVQCRAARRPAYFLWNLFLVTFLICSLSLVTFAVDKDLPQNRLQLSYTLVLTLIAFKFVVNQCLPKISYLTYLDKYIISNLFFLTLV 1069
            P  G D +    V + +    I +I  +   +T  +  +  WR+  L +    LN         + W P  Y  N   D +  ++ +   N          +    R++      ++L  +P D Q+ T+ I +   +  +I+      E   +   S ++  ++ +   IE+    K+++F         P L +  R  R   YF+   ++ + LI  LS V+F ++ D    R+ L  T VLT+      + + LPKI Y+  +D Y++    F+ L 
Sbjct:   42 PDFGGDPV---SVGMSIHISSIDQISEVNMDYTITMYFQQSWRDKRLAYTALPLNLTLDNRVADQLWLPDTYFLN---DKKSFLHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDQQNCTLEIESYGYTIDDIKFFWQGGEEAAVTGVSALELPQFTI---IETRLVSKNVVFTTGS----YPRLSLSFRIKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGVTTVLTMTTINTHLRETLPKIPYVKAIDVYLMGCFVFVFLA 309          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000004017.1 (gamma-aminobutyric acid (GABA) A receptor, beta 1 [Source:NCBI gene;Acc:100489344])

HSP 1 Score: 55.0694 bits (131), Expect = 1.847e-7
Identity = 57/262 (21.76%), Postives = 106/262 (40.46%), Query Frame = 2
Query:  320 LKIGEIDTIKE---QFTADIIVKAKWREPSLDFHIDGLNYDWS-----KCWTPKLYVENTVGDPREHVYQMITFNEF----GHAFLCEKRRVSGVFLENLELNHFPFDVQDLTI-IVATTLSSSEIRLVNDPDEPHRINKQSFVDEQEWFLYKNIESEQKDMIFEYADPLSVRPALLVQCRAARRPAYFLWNLFLVTFLICSLSLVTFAVDKDLPQNRLQLSYTLVLTLIAFKFVVNQCLPKISYLTYLDKYIISNLFFLTL 1066
            + +  ID + E    +T  +  +  WR+  L +    LN         + W P  Y  N   D R  V+ +   N          +    R++      ++L  +P D Q+ T+ I +   ++ +I+   +  +      +    E   F   + +   +++IF         P L +  R  R   YF+   ++ + LI  LS V+F ++ D    R+ L  T VLT+      + + LPKI Y+  +D Y++    F+ L
Sbjct:   67 IDVASIDMVSEVNMDYTLTMYFQQSWRDKRLSYSGIPLNLTLDNRVADQLWVPDTYFLN---DKRSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIKFYWNGGDKAITGVEKI--ELPQFSIIDYKMVSRNVIFS----TGAYPRLSLSFRLKRNIGYFILQTYMPSTLITILSWVSFWINYDASAARVALGITTVLTMTTISTHLRETLPKIPYVKAIDIYLMGCFVFVFL 319          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Xenopus
Match: GLRA1 (glycine receptor alpha 1 [Source:NCBI gene;Acc:100498379])

HSP 1 Score: 54.299 bits (129), Expect = 2.678e-7
Identity = 60/264 (22.73%), Postives = 116/264 (43.94%), Query Frame = 2
Query:  308 CVVFL-KIGEIDTIKEQFTADIIVKAKWREPSL---DFHIDGLNYDWS---KCWTPKLYVENTVGDPREHVYQMITFNE----FGHAFLCEKRRVSGVFLENLELNHFPFDVQDLTIIVATTLSSSEIRLVNDPDEPHRINKQSFVDEQEWFLYKNIESEQKDMIFEYADPLSVRPALLVQCR--AARRPAYFLWNLFLVTFLICSLSLVTFAVDKDLPQNRLQLSYTLVLTLIAFKFVVNQCLPKISYLTYLDKYIISNLFFL 1060
            C +F+   G I      +  +I ++ +W +P L   ++  D L+ D S     W P L+  N  G    + +++ T N+    F +  +    R++      ++L +FP DVQ   I+   +   +   L+ + +E   +     +   ++ L      E+KD+ +      S      ++ R    R+  Y+L  +++ + LI  LS V+F ++ D    R+ L  T VLT+          LPK+SY+  +D ++   L F+
Sbjct:   63 CNIFINSFGSIAETTMDYRLNIFLRQQWNDPRLAYSEYPDDSLDLDPSMLDSIWKPDLFFANEKG---ANFHEITTDNKLLRIFKNGNVLYSIRLTLTLACPMDLKNFPMDVQT-CIMQLESFGYTMNDLIFEWEEVGAVQVAEGLTLPQFIL-----KEEKDLRY-CTKHYSTGKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFV 316          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Xenopus
Match: GLRA1 (glycine receptor alpha 1 [Source:NCBI gene;Acc:100498379])

HSP 1 Score: 54.299 bits (129), Expect = 3.212e-7
Identity = 60/264 (22.73%), Postives = 116/264 (43.94%), Query Frame = 2
Query:  308 CVVFL-KIGEIDTIKEQFTADIIVKAKWREPSL---DFHIDGLNYDWS---KCWTPKLYVENTVGDPREHVYQMITFNE----FGHAFLCEKRRVSGVFLENLELNHFPFDVQDLTIIVATTLSSSEIRLVNDPDEPHRINKQSFVDEQEWFLYKNIESEQKDMIFEYADPLSVRPALLVQCR--AARRPAYFLWNLFLVTFLICSLSLVTFAVDKDLPQNRLQLSYTLVLTLIAFKFVVNQCLPKISYLTYLDKYIISNLFFL 1060
            C +F+   G I      +  +I ++ +W +P L   ++  D L+ D S     W P L+  N  G    + +++ T N+    F +  +    R++      ++L +FP DVQ   I+   +   +   L+ + +E   +     +   ++ L      E+KD+ +      S      ++ R    R+  Y+L  +++ + LI  LS V+F ++ D    R+ L  T VLT+          LPK+SY+  +D ++   L F+
Sbjct:   87 CNIFINSFGSIAETTMDYRLNIFLRQQWNDPRLAYSEYPDDSLDLDPSMLDSIWKPDLFFANEKG---ANFHEITTDNKLLRIFKNGNVLYSIRLTLTLACPMDLKNFPMDVQT-CIMQLESFGYTMNDLIFEWEEVGAVQVAEGLTLPQFIL-----KEEKDLRY-CTKHYSTGKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFV 340          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Mouse
Match: Gabrb2 (gamma-aminobutyric acid (GABA) A receptor, subunit beta 2 [Source:MGI Symbol;Acc:MGI:95620])

HSP 1 Score: 55.0694 bits (131), Expect = 1.148e-7
Identity = 58/271 (21.40%), Postives = 112/271 (41.33%), Query Frame = 2
Query:  320 LKIGEIDTIKE---QFTADIIVKAKWREPSLDFHIDGLNYDWS-----KCWTPKLYVENTVGDPREHVYQMITFNEF----GHAFLCEKRRVSGVFLENLELNHFPFDVQDLTI-IVATTLSSSEIRLVNDPDEPHRINKQSFVDEQEWFLYKNIESE--QKDMIFEYADPLSVRPALLVQCRAARRPAYFLWNLFLVTFLICSLSLVTFAVDKDLPQNRLQLSYTLVLTLIAFKFVVNQCLPKISYLTYLDKYIISNLFFLTLVCAWHGL 1087
            + I  ID + E    +T  +  +  WR+  L +++  LN         + W P  Y  N   D +  V+ +   N          +    R++      ++L  +P D Q+ T+ I +   ++ +I      D+    N  + V + E   +  ++ +   K ++F         P L +  +  R   YF+   ++ + LI  LS V+F ++ D    R+ L  T VLT+      + + LPKI Y+  +D Y++    F+ +    + L
Sbjct:   66 IDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYNVIPLNLTLDNRVADQLWVPDTYFLN---DKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGDD----NAVTGVTKIELPQFSIVDYKLITKKVVFSTGS----YPRLSLSFKLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFMALLEYAL 325          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Mouse
Match: Gabrb2 (gamma-aminobutyric acid (GABA) A receptor, subunit beta 2 [Source:MGI Symbol;Acc:MGI:95620])

HSP 1 Score: 55.0694 bits (131), Expect = 1.289e-7
Identity = 58/271 (21.40%), Postives = 112/271 (41.33%), Query Frame = 2
Query:  320 LKIGEIDTIKE---QFTADIIVKAKWREPSLDFHIDGLNYDWS-----KCWTPKLYVENTVGDPREHVYQMITFNEF----GHAFLCEKRRVSGVFLENLELNHFPFDVQDLTI-IVATTLSSSEIRLVNDPDEPHRINKQSFVDEQEWFLYKNIESE--QKDMIFEYADPLSVRPALLVQCRAARRPAYFLWNLFLVTFLICSLSLVTFAVDKDLPQNRLQLSYTLVLTLIAFKFVVNQCLPKISYLTYLDKYIISNLFFLTLVCAWHGL 1087
            + I  ID + E    +T  +  +  WR+  L +++  LN         + W P  Y  N   D +  V+ +   N          +    R++      ++L  +P D Q+ T+ I +   ++ +I      D+    N  + V + E   +  ++ +   K ++F         P L +  +  R   YF+   ++ + LI  LS V+F ++ D    R+ L  T VLT+      + + LPKI Y+  +D Y++    F+ +    + L
Sbjct:   66 IDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYNVIPLNLTLDNRVADQLWVPDTYFLN---DKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGDD----NAVTGVTKIELPQFSIVDYKLITKKVVFSTGS----YPRLSLSFKLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFMALLEYAL 325          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Mouse
Match: Glrb (glycine receptor, beta subunit [Source:MGI Symbol;Acc:MGI:95751])

HSP 1 Score: 51.9878 bits (123), Expect = 1.347e-6
Identity = 63/256 (24.61%), Postives = 106/256 (41.41%), Query Frame = 2
Query:  329 GEIDTIKEQFTADIIVKAKWREPSL----DFH-IDGLNYDWS--KC-WTPKLYVENTVGDPREHVYQM-ITFNEFGHAFLCEKRRVSGVFLENLELNHFPFDVQDLTIIVAT-TLSSSEIRLV---NDPDEPHRINKQSFVDEQEWFLYKNIESEQKDMIFEYADPLSVRPALLVQCRAARRPAYFLWNLFLVTFLICSLSLVTFAVDKDLPQNRLQLSYTLVLTLIAFKFVVNQCLPKISYLTYLDKYIISNLFF 1057
            G I      +  +I ++ KW +P L    DF   D L  D +  KC W P L+  N        V Q  I    F    +    R+S      L+L  FP D Q   + + +   ++ ++R +    DP +  +I    F  ++E   Y N          +Y         + V     R+  +++  ++  T LI  LS ++F ++ D    R+ L    VL+L +    +   LPK+SY+  LD ++I+ L F
Sbjct:   92 GSIQETTMDYRVNIFLRQKWNDPRLKLPSDFRGSDALTVDPTMYKCLWKPDLFFANEKSANFHDVTQENILLFIFRDGDVLVSMRLSITLSCPLDLTLFPMDTQRCKMQLESFGYTTDDLRFIWQSGDPVQLEKIALPQFDIKKEDIEYGNCT--------KYYKGTGYYTCVEVIFTLRRQVGFYMMGVYAPTLLIVVLSWLSFWINPDASAARVPLGIFSVLSLASECTTLAAELPKVSYVKALDVWLIACLLF 339          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Mouse
Match: Chrna1 (cholinergic receptor, nicotinic, alpha polypeptide 1 (muscle) [Source:MGI Symbol;Acc:MGI:87885])

HSP 1 Score: 51.6026 bits (122), Expect = 1.587e-6
Identity = 56/265 (21.13%), Postives = 116/265 (43.77%), Query Frame = 2
Query:  296 QVYICVVFLKIGEIDTIKEQFTADIIVKAKWREPSLDFHIDG------LNYDWSKCWTPKLYVENTV-GDPREHVYQMITFNEFGHAFLCEKRRVSGVFLENLEL--NHFPFDVQDLTIIVAT-TLSSSEIRLVNDPDEPHRINKQSFVDEQEWFLYKNIESEQKDMIFEYADPLSVRPALLVQCRAARRPAYFLWNLFLVTFLICSLSLVTFAVDKDLPQNRLQLSYTLVLTLIAFKFVVNQCLPKI-SYLTYLDKYIISNLFF 1057
            QV + +  +++  +D + +  T ++ +K +W + +L ++ D       ++    K W P + + N   GD     +  +  +  GH           +F    E+   HFPFD Q+ ++ + T T   S + +  + D+P   N   F++  EW + +      K  +F    P +    +       R P YF+ N+ +   L   L+ + F +  D    ++ LS +++L+L  F  V+ + +P   S +  + KY++  + F
Sbjct:   50 QVTVGLQLIQLINVDEVNQIVTTNVRLKQQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDVVLYNNADGDFAIVKFTKVLLDYTGHITWTPP----AIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSN---FMESGEWVIKE--ARGWKHWVFYSCCPTTPYLDITYHFVMQRLPLYFIVNVIIPCLLFSFLTSLVFYLPTD-SGEKMTLSISVLLSLTVFLLVIVELIPSTSSAVPLIGKYMLFTMVF 304          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Mouse
Match: Gabrb3 (gamma-aminobutyric acid (GABA) A receptor, subunit beta 3 [Source:MGI Symbol;Acc:MGI:95621])

