60S ribosomal protein L37a

Overview
Name60S ribosomal protein L37a
Smed IDSMED30019189
Length (bp)351
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 60S ribosomal protein L37a (SMED30019189) t-SNE clustered cells

Violin plots show distribution of expression levels for 60S ribosomal protein L37a (SMED30019189) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 60S ribosomal protein L37a (SMED30019189) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 60S ribosomal protein L37a (SMED30019189) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019189

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 19

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30019189SMESG000078736.1 SmedASXL_051908SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30019189SMESG000078736.1 dd_Smed_v4_140_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30019189SMESG000078736.1 dd_Smed_v4_140_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30019189SMESG000078736.1 dd_Smed_v4_140_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30019189SMESG000078736.1 dd_Smed_v4_140_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30019189SMESG000078736.1 dd_Smed_v4_140_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30019189SMESG000078736.1 dd_Smed_v4_140_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30019189SMESG000078736.1 dd_Smed_v4_140_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30019189SMESG000078736.1 dd_Smed_v4_140_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30019189SMESG000078736.1 dd_Smed_v4_140_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019189SMESG000078736.1 Contig21767newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019189SMESG000078736.1 Contig21767uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019189SMESG000078736.1 Contig52012newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019189SMESG000078736.1 Contig52012uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019189SMESG000079772.1 SMESG000078736.1 SMESG000029693.1 Contig11241newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019189SMESG000079772.1 SMESG000078736.1 SMESG000029693.1 Contig11241uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30019189SMESG000078736.1 OX_Smed_1.0.09315ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
neoblastSMED30019189SMESG000078736.1 dd_Smed_v6_140_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gamma neoblastSMED30019189SMESG000078736.1 dd_Smed_v6_140_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 60S ribosomal protein L37a vs. Ensembl Human
Match: RPL37A (ribosomal protein L37a [Source:HGNC Symbol;Acc:HGNC:10348])

HSP 1 Score: 55.4546 bits (132), Expect = 3.988e-11
Identity = 27/32 (84.38%), Postives = 30/32 (93.75%), Query Frame = 2
Query:   35 MAKRTKKVGIVGKYGTRYGSSIRKNIKKIEXS 130
            MAKRTKKVGIVGKYGTRYG+S+RK +KKIE S
Sbjct:    1 MAKRTKKVGIVGKYGTRYGASLRKMVKKIEIS 32          
BLAST of 60S ribosomal protein L37a vs. Ensembl Human
Match: RPL37A (ribosomal protein L37a [Source:HGNC Symbol;Acc:HGNC:10348])

HSP 1 Score: 55.4546 bits (132), Expect = 6.196e-11
Identity = 27/32 (84.38%), Postives = 30/32 (93.75%), Query Frame = 2
Query:   35 MAKRTKKVGIVGKYGTRYGSSIRKNIKKIEXS 130
            MAKRTKKVGIVGKYGTRYG+S+RK +KKIE S
Sbjct:    1 MAKRTKKVGIVGKYGTRYGASLRKMVKKIEIS 32          
BLAST of 60S ribosomal protein L37a vs. Ensembl Human
Match: RPL37A (ribosomal protein L37a [Source:HGNC Symbol;Acc:HGNC:10348])

HSP 1 Score: 55.0694 bits (131), Expect = 7.339e-11
Identity = 27/32 (84.38%), Postives = 30/32 (93.75%), Query Frame = 2
Query:   35 MAKRTKKVGIVGKYGTRYGSSIRKNIKKIEXS 130
            MAKRTKKVGIVGKYGTRYG+S+RK +KKIE S
Sbjct:    1 MAKRTKKVGIVGKYGTRYGASLRKMVKKIEIS 32          
BLAST of 60S ribosomal protein L37a vs. Ensembl Human
Match: RPL37A (ribosomal protein L37a [Source:HGNC Symbol;Acc:HGNC:10348])

