Synaptotagmin-15

Overview
NameSynaptotagmin-15
Smed IDSMED30019199
Length (bp)1226
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Synaptotagmin-15 (SMED30019199) t-SNE clustered cells

Violin plots show distribution of expression levels for Synaptotagmin-15 (SMED30019199) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Synaptotagmin-15 (SMED30019199) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Synaptotagmin-15 (SMED30019199) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019199

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30019199SMESG000037727.1 SMESG000037722.1 dd_Smed_v6_25279_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Synaptotagmin-15 vs. Ensembl Human
Match: SYT15 (synaptotagmin 15 [Source:HGNC Symbol;Acc:HGNC:17167])

HSP 1 Score: 107.071 bits (266), Expect = 6.937e-25
Identity = 83/309 (26.86%), Postives = 152/309 (49.19%), Query Frame = 2
Query:  209 LGTLNPALYQTEEVEDLYDLQIDHVGRIWFTITYNCSTECLIVNFHKIRNLKVXXXXXXXXDCQYLSVKIFLENLERNYQNTTIKKYSSNSDFNEKFLFQVPFSALRSRTLHFFILLSEKDRHGKPVAVSSYQLTEIASDERIDKDIIKILTKARIYRDLSEHNSNQISCCPEICISLKYHSDTHRLNVTIYNVRNV-FNNDKGI---YVKLKLF---KGLTCKEKQSKQTSISKENYIFNESFTF-FKIFSLDFISLQITLLSEKTLFGIYDKPIGSATLGSHLFAKGKELSYWLQMVNQPDEHIICW 1111
            +G +NP LY+  E +   D     +GR+WF++ Y    E L+V   K ++L+  S+      C  L VK++L   ER +  +  K+ +SN  F+E F+FQV    +  R L F +   ++ R  + +    + L     +E +  D  ++     I+RDL   +    S   ++   L Y+    RL V +   + +    D+GI   +VK+ L    K + CK+  +   SI   N ++NE+F+F      LD  SL +T++  + + G   + +G   +G +++ +G+EL +W +M+++P E +  W
Sbjct:  124 VGAINPELYKFPEDKSETDFPDGCLGRLWFSVEYEQEAERLLVGLIKAQHLQAPSET-----CSPL-VKLYLLPDERRFLQSKTKRKTSNPQFDEHFIFQVSSKTITQRVLKFSVYHVDRQRKHQLLGQVLFPL----KNETLVGDCRRV-----IWRDLEAESLEPPSEFGDLQFCLSYNDYLSRLTVVVLRAKGLRLQEDRGIVSVFVKVSLMNHNKFVKCKKTSAVLGSI---NPVYNETFSFKADATELDTASLSLTVV--QNMEGDKSQQLGRVVVGPYMYTRGRELEHWDEMLSKPKELVKRW 412          
BLAST of Synaptotagmin-15 vs. Ensembl Human
Match: FO681492.2 (synaptotagmin-15 [Source:NCBI gene;Acc:102724488])

HSP 1 Score: 106.686 bits (265), Expect = 1.155e-24
Identity = 83/309 (26.86%), Postives = 152/309 (49.19%), Query Frame = 2
Query:  209 LGTLNPALYQTEEVEDLYDLQIDHVGRIWFTITYNCSTECLIVNFHKIRNLKVXXXXXXXXDCQYLSVKIFLENLERNYQNTTIKKYSSNSDFNEKFLFQVPFSALRSRTLHFFILLSEKDRHGKPVAVSSYQLTEIASDERIDKDIIKILTKARIYRDLSEHNSNQISCCPEICISLKYHSDTHRLNVTIYNVRNV-FNNDKGI---YVKLKLF---KGLTCKEKQSKQTSISKENYIFNESFTF-FKIFSLDFISLQITLLSEKTLFGIYDKPIGSATLGSHLFAKGKELSYWLQMVNQPDEHIICW 1111
            +G +NP LY+  E +   D     +GR+WF++ Y    E L+V   K ++L+  S+      C  L VK++L   ER +  +  K+ +SN  F+E F+FQV    +  R L F +   ++ R  + +    + L     +E +  D  ++     I+RDL   +    S   ++   L Y+    RL V +   + +    D+GI   +VK+ L    K + CK+  +   SI   N ++NE+F+F      LD  SL +T++  + + G   + +G   +G +++ +G+EL +W +M+++P E +  W
Sbjct:  147 VGAINPELYKFPEDKSETDFPDGCLGRLWFSVEYEQEAERLLVGLIKAQHLQAPSET-----CSPL-VKLYLLPDERRFLQSKTKRKTSNPQFDEHFIFQVSSKTITQRVLKFSVYHVDRQRKHQLLGQVLFPL----KNETLVGDCRRV-----IWRDLEAESLEPPSEFGDLQFCLSYNDYLSRLTVVVLRAKGLRLQEDRGIVSVFVKVSLMNHNKFVKCKKTSAVLGSI---NPVYNETFSFKADATELDTASLSLTVV--QNMEGDKSQQLGRVVVGPYMYTRGRELEHWDEMLSKPKELVKRW 435          
BLAST of Synaptotagmin-15 vs. Ensembl Human
Match: FO681492.1 (synaptotagmin-15 [Source:NCBI gene;Acc:102724488])

HSP 1 Score: 106.686 bits (265), Expect = 1.155e-24
Identity = 83/309 (26.86%), Postives = 152/309 (49.19%), Query Frame = 2
Query:  209 LGTLNPALYQTEEVEDLYDLQIDHVGRIWFTITYNCSTECLIVNFHKIRNLKVXXXXXXXXDCQYLSVKIFLENLERNYQNTTIKKYSSNSDFNEKFLFQVPFSALRSRTLHFFILLSEKDRHGKPVAVSSYQLTEIASDERIDKDIIKILTKARIYRDLSEHNSNQISCCPEICISLKYHSDTHRLNVTIYNVRNV-FNNDKGI---YVKLKLF---KGLTCKEKQSKQTSISKENYIFNESFTF-FKIFSLDFISLQITLLSEKTLFGIYDKPIGSATLGSHLFAKGKELSYWLQMVNQPDEHIICW 1111
            +G +NP LY+  E +   D     +GR+WF++ Y    E L+V   K ++L+  S+      C  L VK++L   ER +  +  K+ +SN  F+E F+FQV    +  R L F +   ++ R  + +    + L     +E +  D  ++     I+RDL   +    S   ++   L Y+    RL V +   + +    D+GI   +VK+ L    K + CK+  +   SI   N ++NE+F+F      LD  SL +T++  + + G   + +G   +G +++ +G+EL +W +M+++P E +  W
Sbjct:  147 VGAINPELYKFPEDKSETDFPDGCLGRLWFSVEYEQEAERLLVGLIKAQHLQAPSET-----CSPL-VKLYLLPDERRFLQSKTKRKTSNPQFDEHFIFQVSSKTITQRVLKFSVYHVDRQRKHQLLGQVLFPL----KNETLVGDCRRV-----IWRDLEAESLEPPSEFGDLQFCLSYNDYLSRLTVVVLRAKGLRLQEDRGIVSVFVKVSLMNHNKFVKCKKTSAVLGSI---NPVYNETFSFKADATELDTASLSLTVV--QNMEGDKSQQLGRVVVGPYMYTRGRELEHWDEMLSKPKELVKRW 435          
BLAST of Synaptotagmin-15 vs. Ensembl Human
Match: FO681492.2 (synaptotagmin-15 [Source:NCBI gene;Acc:102724488])

HSP 1 Score: 105.916 bits (263), Expect = 2.582e-24
Identity = 83/309 (26.86%), Postives = 152/309 (49.19%), Query Frame = 2
Query:  209 LGTLNPALYQTEEVEDLYDLQIDHVGRIWFTITYNCSTECLIVNFHKIRNLKVXXXXXXXXDCQYLSVKIFLENLERNYQNTTIKKYSSNSDFNEKFLFQVPFSALRSRTLHFFILLSEKDRHGKPVAVSSYQLTEIASDERIDKDIIKILTKARIYRDLSEHNSNQISCCPEICISLKYHSDTHRLNVTIYNVRNV-FNNDKGI---YVKLKLF---KGLTCKEKQSKQTSISKENYIFNESFTF-FKIFSLDFISLQITLLSEKTLFGIYDKPIGSATLGSHLFAKGKELSYWLQMVNQPDEHIICW 1111
            +G +NP LY+  E +   D     +GR+WF++ Y    E L+V   K ++L+  S+      C  L VK++L   ER +  +  K+ +SN  F+E F+FQV    +  R L F +   ++ R  + +    + L     +E +  D  ++     I+RDL   +    S   ++   L Y+    RL V +   + +    D+GI   +VK+ L    K + CK+  +   SI   N ++NE+F+F      LD  SL +T++  + + G   + +G   +G +++ +G+EL +W +M+++P E +  W
Sbjct:  177 VGAINPELYKFPEDKSETDFPDGCLGRLWFSVEYEQEAERLLVGLIKAQHLQAPSET-----CSPL-VKLYLLPDERRFLQSKTKRKTSNPQFDEHFIFQVSSKTITQRVLKFSVYHVDRQRKHQLLGQVLFPL----KNETLVGDCRRV-----IWRDLEAESLEPPSEFGDLQFCLSYNDYLSRLTVVVLRAKGLRLQEDRGIVSVFVKVSLMNHNKFVKCKKTSAVLGSI---NPVYNETFSFKADATELDTASLSLTVV--QNMEGDKSQQLGRVVVGPYMYTRGRELEHWDEMLSKPKELVKRW 465          
BLAST of Synaptotagmin-15 vs. Ensembl Human
Match: SYT15 (synaptotagmin 15 [Source:HGNC Symbol;Acc:HGNC:17167])

HSP 1 Score: 105.916 bits (263), Expect = 2.582e-24
Identity = 83/309 (26.86%), Postives = 152/309 (49.19%), Query Frame = 2
Query:  209 LGTLNPALYQTEEVEDLYDLQIDHVGRIWFTITYNCSTECLIVNFHKIRNLKVXXXXXXXXDCQYLSVKIFLENLERNYQNTTIKKYSSNSDFNEKFLFQVPFSALRSRTLHFFILLSEKDRHGKPVAVSSYQLTEIASDERIDKDIIKILTKARIYRDLSEHNSNQISCCPEICISLKYHSDTHRLNVTIYNVRNV-FNNDKGI---YVKLKLF---KGLTCKEKQSKQTSISKENYIFNESFTF-FKIFSLDFISLQITLLSEKTLFGIYDKPIGSATLGSHLFAKGKELSYWLQMVNQPDEHIICW 1111
            +G +NP LY+  E +   D     +GR+WF++ Y    E L+V   K ++L+  S+      C  L VK++L   ER +  +  K+ +SN  F+E F+FQV    +  R L F +   ++ R  + +    + L     +E +  D  ++     I+RDL   +    S   ++   L Y+    RL V +   + +    D+GI   +VK+ L    K + CK+  +   SI   N ++NE+F+F      LD  SL +T++  + + G   + +G   +G +++ +G+EL +W +M+++P E +  W
Sbjct:  177 VGAINPELYKFPEDKSETDFPDGCLGRLWFSVEYEQEAERLLVGLIKAQHLQAPSET-----CSPL-VKLYLLPDERRFLQSKTKRKTSNPQFDEHFIFQVSSKTITQRVLKFSVYHVDRQRKHQLLGQVLFPL----KNETLVGDCRRV-----IWRDLEAESLEPPSEFGDLQFCLSYNDYLSRLTVVVLRAKGLRLQEDRGIVSVFVKVSLMNHNKFVKCKKTSAVLGSI---NPVYNETFSFKADATELDTASLSLTVV--QNMEGDKSQQLGRVVVGPYMYTRGRELEHWDEMLSKPKELVKRW 465          
BLAST of Synaptotagmin-15 vs. Ensembl Celegans
Match: snt-1 (Synaptotagmin-1 [Source:UniProtKB/Swiss-Prot;Acc:P34693])

HSP 1 Score: 62.003 bits (149), Expect = 3.162e-10
Identity = 80/302 (26.49%), Postives = 131/302 (43.38%), Query Frame = 2
Query:  281 VGRIWFTITYNCSTECLIVNFHKIRNLKVXXXXXXXXDCQYLS---VKIFLENLERNYQNTTIKKYSSNSDFNEKFLFQVPFSALRSRTLHFFILLSEKDRHGKPVAVSSYQLTEIASDERIDKDII---KILTKARI--YRDLSEHNSNQIS--CCPEICISLKYHSDTHRLNVTIYNVRNVFNNDKG----IYVKLKLF----KGLTCKEKQSKQTSISKENYIFNESFTFFK--IFSLDFISLQITLLSEKTLFGIYDK-----PIGSATLGSHLFAKGKELSYWLQMVNQPDEHIICW 1111
            +GRI + + Y+     L V   +  +L          D    S   VK++L   ++    T + + + N  FNE F+F+V F+ + ++TL F I                Y     +  ++I + +I   KI   A I  ++D++    ++ +     +IC SL+Y     +L V I   +N+   D G     YVKL++F    K L  K+   K+ ++   N  FNESF F K  +  +  +SL IT++        YDK      IG   LG +    G EL +W+ M+  P   I  W
Sbjct:  160 LGRIQYKLDYDFQQGQLTVTVIQAEDLP-------GMDMSGTSDPYVKLYLLPEKKKKVETKVHRKTLNPVFNETFIFKVAFNEITAKTLVFAI----------------YDFDRFSKHDQIGQVLIPLGKIDLGAVIEEWKDIAPPPDDKEAEKSLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKLEMFGEDRKRLKKKKTNIKRKTL---NPYFNESFVFDKLPLHKMKKVSLMITVMD-------YDKLGSNDAIGRCLLGCN--GTGAELRHWMDMLASPRRPIAQW 426          
BLAST of Synaptotagmin-15 vs. Ensembl Celegans
Match: snt-1 (Synaptotagmin-1 [Source:UniProtKB/Swiss-Prot;Acc:P34693])

HSP 1 Score: 61.6178 bits (148), Expect = 3.503e-10
Identity = 80/313 (25.56%), Postives = 133/313 (42.49%), Query Frame = 2
Query:  281 VGRIWFTITYNCSTECLIVNFHKIRNLKVXXXXXXXXDCQYLS---VKIFLENLERNYQNTTIKKYSSNSDFNEKFLFQVPFSALRSRTLHFFILLSEKDRHGKPVAVSSYQLTEIASDERIDKDII---KILTKARI--YRDLSEHNSNQIS--CCPEICISLKYHSDTHRLNVTIYNVRNVFNNDKG----IYVKLKLFKGLTCKEKQSKQTSISKENYIFNESFTFFKIFS-LDFISLQITLLSEKTLFGIYDK-----PIGSATLGSHLFAKGKELSYWLQMVNQPDEHIICWLPLKY*DLQWHGTKKN 1159
            +GRI + + Y+     L V   +  +L          D    S   VK++L   ++    T + + + N  FNE F+F+V F+ + ++TL F I                Y     +  ++I + +I   KI   A I  ++D++    ++ +     +IC SL+Y     +L V I   +N+   D G     YVK+ L +G    +K+         N  +NESF+F   F  +  +SL IT++        YDK      IG   LG +    G EL +W+ M+  P   I  W  L    ++  G KK+
Sbjct:  160 LGRIQYKLDYDFQQGQLTVTVIQAEDLP-------GMDMSGTSDPYVKLYLLPEKKKKVETKVHRKTLNPVFNETFIFKVAFNEITAKTLVFAI----------------YDFDRFSKHDQIGQVLIPLGKIDLGAVIEEWKDIAPPPDDKEAEKSLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIVLMQGGKRLKKKKTSIKKCTLNPYYNESFSFEVPFEQIQKVSLMITVMD-------YDKLGSNDAIGRCLLGCN--GTGAELRHWMDMLASPRRPIAQWHTLG--PVEEEGDKKD 438          
BLAST of Synaptotagmin-15 vs. Ensembl Celegans
Match: snt-3 (SyNapTotagmin [Source:UniProtKB/TrEMBL;Acc:Q965S5])

HSP 1 Score: 57.7658 bits (138), Expect = 3.776e-9
Identity = 61/241 (25.31%), Postives = 109/241 (45.23%), Query Frame = 2
Query:  410 VKIFLENLERNYQNTTIKKYSSNSDFNEKFLFQVPFSALRSRTLHFFILLSEKDRHGK--PVAVSSYQLTEIASDERIDKDIIKILTKARIYRDLSEHNSNQISCCPEICISLKYHSDTHRLNVTIYNVRNVFNND----KGIYVKLKLFKGLTCKEKQSKQTSISKENYIFNESFTF-FKIFSLDFISLQITLLSEKTLFGIYDKPIGSATLGSHLFAKGKELSYWLQMVNQPDEHIICW 1111
            VK+FL   ++    T +++ S N  FNE F F++PF+ +  +TL   +   + DR GK   +   S  L ++        D+   L +  +     E   N++    E+C++L+Y  + ++L+V +   +N+   D       YVK+ L  G    EK+     +   N  +NESF+F      +  + L +T +S+    G  ++ IG   +G+   A G  L  W  M+  P   +  W
Sbjct:   55 VKLFLLPDKKKKLQTKVQRKSLNPVFNESFTFKIPFNEIGGQTLVLNVF--DFDRFGKHDQIGQISIPLGKV--------DLAATLERTDLIESPPE---NRLG---EVCLALRYVPNKNKLSVVVMECKNLKKMDVLGLSDPYVKIYLMMGTKRLEKKKTTIKMKTLNPYYNESFSFDVTSEKMQRVHLHVT-VSDYDRVGSNER-IGQVIIGT--CATGVALKQWNDMLATPRRSVAQW 275          
BLAST of Synaptotagmin-15 vs. Ensembl Celegans
Match: snt-3 (SyNapTotagmin [Source:UniProtKB/TrEMBL;Acc:Q965S5])