HSP 1 Score: 50.8322 bits (120), Expect = 2.387e-6
Identity = 58/268 (21.64%), Postives = 111/268 (41.42%), Query Frame = 2
Query:  305 ICVVF-LKIGEIDTIKE---QFTADIIVKAKWREPSLDFHIDGLNYDWSKCWTPKLYVENT--VGDPREHVYQMITFNEF----GHAFLCEKRRVSGVFLENLELNHFPFDVQDLTI-IVATTLSSSEIRLVNDPDEPHRINKQSFVDEQEWFLYKNIESE--QKDMIFEYADPLSVRPALLVQCRAARRPAYFLWNLFLVTFLICSLSLVTFAVDKDLPQNRLQLSYTLVLTLIAFKFVVNQCLPKISYLTYLDKYIISNLFFLTLV 1069
            +CV   + I  ID + E    +T  +  +  WR+  L +    LN         +L+V +T  + D +  V+ +   N          +    R++      ++L  +P D Q+ T+ I +   ++ +I       +       + V+  E   +  +E     ++++F         P L +  R  R   YF+   ++ + LI  LS V+F ++ D    R+ L  T VLT+      + + LPKI Y+  +D Y++    F+ L 
Sbjct:   61 VCVGMNIDIASIDMVSEVNMDYTLTMYFQQYWRDKRLAYSGIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGGD----KAVTGVERIELPQFSIVEHRLVSRNVVFA----TGAYPRLSLSFRLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLA 320          
BLAST of Neur_chan_LBD domain-containing protein vs. UniProt/SwissProt
Match: sp|P0C7B7|ELIC_DICCH (Cys-loop ligand-gated ion channel OS=Dickeya chrysanthemi OX=556 PE=1 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 1.113e-12
Identity = 69/277 (24.91%), Postives = 129/277 (46.57%), Query Frame = 2
Query:  272 GDDTLKKRQVYICV-VFL-KIGEIDTIKEQFTADIIVKAKW----REPSLDFHIDGLNYD---W--SKCWTPKLYVENTVGDPREHVYQMITFNEFGHAFLCEKRRVSGVFLENLELNHFPFDVQDLTI-IVATTLSSSEIRLVNDPDEPHRINKQSFVDEQEWFLYKNIESEQKDMIFEYADPLSVRPA------LLVQCRAARRPAYFLWNLFLVTFLICSLSLVTFAVDKDLPQNRLQLSYTLVLTLIAFKFVVNQCLPKISYLTYLDKYIISN 1048
             D+    R V + V +F+ KI  ++T+++ +  D  + A+W    R+   D  +   N     W  +  W P L   N VG P     +++ F +     +    R  G F  +++   FPFD Q   + +   + ++ ++R  +       I+ +      EW++ K   +   D+ +++    SV+P       + V+  A R P+Y+LW+  L   LI + S   F ++      RLQ S+TL+LT++A+ F  +  LP++ Y T +D+ II+ 
Sbjct:    3 ADNAADARPVDVSVSIFINKIYGVNTLEQTYKVDGYIVAQWTGKPRKTPGDKPLIVENTQIERWINNGLWVPALEFINVVGSPDTGNKRLMLFPD---GRVIYNARFLGSFSNDMDFRLFPFDRQQFVLELEPFSYNNQQLRFSDIQVYTENIDNEEI---DEWWIRK-ASTHISDIRYDHLS--SVQPNQNEFSRITVRIDAVRNPSYYLWSFILPLGLIIAASWSVFWLESF--SERLQTSFTLMLTVVAYAFYTSNILPRLPYTTVIDQMIIAG 268          
BLAST of Neur_chan_LBD domain-containing protein vs. UniProt/SwissProt
Match: sp|O18276|GBRB_CAEEL (Gamma-aminobutyric acid receptor subunit beta OS=Caenorhabditis elegans OX=6239 GN=gab-1 PE=2 SV=3)

HSP 1 Score: 62.003 bits (149), Expect = 5.526e-9
Identity = 72/279 (25.81%), Postives = 125/279 (44.80%), Query Frame = 2
Query:  263 PTAGDDTLKKRQVYICVVFLKIGEIDTIKEQFTADIIVKAKWREPSL----DFHID--GLNYDWSK-CWTPKLYVENTVGDPREHVYQMITFNEFGHAFLCEK----RRVSGVFLENLELNHFPFDVQDLTI-IVATTLSSSEIRLV-NDPDEPHRINKQSFVDEQEWFLYKNIESEQKDMIFEYADPLSVRPALLVQCRAARRPAYFLWNLFLVTFLICSLSLVTFAVDKDLPQNRLQLSYTLVLTLIAFKFVVNQCLPKISYLTYLDKYIISNLFFL 1060
            P  G D L      I   F  I E+D     +T  + +   W +  L    +  ID   L+ ++S+  W P  ++ N   D   +++++   N+     +  K     R++     ++ L +FP D Q+ T+ I +   ++SE+ +  N P   H + +Q+ V +   F      +E  D I   A     R +L+ Q R  R   YF++  +L   LI  LS V+F ++ +    R+ L  T VLT+      V Q LP+ISY+  +D Y++    F+
Sbjct:   71 PGFGGDALLLTMDIIIASFDSISEVDM---DYTLTMYLHQYWTDERLRWSNEIPIDEMTLSGEFSQNIWVPDTFLAN---DKHSYLHEVTERNKMLRINVDGKVAYGMRLTSTLSCSMNLRNFPLDSQNCTVEIESYGYTTSEVLMKWNYPLAVHGV-EQADVPQ---FTITGFHTE--DSIVSTATGSYQRLSLVFQLR--RSVGYFIFQTYLPCVLIVMLSWVSFWINHEATSARVALGITTVLTMTTISTGVRQSLPRISYVKSIDIYLVMCFVFV 335          
BLAST of Neur_chan_LBD domain-containing protein vs. UniProt/SwissProt
Match: sp|Q08832|GBRB3_DROME (Gamma-aminobutyric acid receptor subunit beta-like OS=Drosophila melanogaster OX=7227 GN=Lcch3 PE=1 SV=2)

HSP 1 Score: 60.077 bits (144), Expect = 2.516e-8
Identity = 64/272 (23.53%), Postives = 112/272 (41.18%), Query Frame = 2
Query:  320 LKIGEIDTIKE---QFTADIIVKAKWREPSLDFHIDGLNYD-----------------WSKCWTPKLYVENTVGDPREHVYQMITFNEF----GHAFLCEKRRVSGVFLENLELNHFPFDVQDLTI-IVATTLSSSEIRLVNDPDEPHRINKQSFVDEQEWFLYKNIESEQKDMIFEYADPLSVRPALLVQCRAARRPAYFLWNLFLVTFLICSLSLVTFAVDKDLPQNRLQLSYTLVLTLIAFKFVVNQCLPKISYLTYLDKYIISNLFFL 1060
            L I   D I E    +T  + +   WR+  L F+I G  +D                   K W P  +  N   D    ++ +   N+     G   +    R +      ++L+++P D Q+ T+ I +   + S++ +   P  P R      V++ E   +  I  E  D     A  +  R +L  + +  R   YF++  +L + LI  LS V+F ++ +    R+ L  T VLT+      V   LP+ISY+  +D Y++    F+
Sbjct:   70 LTIASFDAISEVNMDYTITMYLNQYWRDERLAFNIFGQYFDDENDDGISDVLTLSGDFAEKIWVPDTFFAN---DKNSFLHDVTERNKLVRLGGDGAVTYGMRFTTTLACMMDLHYYPLDSQNCTVEIESYGYTVSDVVMYWKP-TPVR-----GVEDAELPQFTIIGYETNDRKERLATGVYQRLSLSFKLQ--RNIGYFVFQTYLPSILIVMLSWVSFWINHEATSARVALGITTVLTMTTISTGVRSSLPRISYVKAIDIYLVMCFVFV 330          
BLAST of Neur_chan_LBD domain-containing protein vs. UniProt/SwissProt
Match: sp|P54244|ACH3_CAEEL (Acetylcholine receptor subunit alpha-type deg-3 OS=Caenorhabditis elegans OX=6239 GN=deg-3 PE=1 SV=1)

HSP 1 Score: 56.225 bits (134), Expect = 4.518e-7
Identity = 59/264 (22.35%), Postives = 115/264 (43.56%), Query Frame = 2
Query:  278 DTLKKRQVYICVVFLKIGEIDTIKEQFTADIIVKAKWREPSLDFH------IDGLNYDWSKCWTPKLYVENTVGDPREHVYQMITFNEFGHAFLCEKRR-----VSGVFLENLELN--HFPFDVQDLTIIVAT-TLSSSEIRLVNDPDEPHRINKQSFVDEQEWFLYKNIESEQKDMIFEYADPLSVRPALLVQCRAA--RRPAYFLWNLFLVTFLICSLSLVTF---AVDKDLPQNRLQLSYTLVLTLIAFKFVVNQCLPKIS 1012
            D  K  +V+I +   +I E+D   +    ++ +  KWR+  LD++      I+     +   W P  Y+ N+V   R+   + +      + +  EK          ++     LN   FP+D Q+ T+ +++ T S S +    D +    ++ QSF+  +EW + K+ +  +     EY       P +++Q      R+P Y+L NL + T +I  +++  F   A   D    ++ L  T +L +     +V+  +P  S
Sbjct:   73 DHKKSLKVHISISLYQIIEVDEPSQNIKLNVWMIQKWRDEYLDWNPNEYGMINSTIIPFHHLWIPDTYLYNSVKMSRDETERYMNIQATSNYWKGEKGAELSFLYPAIYTITCRLNIRFFPYDRQNCTLTISSWTNSKSALDYYADTE----VSMQSFIPNEEWQV-KSFKIHRH----EYKYACCAEPWVILQASLVIQRKPLYYLVNLIIPTSIITLVAITGFFTPASTDDDRTEKINLGITTLLAMSILMLMVSDQMPTTS 327          
BLAST of Neur_chan_LBD domain-containing protein vs. UniProt/SwissProt
Match: sp|G5ECT0|PBO5_CAEEL (Proton-gated ion channel subunit pbo-5 OS=Caenorhabditis elegans OX=6239 GN=pbo-5 PE=1 SV=1)

HSP 1 Score: 55.4546 bits (132), Expect = 6.848e-7
Identity = 64/275 (23.27%), Postives = 113/275 (41.09%), Query Frame = 2
Query:  335 IDTIKEQFTADIIVKAKWREPSLDFHIDGLNYDWSKCWTP--KLYVENTVGDPREHVYQMITFNEFGHAFLCEKRRVSG--------------VFLENLELN--HFPFDVQDLTIIVAT-TLSSSEIRLVNDPDEPHRINKQSFVDEQEWFLYKNIESEQKDMIFEYADPLSVRPALLVQCRAARRPAYFLWNLFLVTFLICSLSLVT----FAVDKDLPQNRLQLSYTLVLTLIAFKFVVNQCLPKIS-YLTYLDKYIISNLFFLTLVCAWHGL 1087
            ID +K+  T  I V   W +PSL +    L    +K W P  K++V + +      V+ M+  N   H  L    R                 V   + E+N  HFP D Q   I +A+      +IRL    D     + + +   +EW L     SE+K     Y         +  +    RRP +++  L   ++++C++S+V     F+   +  + R  L  T +LT+     VV++ +P  S ++  L  Y + N+  +++     G+
Sbjct:  102 IDELKQTMTVLIYVDEHWVDPSLTWD-PALFGGITKTWIPLDKIWVPDII------VFNMVKSNRLAHEDLLSAVRAPARIHYNGTIVASHPAVHTVSCEINIRHFPLDDQRCAIEIASWAYGQEKIRLHAHTDH----SLEHYKRNEEWHLLNLNVSEEK-----YEHEGVEVSEVKFEISLKRRPLFYMVTLTFPSYIMCAISVVGLFARFSTTGER-EERFTLGVTAILTMAVLSLVVSEKVPHSSTHVPLLVAYFLFNMVIVSIAAMTTGI 359          
BLAST of Neur_chan_LBD domain-containing protein vs. TrEMBL
Match: A0A0V0J6K7 (Neur_chan_LBD domain-containing protein OS=Schistocephalus solidus OX=70667 GN=TR135000 PE=3 SV=1)