HSP 1 Score: 55.4546 bits (132), Expect = 7.863e-11
Identity = 27/32 (84.38%), Postives = 30/32 (93.75%), Query Frame = 2
Query:   35 MAKRTKKVGIVGKYGTRYGSSIRKNIKKIEXS 130
            MAKRTKKVGIVGKYGTRYG+S+RK +KKIE S
Sbjct:    1 MAKRTKKVGIVGKYGTRYGASLRKMVKKIEIS 32          
BLAST of 60S ribosomal protein L37a vs. Ensembl Celegans
Match: rpl-43 (60S ribosomal protein L37a [Source:UniProtKB/Swiss-Prot;Acc:Q9U2A8])

HSP 1 Score: 52.373 bits (124), Expect = 4.912e-10
Identity = 25/32 (78.12%), Postives = 29/32 (90.62%), Query Frame = 2
Query:   35 MAKRTKKVGIVGKYGTRYGSSIRKNIKKIEXS 130
            MAKRTKKVGIVGKYGTRYG+S+RK  KK+E +
Sbjct:    1 MAKRTKKVGIVGKYGTRYGASLRKMAKKLEVA 32          
BLAST of 60S ribosomal protein L37a vs. Ensembl Celegans
Match: rpl-43 (60S ribosomal protein L37a [Source:UniProtKB/Swiss-Prot;Acc:Q9U2A8])

HSP 1 Score: 52.373 bits (124), Expect = 4.912e-10
Identity = 25/32 (78.12%), Postives = 29/32 (90.62%), Query Frame = 2
Query:   35 MAKRTKKVGIVGKYGTRYGSSIRKNIKKIEXS 130
            MAKRTKKVGIVGKYGTRYG+S+RK  KK+E +
Sbjct:    1 MAKRTKKVGIVGKYGTRYGASLRKMAKKLEVA 32          
BLAST of 60S ribosomal protein L37a vs. Ensembl Celegans
Match: rpl-43 (60S ribosomal protein L37a [Source:UniProtKB/Swiss-Prot;Acc:Q9U2A8])

HSP 1 Score: 52.373 bits (124), Expect = 4.912e-10
Identity = 25/32 (78.12%), Postives = 29/32 (90.62%), Query Frame = 2
Query:   35 MAKRTKKVGIVGKYGTRYGSSIRKNIKKIEXS 130
            MAKRTKKVGIVGKYGTRYG+S+RK  KK+E +
Sbjct:    1 MAKRTKKVGIVGKYGTRYGASLRKMAKKLEVA 32          
BLAST of 60S ribosomal protein L37a vs. Ensembl Fly
Match: RpL37A (gene:FBgn0261608 transcript:FBtr0079017)

HSP 1 Score: 53.9138 bits (128), Expect = 1.628e-10
Identity = 25/30 (83.33%), Postives = 29/30 (96.67%), Query Frame = 2
Query:   35 MAKRTKKVGIVGKYGTRYGSSIRKNIKKIE 124
            MAKRTKKVGIVGKYGTRYG+S+RK +KK+E
Sbjct:    1 MAKRTKKVGIVGKYGTRYGASLRKMVKKME 30          
BLAST of 60S ribosomal protein L37a vs. Ensembl Fly
Match: RpL37A (gene:FBgn0261608 transcript:FBtr0302570)

HSP 1 Score: 53.9138 bits (128), Expect = 1.628e-10
Identity = 25/30 (83.33%), Postives = 29/30 (96.67%), Query Frame = 2
Query:   35 MAKRTKKVGIVGKYGTRYGSSIRKNIKKIE 124
            MAKRTKKVGIVGKYGTRYG+S+RK +KK+E
Sbjct:    1 MAKRTKKVGIVGKYGTRYGASLRKMVKKME 30          
BLAST of 60S ribosomal protein L37a vs. Ensembl Fly
Match: RpL37A (gene:FBgn0261608 transcript:FBtr0079016)

HSP 1 Score: 53.9138 bits (128), Expect = 1.628e-10
Identity = 25/30 (83.33%), Postives = 29/30 (96.67%), Query Frame = 2
Query:   35 MAKRTKKVGIVGKYGTRYGSSIRKNIKKIE 124
            MAKRTKKVGIVGKYGTRYG+S+RK +KK+E
Sbjct:    1 MAKRTKKVGIVGKYGTRYGASLRKMVKKME 30          
BLAST of 60S ribosomal protein L37a vs. Ensembl Zebrafish
Match: zgc:171772 (zgc:171772 [Source:ZFIN;Acc:ZDB-GENE-070928-31])