HSP 1 Score: 57.7658 bits (138), Expect = 3.776e-9
Identity = 61/241 (25.31%), Postives = 109/241 (45.23%), Query Frame = 2
Query:  410 VKIFLENLERNYQNTTIKKYSSNSDFNEKFLFQVPFSALRSRTLHFFILLSEKDRHGK--PVAVSSYQLTEIASDERIDKDIIKILTKARIYRDLSEHNSNQISCCPEICISLKYHSDTHRLNVTIYNVRNVFNND----KGIYVKLKLFKGLTCKEKQSKQTSISKENYIFNESFTF-FKIFSLDFISLQITLLSEKTLFGIYDKPIGSATLGSHLFAKGKELSYWLQMVNQPDEHIICW 1111
            VK+FL   ++    T +++ S N  FNE F F++PF+ +  +TL   +   + DR GK   +   S  L ++        D+   L +  +     E   N++    E+C++L+Y  + ++L+V +   +N+   D       YVK+ L  G    EK+     +   N  +NESF+F      +  + L +T +S+    G  ++ IG   +G+   A G  L  W  M+  P   +  W
Sbjct:   55 VKLFLLPDKKKKLQTKVQRKSLNPVFNESFTFKIPFNEIGGQTLVLNVF--DFDRFGKHDQIGQISIPLGKV--------DLAATLERTDLIESPPE---NRLG---EVCLALRYVPNKNKLSVVVMECKNLKKMDVLGLSDPYVKIYLMMGTKRLEKKKTTIKMKTLNPYYNESFSFDVTSEKMQRVHLHVT-VSDYDRVGSNER-IGQVIIGT--CATGVALKQWNDMLATPRRSVAQW 275          
BLAST of Synaptotagmin-15 vs. Ensembl Celegans
Match: snt-2 (Synaptotagmin 2 [Source:UniProtKB/Swiss-Prot;Acc:K8FE10])

HSP 1 Score: 52.7582 bits (125), Expect = 2.453e-7
Identity = 64/225 (28.44%), Postives = 96/225 (42.67%), Query Frame = 2
Query:  410 VKIFLENLERNYQNTTIKKYSSNSDFNEKFLFQVPFSALRSRTLHFFIL----LSEKDRHGKPVAVSSYQLTEIASDERIDKDIIKILTKARIYRDLSEHNSNQISCCPEICISLKYHSDTHRLNVTIYNVRNVFNNDKG----IYVKLKLFKGLTCKEKQSKQTSISKENYIFNESFTF-FKIFSLDFISLQITLLSEKTLFGIYDKP-----IGSATLGS-HL 1039
            VK+++    +    T I + + N  +NE F F +PF+ L S+TL   +     LS+ D+ G+     S  L  I  D  I  DI + L K        E +  +     +IC S +Y   T  + +TI   RN+   D G     YVK+ L  G     K+         N  +NESF F  +   ++ + L +++         YDK      IG  TLGS HL
Sbjct:  123 VKVYVLPERKQKFETRIIRNTLNPTYNETFQFSIPFNELHSKTLMLVVYDYDRLSKDDKMGQ----LSVPLESI--DFGITTDIERPLQKP-------EKDDEKECRLGDICFSTRYRPATGTVTLTIMEARNLKKMDVGGSSDPYVKIYLHHGRKLLSKKKTSRKYKTLNPYYNESFQFKIEPHMIEKVHLIVSVWD-------YDKMSKNDFIGEVTLGSKHL 327          
BLAST of Synaptotagmin-15 vs. Ensembl Fly
Match: Syt7 (gene:FBgn0039900 transcript:FBtr0089139)

HSP 1 Score: 61.6178 bits (148), Expect = 2.523e-10
Identity = 70/294 (23.81%), Postives = 117/294 (39.80%), Query Frame = 2
Query:  275 DHVGRIWFTITYNCSTECLIVNFHKIRNLKVXXXXXXXXDCQYLSVKIFLENLERNYQNTTIKKYSSNSDFNEKFLFQ-VPFSALRSRTLHFFILLSEKDRHGKPVAVSSYQLTEIASDERIDKDIIKILTKARIYRDLSEHNSNQISCCPEICISLKYHSDTHRLNVTIYNVRNV----FNNDKGIYVKLKLFKGLTCKEKQSKQTSISKENYIFNESFTF------FKIFSLDFISLQITLLSEKTLFGIYDKPIGSATLGSHLFAKGKELSYWLQMVNQPDEHIICWLPLK 1123
            ++VG+I F++ Y+     LI+   + + L        +    Y+ V +  +   R    T IK+ + N  +NE F F+  P   L+SR LH  +   + DR  +  ++    L     D            K   ++ L     ++   C E+  SL YH     L +T+   RN+     N     YVK+ L  G    EK+         N +FNESF+F       +  SLD + +    +    L       IG   L     +   E  +W  M+++P + ++ W  LK
Sbjct:   13 ENVGQIHFSLEYDFQNTTLILKVLQGKELPAKDLSGTSD--PYVRVTLLPDKKHR--LETKIKRRTLNPRWNETFYFEGFPIQKLQSRVLHLHVF--DYDRFSRDDSIGEVFLPLCQVD---------FAGKQSFWKALKPPAKDK---CGELLSSLCYHPSNSILTLTLIKARNLKAKDINGKSDPYVKVWLQFGDKRVEKRKTPIFTCTLNPVFNESFSFNVPWEKIRECSLDVMVMDFDNIGRNEL-------IGRILLAGKNGSGASETKHWQDMISKPRQTVVQWHRLK 281          
BLAST of Synaptotagmin-15 vs. Ensembl Fly
Match: Syt7 (gene:FBgn0039900 transcript:FBtr0343990)

HSP 1 Score: 61.2326 bits (147), Expect = 6.585e-10
Identity = 75/318 (23.58%), Postives = 126/318 (39.62%), Query Frame = 2
Query:  212 GTLNPALYQTEEVEDLYDLQID---HVGRIWFTITYNCSTECLIVNFHKIRNLKVXXXXXXXXDCQYLSVKIFLENLERNYQNTTIKKYSSNSDFNEKFLFQ-VPFSALRSRTLHFFILLSEKDRHGKPVAVSSYQLTEIASDERIDKDIIKILTKARIYRDLSEHNSNQISCCPEICISLKYHSDTHRLNVTIYNVRNV----FNNDKGIYVKLKLFKGLTCKEKQSKQTSISKENYIFNESFTF------FKIFSLDFISLQITLLSEKTLFGIYDKPIGSATLGSHLFAKGKELSYWLQMVNQPDEHIICWLPLK 1123
            GT   +  ++  + D+Y    D   +VG+I F++ Y+     LI+   + + L        +    Y+ V +  +   R    T IK+ + N  +NE F F+  P   L+SR LH  +   + DR  +  ++    L     D            K   ++ L     ++   C E+  SL YH     L +T+   RN+     N     YVK+ L  G    EK+         N +FNESF+F       +  SLD + +    +    L       IG   L     +   E  +W  M+++P + ++ W  LK
Sbjct:  122 GTTKDSANKSISMTDMYLDSTDPSENVGQIHFSLEYDFQNTTLILKVLQGKELPAKDLSGTSD--PYVRVTLLPDKKHR--LETKIKRRTLNPRWNETFYFEGFPIQKLQSRVLHLHVF--DYDRFSRDDSIGEVFLPLCQVD---------FAGKQSFWKALKPPAKDK---CGELLSSLCYHPSNSILTLTLIKARNLKAKDINGKSDPYVKVWLQFGDKRVEKRKTPIFTCTLNPVFNESFSFNVPWEKIRECSLDVMVMDFDNIGRNEL-------IGRILLAGKNGSGASETKHWQDMISKPRQTVVQWHRLK 414          
BLAST of Synaptotagmin-15 vs. Ensembl Fly
Match: Syt7 (gene:FBgn0039900 transcript:FBtr0089137)

HSP 1 Score: 61.2326 bits (147), Expect = 6.585e-10
Identity = 75/318 (23.58%), Postives = 126/318 (39.62%), Query Frame = 2
Query:  212 GTLNPALYQTEEVEDLYDLQID---HVGRIWFTITYNCSTECLIVNFHKIRNLKVXXXXXXXXDCQYLSVKIFLENLERNYQNTTIKKYSSNSDFNEKFLFQ-VPFSALRSRTLHFFILLSEKDRHGKPVAVSSYQLTEIASDERIDKDIIKILTKARIYRDLSEHNSNQISCCPEICISLKYHSDTHRLNVTIYNVRNV----FNNDKGIYVKLKLFKGLTCKEKQSKQTSISKENYIFNESFTF------FKIFSLDFISLQITLLSEKTLFGIYDKPIGSATLGSHLFAKGKELSYWLQMVNQPDEHIICWLPLK 1123
            GT   +  ++  + D+Y    D   +VG+I F++ Y+     LI+   + + L        +    Y+ V +  +   R    T IK+ + N  +NE F F+  P   L+SR LH  +   + DR  +  ++    L     D            K   ++ L     ++   C E+  SL YH     L +T+   RN+     N     YVK+ L  G    EK+         N +FNESF+F       +  SLD + +    +    L       IG   L     +   E  +W  M+++P + ++ W  LK
Sbjct:  122 GTTKDSANKSISMTDMYLDSTDPSENVGQIHFSLEYDFQNTTLILKVLQGKELPAKDLSGTSD--PYVRVTLLPDKKHR--LETKIKRRTLNPRWNETFYFEGFPIQKLQSRVLHLHVF--DYDRFSRDDSIGEVFLPLCQVD---------FAGKQSFWKALKPPAKDK---CGELLSSLCYHPSNSILTLTLIKARNLKAKDINGKSDPYVKVWLQFGDKRVEKRKTPIFTCTLNPVFNESFSFNVPWEKIRECSLDVMVMDFDNIGRNEL-------IGRILLAGKNGSGASETKHWQDMISKPRQTVVQWHRLK 414          
BLAST of Synaptotagmin-15 vs. Ensembl Fly
Match: Syt1 (gene:FBgn0004242 transcript:FBtr0332218)

HSP 1 Score: 57.3806 bits (137), Expect = 1.119e-8
Identity = 79/312 (25.32%), Postives = 130/312 (41.67%), Query Frame = 2
Query:  230 LYQTEEVEDLYDLQIDH-VGRIWFTITYNCSTECLIVNFHKIRNLKVXXXXXXXXDCQYLSVKIFLENLERNYQNTTIKKYSSNSDFNEKFLFQ-VPFSALRSRTLHFFILLSEKDRHGKPVAVSSYQLTEIASDERIDKDIIKILTKARIYRDLS--EHNSNQISCCPEICISLKYHSDTHRLNVTIYNVRNVFNNDKG----IYVKLKLFKGLTCKEKQSKQTSISKENYIFNESFTFFKIFS-LDFISLQITLLSEKTLFGIYDK-----PIGSATLGSHLFAKGKELSYWLQMVNQPDEHIICWLPLK 1123
            L +  E  D  D Q +  +GR+ F + Y+ ++  L V   +   L        +       VK++L   ++    T + + + +  FNE F F+ +P++   ++TL F I   + DR  K       Q+ E+    ++    I +      +RDL   E    Q+    +IC SL+Y     +L V I   +N+   D G     YVK+ + +     +K+         N  +NESF+F   F  +  I L +T++        YD+     PIG   LG      G EL +W  M+  P   I  W  LK
Sbjct:  175 LTENAEEGDEEDKQSEQKLGRLNFKLEYDFNSNSLAVTVIQAEELPALDMGGTSDPY----VKVYLLPDKKKKFETKVHRKTLSPVFNETFTFKSLPYADAMNKTLVFAIF--DFDRFSK-----HDQIGEV----KVPLCTIDLAQTIEEWRDLVSVEGEGGQLG---DICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIAIMQNGKRLKKKKTSIKKCTLNPYYNESFSFEVPFEQIQKICLVVTVVD-------YDRIGTSEPIGRCILG--CMGTGTELRHWSDMLASPRRPIAQWHTLK 459          
BLAST of Synaptotagmin-15 vs. Ensembl Fly
Match: Syt1 (gene:FBgn0004242 transcript:FBtr0343993)

HSP 1 Score: 57.3806 bits (137), Expect = 1.269e-8
Identity = 77/310 (24.84%), Postives = 127/310 (40.97%), Query Frame = 2
Query:  230 LYQTEEVEDLYDLQIDH-VGRIWFTITYNCSTECLIVNFHKIRNLKVXXXXXXXXDCQYLSVKIFLENLERNYQNTTIKKYSSNSDFNEKFLFQ-VPFSALRSRTLHFFILLSEKDRHGKPVAVSSYQLTEIASDERIDKDIIKILTKARIYRDLSEHNSNQISCCPEICISLKYHSDTHRLNVTIYNVRNVFNNDKG----IYVKLKLFKGLTCKEKQSKQTSISKENYIFNESFTFFKIFS-LDFISLQITLLSEKTLFGIYDK-----PIGSATLGSHLFAKGKELSYWLQMVNQPDEHIICWLPLK 1123
            L +  E  D  D Q +  +GR+ F + Y+ ++  L V   +   L        +       VK++L   ++    T + + + +  FNE F F+ +P++   ++TL F I   + DR  K       Q+ E+    ++    I +      +RDL            +IC SL+Y     +L V I   +N+   D G     YVK+ + +     +K+         N  +NESF+F   F  +  I L +T++        YD+     PIG   LG      G EL +W  M+  P   I  W  LK
Sbjct:  175 LTENAEEGDEEDKQSEQKLGRLNFKLEYDFNSNSLAVTVIQAEELPALDMGGTSDPY----VKVYLLPDKKKKFETKVHRKTLSPVFNETFTFKSLPYADAMNKTLVFAIF--DFDRFSK-----HDQIGEV----KVPLCTIDLAQTIEEWRDLVSVEGEGGQKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIAIMQNGKRLKKKKTSIKKCTLNPYYNESFSFEVPFEQIQKICLVVTVVD-------YDRIGTSEPIGRCILG--CMGTGTELRHWSDMLASPRRPIAQWHTLK 460          
BLAST of Synaptotagmin-15 vs. Ensembl Zebrafish
Match: syt15 (synaptotagmin XV [Source:ZFIN;Acc:ZDB-GENE-090527-2])

HSP 1 Score: 84.7297 bits (208), Expect = 1.581e-17
Identity = 84/319 (26.33%), Postives = 143/319 (44.83%), Query Frame = 2
Query:  209 LGTLNPALYQTEEVEDLYDLQIDHVGRIWFTITYNCSTECLIVNFHKIRNLKVXXXXXXXXDCQY--LSVKI-FLENLERNYQNTTIKKYSSNSDFNEKFLFQVPFSALR--SRTLHFFILLSEKDRH--GK---PVAVSSYQLTEIASDERIDKDIIKILTKARIYRDLSEHNSNQISCCPEICISLKYHSDTHRLNVTIYNVRNV-FNNDKGIYVKLKLFKGLTCKEKQSKQTSISKENYI-FNESFTFFKI-FSLDFISLQITLLSEKTLFGIYDKPIGSA--TLGSHLFAKGKELSYWLQMVNQPDEHIICWLPL 1120
            LG++ P LYQ  E    + L      R+WF + Y    E L+V+  +  NL           CQ     VK+  L + +R ++    ++   +  FN+ F+FQV  S +   S  +  F +  +K  H  G+   P+  S  +L E A   +              +RDL   +   +S   +I +SL Y+   HRL V +   R +   ++  +  K+ L   +  +  ++K T+++K N   FNE  TF  +   LD   L + +    T     +KP+  A   +G  ++A+G+EL +W  MV++P E +  W PL
Sbjct:  121 LGSIRPDLYQLPEEPSEWALPDGSAVRLWFALRYQQDKEQLVVSLLRAANLPT--------QCQRNITLVKLQLLPSDDRRHRQAKARRKGCHPQFNDTFVFQVSNSCVDQCSLNMSLFTVDHQKKHHLMGQILIPLICS--ELKEAAGKVQ--------------WRDLDNESDQPLSKNGDIQVSLNYNQSLHRLTVVVLRARGLQCCSEAAVCAKVCL--KIHTQVVRNKWTTVAKGNSPSFNEKLTFRLLPMQLDTACLSLQIQQPST-----EKPVLLAIVVIGPFMYARGRELEHWNDMVSKPQELVRQWHPL 408          
BLAST of Synaptotagmin-15 vs. Ensembl Zebrafish
Match: syt9a (synaptotagmin IXa [Source:ZFIN;Acc:ZDB-GENE-031002-18])

HSP 1 Score: 84.7297 bits (208), Expect = 2.868e-17
Identity = 81/317 (25.55%), Postives = 142/317 (44.79%), Query Frame = 2
Query:  203 LQLGTLNPALYQTEEV--EDLYDLQIDHVGRIWFTITYNCSTECLIVNFHKIRNLKVXXXXXXXXDCQYLSVKIFLENLERNYQNTTIKKYSSNSDFNEKFLFQVPFSALRSRTLHF----FILLSEKDRHGKPVAVSSYQLTEIASDERIDKDIIKILTKARIYRDLSEHNSNQISCCPEICISLKYHSDTHRLNVTIYNVRNVFNND----KGIYVKLKLFKGLTCKEKQSKQTSISKENYIFNESFTF-FKIFSLDFISLQITLLSEKTLFGIYDKPIGSATLGSHLFAKGKELSYWLQMVNQPDEHIICWLPL 1120
            + LG L P LY+   +  ED    ++   GR+ F + Y+C  E LIV  H+ ++L        +       VKI+L    +    T + + + N  F+E FLF V ++ L +R LHF    F   S  D  G+ V V ++             D++    + ++ RD+   +S+ +    ++  SL Y     RL +T+   RN+   D       YVK+ L       +K+   T  +  N ++NE+  F     ++D ISL + ++    +   +++ IG   +G+     G+E  +W +M+  P + I  W PL
Sbjct:  229 MSLGQLKPELYKQRSLDGEDSRSSRVGSCGRLHFILKYDCDLEQLIVKIHRAQDLPAKDFSGTSDP----YVKIYLLPDRKTKHQTKVHRKTLNPVFDEVFLFPVAYADLPTRKLHFSVYDFDRFSRHDIIGQ-VVVDNFL------------DLVDFPRETKLCRDIQYVSSDNVDLG-DLMFSLCYLPTAGRLTITMIKARNLKAMDITGASDPYVKVSLMCDGRRLKKRKTSTKRNTLNPVYNEAIVFDVPPENIDQISLLVAVMDYDRVG--HNEVIGVCRVGNDAEGLGRE--HWNEMLTYPRKPIAHWHPL 523          
BLAST of Synaptotagmin-15 vs. Ensembl Zebrafish
Match: syt9b (synaptotagmin IXb [Source:ZFIN;Acc:ZDB-GENE-040822-6])