HSP 1 Score: 508.064 bits (1307), Expect = 5.193e-172
Identity = 252/387 (65.12%), Postives = 309/387 (79.84%), Query Frame = 2
Query:  158 NDSEFSVYEIHQSRRMSTLAVRVPCIDLRHSLMNIPTAGDDTLKKRQVYICVVFLKIGEIDTIKEQFTADIIVKAKWREPSLDFHIDGLNYDWSKCWTPKLYVENTVGDPREHVYQMITFNEFGHAFLCEKRRVSGVFLENLELNHFPFDVQDLTIIVATTLSSSEIRLVNDPDEPHRINKQSFVDEQEWFLYKNIESEQKDMIFEYADPLSVRPALLVQCRAARRPAYFLWNLFLVTFLICSLSLVTFAVDKDLPQNRLQLSYTLVLTLIAFKFVVNQCLPKISYLTYLDKYIISNLFFLTLVCAWHGLXXXXXXXXXXXXXSLSENLELYVLISISVGYGLYNLGFVLVIYLVAFKRRRQMQKLDKEYLEKVQCQIKTKGNRRAR 1318
            N+SE +V     SRR+S   V +  ++L    +N  T     +KKRQVY+CV+FLKIGEIDTIKEQ+ AD+++KAKWR+  +D       YDW   WTPKLY+ENT+G+ RE ++Q I  NEFGHAFL EKRRVSGVFLENLELNHFPFDVQDLTI VA+ L SSEIRL+NDPDEPHRINKQSFVDEQEW+LYK+I+SEQ ++  EY +  SVRPAL V+CRAARRPAYF+WN+FLVTFLICSLSLVTFAVD+  PQ+RLQL++TLVLTL+AFKFVVNQCLPKISYLTYLDKYIIS+LFFLTL+C WHG + VI ++ +R +  L  ++ELYV++ I +GY  +N+GF+L+IY VA KRRR M+  D EYLEKV+CQ+  KG+R  R
Sbjct:  249 NNSESTVSIC--SRRLSQPNVNI--VELPEVRINPVTRMPTEIKKRQVYLCVIFLKIGEIDTIKEQYAADVLIKAKWRDADMD-TAGSKEYDWLHNWTPKLYIENTIGEIREQIHQTIALNEFGHAFLVEKRRVSGVFLENLELNHFPFDVQDLTITVASNLPSSEIRLLNDPDEPHRINKQSFVDEQEWYLYKHIDSEQHELANEYIENASVRPALSVKCRAARRPAYFIWNIFLVTFLICSLSLVTFAVDRSQPQSRLQLTFTLVLTLVAFKFVVNQCLPKISYLTYLDKYIISSLFFLTLICIWHGGIAVIEKVAQRFDILLWADMELYVILLIGIGYFTFNVGFMLMIYCVACKRRRDMKSKDSEYLEKVKCQMNKKGSRAHR 630          
BLAST of Neur_chan_LBD domain-containing protein vs. TrEMBL
Match: A0A210Q143 (Cys-loop ligand-gated ion channel OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT24637 PE=3 SV=1)

HSP 1 Score: 367.081 bits (941), Expect = 1.221e-120
Identity = 175/328 (53.35%), Postives = 239/328 (72.87%), Query Frame = 2
Query:  296 QVYICVVFLKIGEIDTIKEQFTADIIVKAKWREPSLDF-HIDGLNYDWSKCWTPKLYVENTVGDPREHVYQMITFNEFGHAFLCEKRRVSGVFLENLELNHFPFDVQDLTIIVATTLSSSEIRLVNDPDEPHRINKQSFVDEQEWFLYKNIESEQKDMIFEYADPLSVRPALLVQCRAARRPAYFLWNLFLVTFLICSLSLVTFAVDKDLPQNRLQLSYTLVLTLIAFKFVVNQCLPKISYLTYLDKYIISNLFFLTLVCAWHGLXXXXXXXXXXXXXSLSENLELYVLISISVGYGLYNLGFVLVIYLVAFKRRRQMQKLDKEYLEK 1276
            +V ICV F K+GEIDT+KEQ+TAD+IVKAKWREPSLD  +    + +++K W PKLY+EN++GDP+E +   + +N+ G A++ EKR + G F+ENLEL+ FPFDVQD+TI VA+ L SSE+ L+ D D+ H +NKQ+FVDEQEW LY + E  ++D++ + AD    R AL V+CRAARRP YF+WN+F+VTFLICSL+  TF+V+ +LPQNRLQLS+TLVLT +AFK  VN  LP+ISYLTY+DKY++  +  LT VC WH +V  +    K       + +E  VL  ++  Y  YN+GF +VIY+  +K+RR+MQ+ DKEY  K
Sbjct:   24 KVKICVQFFKVGEIDTLKEQYTADVIVKAKWREPSLDGQNKTSESVEFNKMWNPKLYIENSLGDPKEQIRYQVLYNDKGEAYVSEKRVIKGTFMENLELDDFPFDVQDITITVASELPSSEVELIEDDDDHHVVNKQAFVDEQEWHLYMHTECVKRDIVIDQADMSVRRSALSVKCRAARRPGYFVWNIFVVTFLICSLAFTTFSVNNNLPQNRLQLSFTLVLTAVAFKSAVNSSLPRISYLTYMDKYLLIAMVMLTAVCVWHAIVSTLATQEK------RDRIESVVLTVLAAIYIFYNIGFFIVIYVSPWKKRREMQQKDKEYQMK 345          
BLAST of Neur_chan_LBD domain-containing protein vs. TrEMBL
Match: A0A2T7Q004 (Neur_chan_LBD domain-containing protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_01623 PE=3 SV=1)

HSP 1 Score: 363.229 bits (931), Expect = 6.562e-119
Identity = 170/331 (51.36%), Postives = 240/331 (72.51%), Query Frame = 2
Query:  296 QVYICVVFLKIGEIDTIKEQFTADIIVKAKWREPSLDFHID--GLNYDWSKCWTPKLYVENTVGDPREHVYQMITFNEFGHAFLCEKRRVSGVFLENLELNHFPFDVQDLTIIVATTLSSSEIRLVNDPDEPHRINKQSFVDEQEWFLYKNIESEQKDMIFEYADPLSVRPALLVQCRAARRPAYFLWNLFLVTFLICSLSLVTFAVDKDLPQNRLQLSYTLVLTLIAFKFVVNQCLPKISYLTYLDKYIISNLFFLTLVCAWHGLXXXXXXXXXXXXXSLSENLELYVLISISVGYGLYNLGFVLVIYLVAFKRRRQMQKLDKEYLEKVQ 1282
            +V +CV F K+GEIDT+KEQ+TAD+IV+A+WREPSLD  +   G   +  K W PKLY+EN  GDP+E+    + FNE G AF+ EKR + G F+ENLEL+ FPFDVQDLT+ VA+   S+E+ L+ D D  H +NKQSFVDEQEW+LY + +  + ++  +  D  + R A+ V+CRAARRP YF+WN+F+VTFLICSLS  TF+VDK LPQNRLQL++TL+LT +AFK VVNQ LP+ISYLTY+DKY+++++  ++ VCAWH +      I    ++  ++++E  VLI + + Y L+N+GF+++IYL   K+RR M   D+E+ E+ +
Sbjct:   50 KVLVCVQFFKVGEIDTLKEQYTADVIVRARWREPSLDGQLSEQGDMLEPGKYWNPKLYIENAYGDPKENFRYRVMFNEKGEAFISEKRTIKGTFMENLELDDFPFDVQDLTVTVASEFPSTEVELIEDSDNRHMVNKQSFVDEQEWYLYCHTQCTKWELKIDPVDDAAKRSAISVKCRAARRPGYFVWNIFIVTFLICSLSFATFSVDKSLPQNRLQLAFTLMLTSVAFKSVVNQSLPRISYLTYMDKYLLASMIMMSGVCAWHAV-----VITILNDRGFADHVESIVLIVLGIVYVLFNVGFIIIIYLFPCKKRRTMAVRDREHKEQAR 375          
BLAST of Neur_chan_LBD domain-containing protein vs. TrEMBL
Match: R7UZT0 (Neur_chan_LBD domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_223110 PE=3 SV=1)

HSP 1 Score: 367.081 bits (941), Expect = 3.642e-118
Identity = 183/362 (50.55%), Postives = 254/362 (70.17%), Query Frame = 2
Query:  296 QVYICVVFLKIGEIDTIKEQFTADIIVKAKWREPSLDFHIDGL---NYDWSKCWTPKLYVENTVGDPREHVYQMITFNEFGHAFLCEKRRVSGVFLENLELNHFPFDVQDLTIIVATTLSSSEIRLVNDPDEPHRINKQSFVDEQEWFLYKNIESEQKDMIFEYADPLSVRPALLVQCRAARRPAYFLWNLFLVTFLICSLSLVTFAVDKDLPQNRLQLSYTLVLTLIAFKFVVNQCLPKISYLTYLDKYIISNLFFLTLVCAWHGLXX----------XXXXXXXXXXXSLSENLELYVLISISVGYGLY---NLGFVLVIYLVAFKRRRQMQKLDKEYLEKVQCQIKTKGNRRARMNQQT 1333
            +V +CVVFLKIGEIDT+KEQ+ AD+++K+KWREPSLD   +G+     DWSK W PKL++EN  GD RE  +Q+++FN+ G A++ EKRR+ GVF+ENLEL  FPFDVQDLT+ V +    +EI +  DP++ H++N+QSF+DEQEW LYK I++E +++  EY DP   R +L V+CRAARRPAYF WN+FL+TFLIC L  VTFAV++ LPQNRLQLS+TLVLT +AFKFVVNQ LPKISYLTYLDKY+++ +  LT VCAWHG+             +  +       L+E  ++   +++ V    Y   N+ F++ IY+   K RR+M KL+KEY+E+++ ++    +   +M   T
Sbjct:  188 RVEVCVVFLKIGEIDTLKEQYEADVMIKSKWREPSLDKR-NGMIPGPIDWSKYWNPKLFIENLTGDSRETAFQVVSFNQHGEAYVLEKRRIKGVFVENLELVEFPFDVQDLTVAVMSDRPPAEIEIAEDPNDLHKVNRQSFIDEQEWHLYKCIDTEMREITNEYEDPSVKRCSLNVRCRAARRPAYFFWNIFLITFLICCLVFVTFAVERSLPQNRLQLSFTLVLTSVAFKFVVNQSLPKISYLTYLDKYVLAAMILLTTVCAWHGITTIFGDTTDSLVQVVDVSGIERDRLNEIGKIIDTVALCVFASFYLIFNIVFIIFIYVKPGKTRREMSKLEKEYMERIKRELDENKHTEYQMQPNT 548          
BLAST of Neur_chan_LBD domain-containing protein vs. TrEMBL
Match: A0A1S3HM70 (uncharacterized protein LOC106156405 isoform X5 OS=Lingula unguis OX=7574 GN=LOC106156405 PE=3 SV=1)

HSP 1 Score: 362.073 bits (928), Expect = 5.579e-118
Identity = 188/379 (49.60%), Postives = 253/379 (66.75%), Query Frame = 2
Query:  164 SEFSVYEIHQSRRMSTLAVRVPCIDLRHSLMNIPTAGDDTLKKRQVYICVVFLKIGEIDTIKEQFTADIIVKAKWREPSLDFH-------IDGLNYDWSKCWTPKLYVENTVGDPREHVYQMITFNEFGHAFLCEKRRVSGVFLENLELNHFPFDVQDLTIIVATTLSSSEIRLVNDPDEPHRINKQSFVDEQEWFLYKNIESEQKDMIFEYADPLSVRPALLVQCRAARRPAYFLWNLFLVTFLICSLSLVTFAVDKDLPQNRLQLSYTLVLTLIAFKFVVNQCLPKISYLTYLDKYIISNLFFLTLVCAWHGLXXXXXXXXXXXXXSLSENLELYVLISISVGYGLYNLGFVLVIYLVAFKRRRQMQKLDKEYLEKV 1279
            SE S Y    S+   T  +      L  S++ +    +    +  V +CV+FLK+GEIDT+KEQF+AD++VKAKWREP LD         ID    D+ K W PKL+VENTVGDP+E  ++ + F+  G AF+CE +R+ G F+ENLELN FPFDVQDLT+ V +   +SE+ L+ D  E HR+ KQSF+DEQEW LYK++ESE K +   + DP   R  L V+CRAARRP +F+WN+FLVTFL CSLS  TF+V+ +LPQNRLQLS+TLVLT +AFKFV+NQ LP++SYLTYLDKY++ ++  L +VCAWH +V  I+          ++  EL  L +++V Y  +N G    IY  A KRRR M++ D+EY+E V
Sbjct:   13 SESSPYTASGSQPTYTAGIFA---SLGASIVAVEAHAEPDHDRVTVEVCVIFLKLGEIDTLKEQFSADVLVKAKWREPELDRKGKNKDELIDEDEIDFEKYWNPKLFVENTVGDPKEVRWRTLAFSSEGDAFICENQRLKGTFVENLELNDFPFDVQDLTVTVTSERPASELNLIEDRMELHRVYKQSFIDEQEWSLYKHLESESKFLAEPHGDPSVKRVLLSVKCRAARRPWFFVWNIFLVTFLFCSLSFATFSVEYNLPQNRLQLSFTLVLTAVAFKFVINQSLPRVSYLTYLDKYLLGSMCQLAIVCAWHSIVAKIDSKHD------AKVAELVFLTALAVIYIGFNAGICFHIYAFACKRRRIMKQKDREYMESV 382          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Cavefish
Match: glra1 (glycine receptor alpha 1 [Source:NCBI gene;Acc:103026517])