HSP 1 Score: 56.225 bits (134), Expect = 2.456e-11
Identity = 32/52 (61.54%), Postives = 36/52 (69.23%), Query Frame = 2
Query:   35 MAKRTKKVGIVGKYGTRYGSSIRKNIKKIEXSIARLNXDCXLXCGXXKXXKK 190
            MAKRTKKVGIVGKYGTRYG+S+RK +KKIE S       C   CG  K  +K
Sbjct:    1 MAKRTKKVGIVGKYGTRYGASLRKMVKKIEIS-QHAKYTCSF-CGKTKMKRK 50          
BLAST of 60S ribosomal protein L37a vs. Ensembl Xenopus
Match: abhd3 (abhydrolase domain containing 3 [Source:Xenbase;Acc:XB-GENE-984642])

HSP 1 Score: 56.225 bits (134), Expect = 3.941e-11
Identity = 32/52 (61.54%), Postives = 36/52 (69.23%), Query Frame = 2
Query:   35 MAKRTKKVGIVGKYGTRYGSSIRKNIKKIEXSIARLNXDCXLXCGXXKXXKK 190
            MAKRTKKVGIVGKYGTRYG+S+RK +KKIE S       C   CG  K  +K
Sbjct:    1 MAKRTKKVGIVGKYGTRYGASLRKMVKKIEIS-QHAKYTCSF-CGKTKMKRK 50          
BLAST of 60S ribosomal protein L37a vs. Ensembl Xenopus
Match: gtf3c5 (general transcription factor IIIC subunit 5 [Source:Xenbase;Acc:XB-GENE-1012275])

HSP 1 Score: 49.6766 bits (117), Expect = 1.040e-8
Identity = 29/52 (55.77%), Postives = 34/52 (65.38%), Query Frame = 2
Query:   35 MAKRTKKVGIVGKYGTRYGSSIRKNIKKIEXSIARLNXDCXLXCGXXKXXKK 190
            MAKRTKKVGIVGKY T YG+S+RK +KKIE +       C   CG  K  +K
Sbjct:    1 MAKRTKKVGIVGKYWTWYGASLRKMVKKIEIN-QHAKYTCSF-CGKTKMKRK 50          
BLAST of 60S ribosomal protein L37a vs. Ensembl Mouse
Match: Rpl37a (ribosomal protein L37a [Source:MGI Symbol;Acc:MGI:98068])

HSP 1 Score: 55.4546 bits (132), Expect = 5.398e-11
Identity = 27/32 (84.38%), Postives = 30/32 (93.75%), Query Frame = 2
Query:   35 MAKRTKKVGIVGKYGTRYGSSIRKNIKKIEXS 130
            MAKRTKKVGIVGKYGTRYG+S+RK +KKIE S
Sbjct:    1 MAKRTKKVGIVGKYGTRYGASLRKMVKKIEIS 32          
BLAST of 60S ribosomal protein L37a vs. UniProt/SwissProt
Match: sp|Q8RXU5|R37A2_ARATH (60S ribosomal protein L37a-2 OS=Arabidopsis thaliana OX=3702 GN=RPL37AC PE=3 SV=1)

HSP 1 Score: 56.9954 bits (136), Expect = 1.272e-10
Identity = 28/32 (87.50%), Postives = 30/32 (93.75%), Query Frame = 2
Query:   35 MAKRTKKVGIVGKYGTRYGSSIRKNIKKIEXS 130
            MAKRTKKVGIVGKYGTRYG+SIRK IKK+E S
Sbjct:    1 MAKRTKKVGIVGKYGTRYGASIRKQIKKMEVS 32          
BLAST of 60S ribosomal protein L37a vs. UniProt/SwissProt
Match: sp|P43209|RL37A_BRARR (60S ribosomal protein L37a OS=Brassica rapa subsp. rapa OX=51350 GN=RPL37A PE=3 SV=2)