HSP 1 Score: 83.5741 bits (205), Expect = 6.471e-17
Identity = 83/322 (25.78%), Postives = 138/322 (42.86%), Query Frame = 2
Query:  209 LGTLNPALYQTEEVEDLYDLQIDHVGRIWFTITYNCSTECLIVNFHKIRNLKVXXXXXXXXDCQYLSVKIFLENLERNYQNTTIKKYSSNSDFNEKFLFQVPFSALRSRTLHF----FILLSEKDRHGKPVAVSSYQLTEIASDERIDKDIIKILTKARIYRDLSEHNSNQISCCPEICISLKYHSDTHRLNVTIYNVRNVFNND----KGIYVKLKLFKGLTCKEKQSKQTSISKENYIFNESFTF-FKIFSLDFISLQITLLSEKTLFGIYDKPIGSATLGSHLFAKGKELSYWLQMVNQPDEHIICWLPLKY*DLQWHG 1147
            LG + P LY+   V+     + D  GR+ F I Y+C  E LIV  H+ ++L        +       VKI+L    +    T + + + N  F+E FLF V +  L +R LHF    F   S  D  G+ V  +   L +   + R+ +DI+ +        DL                SL Y     RL +TI   RN+   D       YVK+ +       +K+   T  +  N ++NE+  F     ++D ISL I ++    +   +++ IG   +G+   + G++  +W +M+  P + I  W  L    ++W G
Sbjct:  202 LGRIKPELYKQRSVDTDDGRRADSCGRLHFIIKYDCDLEQLIVKIHRAQDLPAKDFTGTSDP----YVKIYLLPDRKTKHQTKVHRKTLNPIFDEVFLFPVAYGELPTRKLHFSVYDFDRFSRHDVIGQVVVDNFLDLPDFPQETRLCRDILYVSADNVDLGDL--------------MFSLCYLPTAGRLTITIIKARNLKAMDITGASDPYVKVSIMCDGRRLKKRKTSTKRNTLNPVYNEAIVFDVPPENIDQISLLIAVMDYDRVG--HNEVIGICHVGNRAPSLGRD--HWNEMLTYPRKPIARWHQL----VEWVG 497          
BLAST of Synaptotagmin-15 vs. Ensembl Zebrafish
Match: syt15 (synaptotagmin XV [Source:ZFIN;Acc:ZDB-GENE-090527-2])

HSP 1 Score: 81.2629 bits (199), Expect = 2.598e-16
Identity = 87/326 (26.69%), Postives = 145/326 (44.48%), Query Frame = 2
Query:  209 LGTLNPALYQTEEVEDLYDLQIDHVGRIWFTITYNCSTECLIVNFHKIRNLKVXXXXXXXXDCQY--LSVKI-FLENLERNYQNTTIKKYSSNSDFNEKFLFQVPFSALR--SRTLHFFILLSEKDRH--GK---PVAVSSYQLTEIASDERIDKDIIKILTKARIYRDLSEHNSNQISCCPEICISLKYHSDTHRLNVTIYNVRNV-FNNDKGIYVKLKLFKGLTCKEKQSKQTSISKENYI-FNESFTFFKIFSLDF----ISLQITLLS-EKTLFGIYDKPI-----GSATLGSHLFAKGKELSYWLQMVNQPDEHIICWLPL 1120
            LG++ P LYQ  E    + L      R+WF + Y    E L+V+  +  NL           CQ     VK+  L + +R ++    ++   +  FN+ F+FQV  S +   S  +  F +  +K  H  G+   P+  S  +L E A   +              +RDL   +   +S   +I +SL Y+   HRL V +   R +   ++  +  K+ L   +  +  ++K T+++K N   FNE  TF ++  +      +SLQI   S EK   G Y   I         +G  ++A+G+EL +W  MV++P E +  W PL
Sbjct:  114 LGSIRPDLYQLPEEPSEWALPDGSAVRLWFALRYQQDKEQLVVSLLRAANLPT--------QCQRNITLVKLQLLPSDDRRHRQAKARRKGCHPQFNDTFVFQVSNSCVDQCSLNMSLFTVDHQKKHHLMGQILIPLICS--ELKEAAGKVQ--------------WRDLDNESDQPLSKNGDIQVSLNYNQSLHRLTVVVLRARGLQCCSEAAVCAKVCL--KIHTQVVRNKWTTVAKGNSPSFNEKLTF-RLLPMQLDTACLSLQIQQPSTEKP--GNYQTVISIMLLAIVVIGPFMYARGRELEHWNDMVSKPQELVRQWHPL 410          
BLAST of Synaptotagmin-15 vs. Ensembl Zebrafish
Match: syt2a (synaptotagmin IIa [Source:ZFIN;Acc:ZDB-GENE-060503-315])

HSP 1 Score: 76.6406 bits (187), Expect = 8.091e-15
Identity = 76/294 (25.85%), Postives = 128/294 (43.54%), Query Frame = 2
Query:  281 VGRIWFTITYNCSTECLIVNFHKIRNLKVXXXXXXXXDCQYLS---VKIFLENLERNYQNTTIKKYSSNSDFNEKFLFQVPFSALRSRTLHFFILLSEKDRHGKPVAVSSYQLTEIASDERIDKDIIKILTKARIYRDLSEHNSNQISCCPEICISLKYHSDTHRLNVTIYNVRNVFNNDKG----IYVKLKLFKGLTCKEKQSKQTSISKENYIFNESFTF-FKIFSLDFISLQITLLSEKTLFGIYDK-----PIGSATLGSHLFAKGKELSYWLQMVNQPDEHIICWLPLK 1123
            +G++ F++ Y+ S   L V   +  +L        + D    S   VK+F+   ++   +T + K + N  FNE F F++PF+ +  +TL   + + + DR  K          ++  + +I  + + +      +RDL      +     +ICISL+Y     +L + I   +N+   D G     YVK+ L +     +K+      +  N  +NESF+F      +  I   IT+L        YDK      IG   +GS   A+G EL +W  M+  P   I  W PLK
Sbjct:  148 LGKLQFSLDYDFSASQLTVGILQAADL-------LSMDSGGTSDPYVKVFILPDKKKKYDTKVHKKTLNPVFNETFHFKIPFTEMGGKTL--VMSVYDFDRFSK---------HDVIGEVKIPMNTLDLAQPIEQWRDLDSAEKEEPEKLGDICISLRYVPTAGKLTICILEAKNLKKMDVGGLSDPYVKIHLLQNGKRLKKKKTTVKKNTLNPYYNESFSFEIPQDQMQKIQAVITVLD-------YDKIGKNDAIGKIWVGSK--AQGTELRHWSDMLANPRRPIAQWHPLK 414          
BLAST of Synaptotagmin-15 vs. Ensembl Xenopus
Match: ENSXETT00000010544.1 (synaptotagmin 15 [Source:NCBI gene;Acc:100496499])

HSP 1 Score: 108.997 bits (271), Expect = 8.894e-26
Identity = 88/311 (28.30%), Postives = 151/311 (48.55%), Query Frame = 2
Query:  209 LGTLNPALYQTEEVEDLYDLQIDHVGRIWFTITYNCSTECLIVNFHKIRNLKVXXXXXXXXDCQYLSVKIFLENLERNYQNTTIKKYSSNSDFNEKFLFQVPFSALRSRTLHFFILLSEKDRHGKPVAVSSYQL-TEIASDERIDKDIIKILTKARIYRDLSEHNSNQISCCPEICISLKYHSDTHRLNVTIYNVRNV-FNNDKGI----YVKLKLF---KGLTCKEKQSKQTSI-SKENYIFNESFTFFKIFSLDFISLQITLLSEKTLFGIYDKPIGSATLGSHLFAKGKELSYWLQMVNQPDEHIICW 1111
            +G++NPALY+  E  +  D    ++GRIWF + Y   TE L+V+  K+RNL+        SD     VKI L   ER +  +  K+ + N  F+E F+FQV    +  RTL F I   +K +    +    + L  E  +D   D++++       I+RDL   N    S    I  SL Y+    RL V +   + + F  ++G+    +VK+      K + CK    K  +I    N ++NE+F+ FK+  +   +  ++L   +   G     +G   +G +++ +G+EL +W +M+N+P + +  W
Sbjct:  104 VGSINPALYKFPEENEETDFPEGNIGRIWFAVEYELETERLVVSLMKVRNLQF------GSDSCNPFVKIHLLPDERRHLQSKTKRKTVNPQFDETFVFQVSGKTVHQRTLRFSIYHVDKIKKHHLLGQVVFPLKNESLTD---DENVV-------IWRDLELENLEPPSEYGNIQFSLSYNDYLGRLTVVLLRAKGLQFLEERGVISSAFVKVSFMNHNKLVKCK----KTAAICGTANPVYNETFS-FKVEHIGLDTASLSLAVYQNAQGEKSHLLGRVVVGPYMYTRGRELEHWNEMLNKPKDLVKRW 393          
BLAST of Synaptotagmin-15 vs. Ensembl Xenopus
Match: SYT9 (synaptotagmin 9 [Source:NCBI gene;Acc:100497543])

HSP 1 Score: 86.6557 bits (213), Expect = 8.970e-18
Identity = 90/331 (27.19%), Postives = 145/331 (43.81%), Query Frame = 2
Query:  209 LGTLNPALYQTEEVE--DLYDLQIDHVGRIWFTITYNCSTECLIVNFHKIRNLKVXXXXXXXXDCQYLSVKIFLENLERNYQNTTIKKYSSNSDFNEKFLFQVPFSALRSRTLHF----FILLSEKDRHGKPVAVSSYQLTEIASDERIDKDIIKILTKARIYRDLSEHNSNQISCCPEICISLKYHSDTHRLNVTIYNVRNVFNND----KGIYVKLKLFKGLTCKEKQSKQTSISKENYIFNESFTF-FKIFSLDFISLQITLLSEKTLFGIYDKPIGSATLGSHLFAKGKELSYWLQMVNQPDEHIICWLPLKY*DLQWHGTKKNRLN 1168
            +G + P LY+ + VE  D         G++ F I Y+C  E LIV  HK  NL        +       VKI+L    +    T + + + N  F+E FLF VP++ L +R LHF    F   S  D  G+ V V ++             D+     ++ I+RD+ EH +N      ++  SL Y     RL +TI   RN+   D       YVK+ +       +K+   T  +  N ++NE+  F     ++D ISL I ++    +   +++ IG   +G+   + G+E  +W +M++ P + I  W PL     Q   T     N
Sbjct:  193 IGRIKPELYKQKSVETDDGRRNNSKSCGKLNFIIKYDCDLEKLIVKIHKAVNLPAKDFSGTSDP----YVKIYLLPDRKTKHQTKVHRKTLNPVFDEVFLFPVPYNDLPTRKLHFSVYDFDRFSRHDVIGQ-VIVDNFL------------DLADFPRESNIWRDI-EHVTNDNVDLGDLMFSLCYLPTAGRLTITIIKARNLKAMDITGASDPYVKVSIMCEGRRLKKRKTSTKRNTLNPVYNEAIVFDVPPENIDQISLLIAVMDYDRVG--HNEVIGICQVGNDAESLGRE--HWSEMLSYPRKPIAHWHPLTEWSAQAAATGNGSCN 501          
BLAST of Synaptotagmin-15 vs. Ensembl Xenopus
Match: syt4 (synaptotagmin 4 [Source:NCBI gene;Acc:447980])

HSP 1 Score: 73.559 bits (179), Expect = 1.244e-13
Identity = 72/286 (25.17%), Postives = 130/286 (45.45%), Query Frame = 2
Query:  275 DHVGRIWFTITYNCSTECLIVNFHKIRNLKVXXXXXXXXDCQYLSVKIFLENLERNYQNTTIKKYSSNSDFNEKFLF-QVPFSALRSRTLHFFILLSEKDRHGKPVAVSSYQLTEIA-SDERIDKDIIKILTKARIYRDLSEHNSNQISCCPEICISLKYHSDTHRLNVTIYNVRNVFNND-KGI---YVKLKLFKGLTCKEKQSKQTSISKENYIFNESFTF-FKIFSLDFISLQITLLSEKTLFGIYDKPIGSATLGSHLFAKGKELSYWLQMVNQPDEHIICW 1111
            D +G ++F + YN   +  +VN  + R+L    ++S  SD  Y+ + I  E  +++   T + + + +  F+E F F  +P+S ++   LHF IL  ++      +   S+ L+ I  SD R+            + R++++ N  + +   E+ ISL Y S T+ L V +   R++   +  G+   YVK+ L+       K+         N +FNE F F      L+ IS++  ++      G  ++ IG   LGS     G E  +W ++   P   I  W
Sbjct:  151 DKLGTLFFALEYNFEKKAFVVNIKEARSLPAMDEQSMTSD-PYIKMTILPE--KKHKVKTRVLRKTLDPAFDETFTFYGIPYSQVQDLVLHFIILSFDRFSRDDVIGEVSFPLSGIELSDGRV-----------LMNREINKRNVRKSAGRGELLISLCYQSTTNTLTVVVLKARHLPKAEVSGLSDPYVKVNLYHAKKRISKKKTHVKKCTPNAVFNELFVFDIPCEGLEDISVEFLVMDSDR--GSRNEVIGRLILGSSADGTGGE--HWKEICEHPRRQIAKW 418          
BLAST of Synaptotagmin-15 vs. Ensembl Xenopus
Match: wnt6 (Wnt family member 6 [Source:Xenbase;Acc:XB-GENE-486077])

HSP 1 Score: 72.7886 bits (177), Expect = 3.120e-13
Identity = 83/314 (26.43%), Postives = 138/314 (43.95%), Query Frame = 2
Query:  209 LGTLNPALYQTEEVE-DLYDLQIDHVGRIWFTITYNCSTECLIVNFHKIRNLKVXXXXXXXXDCQYLS---VKIFLENLERNYQNTTIKKYSSNSDFNEKFLFQVPFSALRSRTLHF----FILLSEKDRHGKPVAVSSYQLTEIASDERIDKDIIKILTKARIYRDLSEHNSNQISCCPEICISLKYHSDTHRLNVTIYNVRNVFNNDKGIYVKLKLFKGLTCKEKQ--SKQTSISKE--NYIFNESFTF-FKIFSLDFISLQITLLSEKTLFGIYDKPIGSATLGSHLFAKGKELSYWLQMVNQPDEHIICW 1111
            +G + P LY+    + ++   +    GRI F + Y  ++E L+V   K   L          D    S   VK++L    +    T + + + N  FNE F F VPF+ L++R LHF    F   S  D  G+ V  +  + +  A+DE              I+RD+ E +S +     EI  SL Y     RL  TI    N+   D   +    +   L C+ ++   ++TSI K   N  +NE+  F     ++D +SL I ++    +   +++ IG   +GS    +G+E  +W +M+  P + I  W
Sbjct:  223 IGQIKPELYKQRSADAEMKKQEATSCGRISFILRYAYNSEQLVVKILKALELPAK-------DANGFSDPYVKMYLLPDRKKKFQTKVHRKTLNPIFNETFHFNVPFNELQNRKLHFSIYDFDRFSRHDLIGQVVLDNLLEFSN-ATDE------------TPIWRDILEASSEKADLG-EINFSLCYLPTAGRLTATIIKATNLKAMDLTGFSDPYVKASLICEGRRLKKRKTSIKKNTLNPTYNEALVFDIPNENMDHVSLTIAVMDYDCIG--HNEVIGMCRVGSDADMQGRE--HWNEMLANPRKPIEHW 511          
BLAST of Synaptotagmin-15 vs. Ensembl Xenopus
Match: luzp2 (leucine zipper protein 2 [Source:Xenbase;Acc:XB-GENE-940667])

HSP 1 Score: 71.633 bits (174), Expect = 5.954e-13
Identity = 66/243 (27.16%), Postives = 106/243 (43.62%), Query Frame = 2
Query:  410 VKIFLENLERNYQNTTIKKYSSNSDFNEKFLFQVPFSALRSRTLHFFILLSEKDRHGKPVAVSSYQLTEIASDERIDKDIIKILTKARIYRDLSEHNSNQISCCPEICISLKYHSDTHRLNVTIYNVRNVFNNDKG----IYVKLKLFKGLTCKEKQSKQTSISKENYIFNESFTFFKIFS-LDFISLQITLLSEKTLFGIYDKPIGSATLGSHLFAKGKELSYWLQMVNQPDEHIICWLPLK 1123
            VK+F    ++    T + + + N  FNE F F++P+  L  +TL   I   + DR  K          +I  + ++  + + +      +RDL      +     +ICISL+Y     +L V I   +N+   D G     YVK+ L +     +K+         N  FNESF+F   F  +  + + IT+L    L    ++ IG   +G +  A G EL +W  M+  P   I  W PLK
Sbjct:  185 VKVFFLPDKKKKHETKVHRKTLNPIFNETFTFKIPYQELGGKTLCMSIY--DFDRFSK---------HDIIGEVKVPMNTVDLGQPIEEWRDLQSAEKEEPEKLGDICISLRYVPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVITVLDYDKLG--KNEAIGKIFVGCN--ASGTELRHWSDMLANPRRPIAQWHPLK 412          
BLAST of Synaptotagmin-15 vs. Ensembl Mouse
Match: Syt15 (synaptotagmin XV [Source:MGI Symbol;Acc:MGI:2442166])