HSP 1 Score: 55.4546 bits (132), Expect = 7.928e-8
Identity = 60/264 (22.73%), Postives = 116/264 (43.94%), Query Frame = 2
Query:  308 CVVFL-KIGEIDTIKEQFTADIIVKAKWREPSL---DFHIDGLNYDWS---KCWTPKLYVENTVGDPREHVYQMITFNEF----GHAFLCEKRRVSGVFLENLELNHFPFDVQDLTIIVATTLSSSEIRLVNDPDEPHRINKQSFVDEQEWFLYKNIESEQKDMIFEYADPLSVRPALLVQCR--AARRPAYFLWNLFLVTFLICSLSLVTFAVDKDLPQNRLQLSYTLVLTLIAFKFVVNQCLPKISYLTYLDKYIISNLFFL 1060
            C +F+   G I      +  +I ++ +W +P L   ++  D L+ D S     W P L+  N  G    + +++ T N+      +  +    R++ V    ++L +FP DVQ   I+   +   +   L+ + DE   +     +   ++ L      E+KD+ +      +      ++ R    R+  Y+L  +++ + LI  LS V+F ++ D    R+ L  T VLT+          LPK+SY+  +D ++   L F+
Sbjct:   81 CNIFINSFGSIAETTMDYRVNIFLRQQWNDPRLAYSEYPDDSLDLDPSMLDSIWKPDLFFANEKG---ANFHEVTTDNKLLRISKNGNVLYSIRITLVLACPMDLKNFPMDVQT-CIMQLESFGYTMNDLIFEWDEKGAVQVADGLTLPQFIL-----KEEKDLRY-CTKHYNTGKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFV 334          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Cavefish
Match: glra1 (glycine receptor alpha 1 [Source:NCBI gene;Acc:103026517])

HSP 1 Score: 55.0694 bits (131), Expect = 8.990e-8
Identity = 60/264 (22.73%), Postives = 116/264 (43.94%), Query Frame = 2
Query:  308 CVVFL-KIGEIDTIKEQFTADIIVKAKWREPSL---DFHIDGLNYDWS---KCWTPKLYVENTVGDPREHVYQMITFNEF----GHAFLCEKRRVSGVFLENLELNHFPFDVQDLTIIVATTLSSSEIRLVNDPDEPHRINKQSFVDEQEWFLYKNIESEQKDMIFEYADPLSVRPALLVQCR--AARRPAYFLWNLFLVTFLICSLSLVTFAVDKDLPQNRLQLSYTLVLTLIAFKFVVNQCLPKISYLTYLDKYIISNLFFL 1060
            C +F+   G I      +  +I ++ +W +P L   ++  D L+ D S     W P L+  N  G    + +++ T N+      +  +    R++ V    ++L +FP DVQ   I+   +   +   L+ + DE   +     +   ++ L      E+KD+ +      +      ++ R    R+  Y+L  +++ + LI  LS V+F ++ D    R+ L  T VLT+          LPK+SY+  +D ++   L F+
Sbjct:   68 CNIFINSFGSIAETTMDYRVNIFLRQQWNDPRLAYSEYPDDSLDLDPSMLDSIWKPDLFFANEKG---ANFHEVTTDNKLLRISKNGNVLYSIRITLVLACPMDLKNFPMDVQT-CIMQLESFGYTMNDLIFEWDEKGAVQVADGLTLPQFIL-----KEEKDLRY-CTKHYNTGKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFV 321          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Cavefish
Match: GABRB2 (gamma-aminobutyric acid receptor subunit beta-2 [Source:NCBI gene;Acc:103038806])

HSP 1 Score: 52.373 bits (124), Expect = 7.568e-7
Identity = 58/268 (21.64%), Postives = 112/268 (41.79%), Query Frame = 2
Query:  320 LKIGEIDTIKE---QFTADIIVKAKWREPSLDFHIDGLNYDWSKCWTPKLYVENT--VGDPREHVYQMITFNEF----GHAFLCEKRRVSGVFLENLELNHFPFDVQDLTI-IVATTLSSSEIRLVNDPDEPHRINKQSFVDEQEWFL--YKNIESEQKDMIFEYADPLSVRPALLVQCRAARRPAYFLWNLFLVTFLICSLSLVTFAVDKDLPQNRLQLSYTLVLTLIAFKFVVNQCLPKISYLTYLDKYIISNLFFLTLVCAWHGL 1087
            + I  ID + E    +T  +  +  WR+  L +    LN         +L+V +T  + D +  V+ +   N          +    R++      ++L  +P D Q+ T+ I +   ++ +I         H +     ++  ++ +  YK I    K+++F         P L +  +  R   YF+   ++ + LI  LS V+F ++ D    R+ L  T VLT+      + + LPKI Y+  +D Y++    F+ L    + L
Sbjct:   68 IDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYSEIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGGN-HAVTGVERIELPQFSIVDYKLIS---KNVVFS----TGAYPRLSLSFKLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYAL 327          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Cavefish
Match: GABRB2 (gamma-aminobutyric acid receptor subunit beta-2 [Source:NCBI gene;Acc:103038806])

HSP 1 Score: 51.9878 bits (123), Expect = 8.206e-7
Identity = 58/268 (21.64%), Postives = 112/268 (41.79%), Query Frame = 2
Query:  320 LKIGEIDTIKE---QFTADIIVKAKWREPSLDFHIDGLNYDWSKCWTPKLYVENT--VGDPREHVYQMITFNEF----GHAFLCEKRRVSGVFLENLELNHFPFDVQDLTI-IVATTLSSSEIRLVNDPDEPHRINKQSFVDEQEWFL--YKNIESEQKDMIFEYADPLSVRPALLVQCRAARRPAYFLWNLFLVTFLICSLSLVTFAVDKDLPQNRLQLSYTLVLTLIAFKFVVNQCLPKISYLTYLDKYIISNLFFLTLVCAWHGL 1087
            + I  ID + E    +T  +  +  WR+  L +    LN         +L+V +T  + D +  V+ +   N          +    R++      ++L  +P D Q+ T+ I +   ++ +I         H +     ++  ++ +  YK I    K+++F         P L +  +  R   YF+   ++ + LI  LS V+F ++ D    R+ L  T VLT+      + + LPKI Y+  +D Y++    F+ L    + L
Sbjct:   68 IDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYSEIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGGN-HAVTGVERIELPQFSIVDYKLIS---KNVVFS----TGAYPRLSLSFKLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYAL 327          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Cavefish
Match: glrbb (glycine receptor beta [Source:NCBI gene;Acc:103040214])

HSP 1 Score: 51.2174 bits (121), Expect = 1.516e-6
Identity = 61/255 (23.92%), Postives = 104/255 (40.78%), Query Frame = 2
Query:  329 GEIDTIKEQFTADIIVKAKWREPSL----DFHIDGLNYDWS--KC-WTPKLYVENTVGDPREHVYQM-ITFNEFGHAFLCEKRRVSGVFLENLELNHFPFDVQDLTIIVAT-TLSSSEIRLV---NDPDEPHRINKQSFVDEQEWFLYKNIESEQKDMIFEYADPLSVRPALLVQCRAARRPAYFLWNLFLVTFLICSLSLVTFAVDKDLPQNRLQLSYTLVLTLIAFKFVVNQCLPKISYLTYLDKYIISNLFF 1057
            G I      +  +I ++ +W +P L    DF  D L  D    KC W P L+  N        V Q  I    F +  +    R+S      L+L  FP D Q   + + +   ++ +++ +    DP +   I    F   QE   Y N          +Y         + V     R+  +++  ++  T LI  LS ++F ++ D    R+ L    VL+L +    +   LPK+SY+  +D ++I+ L F
Sbjct:  102 GSIQETTMDYRVNIFLRQRWNDPRLRLPQDFKSDSLTVDPKMFKCLWKPDLFFANEKSANFHDVTQENILLFIFRNGDVLISMRLSVTLSCPLDLTLFPMDTQRCKMQLESFGYTTDDLQFMWQSGDPVQMDEIALPQFDIRQEDIEYGNCT--------KYYAGTGYYTCVEVIFTLRRQVGFYMMGVYAPTLLIVVLSWLSFWINPDASAARVPLGILSVLSLSSECTSLASELPKVSYVKAIDIWLIACLLF 348          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Sea Lamprey
Match: gabrb3 (gamma-aminobutyric acid type A receptor beta3 subunit [Source:ZFIN;Acc:ZDB-GENE-101102-2])

HSP 1 Score: 50.8322 bits (120), Expect = 3.431e-7
Identity = 29/90 (32.22%), Postives = 45/90 (50.00%), Query Frame = 2
Query:  800 PALLVQCRAARRPAYFLWNLFLVTFLICSLSLVTFAVDKDLPQNRLQLSYTLVLTLIAFKFVVNQCLPKISYLTYLDKYIISNLFFLTLV 1069
            P L +  R  R   YF+   ++ T LI  LS V+F ++ D    R+ L  T VLT+      + + LPKI Y+  +D Y++    F+ L 
Sbjct:   70 PRLSLSFRLKRNIGYFILQTYMPTILITILSWVSFWINYDASAARVALGVTTVLTMTTISTHLRETLPKIPYVKAIDIYLMGCFCFVFLA 159          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Sea Lamprey
Match: glra2 (glycine receptor, alpha 2 [Source:ZFIN;Acc:ZDB-GENE-090407-1])

HSP 1 Score: 50.447 bits (119), Expect = 4.651e-7
Identity = 61/264 (23.11%), Postives = 115/264 (43.56%), Query Frame = 2
Query:  308 CVVFL-KIGEIDTIKEQFTADIIVKAKWREPSL---DFHIDGLNYDWS---KCWTPKLYVENTVGDPREHVYQMITFNEFGHAF----LCEKRRVSGVFLENLELNHFPFDVQDLTIIVATTLSSSEIRLVNDPDEPHRINKQSFVDEQEWF-LYKNIESEQKDMIFEYADPLSVR-PALLVQCRAARRPAYFLWNLFLVTFLICSLSLVTFAVDKDLPQNRLQLSYTLVLTLIAFKFVVNQCLPKISYLTYLDKYIISNLFFL 1060
            C +F+   G I      +  +I ++ +W +P L   ++  D L+ D S     W P L+  N  G    + +++ T N+    F    +    R++      ++L +FP DVQ      A  L S    +    D      ++  V   E   L + +  ++KD+++      + +   + V+    R+  Y+L  +++ + LI  LS V+F ++ D    R+ L  T VLT+          LPK+SY+  +D ++   L F+
Sbjct:   10 CNIFINSFGSIAETTMDYRVNIFLRQQWNDPRLAYSEYPDDSLDLDPSMLDSIWKPDLFFANEKG---ANFHEVTTDNKLLRIFKDGNVLYSIRLTLTLSCPMDLKNFPMDVQ----TCAMQLESFGYTM---NDLIFEWKQEGAVQVAEGLTLPQFVLKDEKDLVYCTKHYNTGKFTCIEVKFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFV 263          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Sea Lamprey
Match: gabrb3 (gamma-aminobutyric acid type A receptor beta3 subunit [Source:ZFIN;Acc:ZDB-GENE-101102-2])

HSP 1 Score: 48.1358 bits (113), Expect = 2.262e-6
Identity = 28/90 (31.11%), Postives = 45/90 (50.00%), Query Frame = 2
Query:  800 PALLVQCRAARRPAYFLWNLFLVTFLICSLSLVTFAVDKDLPQNRLQLSYTLVLTLIAFKFVVNQCLPKISYLTYLDKYIISNLFFLTLV 1069
            P L +  R  R   YF+   ++ + LI  LS V+F ++ D    R+ L  T VLT+      + + LPKI Y+  +D Y++    F+ L 
Sbjct:   49 PRLSLSFRLKRNIGYFILQTYMPSTLITILSWVSFWINYDASAARVALGITTVLTMTTISTHLRETLPKIPYVKAIDIYLMGCFCFVFLA 138          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Sea Lamprey
Match: glra4a (glycine receptor, alpha 4a [Source:ZFIN;Acc:ZDB-GENE-010410-3])