HSP 1 Score: 97.4413 bits (241), Expect = 1.016e-21
Identity = 83/310 (26.77%), Postives = 141/310 (45.48%), Query Frame = 2
Query:  206 QLGTLNPALYQTEEVEDLYDLQIDHVGRIWFTITYNCSTECLIVNFHKIRNLKVXXXXXXXXDCQYLSVKIFLENLERNYQNTTIKKYSSNSDFNEKFLFQVPFSALRSRTLHFFILLSEKDRHGKPVAVSSYQLTEIASDERIDKDIIKILTKARIYRDLSEHNSNQISCCPEICISLKYHSDTHRLNVTIYNVRNV-FNNDKGIYVKLKLF------KGLTCKEKQSKQTSISKENYIFNESFTF-FKIFSLDFISLQITLLSEKTLFGIYDKPIGSATLGSHLFAKGKELSYWLQMVNQPDEHIICW 1111
            ++G++NP LY++ E           +GR+WF++ Y   +E L+V   K + L+V S+      C  L VK+ L   ER +  +  K    N  F+E F+FQV   ++  R L F +    K R  + +    + L     +E +  D  +I     I+RDL   N    S   +I   L Y+    RL V +   + +    D+ +             K + CK   +   S+   N ++NE+F+F      LD  SL + +L  +T  G    P+G   +G +++ +GKEL +W +M+ +P E +  W
Sbjct:  120 EMGSINPELYKSPEDTSETGFPDGCLGRLWFSVEYQQESERLLVGLIKAQQLQVPSET-----CSTL-VKLHLLPDERRFLQSKTKHKICNPQFDENFIFQVSSKSVTQRVLKFSVYHVNKKRKHQLLGQVLFPL----KNETLAGDHHRI-----IWRDLEAKNLEPPSEFGDIQFCLSYNDYLSRLTVVVLRAKGLQLQEDRSVVSVFVKVSLMNHNKFVKCKRTSAVLGSV---NPVYNETFSFKVDTNELDTASLSLVVL--QTTEGNKSSPLGRVVVGPYMYTRGKELEHWGEMLRKPKELVKRW 409          
BLAST of Synaptotagmin-15 vs. Ensembl Mouse
Match: Syt9 (synaptotagmin IX [Source:MGI Symbol;Acc:MGI:1926373])

HSP 1 Score: 72.7886 bits (177), Expect = 1.839e-13
Identity = 83/327 (25.38%), Postives = 138/327 (42.20%), Query Frame = 2
Query:  185 DYLVKHLQ-------LGTLNPALYQTEEVE--DLYDLQIDHVGRIWFTITYNCSTECLIVNFHKIRNLKVXXXXXXXXDCQYLSVKIFLENLERNYQNTTIKKYSSNSDFNEKFLFQVPFSALRSRTLHF----FILLSEKDRHGKPVAVSSYQLTEIASDERIDKDIIKILTKARIYRDLSEHNSNQISCCPEICISLKYHSDTHRLNVTIYNVRNVFNND----KGIYVKLKLFKGLTCKEKQSKQTSISKENYIFNESFTF-FKIFSLDFISLQITLLSEKTLFGIYDKPIGSATLGSHLFAKGKELSYWLQMVNQPDEHIICW 1111
            D+ ++ LQ       +G + P LY+   ++  D         G++ F + Y+C  E LIV  HK  NL        +       VKI+L    +    T + + + N  F+E FLF V ++ L +R LHF    F   S  D  G+ V    + L +   +  + KDI              E+ +N      E+  SL Y     RL +TI   RN+   D       YVK+ L       +K+   T  +  N ++NE+  F     S+D I L I ++    +   +++ IG   +G+     G++  +W +M++ P + I  W
Sbjct:  180 DFNIQQLQRQEQLTGIGRIKPELYKQRSLDNDDGRRSNSKACGKLNFILKYDCDLEQLIVKIHKAVNLPAKDFSGTSDP----YVKIYLLPDRKTKHQTKVHRKTLNPVFDEVFLFPVHYNDLEARKLHFSVYDFDRFSRHDLIGQVVVDHFFDLADFPRECILWKDI--------------EYVTNDNVDLGELMFSLCYLPTAGRLTITIIKARNLKAMDITGASDPYVKVSLMCDGRRLKKRKTSTKRNTLNPVYNEAIVFDVPPESIDQIHLSIAVMDYDRVG--HNEVIGVCQVGNEAERLGRD--HWSEMLSYPRKPIAHW 484          
BLAST of Synaptotagmin-15 vs. Ensembl Mouse
Match: Syt2 (synaptotagmin II [Source:MGI Symbol;Acc:MGI:99666])

HSP 1 Score: 71.2478 bits (173), Expect = 4.796e-13
Identity = 73/292 (25.00%), Postives = 122/292 (41.78%), Query Frame = 2
Query:  278 HVGRIWFTITYNCSTECLIVNFHKIRNLKVXXXXXXXXDCQYLSVKIFLENLERNYQNTTIKKYSSNSDFNEKFLFQVPFSALRSRTLHFFILLSEKDRHGKPVAVSSYQLTEIASDERIDKDIIKILTKARIYRDLSEHNSNQISCCPEICISLKYHSDTHRLNVTIYNVRNVFNNDKG----IYVKLKLFKGLTCKEKQSKQTSISKENYIFNESFTFFKIFS-LDFISLQITLLSEKTLFGIYDK-----PIGSATLGSHLFAKGKELSYWLQMVNQPDEHIICWLPLK 1123
            ++G++ F++ Y+     L V   +   L        +       VK+FL   ++    T + + + N  FNE F F+VP+  L  +TL   + + + DR  K          +I  + ++  + + +      +RDL      +     +IC SL+Y     +L V I   +N+   D G     YVK+ L +     +K+         N  FNESF+F   F  +  + + +T+L        YDK      IG   +GS+  A G EL +W  M+  P   I  W  LK
Sbjct:  142 NLGKLQFSLDYDFQANQLTVGVLQAAELPALDMGGTSDPY----VKVFLLPDKKKKYETKVHRKTLNPAFNETFTFKVPYQELGGKTL--VMAIYDFDRFSK---------HDIIGEVKVPMNTVDLGQPIEEWRDLQGGEKEEPEKLGDICTSLRYVPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVVTVLD-------YDKLGKNEAIGKIFVGSN--ATGTELRHWSDMLANPRRPIAQWHSLK 409          
BLAST of Synaptotagmin-15 vs. Ensembl Mouse
Match: Syt2 (synaptotagmin II [Source:MGI Symbol;Acc:MGI:99666])

HSP 1 Score: 71.2478 bits (173), Expect = 4.796e-13
Identity = 73/292 (25.00%), Postives = 122/292 (41.78%), Query Frame = 2
Query:  278 HVGRIWFTITYNCSTECLIVNFHKIRNLKVXXXXXXXXDCQYLSVKIFLENLERNYQNTTIKKYSSNSDFNEKFLFQVPFSALRSRTLHFFILLSEKDRHGKPVAVSSYQLTEIASDERIDKDIIKILTKARIYRDLSEHNSNQISCCPEICISLKYHSDTHRLNVTIYNVRNVFNNDKG----IYVKLKLFKGLTCKEKQSKQTSISKENYIFNESFTFFKIFS-LDFISLQITLLSEKTLFGIYDK-----PIGSATLGSHLFAKGKELSYWLQMVNQPDEHIICWLPLK 1123
            ++G++ F++ Y+     L V   +   L        +       VK+FL   ++    T + + + N  FNE F F+VP+  L  +TL   + + + DR  K          +I  + ++  + + +      +RDL      +     +IC SL+Y     +L V I   +N+   D G     YVK+ L +     +K+         N  FNESF+F   F  +  + + +T+L        YDK      IG   +GS+  A G EL +W  M+  P   I  W  LK
Sbjct:  142 NLGKLQFSLDYDFQANQLTVGVLQAAELPALDMGGTSDPY----VKVFLLPDKKKKYETKVHRKTLNPAFNETFTFKVPYQELGGKTL--VMAIYDFDRFSK---------HDIIGEVKVPMNTVDLGQPIEEWRDLQGGEKEEPEKLGDICTSLRYVPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVVTVLD-------YDKLGKNEAIGKIFVGSN--ATGTELRHWSDMLANPRRPIAQWHSLK 409          
BLAST of Synaptotagmin-15 vs. Ensembl Mouse
Match: Syt15 (synaptotagmin XV [Source:MGI Symbol;Acc:MGI:2442166])

HSP 1 Score: 66.6254 bits (161), Expect = 1.303e-11
Identity = 69/264 (26.14%), Postives = 115/264 (43.56%), Query Frame = 2
Query:  206 QLGTLNPALYQTEEVEDLYDLQIDHVGRIWFTITYNCSTECLIVNFHKIRNLKVXXXXXXXXDCQYLSVKIFLENLERNYQNTTIKKYSSNSDFNEKFLFQVPFSALRSRTLHFFILLSEKDRHGKPVAVSSYQLTEIASDERIDKDIIKILTKARIYRDLSEHNSNQISCCPEICISLKYHSDTHRLNVTIYNVRNV-FNNDKGIYVKLKLF------KGLTCKEKQSKQTSISKENYIFNESFTF-FKIFSLDFISLQITLL 973
            ++G++NP LY++ E           +GR+WF++ Y   +E L+V   K + L+V S+      C  L VK+ L   ER +  +  K    N  F+E F+FQV   ++  R L F +    K R  + +    + L     +E +  D  +I     I+RDL   N    S   +I   L Y+    RL V +   + +    D+ +             K + CK   +   S+   N ++NE+F+F      LD  SL + +L
Sbjct:  120 EMGSINPELYKSPEDTSETGFPDGCLGRLWFSVEYQQESERLLVGLIKAQQLQVPSET-----CSTL-VKLHLLPDERRFLQSKTKHKICNPQFDENFIFQVSSKSVTQRVLKFSVYHVNKKRKHQLLGQVLFPL----KNETLAGDHHRI-----IWRDLEAKNLEPPSEFGDIQFCLSYNDYLSRLTVVVLRAKGLQLQEDRSVVSVFVKVSLMNHNKFVKCKRTSAVLGSV---NPVYNETFSFKVDTNELDTASLSLVVL 365          
BLAST of Synaptotagmin-15 vs. UniProt/SwissProt
Match: sp|Q9BQS2|SYT15_HUMAN (Synaptotagmin-15 OS=Homo sapiens OX=9606 GN=SYT15 PE=1 SV=3)

HSP 1 Score: 107.071 bits (266), Expect = 3.331e-24
Identity = 83/309 (26.86%), Postives = 152/309 (49.19%), Query Frame = 2
Query:  209 LGTLNPALYQTEEVEDLYDLQIDHVGRIWFTITYNCSTECLIVNFHKIRNLKVXXXXXXXXDCQYLSVKIFLENLERNYQNTTIKKYSSNSDFNEKFLFQVPFSALRSRTLHFFILLSEKDRHGKPVAVSSYQLTEIASDERIDKDIIKILTKARIYRDLSEHNSNQISCCPEICISLKYHSDTHRLNVTIYNVRNV-FNNDKGI---YVKLKLF---KGLTCKEKQSKQTSISKENYIFNESFTF-FKIFSLDFISLQITLLSEKTLFGIYDKPIGSATLGSHLFAKGKELSYWLQMVNQPDEHIICW 1111
            +G +NP LY+  E +   D     +GR+WF++ Y    E L+V   K ++L+  S+      C  L VK++L   ER +  +  K+ +SN  F+E F+FQV    +  R L F +   ++ R  + +    + L     +E +  D  ++     I+RDL   +    S   ++   L Y+    RL V +   + +    D+GI   +VK+ L    K + CK+  +   SI   N ++NE+F+F      LD  SL +T++  + + G   + +G   +G +++ +G+EL +W +M+++P E +  W
Sbjct:  124 VGAINPELYKFPEDKSETDFPDGCLGRLWFSVEYEQEAERLLVGLIKAQHLQAPSET-----CSPL-VKLYLLPDERRFLQSKTKRKTSNPQFDEHFIFQVSSKTITQRVLKFSVYHVDRQRKHQLLGQVLFPL----KNETLVGDCRRV-----IWRDLEAESLEPPSEFGDLQFCLSYNDYLSRLTVVVLRAKGLRLQEDRGIVSVFVKVSLMNHNKFVKCKKTSAVLGSI---NPVYNETFSFKADATELDTASLSLTVV--QNMEGDKSQQLGRVVVGPYMYTRGRELEHWDEMLSKPKELVKRW 412          
BLAST of Synaptotagmin-15 vs. UniProt/SwissProt
Match: sp|P59926|SYT15_RAT (Synaptotagmin-15 OS=Rattus norvegicus OX=10116 GN=Syt15 PE=2 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 1.215e-23
Identity = 83/314 (26.43%), Postives = 149/314 (47.45%), Query Frame = 2
Query:  209 LGTLNPALYQTEEVEDLYDLQIDHVGRIWFTITYNCSTECLIVNFHKIRNLKVXXXXXXXXDCQYLSVKIFLENLERNYQNTTIKKYSSNSDFNEKFLFQVPFSALRSRTLHFFILLSEKDRHGKPVAVSSYQLTEIASDERIDKDIIKILTKARIYRDLSEHNSNQISCCPEICISLKYHSDTHRLNVTIYNVRNV-FNNDKGI---YVKLKLF---KGLTCKEKQSKQTSISKENYIFNESFTF------FKIFSLDFISLQITLLSEKTLFGIYDKPIGSATLGSHLFAKGKELSYWLQMVNQPDEHIICW 1111
            +G++NP LY++ E           +GR+WF++ Y   +E L+V+  K ++L+V ++      C  L VK+ L   +R +  +  K+ + N  F+E F+FQV   ++  R L F +    K R  + +    + L     +E +  D  ++     I+RDL   N   +S   ++   L Y+    RL V +   + +    D+G+   +VK+ L    K + CK   +   S+   N ++NE+F+F          SL  + LQIT        G    P+G   +G +++ +GKEL +W +M+ +P E +  W
Sbjct:  125 MGSINPELYKSSEDVSEAGFPDGCLGRLWFSVEYQQESERLLVDLIKAQHLQVPAET-----CSTL-VKLHLLPDKRRFLQSKAKRKTCNPQFDESFIFQVSSKSVAQRVLKFSVYHINKQRKHQLLGQVLFPL----KNETLAGDRHRV-----IWRDLEAENLEPLSEFGDLQFCLSYNDYLSRLTVVVLRAKGLQLQEDRGVVSVFVKVSLMNHNKFVKCKRTSAVLGSV---NPVYNETFSFKADANELDTASLSLVVLQIT-------EGDKSYPLGRVVVGPYMYTRGKELEHWNEMLRKPKELVKRW 413          
BLAST of Synaptotagmin-15 vs. UniProt/SwissProt
Match: sp|Q8C6N3|SYT15_MOUSE (Synaptotagmin-15 OS=Mus musculus OX=10090 GN=Syt15 PE=2 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 7.109e-21
Identity = 83/310 (26.77%), Postives = 141/310 (45.48%), Query Frame = 2
Query:  206 QLGTLNPALYQTEEVEDLYDLQIDHVGRIWFTITYNCSTECLIVNFHKIRNLKVXXXXXXXXDCQYLSVKIFLENLERNYQNTTIKKYSSNSDFNEKFLFQVPFSALRSRTLHFFILLSEKDRHGKPVAVSSYQLTEIASDERIDKDIIKILTKARIYRDLSEHNSNQISCCPEICISLKYHSDTHRLNVTIYNVRNV-FNNDKGIYVKLKLF------KGLTCKEKQSKQTSISKENYIFNESFTF-FKIFSLDFISLQITLLSEKTLFGIYDKPIGSATLGSHLFAKGKELSYWLQMVNQPDEHIICW 1111
            ++G++NP LY++ E           +GR+WF++ Y   +E L+V   K + L+V S+      C  L VK+ L   ER +  +  K    N  F+E F+FQV   ++  R L F +    K R  + +    + L     +E +  D  +I     I+RDL   N    S   +I   L Y+    RL V +   + +    D+ +             K + CK   +   S+   N ++NE+F+F      LD  SL + +L  +T  G    P+G   +G +++ +GKEL +W +M+ +P E +  W
Sbjct:  120 EMGSINPELYKSPEDTSETGFPDGCLGRLWFSVEYQQESERLLVGLIKAQQLQVPSET-----CSTL-VKLHLLPDERRFLQSKTKHKICNPQFDENFIFQVSSKSVTQRVLKFSVYHVNKKRKHQLLGQVLFPL----KNETLAGDHHRI-----IWRDLEAKNLEPPSEFGDIQFCLSYNDYLSRLTVVVLRAKGLQLQEDRSVVSVFVKVSLMNHNKFVKCKRTSAVLGSV---NPVYNETFSFKVDTNELDTASLSLVVL--QTTEGNKSSPLGRVVVGPYMYTRGKELEHWGEMLRKPKELVKRW 409          
BLAST of Synaptotagmin-15 vs. UniProt/SwissProt
Match: sp|P24507|SY63_DIPOM (Synaptotagmin-C OS=Diplobatis ommata OX=1870830 GN=P65-C PE=2 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 2.678e-13
Identity = 81/314 (25.80%), Postives = 141/314 (44.90%), Query Frame = 2
Query:  209 LGTLNPALYQTEEVE-DLYDLQIDHVGRIWFTITYNCSTECLIVNFHKIRNLKVXXXXXXXXDCQYLS---VKIFLENLERNYQNTTIKKYSSNSDFNEKFLFQVPFSALRSRTLHF----FILLSEKDRHGKPVAVSSYQLTEIASDERIDKDIIKILTKARIYRDLSEHNSNQISCCPEICISLKYHSDTHRLNVTIYNVRNVFNNDKGIYVKLKLFKGLTCKEKQ--SKQTSISKE--NYIFNESFTF-FKIFSLDFISLQITLLSEKTLFGIYDKPIGSATLGSHLFAKGKELSYWLQMVNQPDEHIICW 1111
            +G + P LY+   ++ +    Q  + GRI F + Y  +TE L+V   K  +L          D    S   VKI+L    +    T + + + N  FNE F F VPF+ L++R LHF    F   S  D  G+ V  +  + ++ + D  I +DI++  ++     DL E N            SL Y     RL +TI    N+   D   +    +   L C E++   ++TSI K   N ++NE+  F     +++ +++ I ++    +   +++ IG   +G+     G+E  +W +M+  P + I  W
Sbjct:  212 IGQIKPELYKQRSIDTEAKKHQKVNCGRINFMLRYTYTTEQLVVKILKALDLPAK-------DANGFSDPYVKIYLLPDRKKKFQTKVHRKTLNPIFNETFQFNVPFNELQNRKLHFSVYDFDRFSRHDLIGQVVLDNLLEFSDFSEDTTIWRDILEATSEK---ADLGEIN-----------FSLCYLPTAGRLTITIIKATNLKAMDLTGFSDPYVKASLICDERRLKKRKTSIKKNTLNPVYNEALVFDIPNENMEHVNVIIAVMDYDCIG--HNEVIGMCRVGNATDGPGRE--HWNEMLANPRKPIEQW 500          
BLAST of Synaptotagmin-15 vs. UniProt/SwissProt
Match: sp|Q86SS6|SYT9_HUMAN (Synaptotagmin-9 OS=Homo sapiens OX=9606 GN=SYT9 PE=1 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 4.381e-13
Identity = 83/327 (25.38%), Postives = 138/327 (42.20%), Query Frame = 2
Query:  185 DYLVKHLQ-------LGTLNPALYQTEEVE--DLYDLQIDHVGRIWFTITYNCSTECLIVNFHKIRNLKVXXXXXXXXDCQYLSVKIFLENLERNYQNTTIKKYSSNSDFNEKFLFQVPFSALRSRTLHF----FILLSEKDRHGKPVAVSSYQLTEIASDERIDKDIIKILTKARIYRDLSEHNSNQISCCPEICISLKYHSDTHRLNVTIYNVRNVFNND----KGIYVKLKLFKGLTCKEKQSKQTSISKENYIFNESFTF-FKIFSLDFISLQITLLSEKTLFGIYDKPIGSATLGSHLFAKGKELSYWLQMVNQPDEHIICW 1111
            D+ ++ LQ       +G + P LY+   ++  D         G++ F + Y+C  E LIV  HK  NL        +       VKI+L    +    T + + + N  F+E FLF VP++ L +R LHF    F   S  D  G+ V      L +   +  + KDI              E+ +N      E+  SL Y     RL +TI   RN+   D       YVK+ L       +K+   T  +  N ++NE+  F     ++D I L I ++    +   +++ IG   +G+     G++  +W +M++ P + I  W
Sbjct:  180 DFNIQQLQKQEQLTGIGRIKPELYKQRSLDNDDGRRSNSKACGKLNFILKYDCDLEQLIVKIHKAVNLPAKDFSGTSDP----YVKIYLLPDRKTKHQTKVHRKTLNPVFDEVFLFPVPYNDLEARKLHFSVYDFDRFSRHDLIGQVVVDHFLDLADFPRECILWKDI--------------EYVTNDNVDLGELMFSLCYLPTAGRLTITIIKARNLKAMDITGASDPYVKVSLMCDGRRLKKRKTSTKRNTLNPVYNEAIVFDVPPENIDQIHLSIAVMDYDRVG--HNEIIGVCQVGNEAERLGRD--HWSEMLSYPRKPIAHW 484          
BLAST of Synaptotagmin-15 vs. TrEMBL
Match: A0A074ZPW2 (C2 domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=T265_04210 PE=4 SV=1)