HSP 1 Score: 48.521 bits (114), Expect = 2.354e-6
Identity = 56/267 (20.97%), Postives = 116/267 (43.45%), Query Frame = 2
Query:  308 CVVFLK-IGEIDTIKEQFTADIIVKAKWREP-------SLDFHIDGLNYDWS---KCWTPKLYVENTVGDPREHVYQMIT-------FNEFGHAFLCEKRRVSGVFLENLELNHFPFDVQDLTIIVAT-TLSSSEIRLVNDPDEP----HRINKQSFVDEQEWFLYKNIESEQKDMIFEYADPLSVRPALLVQCRAARRPAYFLWNLFLVTFLICSLSLVTFAVDKDLPQNRLQLSYTLVLTLIAFKFVVNQCLPKISYLTYLDKYI 1039
            C + +K  G ++     ++ +I ++  W +P       S++++ D L+   S     W P L+ EN      + +YQ++T       F  +   FLC   R+S V    + L  +P D Q  +I + +   +++++    +  EP      ++   F    E FL +  +       + Y     V+    +     R   Y+L  +++ + L+  +S ++F ++ +    R+ L  T +LT+       N  LPK+SY+  +D ++
Sbjct:   73 CSILVKGFGPVEEATMDYSINIFLRQTWNDPRILNVLKSIEYNTDFLDLGNSFVDSVWKPDLFFENEKSAAFQ-MYQLVTGFKYMYTFAMWITCFLC--FRLSLVLACPMSLEVYPMDAQYCSIYLESYGYTTNDLIFQWNDTEPVSFGAGVSTPKFTLSNETFLGECTKE------YTYGTFSCVKATFFLD----RDMGYYLIQVYIPSCLLVIISWLSFWLNVEAAPARVGLGITTILTVTTQMTSANAALPKVSYIKAIDVWM 326          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Sea Lamprey
Match: glra1 (glycine receptor, alpha 1 [Source:NCBI gene;Acc:30676])

HSP 1 Score: 47.3654 bits (111), Expect = 3.114e-6
Identity = 50/247 (20.24%), Postives = 110/247 (44.53%), Query Frame = 2
Query:  308 CVVFLK-IGEIDTIKEQFTADIIVKAKWREPSLDF------HIDGLNYDWSKCWTPKLYVENTVGDPREHVYQMITFNE----FGHAFLCEKRRVSGVFLENLELNHFPFDVQDLTIIVAT-TLSSSEIRLVNDPDEPHRINKQSFVDEQEWFLYKNIESEQKDMIFEYADPLSVRPALLVQCRAARRPAYFLWNLFLVTFLICSLSLVTFAVDKDLPQNRLQLSYTLVLTLIAFKFVVNQCLPKIS 1012
            C V++K  G I+     +   I ++ KW +P L +      ++D    +    W P L+ +N   +   + +++ T N+    F +  +    R++      ++L +FP D Q   + + +   + +++    D +EP  I+K+  +   ++ L   I+++  D +  Y+        +  +    R   ++L  L++ + LI  +S V+F ++ +    R+ L  T VLT+          LPK++
Sbjct:   34 CSVYIKSFGSIEETTMDYQVTIFLRQKWIDPRLTYSHYPEPYLDLDQSNIQYIWRPDLFFDN---EKSAYFHEVTTDNKMLRIFKNGLVLFTVRLTLTLSCPMDLRNFPMDTQMCYMFLESFGYTMADLSFHWDEEEPVIISKELVL--PQFVLSSKIDTDSCDKL--YSSGTGHFSCISARFVLHREMGFYLIQLYVPSALIVIISWVSFWINMEAAPARVALGITTVLTMTTQSTGARASLPKVT 273          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Nematostella
Match: EDO32790 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SU26])

HSP 1 Score: 138.272 bits (347), Expect = 2.085e-36
Identity = 87/319 (27.27%), Postives = 159/319 (49.84%), Query Frame = 2
Query:  326 IGEIDTIKEQFTADIIVKAKWREPSLDFHIDGLNYDWSKCWTPKLYVENTVGDPREHVYQMITFNEFGHAFLC-EKRRVSGVFLENLELNHFPFDVQDLTIIVATTLSSSEIRLVNDPDEPHRINKQSFVDEQEWFLYKNIESEQKDMIFEYADPLSVR-PALLVQCRAARRPAYFLWNLFLVTFLICSLSLVTFAVDKDLPQNRLQLSYTLVLTLIAFKFVVNQCLPKISYLTYLDKYIISNLFFLTLVCAWHGLXXXXXXXXXXXXXSLSENLELYVLISISVGYGLYNLGFVLVIYLVAFKRRRQMQKLDKEYLEK 1276
            +G+ID I++QFT ++ + A WREP L    +     W   W+PK+   N++   R +  + + + E     L  E  ++ G F E   L  FP D+Q+L+II+++  S   +    D  +P  + +Q+F   ++W LY ++ ++      E   P     P  ++     RR  ++ WN  +V  ++ +LS  +FA+      +RL ++  L+L  +A+KFV +  LP+ SYLT+LDKY + NL F++ +   + + V +          L   L LYV++    G    +  +V+   L  F R+ +++  + E L +
Sbjct:   27 LGDIDVIRQQFTCELWMTASWREPKLAGKKNE-EVKWDNEWSPKISFSNSLLLDRVYKGRRLYYEENSTVPLAQEVYKIRGTFKEQFSLEQFPVDLQELSIIISSDWSDRTVTFEKDMAKPDYLRQQTFSSPRDWVLYPHVHTDTATQEGEGLGPNDRSYPVYIITAHVRRRAVHYFWNTAVVMSVLTALSFASFAIPPQQTADRLTVTLLLLLISVAYKFVTSLHLPRTSYLTFLDKYQLGNLLFISFIAVLNTIAVAVESRDTYDMVCLYAGLALYVILQCMAGILTLHKHYVVNGELKKFTRKYEIRNDEIERLRR 344          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Nematostella
Match: EDO26859 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TAV8])

HSP 1 Score: 77.7962 bits (190), Expect = 8.163e-17
Identity = 46/167 (27.54%), Postives = 84/167 (50.30%), Query Frame = 2
Query:  680 EPHRINKQSFVDEQEWFLYKNIESEQKDMIFEYADPLS-VRPALLVQCRAARRPAYFLWNLFLVTFLICSLSLVTFAVDKDLPQNRLQLSYTLVLTLIAFKFVVNQCLPKISYLTYLDKYIISNLFFLTLVCAWHGLXXXXXXXXXXXXXSLSENLELYVLISISVG 1177
            +P  + +Q+F   ++W LY ++ ++      E   P     P  ++     RR  ++ WN  +V  ++ +LS  +FA+      +RL ++  L+L  +A+KFV +  LP+ SYLT+LDKY + NL F++ +   + + V +          L   L LYV++    G
Sbjct:    3 KPDYLRQQTFSSPRDWVLYPHVHTDTATQEGEGLGPNDRSYPVYIITAHVRRRAVHYFWNTAVVMSVLTALSFASFAIPPQQTADRLTVTLLLLLISVAYKFVTSLHLPRTSYLTFLDKYQLGNLLFISFIAVLNTIAVAVESRDTYDMVCLYAGLALYVILQCMAG 169          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Nematostella
Match: EDO40746 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6G8])

HSP 1 Score: 65.0846 bits (157), Expect = 5.708e-12
Identity = 66/254 (25.98%), Postives = 116/254 (45.67%), Query Frame = 2
Query:  356 FTADIIVKAKWREPSLDFHID------GLNYDWSKCWTPKLYVENTVGDPREHVYQMITFN-------EFGHAFLCEKRRVSGVFLENLELNHFPFDVQDLTIIVATTLSSSEIRLVNDPDEPHRINKQSFVDEQEWFLYKNIESEQKDMIFEYADPLSVR-PALLVQCRAARRPAYFLWNLFLVTFLICSLSLVTFAVDKDLPQNRLQLSYTLVLTLIAFKFVVNQCLPKISYLTYLDKYII--SNLFFLTLV 1069
            FT DI +   W++P   F ++      GL  D  + W P  +  N+V      +++MI+ N       + GH  L  + +        ++L  +P D+Q   + + +  S  E  L+ +  +P   +   +  E   F   N++ + K  ++      S R   + V  +  RR  Y+++ +++    I +LS V+F VD D    R+ LS T VLT+      VN  LP++SYL  +D +++      FLTLV
Sbjct:    1 FTMDIYLGQFWQDPRFAFGLNKTVSLGGLFVD--RFWIPDTFFVNSVD---TEIHKMISPNKKVWLNLDQGHIMLSTRLKSRAT--CKMDLRKYPMDLQTCHLALES-FSFDEEDLMYEWKKPVGSDVFIYDAEMAQFTVVNVKRKLKHPLYH-----SRRFSGMTVTFKFQRRTMYYIFQMYIPCVCIVALSWVSFWVDADAVPARVGLSITTVLTICYMLGSVNSNLPRVSYLKAIDYFLLLSFGFIFLTLV 241          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Nematostella
Match: EDO37555 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFG6])

HSP 1 Score: 62.003 bits (149), Expect = 2.234e-10
Identity = 65/279 (23.30%), Postives = 113/279 (40.50%), Query Frame = 2
Query:  263 PTAGDDTLKKRQVYICVVFLKIGEIDTIKEQFTADIIVKAKWREPSLDFHIDGL----NYDWSKCWTPKLYVENTVGDPREHVY---QMITFNEFGHAFLCEKRRVSGVFLENLELNHFPFDVQDLTIIVATTLSSSE---IRLVNDPDEPHRINKQSFVDEQEWFLYKNIESEQKDMIFEYADPLSVRPALLVQCRAARRPAYFLWNLFLVTFLICSLSLVTFAVDKDLPQNRLQLSYTLVLTLIAFKFVVNQCLPKISYLTYLDKYIISNLFFLTLV 1069
            P  G D +    V +    L I  I+ I   +  D  ++  WR+P L    D      N    K W P  Y  N+       V    +M++ +  G      +  V      NL +  FP DVQ+  I + +   S++    +  N  D    +NK+  + +   +   +I   +   ++   +       L    R  RR  YF+ +++    LI  LS ++F +  +    R+ L  T VLT+     ++N  +PK+SY+  +D Y+I    F+  V
Sbjct:   23 PDFGGDPV---TVTVGFWVLSIDAINVIDMDYRMDFFLRQLWRDPRLKHRFDDTLALSNTMLDKIWVPDTYFVNSKMSKFHSVTTINKMLSISPDGLVHYNSRVTVKASCAMNLRM--FPKDVQNCNIDIESYGYSADNVQYQWENRSDNGIAVNKK--IRDMPQYNLSDINVSRHFTMYVAGN----WSGLTATFRFRRRSGYFIIHIYAPCALIVILSWISFCIPPESTAARIALGITSVLTITTILNMLNNSMPKVSYVKAVDWYLIGCFLFVFAV 290          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Nematostella
Match: EDO37396 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFV7])

HSP 1 Score: 60.8474 bits (146), Expect = 5.280e-10
Identity = 65/270 (24.07%), Postives = 111/270 (41.11%), Query Frame = 2
Query:  320 LKIGEIDTIKEQFTADIIVKAKWREPSLDFHIDGLNY----DWSKCWTPKLYVENTVGDPREHVY---QMITFNEFGHAFLCEKRRVSGVFLENLELNHFPFDVQ-----------DLTIIVATTLSSSEIRLVNDPDEPHRINKQSFVD---EQEWFLYKNIESEQKDMIFEYADPLSVRPALLVQCRAARRPAYFLWNLFLVTFLICSLSLVTFAVDKDLPQNRLQLSYTLVLTLIAFKFVVNQCLPKISYLTYLDKYIISNLFFLTL 1066
            L +  ID +   FT D+ ++ +W +P LD  ++   Y       K WTP  Y  N       HV    QM      G   +    RV+      ++L  FP D Q           D + IV     ++   L   P+    + + S V     +EW  Y         +I  ++       A++      R   YFL +++  + +I  +S + F +  D    R+ +  T +LT +    ++N  +PK+SY+  +DK++IS L F+ L
Sbjct:   68 LSVDSIDVVNMDFTVDLFLRQEWVDPRLDHGLNETIYLGHRVMQKIWTPDSYFLNAKTAKMHHVTTPNQMTLIAPMG--VVKYNTRVTVKAACTIDLRSFPMDQQNCPLVLESYGYDRSHIVYHWEGNATDGLPFVPNRMRIMPQYSLVRLTLSREWHQY---------IIGNFS-------AVVAVFSIERSYTYFLTHVYGTSCVIVFISWMGFVIPPDQTAARIAVGVTTLLTQVTVINILNSSMPKVSYVKSIDKFLISCLIFVFL 319          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Medaka
Match: glra1 (glycine receptor alpha 1 [Source:NCBI gene;Acc:101173557])