HSP 1 Score: 189.889 bits (481), Expect = 1.972e-52
Identity = 119/323 (36.84%), Postives = 174/323 (53.87%), Query Frame = 2
Query:  206 QLGTLNPALYQTEEVEDLYDLQIDHVGRIWFTITYNCSTECLIVNFHKIRNLK-----------VXXXXXXXXDC--QYLSVKIFLENLERNYQNTTIKKYSSNSDFNEKFLFQVPFSALRSRTLHFFILLSEKDRHGKPVAVSSYQLTEIASDERIDKDIIKILTKARIYRDLSEHNSNQISCCPEICISLKYHSDTHRLNVTIYNVRNVFNNDKG----IYVKLKLFKGLTCKEKQSKQTSISKENYIFNESFTFFKIFSLDFISLQITLLSEKTLFGIYDKPIGSATLGSHLFAKGKELSYWLQMVNQPDEHIICWLPLK 1123
            QLG L+P LY +EE EDLYD+   H+GRIWFT++Y+ S+E L V  HK RNL+            S   + N DC  Q   VK+FLE  ER +  T  KK + N DFNE+F FQV    L  +TL   +L  +K R  K +  ++Y L+ + ++   D++I       R +RDL   + + IS  P++ ++L Y   T RL V ++  RN+   + G    +Y K+ L++GL  KE +SK+T        F+ESF F KI     I+L+ITL+      G  DK I    LG  L +KG+ + +W  M+  PD+ +  W  L+
Sbjct:   83 QLGKLDPRLYLSEEGEDLYDITPGHLGRIWFTVSYSRSSELLKVTIHKARNLRKWSVFGSLMPDQSQIVTQNEDCLLQDFRVKLFLEQAERKFHMTATKKQTDNPDFNEQFCFQVAAHDLGQQTLRILVLGLDKRRRCKLIGYATYGLSTLVNNTSDDQEI-------RTFRDLQLDDESGISANPQLLVALTYFPTTERLIVGLFECRNLPLKENGLPIDVYAKVVLYQGLQGKELKSKRTEALGTRDSFDESFVFQKIPDPTNINLRITLVQH----GFIDKQICFIVLGGELVSKGRGVLHWSAMLEHPDKQVSEWHELQ 394          
BLAST of Synaptotagmin-15 vs. TrEMBL
Match: G7YRD8 (Synaptotagmin-15 OS=Clonorchis sinensis OX=79923 GN=SYT15 PE=4 SV=1)

HSP 1 Score: 187.193 bits (474), Expect = 1.595e-51
Identity = 119/323 (36.84%), Postives = 173/323 (53.56%), Query Frame = 2
Query:  206 QLGTLNPALYQTEEVEDLYDLQIDHVGRIWFTITYNCSTECLIVNFHKIRNLK-----------VXXXXXXXXDC--QYLSVKIFLENLERNYQNTTIKKYSSNSDFNEKFLFQVPFSALRSRTLHFFILLSEKDRHGKPVAVSSYQLTEIASDERIDKDIIKILTKARIYRDLSEHNSNQISCCPEICISLKYHSDTHRLNVTIYNVRNVFNNDKG----IYVKLKLFKGLTCKEKQSKQTSISKENYIFNESFTFFKIFSLDFISLQITLLSEKTLFGIYDKPIGSATLGSHLFAKGKELSYWLQMVNQPDEHIICWLPLK 1123
            QLG L+P LY +EE EDLYD+   H+GRIWFT++Y+ S E L V  HK RNL+            S   + N +C  Q   VK+FLE  ER Y  T  KK + N DFNE+F FQV    L  +TL   +L  +K R  K +  ++Y L+ + ++   D++I       R +RDL   + + IS  P++ ++L Y   T RL V ++  RN+   + G    +Y K+ L++GL  KE +SK+T        F+ESF F KI     I+L+ITL+      G  DK I    LG  L +KG+ + +W  M+  PD+ +  W  L+
Sbjct:   83 QLGKLDPRLYLSEEGEDLYDITPGHLGRIWFTVSYSRSNELLKVTVHKARNLRKWSVFGSLTPDQSQIATQNEECLLQDFRVKLFLEQAERKYHMTATKKQTDNPDFNEQFCFQVAAHDLGQQTLRIHVLGLDKRRRCKLIGYATYGLSALENNTSDDQEI-------RTFRDLQLDDESGISANPQLLVALTYFPTTERLIVGLFECRNLPLKENGLPIDVYAKVVLYQGLQGKELKSKRTESLGTRDSFDESFVFQKIPDPTNINLRITLVQH----GFIDKQICFIVLGGELVSKGRGVLHWSAMLEHPDKQVSEWHELQ 394          
BLAST of Synaptotagmin-15 vs. TrEMBL
Match: A0A267EB54 (C2 domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig005944g1 PE=4 SV=1)

HSP 1 Score: 184.496 bits (467), Expect = 1.126e-50
Identity = 106/316 (33.54%), Postives = 172/316 (54.43%), Query Frame = 2
Query:  188 YLVKHLQLGTLNPALYQTEEVEDLYDLQIDHVGRIWFTITYNCSTECLIVNFHKIRNLKVXXXXXXXX--DCQYLSVKIFLENLERNYQNTTIKKYSSNSDFNEKFLFQVPFSALRSRTLHFFILLSEKDRHGKPVAVSSYQLTEIASDERIDKDIIKILTKARIYRDLSEHNSNQISCCPEICISLKYHSDTHRLNVTIYNVRNVFNNDKG-----IYVKLKLFKGLTCKEKQSKQTSISKENYIFNESFTFFKIFSLDFISLQITLLSEKTLFG-IYDKPIGSATLGSHLFAKGKELSYWLQMVNQPDEHIICW 1111
            + +K   LG L+P+LY  E+ E+LY+    HVGR+WF + Y    E L V   K RNL+V  + S+    DC    V++ +EN +R    T++KK ++N +F+EKF FQ+  ++L S+TL   +   +K +  K +   +Y L E+ S   +DKD        RI+RDL +  +   S  PE+ I L YH+   R+ V ++  RN+           +Y+++ +  GL  KE +SK+T     +  FN+S  F ++  L    +++T++   T  G ++DKP+GS  LG  LFAK +EL +W +M   P++ I  W
Sbjct:   60 HQMKSRALGQLDPSLYLNEDAEELYEHAPGHVGRLWFVLNYTLEVEQLAVTVRKARNLRVRKEASSGQPGDCY---VRLAMENDDRRVHTTSVKKKTNNPNFDEKFCFQIATASLESQTLLMTVFHVDKQKRQKAIGHVAYPLRELLS---VDKDC-------RIFRDL-DSEAGDTSQNPEVKIGLTYHAQLERITVVLHECRNLPTKSDTDECIEVYLRVSMHTGLQGKEVKSKRTETVSHSSAFNQSLIFNRVADLSQTIIKVTMMHHATGIGSLFDKPLGSVVLGCELFAKRRELEHWREMSANPEQTITYW 361          
BLAST of Synaptotagmin-15 vs. TrEMBL
Match: A0A267DT16 (C2 domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig005944g2 PE=4 SV=1)

HSP 1 Score: 184.111 bits (466), Expect = 1.264e-50
Identity = 106/316 (33.54%), Postives = 172/316 (54.43%), Query Frame = 2
Query:  188 YLVKHLQLGTLNPALYQTEEVEDLYDLQIDHVGRIWFTITYNCSTECLIVNFHKIRNLKVXXXXXXXX--DCQYLSVKIFLENLERNYQNTTIKKYSSNSDFNEKFLFQVPFSALRSRTLHFFILLSEKDRHGKPVAVSSYQLTEIASDERIDKDIIKILTKARIYRDLSEHNSNQISCCPEICISLKYHSDTHRLNVTIYNVRNVFNNDKG-----IYVKLKLFKGLTCKEKQSKQTSISKENYIFNESFTFFKIFSLDFISLQITLLSEKTLFG-IYDKPIGSATLGSHLFAKGKELSYWLQMVNQPDEHIICW 1111
            + +K   LG L+P+LY  E+ E+LY+    HVGR+WF + Y    E L V   K RNL+V  + S+    DC    V++ +EN +R    T++KK ++N +F+EKF FQ+  ++L S+TL   +   +K +  K +   +Y L E+ S   +DKD        RI+RDL +  +   S  PE+ I L YH+   R+ V ++  RN+           +Y+++ +  GL  KE +SK+T     +  FN+S  F ++  L    +++T++   T  G ++DKP+GS  LG  LFAK +EL +W +M   P++ I  W
Sbjct:   60 HQMKSRALGQLDPSLYLNEDAEELYEHAPGHVGRLWFVLNYTLEVEQLAVTVRKARNLRVRKEASSGQPGDCY---VRLAMENDDRRVHTTSVKKKTNNPNFDEKFCFQIATASLESQTLLMTVFHVDKQKRQKAIGHVAYPLRELLS---VDKDC-------RIFRDL-DSEAGDTSQNPEVKIGLTYHAQLERITVVLHECRNLPTKSDTDECIEVYLRVSMHTGLQGKEVKSKRTETVGHSSAFNQSLIFNRVADLSQTIIKVTMMHHATGIGSLFDKPLGSVVLGCELFAKRRELEHWREMSANPEQTITYW 361          
BLAST of Synaptotagmin-15 vs. TrEMBL
Match: A0A4S2LSP2 (C2 domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_005118 PE=4 SV=1)

HSP 1 Score: 182.956 bits (463), Expect = 6.453e-50
Identity = 117/323 (36.22%), Postives = 172/323 (53.25%), Query Frame = 2
Query:  206 QLGTLNPALYQTEEVEDLYDLQIDHVGRIWFTITYNCSTECLIVNFHKIRNLK-----------VXXXXXXXXDC--QYLSVKIFLENLERNYQNTTIKKYSSNSDFNEKFLFQVPFSALRSRTLHFFILLSEKDRHGKPVAVSSYQLTEIASDERIDKDIIKILTKARIYRDLSEHNSNQISCCPEICISLKYHSDTHRLNVTIYNVRNVFNNDKG----IYVKLKLFKGLTCKEKQSKQTSISKENYIFNESFTFFKIFSLDFISLQITLLSEKTLFGIYDKPIGSATLGSHLFAKGKELSYWLQMVNQPDEHIICWLPLK 1123
            QLG L+P LY +EE EDLYD+   H+GRIWFT++Y+ + E L V  HK RNL+            S   + N DC  Q   VK+FLE  ER Y  T  KK + N DFNE+F FQV    L  +TL   +L  +K R  K +  ++Y L+ + ++    ++I       R +R+L   + + IS  P++ ++L Y   T RL V ++  RN+   + G    +Y K+ L++GL  KE +SK+T        F+ESF F KI     I+L+ITL+      G  DK I    LG  L +KG+ + +W  M+  PD+ +  W  L+
Sbjct:   83 QLGKLDPRLYLSEEGEDLYDITPGHLGRIWFTVSYSRANELLRVTVHKARNLRKWSVFGSLTLDQSQISTQNEDCLLQDFRVKLFLEQAERKYHMTATKKQTDNPDFNEQFCFQVAAHDLGQQTLRIHVLGLDKRRRCKLIGYATYGLSALENNASDYQEI-------RTFRNLQLDDESGISANPQLLVALTYFPTTERLIVGLFECRNLPLKENGLPIDVYAKVVLYQGLQGKELKSKRTEALGTRDSFDESFVFQKIPDPTNINLRITLVQH----GFIDKQICFIVLGGELVSKGRGVLHWSAMLEHPDKQVSEWHELQ 394          
BLAST of Synaptotagmin-15 vs. Ensembl Cavefish
Match: syt9b (synaptotagmin 9 [Source:NCBI gene;Acc:103033725])

HSP 1 Score: 88.1965 bits (217), Expect = 1.567e-18
Identity = 85/322 (26.40%), Postives = 138/322 (42.86%), Query Frame = 2
Query:  209 LGTLNPALYQTEEVEDLYDLQIDHVGRIWFTITYNCSTECLIVNFHKIRNLKVXXXXXXXXDCQYLSVKIFLENLERNYQNTTIKKYSSNSDFNEKFLFQVPFSALRSRTLHF----FILLSEKDRHGKPVAVSSYQLTEIASDERIDKDIIKILTKARIYRDLSEHNSNQISCCPEICISLKYHSDTHRLNVTIYNVRNVFNND----KGIYVKLKLFKGLTCKEKQSKQTSISKENYIFNESFTF-FKIFSLDFISLQITLLSEKTLFGIYDKPIGSATLGSHLFAKGKELSYWLQMVNQPDEHIICWLPLKY*DLQWHG 1147
            LG + P LY+   V+     + D  GR+ F + Y+C  E LIV  HK  +L        +       VKI+L    +    T + + + N  F+E FLF V ++ L  R LHF    F   S  D  G+ V  +   L +   + ++ KDI+ +        DL                SL Y     RL +TI   RN+   D       YVK+ L       +K+   T  +  N ++NE+  F     ++D ISL I ++    +   +++ IG   +G+   + G++  +W +M+  P + I  W PL    ++W G
Sbjct:  203 LGRIKPELYKQRSVDTDDGRRADSCGRLHFILKYDCDLEQLIVKIHKAEDLPAKDFSGTSDP----YVKIYLLPERKTKHQTKVHRKTLNPVFDEVFLFPVAYAELNMRKLHFSVYDFDRFSRHDLIGQVVVDNFLDLPDFPRETKLCKDILYVTADNVDLGDL--------------MFSLCYLPTAGRLTITIIKARNLKAMDITGASDPYVKVSLMCDGRRLKKRKTSTKRNTLNPVYNEAIVFDVPPENIDQISLLIAVMDYDRVG--HNEIIGVCRVGNTAESLGRD--HWNEMLTYPRKPIAHWHPL----IEWSG 498          
BLAST of Synaptotagmin-15 vs. Ensembl Cavefish
Match: syt3 (synaptotagmin III [Source:ZFIN;Acc:ZDB-GENE-090601-1])

HSP 1 Score: 78.9518 bits (193), Expect = 1.394e-15
Identity = 87/314 (27.71%), Postives = 138/314 (43.95%), Query Frame = 2
Query:  209 LGTLNPALYQTEEVEDLYDLQIDHVGRIWFTITYNCSTECLIVNFHKIRNLKVXXXXXXXXDCQYLS---VKIFL-ENLERNYQNTTIKKYSSNSDFNEKFLFQVPFSALRSRTLHF----FILLSEKDRHGKPVAVSSYQLTEIASDERIDKDIIKILTKARIYRDLSEHNSNQISCCPEICISLKYHSDTHRLNVTIYNVRNVFNNDKGIYVKLKLFKGLTCKEKQ--SKQTSISKE--NYIFNESFTF-FKIFSLDFISLQITLLSEKTLFGIYDKPIGSATLGSHLFAKGKELSYWLQMVNQPDEHIICW 1111
            +G + P LY+  + E     Q D  G+I F + Y  +TE L+V   K  +L          D    S   VKI+L  + ++ YQ T + + + N  FNE F F VP + L SR LHF    F   S  D  G+ V  +    +E   ++ I +DI++   +     DL E N            SL Y     RL VTI    N+   D   +    +   L C+ ++   ++TSI K   N  +NE+  F     +++ +SL I ++    +   +++ IG   +GS     G+E  +W  M+  P + I  W
Sbjct:  185 IGQIKPELYRLRQGEQGDGKQGDTCGKISFLLRYAFNTEQLVVKILKALDLPAK-------DANGFSDPYVKIYLLPDRKKKYQ-TKVHRKTLNPVFNETFQFGVPLAELHSRKLHFSVYDFDRFSRHDLIGQVVVDNLLDFSEGTGEKPIWRDIVEGTAEK---ADLGELN-----------FSLCYLPTAGRLTVTIIKATNLKAMDLTGFSDPYVKASLVCEGRRLKKRKTSIKKNTLNPTYNEALVFDIPNENIESVSLIIAVMDYDCIG--HNEVIGMCCVGSDAEGPGRE--HWTAMLANPRKPIEHW 472          
BLAST of Synaptotagmin-15 vs. Ensembl Cavefish
Match: syt3 (synaptotagmin III [Source:ZFIN;Acc:ZDB-GENE-090601-1])

HSP 1 Score: 78.1814 bits (191), Expect = 2.736e-15
Identity = 87/314 (27.71%), Postives = 138/314 (43.95%), Query Frame = 2
Query:  209 LGTLNPALYQTEEVEDLYDLQIDHVGRIWFTITYNCSTECLIVNFHKIRNLKVXXXXXXXXDCQYLS---VKIFL-ENLERNYQNTTIKKYSSNSDFNEKFLFQVPFSALRSRTLHF----FILLSEKDRHGKPVAVSSYQLTEIASDERIDKDIIKILTKARIYRDLSEHNSNQISCCPEICISLKYHSDTHRLNVTIYNVRNVFNNDKGIYVKLKLFKGLTCKEK--QSKQTSISKE--NYIFNESFTF-FKIFSLDFISLQITLLSEKTLFGIYDKPIGSATLGSHLFAKGKELSYWLQMVNQPDEHIICW 1111
            +G + P LY+  + E     Q D  G+I F + Y  +TE L+V   K  +L          D    S   VKI+L  + ++ YQ T + + + N  FNE F F VP + L SR LHF    F   S  D  G+ V  +    +E   ++ I +DI++   +     DL E N            SL Y     RL VTI    N+   D   +    +   L C+ +  + ++TSI K   N  +NE+  F     +++ +SL I ++    +   +++ IG   +GS     G+E  +W  M+  P + I  W
Sbjct:  214 IGQIKPELYRLRQGEQGDGKQGDTCGKISFLLRYAFNTEQLVVKILKALDLPAK-------DANGFSDPYVKIYLLPDRKKKYQ-TKVHRKTLNPVFNETFQFGVPLAELHSRKLHFSVYDFDRFSRHDLIGQVVVDNLLDFSEGTGEKPIWRDIVEGTAEK---ADLGELN-----------FSLCYLPTAGRLTVTIIKATNLKAMDLTGFSDPYVKASLVCEGRRLKKRKTSIKKNTLNPTYNEALVFDIPNENIESVSLIIAVMDYDCIG--HNEVIGMCCVGSDAEGPGRE--HWTAMLANPRKPIEHW 501          
BLAST of Synaptotagmin-15 vs. Ensembl Cavefish
Match: syt5b (synaptotagmin-1-like [Source:NCBI gene;Acc:103029888])

HSP 1 Score: 72.0182 bits (175), Expect = 2.458e-13
Identity = 71/288 (24.65%), Postives = 124/288 (43.06%), Query Frame = 2
Query:  278 HVGRIWFTITYNCSTECLIVNFHKIRNLKVXXXXXXXXDCQYLSVKIFLENLERNYQNTTIKKYSSNSDFNEKFLFQVPFSALRSRTLHFFILLSEKDRHGKPVAVSSYQLTEIASDERIDKDIIKILTKARIYRDLSEHNSNQISCCPEICISLKYHSDTHRLNVTIYNVRNVFNNDKG----IYVKLKLFKGLTCKEKQSKQTSISKENYIFNESFTFFKIF-SLDFISLQITLLSEKTLFGIYDK-----PIGSATLGSHLFAKGKELSYWLQMVNQPDEHIICW 1111
            H+G++ F++ YN +   LIV   + ++L        +       VK+FL   ++    T +++ +    FNE F+F++P++ L  + L   +L+ + DR GK          ++    +I  + + +      +RDL      +     ++CISL+Y     +L V I   +N+   D G     +VK+ L       +K+      +  N  FNESF+F   F  +  + L IT+         YDK     PIG   +G    A G  L +W  M+  P   +  W
Sbjct:  162 HLGKLEFSLDYNFTEAQLIVGILQAQDLAAMDIGGTSDPY----VKVFLLPDKKKKFETKVQRKNLCPVFNETFIFKIPYAELGGKIL--VLLVYDFDRFGK---------HDVIGQIKIPMNCVDLGQPLHQWRDLESAEKEEQEKLGDVCISLRYVPTAGKLTVNIMEAKNLKKMDVGGLSDPFVKIVLQHNGKRLKKKKTTVKKNTLNPYFNESFSFEIPFEQIQKVQLLITVYD-------YDKLGSNDPIGKIFIGYG--ATGVGLRHWSDMLANPRRPVAQW 425          
BLAST of Synaptotagmin-15 vs. Ensembl Cavefish
Match: syt1a (synaptotagmin 1 [Source:NCBI gene;Acc:103044539])

HSP 1 Score: 70.8626 bits (172), Expect = 5.046e-13
Identity = 80/322 (24.84%), Postives = 138/322 (42.86%), Query Frame = 2
Query:  212 GTLNPALYQTEEVE--------DLYDLQIDHVGRIWFTITYNCSTECLIVNFHKIRNLKVXXXXXXXXDCQYLSVKIFLENLERNYQNTTIKKYSSNSDFNEKFLFQVPFSALRSRTLHFFILLSEKDRHGKPVAVSSYQLTEIASDERIDKDIIKILTKARIYRDLSEHNSNQISCCPEICISLKYHSDTHRLNVTIYNVRNVFNNDKG----IYVKLKLFKGLTCKEKQSKQTSISKENYIFNESFTFFKIFS-LDFISLQITLLSEKTLFGIYDK-----PIGSATLGSHLFAKGKELSYWLQMVNQPDEHIICWLPLK 1123
            GT   AL   +EVE        +    + + +G++ +++ YN +   LIV    I+  ++ +     +   Y  VK++L   ++    T + + + N  FNE+F F+VP++ L  +TL   + + + DR  K  A+          D ++  + +        +RDL      +     +IC SL+Y     +L V I   +N+   D G     Y K+ L +     +K+      +  N  +NESF+F   F  +  + + IT+L        YDK      IG   +G  L + G EL +W  M+  P   I  W  LK
Sbjct:  108 GTKTEALKDEDEVETGLTENEKEAEPKEQEKLGKLQYSLDYNFTENTLIVGI--IQAAELPAMDMGGTSDPY--VKVYLLPDKKKKFETKVHRKTLNPTFNEQFTFKVPYTELGGKTL--VMTVYDFDRFSKHDAI---------GDVKVPMNKVDFSHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYAKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQIVITVLD-------YDKIGKNDAIGKVFVG--LNSSGTELRHWSDMLANPRRPIAQWHVLK 405          
BLAST of Synaptotagmin-15 vs. Ensembl Sea Lamprey
Match: SYT6 (synaptotagmin 6 [Source:HGNC Symbol;Acc:HGNC:18638])

HSP 1 Score: 55.8398 bits (133), Expect = 5.803e-9
Identity = 40/123 (32.52%), Postives = 61/123 (49.59%), Query Frame = 2
Query:  191 LVKHLQLGTLNPALYQTEE-VEDLYDLQIDHVGRIWFTITYNCSTECLIVNFHKIRNLKVXXXXXXXXDCQYLSVKIFL-ENLERNYQNTTIKKYSSNSDFNEKFLFQVPFSALRSRTLHFFI 553
            L++   LG + P LY+    V  + D++    GRI F + Y+   E L+V  +K  +L        +       VKI+L    +R YQ T + + + N  F+E F F VP+S L SR LHF +
Sbjct:  153 LLRTNTLGRIKPELYKARPSVPAVGDMKAPPCGRINFQVRYDYEGEQLVVKINKAVDLPAKDFSGTSDP----YVKIYLLPERKRKYQ-TKVHRKTLNPVFDETFQFGVPYSELASRRLHFSV 270          
BLAST of Synaptotagmin-15 vs. Ensembl Sea Lamprey
Match: syt12 (synaptotagmin XII [Source:ZFIN;Acc:ZDB-GENE-081022-147])

HSP 1 Score: 53.9138 bits (128), Expect = 2.189e-8
Identity = 38/149 (25.50%), Postives = 70/149 (46.98%), Query Frame = 2
Query:  695 HNSNQIS-CCPEICISLKYHSDTHRLNVTIYNVRNV----FNNDKGIYVKLKLFKGLTCKEKQSKQTSISKENYIFNESFTF-FKIFSLDFISLQITLLSEKTLFGIYDKPIGSATLGSHLFAKGKELSYWLQMVNQPDEHIICWLPLK 1123
             +S+Q++ CC E+ +SL Y     RL V +   + +           +VK+ L +G     K+   T   + N ++N++  F     +L  ISL++T+   +   G+  + IG A +G    + G  L++W QM+      +  W PL+
Sbjct:  161 QDSSQVAECCGEVLLSLSYLPTAERLTVVVVKAKGLEWPQGRESGAPFVKVYLLQGGRKVSKKKTVTKRDERNPVYNDAIIFSVPASTLQDISLRVTVADHRE--GMRAEDIGHAVIGPQ--SSGVALAHWQQMLATLRRPVSMWHPLR 305          
BLAST of Synaptotagmin-15 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000226.1 (pep scaffold:Pmarinus_7.0:GL478944:1404:4221:1 gene:ENSPMAG00000000205.1 transcript:ENSPMAT00000000226.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 47.7506 bits (112), Expect = 3.596e-7
Identity = 36/138 (26.09%), Postives = 59/138 (42.75%), Query Frame = 2
Query:  725 EICISLKYHSDTHRLNVTIYNVRNVFNND-KGI----YVKLKLFKGLTCKEKQSKQTSISKENYIFNESFTF-FKIFSLDFISLQITLLSEKTLFGIYDKPIGSATLGSHLFAKGKELSYWLQMVNQPDEHIICWLPL 1120
            EI +SL YH    RL V +   R++   D  G+    YVK+ ++ G     K+         N +FNESF F      L  +++++T++        +D+      +G      G E  +W ++   P   I  W PL
Sbjct:    7 EILVSLCYHPAASRLTVVVLKARHLPKTDIVGLSVDPYVKVNIYSGKRRFAKKKTHVKKCTLNPVFNESFVFELPEEGLSDLAVELTVVD-------FDRTTKDEVIGRLALGPGTE--HWREVCENPRRQIAKWHPL 135          
BLAST of Synaptotagmin-15 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003267.1 (pep scaffold:Pmarinus_7.0:GL476427:260045:262512:1 gene:ENSPMAG00000002986.1 transcript:ENSPMAT00000003267.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 46.2098 bits (108), Expect = 5.856e-6
Identity = 61/224 (27.23%), Postives = 93/224 (41.52%), Query Frame = 2
Query:  281 VGRIWFTITYNCSTECLIVNFHKIRNLKVXXXXXXXXDCQYLSVKIFLENLERNYQNTTIKKYSSNSDFNEKFLFQVPFSALRSRTLHFFILLSEKDRHGKPVAVSSYQ--LTEIASDERIDKDIIKILTKARIYRDLSEHNSNQISCCPEICISLKYHSDTHRLNVTIYNVRN---VFNNDKGIYVKLKLF----KGLTCKEKQSKQTSISKENYIFNESFTF 925
            +G I F + Y      L V   ++R+L         S    +S+   + +L+    + T      N  F E FLF VP   L  RT+   I L + DR  K   V   +  L ++  D +  +  +K  TK +      EH         E+ ISL Y  +  +L +T+   RN   + N  +G++VKL +     K +  K+   KQ   S E   FNES  F
Sbjct:    1 LGSINFCLLYEEELNILTVQIIQMRDLPAKEFGKPASFICTVSLLPDVSSLQSQVHHNT-----PNPIFMESFLFSVPLLELHRRTV--LIKLFDVDRFSKKNIVGKIEQPLRDLLLDMKAPQHFLK-KTKGKQKSQPDEHG--------ELSISLGYLPNAEKLTITVLQARNINAIQNGSQGLFVKLTVSVENEKYIKTKKIMQKQRDGSIE---FNESVAF 205          
BLAST of Synaptotagmin-15 vs. Ensembl Nematostella
Match: EDO47762 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKX9])

HSP 1 Score: 87.8113 bits (216), Expect = 1.617e-19
Identity = 76/289 (26.30%), Postives = 134/289 (46.37%), Query Frame = 2
Query:  278 HVGRIWFTITYNCSTECLIVNFHKIRNLKVXXXXXXXXDCQYLSVKIFLENLERNYQNTTIKKYSSNSDFNEKFLFQVPFSALRSRTLHFFILLSEKDRHGKPVAVSSYQLTEIASD--ERIDKDIIKILTKARIYRDLSEHNSNQISCCPEICISLKYHSDTHRLNVTI---YNVRNVFNNDKGIYVKLKLFKGLTCKEKQSKQTSISKE--NYIFNESFTFFKIFSLDFISLQITLLSEKTLFGIY-DKPIGSATLGSHLFAKGKELSYWLQMVNQPDEHIICWLPL 1120
            H+GR+WF I Y+ + + L+V   K RNL   SK     D     VKI L   +++   +  K+ +    FNE F   +    L S TL F +    +      +  + Y L ++ S   + + +D+ K +  ++  R L            +I ISL Y+    RL + I    N+R + +     +VK+    G   K  ++K+T++ ++  N +FN++F +  +   D  +  + +    +  G+  DK IG   LG  ++A+GKE  +W +M+  P + I  W PL
Sbjct:   29 HIGRLWFNIQYSTTGQNLVVTLVKARNLPSRSKTVRTCDP---FVKIALLPKDKHVSQSRCKRKTKRPTFNETFYIPIAEDELDSSTLQFTVFDGYRMSQQAIIGEAMYPLIDMESTGIQELWRDLEKPIEVSQAKRKL----------LGDIHISLSYYPTLDRLTIIILRAANLRTIGHKGTDPFVKIAFSIG--NKVMKTKKTAVHQDTVNPMFNDAFNY-TVTEDDLGTSSLLVSVWHSGGGVREDKLIGRVLLGGMMYARGKECEHWTEMMTNPRKMIKYWHPL 301          
BLAST of Synaptotagmin-15 vs. Ensembl Nematostella
Match: EDO50013 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RF18])

HSP 1 Score: 62.7734 bits (151), Expect = 4.602e-11
Identity = 76/292 (26.03%), Postives = 128/292 (43.84%), Query Frame = 2
Query:  284 GRIWFTITYNCSTECLIVNFHKIRNLKVXXXXXXXXDCQYLSVKIFLENLERNYQNTTIKKYSSNSDFNEKFLFQVPFSALRSRTLHFFILLSEKDRHGKPVAVSSYQLTEIASDERIDKDIIKILTKARIYRDLSEHNSNQISCCPEICISLKYHSDTHRLNVTIYNVRNVFN-----NDKGIYVKLKLFKGLTCKEKQSKQTSISKENY--IFNESFTF-FKIFSLDFISLQITLLSE-----KTLFGIYDKPIGSATLGSHLFAKGKELSYWLQMVNQPDEHIICWLPL 1120
            G++ F+I Y+ + ECL V   K  NL V    +      Y+ V +  + +E+ YQ T +K  +SN  FNE F F V FS L  RTL F I  ++ D + +  A+          +  + +D + I  K  I RD+     NQ+    E+ +SL Y   + RL   +   R         +    +VK+ L   ++ ++ +  +TS+       ++NE+F F   +  L  +SL + +L       +T+      P    ++G H         +W  M+  P + I  W PL
Sbjct:   16 GKLEFSIMYDTTCECLRVRVLKANNLSVPEATT------YVEVFLLPDKIEK-YQ-TNVKYKNSNPVFNETFEFDVAFSELPERTLQFCI--NDYDGYSRHQALGEV-FHSFDVNVNMQEDTVVIYEKD-IRRDIFTFRENQVRKG-EVLLSLCYLPTSGRLTFVVLKARLSMRLLFRYSLSDPFVKVSLM--VSGRQIKKTKTSVMHGTLRPVYNEAFVFDIPVERLSDVSLLVRMLHSDGKRCQTIAKTVVGPDSQTSIGLH---------HWNCMMTSPRKPIAQWHPL 283          
BLAST of Synaptotagmin-15 vs. Ensembl Nematostella
Match: EDO31746 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX17])

HSP 1 Score: 61.6178 bits (148), Expect = 1.476e-10
Identity = 73/288 (25.35%), Postives = 132/288 (45.83%), Query Frame = 2
Query:  281 VGRIWFTITYNCSTECLIVNFHKIRNLKVXXXXXXXXDCQYLSVKIFLENLERNYQNTTIKKYSSNSDFNEKFLFQ-VPFSALRSRTLHFFILLSEKDRHGKPVAVSSYQLTEIASDERIDKDIIKILTKARIYRDLSEHNS--NQISCCPEICISLKYHSDTHRLNVTIYNVRNVFNND----KGIYVKLKLFKGLTCKEKQSKQTSISKENYIFNESFTFFKIFS-LDFISLQITLLSEKTLFGIYDKPIGSATLGSHLFAK---GKELSYWLQMVNQPDEHIICW 1111
            +GRI FT+ Y+ +   L V    IR   + +K  + S   Y+ + + L + ++ Y+ T + + + N  FNE+F+F+ +P+S + +R L   + L + DR       S + L   A    ID D+   + + R+    S      +  S   +IC SL+Y   + +L +TI   +++ + D       YVK+ L +     +K+         N  +NE+FTF   F  ++  SL I++L        YD+   S  +G  +  +   G +L +W  M+  P   +  W
Sbjct:   84 IGRINFTLDYSFTDNTLTVGI--IRAEDIPAKDFSGSSDPYVKI-MLLPDKKKKYE-TKVHRKTLNPVFNEQFVFKNIPYSEITNRIL--LMELFDFDR------FSRHDLIGEARLPLIDVDLASNINEWRVLTPPSGSGGAGHSKSDLGDICFSLRYVPSSGKLQITIVEAKSLKSMDLTGYSDPYVKIALVQEGRKIKKKKTTVKKRTLNPYYNETFTFTVAFEKIEQTSLIISVLD-------YDRVGKSEMIGKCVVGELSSGADLRHWADMLASPRRSVAQW 352          
BLAST of Synaptotagmin-15 vs. Ensembl Nematostella
Match: EDO33081 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST78])