HSP 1 Score: 55.0694 bits (131), Expect = 9.289e-8
Identity = 59/264 (22.35%), Postives = 116/264 (43.94%), Query Frame = 2
Query:  308 CVVFL-KIGEIDTIKEQFTADIIVKAKWREPSL---DFHIDGLNYDWS---KCWTPKLYVENTVGDPREHVYQMITFNEF----GHAFLCEKRRVSGVFLENLELNHFPFDVQDLTIIVATTLSSSEIRLVNDPDEPHRINKQSFVDEQEWFLYKNIESEQKDMIFEYADPLSVRPALLVQCR--AARRPAYFLWNLFLVTFLICSLSLVTFAVDKDLPQNRLQLSYTLVLTLIAFKFVVNQCLPKISYLTYLDKYIISNLFFL 1060
            C +F+   G I      +  +I ++ +W +P L   ++  D L+ D S     W P L+  N  G    + +++ T N+      +  +    R++ +    ++L +FP DVQ   I+   +   +   L+ + DE   +     +   ++ L      E+KD+ +      +      ++ R    R+  Y+L  +++ + LI  LS V+F ++ D    R+ L  T VLT+          LPK+SY+  +D ++   L F+
Sbjct:   86 CNIFINSFGSIAETTMDYRVNIFLRQQWNDPRLAYSEYPDDSLDLDPSMLDSIWKPDLFFANEKG---ANFHEVTTDNKLLRISKNGNVLYSIRITLILACPMDLKNFPMDVQT-CIMQLESFGYTMNDLIFEWDEKGAVQVADGLTLPQFIL-----KEEKDLRY-CTKHYNTGKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFV 339          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Medaka
Match: glra1 (glycine receptor alpha 1 [Source:NCBI gene;Acc:101173557])

HSP 1 Score: 55.0694 bits (131), Expect = 1.007e-7
Identity = 59/264 (22.35%), Postives = 116/264 (43.94%), Query Frame = 2
Query:  308 CVVFL-KIGEIDTIKEQFTADIIVKAKWREPSL---DFHIDGLNYDWS---KCWTPKLYVENTVGDPREHVYQMITFNEF----GHAFLCEKRRVSGVFLENLELNHFPFDVQDLTIIVATTLSSSEIRLVNDPDEPHRINKQSFVDEQEWFLYKNIESEQKDMIFEYADPLSVRPALLVQCR--AARRPAYFLWNLFLVTFLICSLSLVTFAVDKDLPQNRLQLSYTLVLTLIAFKFVVNQCLPKISYLTYLDKYIISNLFFL 1060
            C +F+   G I      +  +I ++ +W +P L   ++  D L+ D S     W P L+  N  G    + +++ T N+      +  +    R++ +    ++L +FP DVQ   I+   +   +   L+ + DE   +     +   ++ L      E+KD+ +      +      ++ R    R+  Y+L  +++ + LI  LS V+F ++ D    R+ L  T VLT+          LPK+SY+  +D ++   L F+
Sbjct:   58 CNIFINSFGSIAETTMDYRVNIFLRQQWNDPRLAYSEYPDDSLDLDPSMLDSIWKPDLFFANEKG---ANFHEVTTDNKLLRISKNGNVLYSIRITLILACPMDLKNFPMDVQT-CIMQLESFGYTMNDLIFEWDEKGAVQVADGLTLPQFIL-----KEEKDLRY-CTKHYNTGKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFV 311          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Medaka
Match: glra1 (glycine receptor alpha 1 [Source:NCBI gene;Acc:101173557])

HSP 1 Score: 55.0694 bits (131), Expect = 1.060e-7
Identity = 59/264 (22.35%), Postives = 116/264 (43.94%), Query Frame = 2
Query:  308 CVVFL-KIGEIDTIKEQFTADIIVKAKWREPSL---DFHIDGLNYDWS---KCWTPKLYVENTVGDPREHVYQMITFNEF----GHAFLCEKRRVSGVFLENLELNHFPFDVQDLTIIVATTLSSSEIRLVNDPDEPHRINKQSFVDEQEWFLYKNIESEQKDMIFEYADPLSVRPALLVQCR--AARRPAYFLWNLFLVTFLICSLSLVTFAVDKDLPQNRLQLSYTLVLTLIAFKFVVNQCLPKISYLTYLDKYIISNLFFL 1060
            C +F+   G I      +  +I ++ +W +P L   ++  D L+ D S     W P L+  N  G    + +++ T N+      +  +    R++ +    ++L +FP DVQ   I+   +   +   L+ + DE   +     +   ++ L      E+KD+ +      +      ++ R    R+  Y+L  +++ + LI  LS V+F ++ D    R+ L  T VLT+          LPK+SY+  +D ++   L F+
Sbjct:   71 CNIFINSFGSIAETTMDYRVNIFLRQQWNDPRLAYSEYPDDSLDLDPSMLDSIWKPDLFFANEKG---ANFHEVTTDNKLLRISKNGNVLYSIRITLILACPMDLKNFPMDVQ-TCIMQLESFGYTMNDLIFEWDEKGAVQVADGLTLPQFIL-----KEEKDLRY-CTKHYNTGKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFV 324          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Medaka
Match: si:ch211-39a7.1 (neuronal acetylcholine receptor subunit alpha-7-like [Source:NCBI gene;Acc:101160921])

HSP 1 Score: 53.9138 bits (128), Expect = 2.798e-7
Identity = 51/265 (19.25%), Postives = 117/265 (44.15%), Query Frame = 2
Query:  254 MNIPTAGDDTLKKRQVYICVVFLKIGEIDTIKEQFTADIIVKAKWREPSLDFH------IDGLNYDWSKCWTPKLYVENTVGDPREHVYQM-ITFNEFGHAFLCEKRRVSGVFLE--NLELNHFPFDVQDLTIIVATTLSSS---EIRLVNDPDEPHRINKQSFVDEQEWFLYKNIESEQKDMIFEYADPLSVRPALLVQCRAARRPAYFLWNLFLVTFLICSLSLVTFAVDKDLPQNRLQLSYTLVLTLIAFKFVVNQCLPKIS 1012
            M  P A D       V+  +  ++I ++D   +  T+++ ++  W +  L ++      +  L +   + WTP + + N+  D  +  ++  +  N  G+A    K    G+F+   N+++  FPFD+Q   +   +        +++++         +  S++   EW L   +   + ++ ++           ++  R  RR  Y+  NL +   L+ S++L+ F +  D  + ++ L  T++L+L  F  +V + +P  S
Sbjct:   39 MERPVANDS--HTLTVHFTLSLIQIMDVDEKNQVLTSNMWLQMTWYDHYLQWNQSEYPGVKNLRFTSDQVWTPDILLYNSADDDFDSTFKTNVLVNSSGYA----KYLPPGIFMSTCNVDVRWFPFDIQKCNLKFGSWTYDGWLLDLQMI-------EADISSYMPNGEWDLI-GVPGSRNEIFYDCCKEPYTDVTFVITIR--RRTLYYALNLLIPCVLLSSMTLLVFVLPADSGE-KISLGITVLLSLTVFMLLVAEIMPATS 286          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Medaka
Match: si:ch211-39a7.1 (neuronal acetylcholine receptor subunit alpha-7-like [Source:NCBI gene;Acc:101160921])

HSP 1 Score: 53.5286 bits (127), Expect = 3.646e-7
Identity = 51/265 (19.25%), Postives = 117/265 (44.15%), Query Frame = 2
Query:  254 MNIPTAGDDTLKKRQVYICVVFLKIGEIDTIKEQFTADIIVKAKWREPSLDFH------IDGLNYDWSKCWTPKLYVENTVGDPREHVYQM-ITFNEFGHAFLCEKRRVSGVFLE--NLELNHFPFDVQDLTIIVATTLSSS---EIRLVNDPDEPHRINKQSFVDEQEWFLYKNIESEQKDMIFEYADPLSVRPALLVQCRAARRPAYFLWNLFLVTFLICSLSLVTFAVDKDLPQNRLQLSYTLVLTLIAFKFVVNQCLPKIS 1012
            M  P A D       V+  +  ++I ++D   +  T+++ ++  W +  L ++      +  L +   + WTP + + N+  D  +  ++  +  N  G+A    K    G+F+   N+++  FPFD+Q   +   +        +++++         +  S++   EW L   +   + ++ ++           ++  R  RR  Y+  NL +   L+ S++L+ F +  D  + ++ L  T++L+L  F  +V + +P  S
Sbjct:   85 MERPVANDS--HTLTVHFTLSLIQIMDVDEKNQVLTSNMWLQMTWYDHYLQWNQSEYPGVKNLRFTSDQVWTPDILLYNSADDDFDSTFKTNVLVNSSGYA----KYLPPGIFMSTCNVDVRWFPFDIQKCNLKFGSWTYDGWLLDLQMI-------EADISSYMPNGEWDLI-GVPGSRNEIFYDCCKEPYTDVTFVITIR--RRTLYYALNLLIPCVLLSSMTLLVFVLPADSGE-KISLGITVLLSLTVFMLLVAEIMPATS 332          
BLAST of Neur_chan_LBD domain-containing protein vs. Planmine SMEST
Match: SMESG000039749.1 (SMESG000039749.1)

HSP 1 Score: 886.715 bits (2290), Expect = 0.000e+0
Identity = 441/441 (100.00%), Postives = 441/441 (100.00%), Query Frame = 2
Query:   50 MFPNRIMTMQDVSKGLVAPEDNWNWYRKRSSGSSQNNDSEFSVYEIHQSRRMSTLAVRVPCIDLRHSLMNIPTAGDDTLKKRQVYICVVFLKIGEIDTIKEQFTADIIVKAKWREPSLDFHIDGLNYDWSKCWTPKLYVENTVGDPREHVYQMITFNEFGHAFLCEKRRVSGVFLENLELNHFPFDVQDLTIIVATTLSSSEIRLVNDPDEPHRINKQSFVDEQEWFLYKNIESEQKDMIFEYADPLSVRPALLVQCRAARRPAYFLWNLFLVTFLICSLSLVTFAVDKDLPQNRLQLSYTLVLTLIAFKFVVNQCLPKISYLTYLDKYIISNLFFLTLVCAWHGLXXXXXXXXXXXXXSLSENLELYVLISISVGYGLYNLGFVLVIYLVAFKRRRQMQKLDKEYLEKVQCQIKTKGNRRARMNQQTRQIHEVKANGSTV 1372
            MFPNRIMTMQDVSKGLVAPEDNWNWYRKRSSGSSQNNDSEFSVYEIHQSRRMSTLAVRVPCIDLRHSLMNIPTAGDDTLKKRQVYICVVFLKIGEIDTIKEQFTADIIVKAKWREPSLDFHIDGLNYDWSKCWTPKLYVENTVGDPREHVYQMITFNEFGHAFLCEKRRVSGVFLENLELNHFPFDVQDLTIIVATTLSSSEIRLVNDPDEPHRINKQSFVDEQEWFLYKNIESEQKDMIFEYADPLSVRPALLVQCRAARRPAYFLWNLFLVTFLICSLSLVTFAVDKDLPQNRLQLSYTLVLTLIAFKFVVNQCLPKISYLTYLDKYIISNLFFLTLVCAWHGLVVVINRIIKRVNKSLSENLELYVLISISVGYGLYNLGFVLVIYLVAFKRRRQMQKLDKEYLEKVQCQIKTKGNRRARMNQQTRQIHEVKANGSTV
Sbjct:    1 MFPNRIMTMQDVSKGLVAPEDNWNWYRKRSSGSSQNNDSEFSVYEIHQSRRMSTLAVRVPCIDLRHSLMNIPTAGDDTLKKRQVYICVVFLKIGEIDTIKEQFTADIIVKAKWREPSLDFHIDGLNYDWSKCWTPKLYVENTVGDPREHVYQMITFNEFGHAFLCEKRRVSGVFLENLELNHFPFDVQDLTIIVATTLSSSEIRLVNDPDEPHRINKQSFVDEQEWFLYKNIESEQKDMIFEYADPLSVRPALLVQCRAARRPAYFLWNLFLVTFLICSLSLVTFAVDKDLPQNRLQLSYTLVLTLIAFKFVVNQCLPKISYLTYLDKYIISNLFFLTLVCAWHGLVVVINRIIKRVNKSLSENLELYVLISISVGYGLYNLGFVLVIYLVAFKRRRQMQKLDKEYLEKVQCQIKTKGNRRARMNQQTRQIHEVKANGSTV 441          
BLAST of Neur_chan_LBD domain-containing protein vs. Planmine SMEST
Match: SMESG000039749.1 (SMESG000039749.1)