HSP 1 Score: 59.3066 bits (142), Expect = 4.669e-10
Identity = 68/285 (23.86%), Postives = 122/285 (42.81%), Query Frame = 2
Query:  287 RIWFTITYNCSTECLIVNFHKIRNLKVXXXXXXXXDCQYLSVKIFLENLERNYQNTTIKKYSSNSDFNEKFLFQVPFSALRSRTLHFFILLSEKDRHGKPVAVSSYQLTEIASDERIDKDIIKILTKARIYRDLSEHNSNQISCCPEICISLKYHSDTHRLNVTIYNVRNVF-----NNDKGIYVKLKLFKGLTCKEKQSKQTSISKE--NYIFNESFTFFKIFS-LDFISLQITLLSEKTLFG--IYDKPIGSATLGSHLFAKGKELSYWLQMVNQPDEHIICW 1111
            R+ F++ Y+   E L V    IR  +++ K +N     Y+ +   L + +R  Q+T  +  +SN  FNE F+F VP   LR RTL F +   + DR  +   +   QL +                                    ++  SL+Y     RL V I   +++        +   YVK+ +  G   K  + ++T + K+  N +FN++F F    S L+ +S  I++++     G  I+   +G A +G ++++    LS+W  M+  P   +  W
Sbjct:    5 RLCFSLNYSHYNEKLQVKL--IRATRLTPKGNNVVATPYVKM-CLLPDRKRKLQSTR-RHRNSNPAFNEDFVFSVPAEELRMRTLKFTV--CDFDRFSRQQVIGHVQLEK-----------------------------------GQLLFSLQYLPTACRLTVAILKGKDLRVEGEETTEIDTYVKVSMIMG--GKAVKKRKTPVVKKTCNPVFNQAFVFSMPPSYLENVSFVISVIATPKRGGNKIH---VGRAVVGPYMYSTSPGLSHWTDMLGSPRSAVAQW 243          
BLAST of Synaptotagmin-15 vs. Ensembl Nematostella
Match: EDO33088 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST77])

HSP 1 Score: 55.8398 bits (133), Expect = 8.211e-9
Identity = 62/290 (21.38%), Postives = 119/290 (41.03%), Query Frame = 2
Query:  281 VGRIWFTITYNCSTECLIVNFHKIRNLKVXXXXXXXXDCQYLSVK-------IFLENLERNYQNTTIKKYSSNSDFNEKFLFQVPFSALRSRTLHFFILLSEKDRHGKPVAVSSYQLTEIASDERIDKDIIKILTKARIYRDLSEHNSNQISCCPEICISLKYHSDTHRLNVTIYNVRNVF----NNDKGIYVKL-KLFKGLTCKEKQSKQTSISKENYIFNESFTF-FKIFSLDFISLQITLLSEKTLFGIYDKPIGSATLGSHLFAKGKELSYWLQMVNQPDEHIICW 1111
            +G + F   Y    E L ++    + L V     +  DC +  V        + L   E+    + +K+ + + +F+E F+F++  + ++ +TL F +    +     P+  + + L          +D+   +   R  +   + N  +IS      +SL Y+  T RL V +   RN+     +  K  +VK+ ++      K K++  T     + IF    +F      L    L ++L++   + G     IG   LG ++F  G E S+W +M+  P   I  W
Sbjct:    1 MGTLLFEARYQKYEEQLTIHLIGAKRLPVRHHVIDVGDCPHYDVMPCDPKVLVCLLPDEKPVLESYVKQSTWDPNFDETFVFKLNTNEVKEKTLRFSVYDCTRLHKLCPIGHTLFSLK--------GQDLDGTMAVERAIKPQCQVNRGEIS------LSLTYNPGTSRLVVGVRQARNILQFEGHAHKEYFVKISRIHLNRKVKTKRTPSTD-GDASPIFKHDMSFNIPTEQLSDSCLVLSLMNHGVVRG--STTIGRVVLGPYVFGSGNERSHWGRMIRSPLNTIEQW 273          
BLAST of Synaptotagmin-15 vs. Ensembl Medaka
Match: syt9b (synaptotagmin-9 [Source:NCBI gene;Acc:101171486])

HSP 1 Score: 83.1889 bits (204), Expect = 6.275e-17
Identity = 85/326 (26.07%), Postives = 147/326 (45.09%), Query Frame = 2
Query:  209 LGTLNPALYQTEEVEDLYDLQIDHVGRIWFTITYNCSTECLIVNFHKIRNLKVXXXXXXXXDCQYLSVKIFLENLERNYQNTTIKKYSSNSDFNEKFLFQVPFSALRSRTLHF----FILLSEKDRHGKPVAVSSYQLTEIASDERIDKDIIKILTKARIYRDLSEHNSNQISCCPEICISLKYHSDTHRLNVTIYNVRNVFNND----KGIYVKLKLFKGLTCKEKQSKQTSISKE----NYIFNESFTF-FKIFSLDFISLQITLLSEKTLFGIYDKPIGSATLGSHLFAKGKELSYWLQMVNQPDEHIICWLPLKY*DLQWHG 1147
            LG + P LY+   V+     + D  GR+ F + ++   E LIV  H+ ++L        +       VKI+L    +    T + + + N  F+E FLF V ++ L SR LHF    F   S  D  G+ V  +   L +   + ++ +D I+ +T   +  DL            E+  SL Y     RL +T+   RN+   D       YVK+ L     C+ ++ K+   S +    N ++NE+  F     ++D ISL I ++    +   +++ IG   +GS   + G++  +W +M++ P + I  W PL    ++W G
Sbjct:  210 LGRIKPELYKQRSVDAEDGRRTDSCGRLHFILKFDLDLEQLIVKIHRAQDLPAKDFSGTSDP----YVKIYLLPDRKTKHQTKVHRKTLNPVFDEVFLFPVAYAELSSRKLHFSVYDFDRFSRHDLIGQVVVDNFLDLPDFPRETKLCRD-IQYVTSDNV--DLG-----------ELMFSLCYLPTAGRLTITMIKARNLKAMDITGASDPYVKVSLM----CEGRRLKKRKTSTKRNTLNPVYNEAIVFDVPPENIDQISLLIAVMDYDRVG--HNEVIGVCRVGSEAESLGRD--HWNEMLSYPRKPIAHWHPL----IEWVG 505          
BLAST of Synaptotagmin-15 vs. Ensembl Medaka
Match: syt9b (synaptotagmin-9 [Source:NCBI gene;Acc:101171486])

HSP 1 Score: 82.8037 bits (203), Expect = 8.732e-17
Identity = 83/314 (26.43%), Postives = 144/314 (45.86%), Query Frame = 2
Query:  209 LGTLNPALYQTEEVEDLYDLQIDHVGRIWFTITYNCSTECLIVNFHKIRNLKVXXXXXXXXDCQYLSVKIFLENLERNYQNTTIKKYSSNSDFNEKFLFQVPFSALRSRTLHF----FILLSEKDRHGKPVAVSSYQLTEIASDERIDKDIIKILTKARIYRDLSEHNSNQISCCPEICISLKYHSDTHRLNVTIYNVRNVFNND----KGIYVKLKLF-KGLTCKEKQSKQTSISKENYIFNESFTF-FKIFSLDFISLQITLLSEKTLFGIYDKPIGSATLGSHLFAKGKELSYWLQMVNQPDEHIICWLPL 1120
            LG + P LY+   V+     + D  GR+ F + ++   E LIV  H+ ++L        +       VKI+L    +    T + + + N  F+E FLF V ++ L SR LHF    F   S  D  G+ V  +   L +   + ++ +D I+ +T   +  DL            E+  SL Y     RL +T+   RN+   D       YVK+ L  +G   K++++  T  +  N ++NE+  F     ++D ISL I ++    +   +++ IG   +GS   + G++  +W +M++ P + I  W PL
Sbjct:  210 LGRIKPELYKQRSVDAEDGRRTDSCGRLHFILKFDLDLEQLIVKIHRAQDLPAKDFSGTSDP----YVKIYLLPDRKTKHQTKVHRKTLNPVFDEVFLFPVAYAELSSRKLHFSVYDFDRFSRHDLIGQVVVDNFLDLPDFPRETKLCRD-IQYVTSDNV--DLG-----------ELMFSLCYLPTAGRLTITMIKARNLKAMDITGASDPYVKVSLMCEGRRLKKRKT-STKRNTLNPVYNEAIVFDVPPENIDQISLLIAVMDYDRVG--HNEVIGVCRVGSEAESLGRD--HWNEMLSYPRKPIAHWHPL 500          
BLAST of Synaptotagmin-15 vs. Ensembl Medaka
Match: syt9a (synaptotagmin-9 [Source:NCBI gene;Acc:101174010])

HSP 1 Score: 77.411 bits (189), Expect = 5.814e-15
Identity = 89/330 (26.97%), Postives = 148/330 (44.85%), Query Frame = 2
Query:  203 LQLGTLNPALYQTEEV-EDLYDLQIDHVGRIWFTITYNCSTECLIVNFHKIRNLKVXXXXXXXXDCQYLSVKIFLENLERNYQNTTIKKYSSNSDFNEKFLFQVPFSALRSRTLHF----FILLSEKDRHGKPVAVSSYQLTEIASDERIDKDIIKILTKARIYRDLSEHNSNQISCCPEICISLKYHSDTHRLNVTIYNVRNVFNND----KGIYVKLKLFKGLTCKEKQSKQTSISKE----NYIFNESFTF-FKIFSLDFISLQITLLSEKTLFGIYDKPIGSATLGSHLFAKGKELSYWLQMVNQPDEHIICWLPLKY*DLQWHGT 1150
            L LG+L P LYQ   + ED    +    GR+ F + ++C+ E LIV  HK  +L        +       VKI+L    +    T + + + N  F+E FLF V +S L +R LHF    F   S  D  G+ V V ++   E+A   R  +  + I   +    DL            ++  SL Y     RL +T+   RN+   D       YVK+ L     C+ ++ K+   S +    N I+NE+  F     +++ ISL I ++    +   +++ IG   +G+   + G+E  +W +M+  P + +  W PL    +++ GT
Sbjct:  246 LGLGSLKPELYQPCSMDEDEGSHRGRSCGRLHFVLKFDCNLEQLIVKIHKAEDLPAKDFSGTSDP----YVKIYLLPDRKTKHQTKVHRKTLNPVFDEVFLFPVAYSELPTRKLHFSVYDFDRFSRHDIIGQ-VVVDNF--LELADFPRETQLCLNIQYVSSDNVDLG-----------DLMFSLCYLPTAGRLTITMIKARNLKAMDITGASDPYVKVSLM----CEGRRLKKRKTSTKRNTLNPIYNEAIVFDVPPENIEQISLLIAVMDYDRVG--HNEVIGVCRVGNDADSLGRE--HWNEMLTYPRKPVAHWHPL----VEYQGT 545          
BLAST of Synaptotagmin-15 vs. Ensembl Medaka
Match: syt9a (synaptotagmin-9 [Source:NCBI gene;Acc:101174010])

HSP 1 Score: 77.0258 bits (188), Expect = 6.235e-15
Identity = 84/320 (26.25%), Postives = 141/320 (44.06%), Query Frame = 2
Query:  203 LQLGTLNPALYQTEEV-EDLYDLQIDHVGRIWFTITYNCSTECLIVNFHKIRNLKVXXXXXXXXDCQYLSVKIFLENLERNYQNTTIKKYSSNSDFNEKFLFQVPFSALRSRTLHF----FILLSEKDRHGKPVAVSSYQLTEIASDERIDKDIIKILTKARIYRDLSEHNSNQISCCPEICISLKYHSDTHRLNVTIYNVRNVFNND----KGIYVKLKLFKGLTCKEKQSKQTSISKE----NYIFNESFTF-FKIFSLDFISLQITLLSEKTLFGIYDKPIGSATLGSHLFAKGKELSYWLQMVNQPDEHIICWLPL 1120
            L LG+L P LYQ   + ED    +    GR+ F + ++C+ E LIV  HK  +L        +       VKI+L    +    T + + + N  F+E FLF V +S L +R LHF    F   S  D  G+ V  +  +L +   + ++  +I  + +      DL                SL Y     RL +T+   RN+   D       YVK+ L     C+ ++ K+   S +    N I+NE+  F     +++ ISL I ++    +   +++ IG   +G+   + G+E  +W +M+  P + +  W PL
Sbjct:  191 LGLGSLKPELYQPCSMDEDEGSHRGRSCGRLHFVLKFDCNLEQLIVKIHKAEDLPAKDFSGTSDP----YVKIYLLPDRKTKHQTKVHRKTLNPVFDEVFLFPVAYSELPTRKLHFSVYDFDRFSRHDIIGQVVVDNFLELADFPRETQLCLNIQYVSSDNVDLGDL--------------MFSLCYLPTAGRLTITMIKARNLKAMDITGASDPYVKVSLM----CEGRRLKKRKTSTKRNTLNPIYNEAIVFDVPPENIEQISLLIAVMDYDRVG--HNEVIGVCRVGNDADSLGRE--HWNEMLTYPRKPVAHWHPL 484          
BLAST of Synaptotagmin-15 vs. Ensembl Medaka
Match: syt6a (synaptotagmin VIa [Source:ZFIN;Acc:ZDB-GENE-090601-2])

HSP 1 Score: 75.485 bits (184), Expect = 1.889e-14
Identity = 85/328 (25.91%), Postives = 143/328 (43.60%), Query Frame = 2
Query:  185 DYLV----KHLQLGTLNPALYQT---EEVEDLYDLQIDHVGRIWFTITYNCSTECLIVNFHKIRNLKVXXXXXXXXDCQYLSVKIFLENLERNYQNTTIKKYSSNSDFNEKFLFQVPFSALRSRTLHF----FILLSEKDRHGKPVAVSSYQLTEIASDERIDKDIIKILTKARIYRDLSEHNSNQISCCPEICISLKYHSDTHRLNVTIYNVRNVFNNDKGIYVKLKLFKGLTCKEKQSKQTSISKENYIFNESFTFFKIF-----SLDFISLQITLLSEKTLFGIYDKPIGSATLGSHLFAKGKELSYWLQMVNQPDEHIICWLPL 1120
            DY+V    K   +G + P LYQ    E  E   +    + GRI F++ Y+  +E L+VN  K  +L        +       VK++L    + +Q T + + + N  F+E F F VP+  L  R LH     F   S  D  G+ V  + ++ ++++ +               I+RD+    S  +    EI  SL Y     RL +T+   RN+   D   Y    +   L C  ++ K+   S +    N ++    IF     S+D +SL I+++ +  L G +++ IG   +G    A+G    +W +M+  P + I  W PL
Sbjct:  104 DYMVDKDEKQTSIGRIQPELYQQKALESEESSKNGSSKNCGRINFSLKYDYESEALLVNILKAVDLPAKDLCGTSDPY----VKVYLLPDRKKFQ-TRVHRKTLNPTFDETFQFPVPYEELAIRKLHMSVFDFDRFSRHDMIGEVVLENLFETSDLSRE-------------TNIWRDIQYATSESVDLG-EIMFSLCYLPTAGRLTLTVIKCRNLKAMDITGYSDPYVKVSLICDGRRLKKKKTSIKKNTLNPTYNEAIIFDIPPDSMDHVSLHISVM-DYDLVG-HNEIIGVMRVGCQ--AEGLGRDHWNEMLAYPRKPIAHWHPL 408          
BLAST of Synaptotagmin-15 vs. Planmine SMEST
Match: SMESG000037727.1 (SMESG000037727.1)

HSP 1 Score: 425.246 bits (1092), Expect = 3.650e-150
Identity = 207/208 (99.52%), Postives = 207/208 (99.52%), Query Frame = 2
Query:  503 FQVPFSALRSRTLHFFILLSEKDRHGKPVAVSSYQLTEIASDERIDKDIIKILTKARIYRDLSEHNSNQISCCPEICISLKYHSDTHRLNVTIYNVRNVFNNDKGIYVKLKLFKGLTCKEKQSKQTSISKENYIFNESFTFFKIFSLDFISLQITLLSEKTLFGIYDKPIGSATLGSHLFAKGKELSYWLQMVNQPDEHIICWLPLKY 1126
            FQVPFSALRSRTLHFFILLSEKDRHGKPVAVSSYQLTEIASDERIDKD IKILTKARIYRDLSEHNSNQISCCPEICISLKYHSDTHRLNVTIYNVRNVFNNDKGIYVKLKLFKGLTCKEKQSKQTSISKENYIFNESFTFFKIFSLDFISLQITLLSEKTLFGIYDKPIGSATLGSHLFAKGKELSYWLQMVNQPDEHIICWLPLKY
Sbjct:   29 FQVPFSALRSRTLHFFILLSEKDRHGKPVAVSSYQLTEIASDERIDKDNIKILTKARIYRDLSEHNSNQISCCPEICISLKYHSDTHRLNVTIYNVRNVFNNDKGIYVKLKLFKGLTCKEKQSKQTSISKENYIFNESFTFFKIFSLDFISLQITLLSEKTLFGIYDKPIGSATLGSHLFAKGKELSYWLQMVNQPDEHIICWLPLKY 236          
BLAST of Synaptotagmin-15 vs. Planmine SMEST
Match: SMESG000037727.1 (SMESG000037727.1)

HSP 1 Score: 424.861 bits (1091), Expect = 3.989e-150
Identity = 207/208 (99.52%), Postives = 207/208 (99.52%), Query Frame = 2
Query:  503 FQVPFSALRSRTLHFFILLSEKDRHGKPVAVSSYQLTEIASDERIDKDIIKILTKARIYRDLSEHNSNQISCCPEICISLKYHSDTHRLNVTIYNVRNVFNNDKGIYVKLKLFKGLTCKEKQSKQTSISKENYIFNESFTFFKIFSLDFISLQITLLSEKTLFGIYDKPIGSATLGSHLFAKGKELSYWLQMVNQPDEHIICWLPLKY 1126
            FQVPFSALRSRTLHFFILLSEKDRHGKPVAVSSYQLTEIASDERIDKD IKILTKARIYRDLSEHNSNQISCCPEICISLKYHSDTHRLNVTIYNVRNVFNNDKGIYVKLKLFKGLTCKEKQSKQTSISKENYIFNESFTFFKIFSLDFISLQITLLSEKTLFGIYDKPIGSATLGSHLFAKGKELSYWLQMVNQPDEHIICWLPLKY
Sbjct:   26 FQVPFSALRSRTLHFFILLSEKDRHGKPVAVSSYQLTEIASDERIDKDNIKILTKARIYRDLSEHNSNQISCCPEICISLKYHSDTHRLNVTIYNVRNVFNNDKGIYVKLKLFKGLTCKEKQSKQTSISKENYIFNESFTFFKIFSLDFISLQITLLSEKTLFGIYDKPIGSATLGSHLFAKGKELSYWLQMVNQPDEHIICWLPLKY 233          
BLAST of Synaptotagmin-15 vs. Planmine SMEST
Match: SMESG000037722.1 (SMESG000037722.1)