HSP 1 Score: 873.618 bits (2256), Expect = 0.000e+0
Identity = 435/435 (100.00%), Postives = 435/435 (100.00%), Query Frame = 2
Query:   68 MTMQDVSKGLVAPEDNWNWYRKRSSGSSQNNDSEFSVYEIHQSRRMSTLAVRVPCIDLRHSLMNIPTAGDDTLKKRQVYICVVFLKIGEIDTIKEQFTADIIVKAKWREPSLDFHIDGLNYDWSKCWTPKLYVENTVGDPREHVYQMITFNEFGHAFLCEKRRVSGVFLENLELNHFPFDVQDLTIIVATTLSSSEIRLVNDPDEPHRINKQSFVDEQEWFLYKNIESEQKDMIFEYADPLSVRPALLVQCRAARRPAYFLWNLFLVTFLICSLSLVTFAVDKDLPQNRLQLSYTLVLTLIAFKFVVNQCLPKISYLTYLDKYIISNLFFLTLVCAWHGLXXXXXXXXXXXXXSLSENLELYVLISISVGYGLYNLGFVLVIYLVAFKRRRQMQKLDKEYLEKVQCQIKTKGNRRARMNQQTRQIHEVKANGSTV 1372
            MTMQDVSKGLVAPEDNWNWYRKRSSGSSQNNDSEFSVYEIHQSRRMSTLAVRVPCIDLRHSLMNIPTAGDDTLKKRQVYICVVFLKIGEIDTIKEQFTADIIVKAKWREPSLDFHIDGLNYDWSKCWTPKLYVENTVGDPREHVYQMITFNEFGHAFLCEKRRVSGVFLENLELNHFPFDVQDLTIIVATTLSSSEIRLVNDPDEPHRINKQSFVDEQEWFLYKNIESEQKDMIFEYADPLSVRPALLVQCRAARRPAYFLWNLFLVTFLICSLSLVTFAVDKDLPQNRLQLSYTLVLTLIAFKFVVNQCLPKISYLTYLDKYIISNLFFLTLVCAWHGLVVVINRIIKRVNKSLSENLELYVLISISVGYGLYNLGFVLVIYLVAFKRRRQMQKLDKEYLEKVQCQIKTKGNRRARMNQQTRQIHEVKANGSTV
Sbjct:    1 MTMQDVSKGLVAPEDNWNWYRKRSSGSSQNNDSEFSVYEIHQSRRMSTLAVRVPCIDLRHSLMNIPTAGDDTLKKRQVYICVVFLKIGEIDTIKEQFTADIIVKAKWREPSLDFHIDGLNYDWSKCWTPKLYVENTVGDPREHVYQMITFNEFGHAFLCEKRRVSGVFLENLELNHFPFDVQDLTIIVATTLSSSEIRLVNDPDEPHRINKQSFVDEQEWFLYKNIESEQKDMIFEYADPLSVRPALLVQCRAARRPAYFLWNLFLVTFLICSLSLVTFAVDKDLPQNRLQLSYTLVLTLIAFKFVVNQCLPKISYLTYLDKYIISNLFFLTLVCAWHGLVVVINRIIKRVNKSLSENLELYVLISISVGYGLYNLGFVLVIYLVAFKRRRQMQKLDKEYLEKVQCQIKTKGNRRARMNQQTRQIHEVKANGSTV 435          
BLAST of Neur_chan_LBD domain-containing protein vs. Planmine SMEST
Match: SMESG000039749.1 (SMESG000039749.1)

HSP 1 Score: 869.381 bits (2245), Expect = 0.000e+0
Identity = 433/433 (100.00%), Postives = 433/433 (100.00%), Query Frame = 2
Query:   74 MQDVSKGLVAPEDNWNWYRKRSSGSSQNNDSEFSVYEIHQSRRMSTLAVRVPCIDLRHSLMNIPTAGDDTLKKRQVYICVVFLKIGEIDTIKEQFTADIIVKAKWREPSLDFHIDGLNYDWSKCWTPKLYVENTVGDPREHVYQMITFNEFGHAFLCEKRRVSGVFLENLELNHFPFDVQDLTIIVATTLSSSEIRLVNDPDEPHRINKQSFVDEQEWFLYKNIESEQKDMIFEYADPLSVRPALLVQCRAARRPAYFLWNLFLVTFLICSLSLVTFAVDKDLPQNRLQLSYTLVLTLIAFKFVVNQCLPKISYLTYLDKYIISNLFFLTLVCAWHGLXXXXXXXXXXXXXSLSENLELYVLISISVGYGLYNLGFVLVIYLVAFKRRRQMQKLDKEYLEKVQCQIKTKGNRRARMNQQTRQIHEVKANGSTV 1372
            MQDVSKGLVAPEDNWNWYRKRSSGSSQNNDSEFSVYEIHQSRRMSTLAVRVPCIDLRHSLMNIPTAGDDTLKKRQVYICVVFLKIGEIDTIKEQFTADIIVKAKWREPSLDFHIDGLNYDWSKCWTPKLYVENTVGDPREHVYQMITFNEFGHAFLCEKRRVSGVFLENLELNHFPFDVQDLTIIVATTLSSSEIRLVNDPDEPHRINKQSFVDEQEWFLYKNIESEQKDMIFEYADPLSVRPALLVQCRAARRPAYFLWNLFLVTFLICSLSLVTFAVDKDLPQNRLQLSYTLVLTLIAFKFVVNQCLPKISYLTYLDKYIISNLFFLTLVCAWHGLVVVINRIIKRVNKSLSENLELYVLISISVGYGLYNLGFVLVIYLVAFKRRRQMQKLDKEYLEKVQCQIKTKGNRRARMNQQTRQIHEVKANGSTV
Sbjct:    1 MQDVSKGLVAPEDNWNWYRKRSSGSSQNNDSEFSVYEIHQSRRMSTLAVRVPCIDLRHSLMNIPTAGDDTLKKRQVYICVVFLKIGEIDTIKEQFTADIIVKAKWREPSLDFHIDGLNYDWSKCWTPKLYVENTVGDPREHVYQMITFNEFGHAFLCEKRRVSGVFLENLELNHFPFDVQDLTIIVATTLSSSEIRLVNDPDEPHRINKQSFVDEQEWFLYKNIESEQKDMIFEYADPLSVRPALLVQCRAARRPAYFLWNLFLVTFLICSLSLVTFAVDKDLPQNRLQLSYTLVLTLIAFKFVVNQCLPKISYLTYLDKYIISNLFFLTLVCAWHGLVVVINRIIKRVNKSLSENLELYVLISISVGYGLYNLGFVLVIYLVAFKRRRQMQKLDKEYLEKVQCQIKTKGNRRARMNQQTRQIHEVKANGSTV 433          
BLAST of Neur_chan_LBD domain-containing protein vs. Planmine SMEST
Match: SMESG000066647.1 (SMESG000066647.1)

HSP 1 Score: 559.296 bits (1440), Expect = 0.000e+0
Identity = 272/418 (65.07%), Postives = 332/418 (79.43%), Query Frame = 2
Query:  125 YRKRSSGSSQNNDSEFSVYEI---HQSRRMSTLAVRVPCIDLRHSLMNIPTAGDDTLKKRQVYICVVFLKIGEIDTIKEQFTADIIVKAKWREPSLDFHIDGLNYDWSKCWTPKLYVENTVGDPREHVYQMITFNEFGHAFLCEKRRVSGVFLENLELNHFPFDVQDLTIIVATTLSSSEIRLVNDPDEPHRINKQSFVDEQEWFLYKNIESEQKDMIFEYADPLSVRPALLVQCRAARRPAYFLWNLFLVTFLICSLSLVTFAVDKDLPQNRLQLSYTLVLTLIAFKFVVNQCLPKISYLTYLDKYIISNLFFLTLVCAWHGLXXXXXXXXXXXXXSLSENLELYVLISISVGYGLYNLGFVLVIYLVAFKRRRQMQKLDKEYLEKVQCQIKTKGNRRARMNQQTRQIHEVKANGST 1369
            Y K  S  S +ND    + E    H ++R     +R+   +  H L +      DT  K QVY+CVVFLKIGEIDTIKEQ+ AD+++K+KWREP LD   + L YDW+  W+PKLY+ENT+G+ +EHVY MITFNEF HAFLCEKRRVSGVFLENLELNHFPFDVQDLTI VA+ L +SEIRLVNDPDE HRINKQSFVDEQEW+LYK+IE+EQ+++ +EY D  +VRPAL V+CRAARRPAYF+WN+FLVTFLICSLSLVTFAVDK LPQNRLQL+YTLVLTL+AFKFVVNQCLPKISYLTYLDKY+IS+LF LTL+C WHGL+VVI ++  R    + +++E+YV+I +++GY  YN+ F+++IY VA KRRR M + DKEY+EKVQCQ+K KG R  RM QQT Q+HEVK NG+ 
Sbjct:   55 YTKSESTKSNDNDRASIINETLFNHANKR-----IRMKSFNKFHRL-DSKCLNVDTSIKHQVYVCVVFLKIGEIDTIKEQYAADVLIKSKWREPMLDNQTETLKYDWANSWSPKLYIENTIGEAKEHVYHMITFNEFNHAFLCEKRRVSGVFLENLELNHFPFDVQDLTITVASNLPTSEIRLVNDPDETHRINKQSFVDEQEWYLYKHIETEQRELAYEYTDLATVRPALSVKCRAARRPAYFIWNIFLVTFLICSLSLVTFAVDKKLPQNRLQLTYTLVLTLVAFKFVVNQCLPKISYLTYLDKYVISSLFILTLICLWHGLIVVIEKVSDRFKYVIPDDMEVYVIIFMAIGYMGYNIAFIVMIYCVACKRRRDMMQRDKEYVEKVQCQMKYKGMRAMRMIQQTHQLHEVKENGNA 466          
BLAST of Neur_chan_LBD domain-containing protein vs. Planmine SMEST
Match: SMESG000066647.1 (SMESG000066647.1)