HSP 1 Score: 209.149 bits (531), Expect = 9.026e-67
Identity = 109/109 (100.00%), Postives = 109/109 (100.00%), Query Frame = 2
Query:  185 DYLVKHLQLGTLNPALYQTEEVEDLYDLQIDHVGRIWFTITYNCSTECLIVNFHKIRNLKVXXXXXXXXDCQYLSVKIFLENLERNYQNTTIKKYSSNSDFNEKFLFQV 511
            DYLVKHLQLGTLNPALYQTEEVEDLYDLQIDHVGRIWFTITYNCSTECLIVNFHKIRNLKVSSKKSNNSDCQYLSVKIFLENLERNYQNTTIKKYSSNSDFNEKFLFQV
Sbjct:   27 DYLVKHLQLGTLNPALYQTEEVEDLYDLQIDHVGRIWFTITYNCSTECLIVNFHKIRNLKVSSKKSNNSDCQYLSVKIFLENLERNYQNTTIKKYSSNSDFNEKFLFQV 135          
BLAST of Synaptotagmin-15 vs. Planmine SMEST
Match: SMESG000024602.1 (SMESG000024602.1)

HSP 1 Score: 211.075 bits (536), Expect = 1.010e-64
Identity = 120/313 (38.34%), Postives = 181/313 (57.83%), Query Frame = 2
Query:  191 LVKHLQLGTLNPALYQTEEVEDLYDLQIDHVGRIWFTITYNCSTECLIVNFHKIRNLKVXXXXXXXXDCQYLSVKIFLENLERNYQNTTIKKYSSNSDFNEKFLFQVPFSALRSRTLHFFILLSEKDRHGKPVAVSSYQLTEIASDERIDKDIIKILTKARIYRDLSE-HNSNQISCCPEICISLKYHSDTHRLNVTIYNVRNVFNNDKG-----IYVKLKLFKGLTCKEKQSKQTSISKENYIFNESFTFFKIFSLDFISLQITLLSEKTLFGIYDKPIGSATLGSHLFAKGKELSYWLQMVNQPDEHIICW 1111
            +++  +LG L+PALY  EE E+LYD    H+GRIWFT+ Y    E L +   KIRNL+      +  +    +VK+ L+  ER    T+I+K +SN + NE    QVPFS + S  +H ++   +K +H KPV ++++ L  + +    DK         R++RDLSE  N+  I    E+ ++L Y+S   RL V +++VR +   DK      I+ K+ L +GL C   + KQ+S+      FNESFTF KI  L+ IS+++TL  +K  F +++KPIG   LGS LFAK KEL +W +MVN+P+E +  W
Sbjct:   36 IMQRHELGHLDPALYMNEETEELYDQPPGHLGRIWFTVHYKTEEEELKITLLKIRNLRFYRDPISGQEWYDFNVKLILDRDERRCYVTSIRKKNSNLNINETLSMQVPFSEIESHRIHIYVNCVDKHKHQKPVGMAAFDLKLLKT--YYDKTF-------RVFRDLSELENTEVIRDRSELLVALTYNSALERLTVGLFDVRKLPMKDKSSGAYNIFAKISLHQGLQCTLIKQKQSSVLSHGRAFNESFTFSKIIDLEHISIRVTLYKQKFSFNLFNKPIGFIVLGSDLFAKRKELEHWQEMVNRPNEQVCYW 339          
BLAST of Synaptotagmin-15 vs. Planmine SMEST
Match: SMESG000024602.1 (SMESG000024602.1)

HSP 1 Score: 126.331 bits (316), Expect = 1.552e-33
Identity = 80/235 (34.04%), Postives = 126/235 (53.62%), Query Frame = 2
Query:  191 LVKHLQLGTLNPALYQTEEVEDLYDLQIDHVGRIWFTITYNCSTECLIVNFHKIRNLKVXXXXXXXXDCQYLSVKIFLENLERNYQNTTIKKYSSNSDFNEKFLFQVPFSALRSRTLHFFILLSEKDRHGKPVAVSSYQLTEIASDERIDKDIIKILTKARIYRDLSE-HNSNQISCCPEICISLKYHSDTHRLNVTIYNVRNVFNNDK--GIYVKLKLFKGLTCKEKQSKQTSI 886
            +++  +LG L+PALY  EE E+LYD    H+GRIWFT+ Y    E L +   KIRNL+      +  +    +VK+ L+  ER    T+I+K +SN + NE    QVPFS + S  +H ++   +K +H KPV ++++ L  + +    DK         R++RDLSE  N+  I    E+ ++L Y+S   RL V +++VR +   DK  G Y          C+ + S +TS+
Sbjct:   36 IMQRHELGHLDPALYMNEETEELYDQPPGHLGRIWFTVHYKTEEEELKITLLKIRNLRFYRDPISGQEWYDFNVKLILDRDERRCYVTSIRKKNSNLNINETLSMQVPFSEIESHRIHIYVNCVDKHKHQKPVGMAAFDLKLLKT--YYDKTF-------RVFRDLSELENTEVIRDRSELLVALTYNSALERLTVGLFDVRKLPMKDKSSGAYF---------CQNQSSSRTSV 252          
The following BLAST results are available for this feature:
BLAST of Synaptotagmin-15 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SYT156.937e-2526.86synaptotagmin 15 [Source:HGNC Symbol;Acc:HGNC:1716... [more]
FO681492.21.155e-2426.86synaptotagmin-15 [Source:NCBI gene;Acc:102724488][more]
FO681492.11.155e-2426.86synaptotagmin-15 [Source:NCBI gene;Acc:102724488][more]
FO681492.22.582e-2426.86synaptotagmin-15 [Source:NCBI gene;Acc:102724488][more]
SYT152.582e-2426.86synaptotagmin 15 [Source:HGNC Symbol;Acc:HGNC:1716... [more]
back to top
BLAST of Synaptotagmin-15 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snt-13.162e-1026.49Synaptotagmin-1 [Source:UniProtKB/Swiss-Prot;Acc:... [more]
snt-13.503e-1025.56Synaptotagmin-1 [Source:UniProtKB/Swiss-Prot;Acc:... [more]
snt-33.776e-925.31SyNapTotagmin [Source:UniProtKB/TrEMBL;Acc:Q965S5... [more]
snt-33.776e-925.31SyNapTotagmin [Source:UniProtKB/TrEMBL;Acc:Q965S5... [more]
snt-22.453e-728.44Synaptotagmin 2 [Source:UniProtKB/Swiss-Prot;Acc:... [more]
back to top
BLAST of Synaptotagmin-15 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Syt72.523e-1023.81gene:FBgn0039900 transcript:FBtr0089139[more]
Syt76.585e-1023.58gene:FBgn0039900 transcript:FBtr0343990[more]
Syt76.585e-1023.58gene:FBgn0039900 transcript:FBtr0089137[more]
Syt11.119e-825.32gene:FBgn0004242 transcript:FBtr0332218[more]
Syt11.269e-824.84gene:FBgn0004242 transcript:FBtr0343993[more]
back to top
BLAST of Synaptotagmin-15 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
syt151.581e-1726.33synaptotagmin XV [Source:ZFIN;Acc:ZDB-GENE-090527-... [more]
syt9a2.868e-1725.55synaptotagmin IXa [Source:ZFIN;Acc:ZDB-GENE-031002... [more]
syt9b6.471e-1725.78synaptotagmin IXb [Source:ZFIN;Acc:ZDB-GENE-040822... [more]
syt152.598e-1626.69synaptotagmin XV [Source:ZFIN;Acc:ZDB-GENE-090527-... [more]
syt2a8.091e-1525.85synaptotagmin IIa [Source:ZFIN;Acc:ZDB-GENE-060503... [more]
back to top
BLAST of Synaptotagmin-15 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000010544.18.894e-2628.30synaptotagmin 15 [Source:NCBI gene;Acc:100496499][more]
SYT98.970e-1827.19synaptotagmin 9 [Source:NCBI gene;Acc:100497543][more]
syt41.244e-1325.17synaptotagmin 4 [Source:NCBI gene;Acc:447980][more]
wnt63.120e-1326.43Wnt family member 6 [Source:Xenbase;Acc:XB-GENE-48... [more]
luzp25.954e-1327.16leucine zipper protein 2 [Source:Xenbase;Acc:XB-GE... [more]
back to top
BLAST of Synaptotagmin-15 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Syt151.016e-2126.77synaptotagmin XV [Source:MGI Symbol;Acc:MGI:244216... [more]
Syt91.839e-1325.38synaptotagmin IX [Source:MGI Symbol;Acc:MGI:192637... [more]
Syt24.796e-1325.00synaptotagmin II [Source:MGI Symbol;Acc:MGI:99666][more]
Syt24.796e-1325.00synaptotagmin II [Source:MGI Symbol;Acc:MGI:99666][more]
Syt151.303e-1126.14synaptotagmin XV [Source:MGI Symbol;Acc:MGI:244216... [more]
back to top
BLAST of Synaptotagmin-15 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9BQS2|SYT15_HUMAN3.331e-2426.86Synaptotagmin-15 OS=Homo sapiens OX=9606 GN=SYT15 ... [more]
sp|P59926|SYT15_RAT1.215e-2326.43Synaptotagmin-15 OS=Rattus norvegicus OX=10116 GN=... [more]
sp|Q8C6N3|SYT15_MOUSE7.109e-2126.77Synaptotagmin-15 OS=Mus musculus OX=10090 GN=Syt15... [more]
sp|P24507|SY63_DIPOM2.678e-1325.80Synaptotagmin-C OS=Diplobatis ommata OX=1870830 GN... [more]
sp|Q86SS6|SYT9_HUMAN4.381e-1325.38Synaptotagmin-9 OS=Homo sapiens OX=9606 GN=SYT9 PE... [more]
back to top
BLAST of Synaptotagmin-15 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A074ZPW21.972e-5236.84C2 domain-containing protein OS=Opisthorchis viver... [more]
G7YRD81.595e-5136.84Synaptotagmin-15 OS=Clonorchis sinensis OX=79923 G... [more]
A0A267EB541.126e-5033.54C2 domain-containing protein OS=Macrostomum lignan... [more]
A0A267DT161.264e-5033.54C2 domain-containing protein OS=Macrostomum lignan... [more]
A0A4S2LSP26.453e-5036.22C2 domain-containing protein OS=Opisthorchis felin... [more]
back to top
BLAST of Synaptotagmin-15 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
syt9b1.567e-1826.40synaptotagmin 9 [Source:NCBI gene;Acc:103033725][more]
syt31.394e-1527.71synaptotagmin III [Source:ZFIN;Acc:ZDB-GENE-090601... [more]
syt32.736e-1527.71synaptotagmin III [Source:ZFIN;Acc:ZDB-GENE-090601... [more]
syt5b2.458e-1324.65synaptotagmin-1-like [Source:NCBI gene;Acc:1030298... [more]
syt1a5.046e-1324.84synaptotagmin 1 [Source:NCBI gene;Acc:103044539][more]
back to top
BLAST of Synaptotagmin-15 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
SYT65.803e-932.52synaptotagmin 6 [Source:HGNC Symbol;Acc:HGNC:18638... [more]
syt122.189e-825.50synaptotagmin XII [Source:ZFIN;Acc:ZDB-GENE-081022... [more]
ENSPMAT00000000226.13.596e-726.09pep scaffold:Pmarinus_7.0:GL478944:1404:4221:1 gen... [more]
ENSPMAT00000003267.15.856e-627.23pep scaffold:Pmarinus_7.0:GL476427:260045:262512:1... [more]
back to top
BLAST of Synaptotagmin-15 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Synaptotagmin-15 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO477621.617e-1926.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO500134.602e-1126.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO317461.476e-1025.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO330814.669e-1023.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO330888.211e-921.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Synaptotagmin-15 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
syt9b6.275e-1726.07synaptotagmin-9 [Source:NCBI gene;Acc:101171486][more]
syt9b8.732e-1726.43synaptotagmin-9 [Source:NCBI gene;Acc:101171486][more]
syt9a5.814e-1526.97synaptotagmin-9 [Source:NCBI gene;Acc:101174010][more]
syt9a6.235e-1526.25synaptotagmin-9 [Source:NCBI gene;Acc:101174010][more]
syt6a1.889e-1425.91synaptotagmin VIa [Source:ZFIN;Acc:ZDB-GENE-090601... [more]
back to top
BLAST of Synaptotagmin-15 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000037727.13.650e-15099.52SMESG000037727.1[more]
SMESG000037727.13.989e-15099.52SMESG000037727.1[more]
SMESG000037722.19.026e-67100.00SMESG000037722.1[more]
SMESG000024602.11.010e-6438.34SMESG000024602.1[more]
SMESG000024602.11.552e-3334.04SMESG000024602.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019199 ID=SMED30019199|Name=Synaptotagmin-15|organism=Schmidtea mediterranea sexual|type=transcript|length=1226bp
ATTAGACAACTCATTCAATCATCGTTTCCATCTGTTATTTAGCTCTCGAA
TCTGATTGGCTGATGGCAATATTTAAATTTTCATAATTTCCAAAGTCATT
TCAAACATGACTAACTTAATCAATTCGAAATCGATCAATGAAATTCAAAA
ATCCAGCTCTTCGTCTGTTAACCGATCATATTCAGATTATTTGGTTAAGC
ACTTGCAACTTGGTACTTTAAACCCAGCATTGTATCAAACTGAGGAGGTT
GAAGACTTGTATGACCTTCAAATTGACCACGTCGGGCGCATTTGGTTCAC
TATAACATACAACTGCAGTACCGAATGCTTAATAGTAAACTTCCATAAAA
TACGAAATCTCAAAGTTTCATCGAAAAAGTCCAACAATAGTGATTGTCAA
TATTTAAGTGTAAAAATATTCCTGGAAAATTTAGAAAGAAATTATCAGAA
TACAACGATTAAAAAATATTCAAGCAATTCCGATTTTAATGAAAAATTTT
TATTTCAAGTGCCATTTTCTGCTTTACGAAGTCGAACTCTTCATTTTTTT
ATTTTACTTTCGGAAAAAGACAGACACGGAAAACCAGTAGCAGTCAGTTC
ATATCAATTAACTGAAATTGCATCAGATGAAAGAATAGATAAAGACATTA
TAAAAATTTTAACCAAAGCCAGAATTTACAGAGATTTGTCAGAACACAAT
TCTAACCAAATTAGTTGTTGTCCAGAAATTTGCATTTCCCTCAAATATCA
CAGCGACACTCACAGACTAAATGTGACTATTTATAACGTACGAAATGTTT
TCAATAATGATAAAGGAATATATGTCAAGTTGAAATTATTTAAAGGTTTG
ACATGCAAAGAAAAACAATCCAAACAGACATCAATTTCCAAAGAAAATTA
TATATTTAACGAATCATTCACCTTTTTCAAAATCTTTTCTTTGGATTTCA
TCTCCCTCCAAATAACCTTACTAAGTGAAAAGACGCTTTTTGGAATATAT
GATAAACCAATTGGATCGGCTACACTTGGATCGCATTTGTTCGCAAAGGG
AAAAGAGCTCTCATATTGGTTACAAATGGTCAATCAACCGGATGAGCACA
TCATTTGTTGGTTGCCATTGAAATATTGAGACCTTCAATGGCATGGAACT
AAAAAGAACAGATTAAATTGGTTTATTAAAATAATGATTTTGAAGCTGAA
ATTTGGAAAAATTGCAAAATCTCGAT
back to top

protein sequence of SMED30019199-orf-1

>SMED30019199-orf-1 ID=SMED30019199-orf-1|Name=SMED30019199-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=341bp
MTNLINSKSINEIQKSSSSSVNRSYSDYLVKHLQLGTLNPALYQTEEVED
LYDLQIDHVGRIWFTITYNCSTECLIVNFHKIRNLKVSSKKSNNSDCQYL
SVKIFLENLERNYQNTTIKKYSSNSDFNEKFLFQVPFSALRSRTLHFFIL
LSEKDRHGKPVAVSSYQLTEIASDERIDKDIIKILTKARIYRDLSEHNSN
QISCCPEICISLKYHSDTHRLNVTIYNVRNVFNNDKGIYVKLKLFKGLTC
KEKQSKQTSISKENYIFNESFTFFKIFSLDFISLQITLLSEKTLFGIYDK
PIGSATLGSHLFAKGKELSYWLQMVNQPDEHIICWLPLKY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR035892C2_domain_sf
IPR030539SYT15
IPR000008C2_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0046928regulation of neurotransmitter secretion
GO:0060291long-term synaptic potentiation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000008C2 domainSMARTSM00239C2_3ccoord: 74..180
e-value: 0.73
score: 18.5
coord: 220..321
e-value: 8.7E-5
score: 31.9
IPR000008C2 domainPFAMPF00168C2coord: 75..178
e-value: 5.2E-5
score: 23.5
coord: 220..323
e-value: 9.4E-6
score: 25.9
IPR035892C2 domain superfamilyGENE3DG3DSA:2.60.40.150coord: 192..339
e-value: 7.8E-17
score: 63.2
IPR035892C2 domain superfamilyGENE3DG3DSA:2.60.40.150coord: 54..187
e-value: 3.7E-14
score: 54.6
IPR030539Synaptotagmin-15PANTHERPTHR10024:SF234SYNAPTOTAGMIN-15coord: 14..338
NoneNo IPR availablePANTHERPTHR10024SYNAPTOTAGMINcoord: 14..338
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 54..177
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 198..330