HSP 1 Score: 556.599 bits (1433), Expect = 0.000e+0
Identity = 258/361 (71.47%), Postives = 310/361 (85.87%), Query Frame = 2
Query:  290 KRQVYICVVFLKIGEIDTIKEQFTADIIVKAKWREPSLDFHIDGLNYDWSKCWTPKLYVENTVGDPREHVYQMITFNEFGHAFLCEKRRVSGVFLENLELNHFPFDVQDLTIIVATTLSSSEIRLVNDPDEPHRINKQSFVDEQEWFLYKNIESEQKDMIFEYADPLSVRPALLVQCRAARRPAYFLWNLFLVTFLICSLSLVTFAVDKDLPQNRLQLSYTLVLTLIAFKFVVNQCLPKISYLTYLDKYIISNLFFLTLVCAWHGLXXXXXXXXXXXXXSLSENLELYVLISISVGYGLYNLGFVLVIYLVAFKRRRQMQKLDKEYLEKVQCQIKTKGNRRARMNQQTRQIHEVKANGSTV 1372
            K QVY+CVVFLKIGEIDTIKEQ+ AD+++K+KWREP LD   + L YDW+  W+PKLY+ENT+G+ +EHVY MITFNEF HAFLCEKRRVSGVFLENLELNHFPFDVQDLTI VA+ L +SEIRLVNDPDE HRINKQSFVDEQEW+LYK+IE+EQ+++ +EY D  +VRPAL V+CRAARRPAYF+WN+FLVTFLICSLSLVTFAVDK LPQNRLQL+YTLVLTL+AFKFVVNQCLPKISYLTYLDKY+IS+LF LTL+C WHGL+VVI ++  R    + +++E+YV+I +++GY  YN+ F+++IY VA KRRR M + DKEY+EKVQCQ+K KG R  RM QQT Q+HEVK NG+  
Sbjct:  226 KHQVYVCVVFLKIGEIDTIKEQYAADVLIKSKWREPMLDNQTETLKYDWANSWSPKLYIENTIGEAKEHVYHMITFNEFNHAFLCEKRRVSGVFLENLELNHFPFDVQDLTITVASNLPTSEIRLVNDPDETHRINKQSFVDEQEWYLYKHIETEQRELAYEYTDLATVRPALSVKCRAARRPAYFIWNIFLVTFLICSLSLVTFAVDKKLPQNRLQLTYTLVLTLVAFKFVVNQCLPKISYLTYLDKYVISSLFILTLICLWHGLIVVIEKVSDRFKYVIPDDMEVYVIIFMAIGYMGYNIAFIVMIYCVACKRRRDMMQRDKEYVEKVQCQMKYKGMRAMRMIQQTHQLHEVKENGNAT 586          
The following BLAST results are available for this feature:
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GABRB21.405e-721.40gamma-aminobutyric acid type A receptor beta2 subu... [more]
GABRB21.615e-721.27gamma-aminobutyric acid type A receptor beta2 subu... [more]
GABRB21.615e-721.27gamma-aminobutyric acid type A receptor beta2 subu... [more]
GABRB21.735e-721.40gamma-aminobutyric acid type A receptor beta2 subu... [more]
GABRB21.735e-721.40gamma-aminobutyric acid type A receptor beta2 subu... [more]
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gab-14.344e-1025.81Gamma-aminobutyric acid receptor subunit beta [So... [more]
lgc-185.782e-921.68Ligand-Gated ion Channel [Source:UniProtKB/TrEMBL... [more]
deg-33.552e-822.35Acetylcholine receptor subunit alpha-type deg-3 [... [more]
deg-33.552e-822.35Acetylcholine receptor subunit alpha-type deg-3 [... [more]
pbo-55.384e-823.27Proton-gated ion channel subunit pbo-5 [Source:Un... [more]
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Lcch32.510e-923.53gene:FBgn0010240 transcript:FBtr0074129[more]
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
glra19.843e-822.73glycine receptor, alpha 1 [Source:NCBI gene;Acc:30... [more]
glra19.895e-822.73glycine receptor, alpha 1 [Source:NCBI gene;Acc:30... [more]
glra11.122e-722.73glycine receptor, alpha 1 [Source:NCBI gene;Acc:30... [more]
glra4a8.623e-721.17glycine receptor, alpha 4a [Source:ZFIN;Acc:ZDB-GE... [more]
glra4a8.930e-721.17glycine receptor, alpha 4a [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000020832.11.342e-721.35gamma-aminobutyric acid type A receptor theta subu... [more]
ENSXETT00000020814.11.701e-721.35gamma-aminobutyric acid type A receptor theta subu... [more]
ENSXETT00000004017.11.847e-721.76gamma-aminobutyric acid (GABA) A receptor, beta 1 ... [more]
GLRA12.678e-722.73glycine receptor alpha 1 [Source:NCBI gene;Acc:100... [more]
GLRA13.212e-722.73glycine receptor alpha 1 [Source:NCBI gene;Acc:100... [more]
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gabrb21.148e-721.40gamma-aminobutyric acid (GABA) A receptor, subunit... [more]
Gabrb21.289e-721.40gamma-aminobutyric acid (GABA) A receptor, subunit... [more]
Glrb1.347e-624.61glycine receptor, beta subunit [Source:MGI Symbol;... [more]
Chrna11.587e-621.13cholinergic receptor, nicotinic, alpha polypeptide... [more]
Gabrb32.387e-621.64gamma-aminobutyric acid (GABA) A receptor, subunit... [more]
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P0C7B7|ELIC_DICCH1.113e-1224.91Cys-loop ligand-gated ion channel OS=Dickeya chrys... [more]
sp|O18276|GBRB_CAEEL5.526e-925.81Gamma-aminobutyric acid receptor subunit beta OS=C... [more]
sp|Q08832|GBRB3_DROME2.516e-823.53Gamma-aminobutyric acid receptor subunit beta-like... [more]
sp|P54244|ACH3_CAEEL4.518e-722.35Acetylcholine receptor subunit alpha-type deg-3 OS... [more]
sp|G5ECT0|PBO5_CAEEL6.848e-723.27Proton-gated ion channel subunit pbo-5 OS=Caenorha... [more]
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0V0J6K75.193e-17265.12Neur_chan_LBD domain-containing protein OS=Schisto... [more]
A0A210Q1431.221e-12053.35Cys-loop ligand-gated ion channel OS=Mizuhopecten ... [more]
A0A2T7Q0046.562e-11951.36Neur_chan_LBD domain-containing protein OS=Pomacea... [more]
R7UZT03.642e-11850.55Neur_chan_LBD domain-containing protein OS=Capitel... [more]
A0A1S3HM705.579e-11849.60uncharacterized protein LOC106156405 isoform X5 OS... [more]
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
glra17.928e-822.73glycine receptor alpha 1 [Source:NCBI gene;Acc:103... [more]
glra18.990e-822.73glycine receptor alpha 1 [Source:NCBI gene;Acc:103... [more]
GABRB27.568e-721.64gamma-aminobutyric acid receptor subunit beta-2 [S... [more]
GABRB28.206e-721.64gamma-aminobutyric acid receptor subunit beta-2 [S... [more]
glrbb1.516e-623.92glycine receptor beta [Source:NCBI gene;Acc:103040... [more]
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gabrb33.431e-732.22gamma-aminobutyric acid type A receptor beta3 subu... [more]
glra24.651e-723.11glycine receptor, alpha 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
gabrb32.262e-631.11gamma-aminobutyric acid type A receptor beta3 subu... [more]
glra4a2.354e-620.97glycine receptor, alpha 4a [Source:ZFIN;Acc:ZDB-GE... [more]
glra13.114e-620.24glycine receptor, alpha 1 [Source:NCBI gene;Acc:30... [more]
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO327902.085e-3627.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO268598.163e-1727.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO407465.708e-1225.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO375552.234e-1023.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO373965.280e-1024.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
glra19.289e-822.35glycine receptor alpha 1 [Source:NCBI gene;Acc:101... [more]
glra11.007e-722.35glycine receptor alpha 1 [Source:NCBI gene;Acc:101... [more]
glra11.060e-722.35glycine receptor alpha 1 [Source:NCBI gene;Acc:101... [more]
si:ch211-39a7.12.798e-719.25neuronal acetylcholine receptor subunit alpha-7-li... [more]
si:ch211-39a7.13.646e-719.25neuronal acetylcholine receptor subunit alpha-7-li... [more]
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000039749.10.000e+0100.00SMESG000039749.1[more]
SMESG000039749.10.000e+0100.00SMESG000039749.1[more]
SMESG000039749.10.000e+0100.00SMESG000039749.1[more]
SMESG000066647.10.000e+065.07SMESG000066647.1[more]
SMESG000066647.10.000e+071.47SMESG000066647.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019205 ID=SMED30019205|Name=Neur_chan_LBD domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1431bp
GAATATTCATTAATTTCTTTCGGTTTCTAATACATTTGCAGAATCCGCAA
TGTTTCCAAATCGAATCATGACGATGCAGGACGTTTCAAAGGGCTTAGTA
GCCCCAGAGGACAATTGGAATTGGTATAGAAAACGGTCAAGTGGATCAAG
TCAAAATAATGATAGTGAGTTCTCTGTTTATGAAATACATCAAAGCCGAA
GAATGTCGACGTTAGCGGTTAGGGTTCCGTGTATTGACTTGAGGCACAGT
TTAATGAACATTCCCACTGCAGGCGATGATACGCTTAAAAAAAGGCAGGT
TTATATTTGCGTAGTTTTCCTTAAAATTGGGGAAATTGATACAATAAAAG
AACAGTTTACAGCTGATATAATAGTAAAAGCAAAATGGAGAGAACCAAGT
TTGGATTTTCATATTGATGGATTGAACTATGATTGGTCAAAATGCTGGAC
ACCGAAACTTTATGTAGAAAACACAGTCGGAGACCCAAGAGAGCATGTTT
ATCAAATGATTACCTTCAATGAATTCGGACACGCTTTTCTCTGTGAGAAA
CGAAGAGTTTCAGGAGTATTTTTAGAAAATCTTGAATTGAATCATTTCCC
TTTTGATGTTCAAGATTTGACAATAATAGTAGCTACGACTTTGTCAAGTT
CTGAAATTCGGCTGGTTAATGATCCAGACGAACCGCATCGAATTAATAAA
CAATCATTTGTGGACGAACAGGAATGGTTTCTTTATAAGAACATCGAGTC
AGAACAGAAGGACATGATTTTCGAATATGCTGATCCATTGTCTGTGAGGC
CGGCTTTGCTTGTTCAATGTAGAGCTGCACGAAGACCAGCTTATTTTTTG
TGGAATCTCTTTTTAGTTACATTTTTGATCTGCTCACTATCTCTAGTCAC
CTTTGCTGTTGATAAAGATCTACCTCAGAATAGACTTCAGTTGTCATACA
CTCTTGTTTTGACGTTGATTGCGTTTAAATTTGTGGTCAACCAATGCTTG
CCTAAAATATCTTACCTTACCTACTTAGATAAATATATTATTTCAAATCT
ATTCTTTTTGACTTTGGTTTGTGCTTGGCATGGATTGGTAGTAGTGATTA
ATAGAATAATCAAAAGAGTAAATAAAAGTCTGAGTGAAAATTTAGAATTA
TACGTCCTTATTTCAATATCAGTTGGGTATGGTCTCTACAATTTGGGTTT
TGTCCTTGTTATTTATCTTGTGGCTTTTAAAAGACGAAGACAAATGCAGA
AATTGGACAAAGAGTATTTGGAGAAAGTTCAATGTCAAATAAAAACGAAA
GGAAATCGTCGAGCGAGAATGAATCAGCAAACCAGACAAATCCATGAAGT
TAAAGCAAATGGTTCGACAGTTTTCATTTAATTTTTCTGTAATAAATTTT
TCAAAAATATTTTTTTTCTGATGCTAATAAG
back to top

protein sequence of SMED30019205-orf-1

>SMED30019205-orf-1 ID=SMED30019205-orf-1|Name=SMED30019205-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=444bp
MFPNRIMTMQDVSKGLVAPEDNWNWYRKRSSGSSQNNDSEFSVYEIHQSR
RMSTLAVRVPCIDLRHSLMNIPTAGDDTLKKRQVYICVVFLKIGEIDTIK
EQFTADIIVKAKWREPSLDFHIDGLNYDWSKCWTPKLYVENTVGDPREHV
YQMITFNEFGHAFLCEKRRVSGVFLENLELNHFPFDVQDLTIIVATTLSS
SEIRLVNDPDEPHRINKQSFVDEQEWFLYKNIESEQKDMIFEYADPLSVR
PALLVQCRAARRPAYFLWNLFLVTFLICSLSLVTFAVDKDLPQNRLQLSY
TLVLTLIAFKFVVNQCLPKISYLTYLDKYIISNLFFLTLVCAWHGLVVVI
NRIIKRVNKSLSENLELYVLISISVGYGLYNLGFVLVIYLVAFKRRRQMQ
KLDKEYLEKVQCQIKTKGNRRARMNQQTRQIHEVKANGSTVFI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004888transmembrane signaling receptor activity
GO:0005216ion channel activity
GO:0005230extracellular ligand-gated ion channel activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000099neuron
PLANA:0000418head
PLANA:0003104enteric muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR036734Neur_chan_lig-bd_sf
IPR006201Neur_channel
IPR036719Neuro-gated_channel_TM_sf
IPR006202Neur_chan_lig-bd
IPR006029Neurotrans-gated_channel_TM
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0006811ion transport
GO:0034220ion transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006202Neurotransmitter-gated ion-channel ligand-binding domainPFAMPF02931Neur_chan_LBDcoord: 83..230
e-value: 3.3E-9
score: 36.5
IPR036734Neurotransmitter-gated ion-channel ligand-binding domain superfamilyGENE3DG3DSA:2.70.170.10coord: 77..247
e-value: 1.4E-19
score: 72.4
IPR036734Neurotransmitter-gated ion-channel ligand-binding domain superfamilySUPERFAMILYSSF63712Nicotinic receptor ligand binding domain-likecoord: 82..230
NoneNo IPR availableGENE3DG3DSA:1.20.58.390coord: 263..393
e-value: 3.8E-20
score: 74.1
NoneNo IPR availablePANTHERPTHR18945:SF768coord: 79..371
NoneNo IPR availableCDDcd19050LGIC_TM_bactcoord: 265..340
e-value: 7.5827E-17
score: 74.167
NoneNo IPR availableCDDcd18988LGIC_ECD_bactcoord: 83..222
e-value: 1.49019E-19
score: 83.8814
NoneNo IPR availableTMHMMTMhelixcoord: 264..286
NoneNo IPR availableTMHMMTMhelixcoord: 296..313
NoneNo IPR availableTMHMMTMhelixcoord: 369..391
NoneNo IPR availableTMHMMTMhelixcoord: 332..354
IPR006201Neurotransmitter-gated ion-channelPANTHERPTHR18945NEUROTRANSMITTER GATED ION CHANNELcoord: 79..371
IPR036719Neurotransmitter-gated ion-channel transmembrane domain superfamilySUPERFAMILYSSF90112Neurotransmitter-gated ion-channel transmembrane porecoord: 263..352