HSP 1 Score: 56.9954 bits (136), Expect = 1.288e-10
Identity = 28/32 (87.50%), Postives = 30/32 (93.75%), Query Frame = 2
Query:   35 MAKRTKKVGIVGKYGTRYGSSIRKNIKKIEXS 130
            MAKRTKKVGIVGKYGTRYG+SIRK IKK+E S
Sbjct:    1 MAKRTKKVGIVGKYGTRYGASIRKQIKKMEVS 32          
BLAST of 60S ribosomal protein L37a vs. UniProt/SwissProt
Match: sp|P32046|RL37A_CHICK (60S ribosomal protein L37a OS=Gallus gallus OX=9031 GN=RPL37A PE=3 SV=2)

HSP 1 Score: 56.225 bits (134), Expect = 1.936e-10
Identity = 32/52 (61.54%), Postives = 36/52 (69.23%), Query Frame = 2
Query:   35 MAKRTKKVGIVGKYGTRYGSSIRKNIKKIEXSIARLNXDCXLXCGXXKXXKK 190
            MAKRTKKVGIVGKYGTRYG+S+RK +KKIE S       C   CG  K  +K
Sbjct:    1 MAKRTKKVGIVGKYGTRYGASLRKMVKKIEIS-QHAKYTCSF-CGKTKMKRK 50          
BLAST of 60S ribosomal protein L37a vs. UniProt/SwissProt
Match: sp|D4AAZ6|RL37A_RAT (60S ribosomal protein L37a OS=Rattus norvegicus OX=10116 GN=Rpl37a PE=1 SV=1)

HSP 1 Score: 55.4546 bits (132), Expect = 2.976e-10
Identity = 27/32 (84.38%), Postives = 30/32 (93.75%), Query Frame = 2
Query:   35 MAKRTKKVGIVGKYGTRYGSSIRKNIKKIEXS 130
            MAKRTKKVGIVGKYGTRYG+S+RK +KKIE S
Sbjct:    1 MAKRTKKVGIVGKYGTRYGASLRKMVKKIEIS 32          
BLAST of 60S ribosomal protein L37a vs. UniProt/SwissProt
Match: sp|Q90YT0|RL37A_ICTPU (60S ribosomal protein L37a OS=Ictalurus punctatus OX=7998 GN=rpl37a PE=3 SV=3)

HSP 1 Score: 55.8398 bits (133), Expect = 3.578e-10
Identity = 27/32 (84.38%), Postives = 30/32 (93.75%), Query Frame = 2
Query:   35 MAKRTKKVGIVGKYGTRYGSSIRKNIKKIEXS 130
            MAKRTKKVGIVGKYGTRYG+S+RK +KKIE S
Sbjct:    1 MAKRTKKVGIVGKYGTRYGASLRKMVKKIEIS 32          
BLAST of 60S ribosomal protein L37a vs. TrEMBL
Match: A0A2K5JA44 (Uncharacterized protein OS=Colobus angolensis palliatus OX=336983 PE=3 SV=1)

HSP 1 Score: 59.3066 bits (142), Expect = 4.004e-9
Identity = 31/52 (59.62%), Postives = 36/52 (69.23%), Query Frame = 2
Query:   35 MAKRTKKVGIVGKYGTRYGSSIRKNIKKIEXSIARLNXDCXLXCGXXKXXKK 190
            MAKRTKKVGIVGKYGTRYG+S+RK +KKIE S       C   CG  K  ++
Sbjct:    1 MAKRTKKVGIVGKYGTRYGASLRKMVKKIEISHQHAKYTCSF-CGKTKMKRR 51          
BLAST of 60S ribosomal protein L37a vs. TrEMBL
Match: A0A4Z2C102 (Uncharacterized protein OS=Takifugu bimaculatus OX=433685 GN=fugu_014300 PE=4 SV=1)

HSP 1 Score: 58.9214 bits (141), Expect = 1.414e-8
Identity = 29/39 (74.36%), Postives = 32/39 (82.05%), Query Frame = 2
Query:   14 TKXQIISMAKRTKKVGIVGKYGTRYGSSIRKNIKKIEXS 130
            T    IS AKRTKKVGIVGKYGTRYG+S+RK +KKIE S
Sbjct:   20 TAISCISQAKRTKKVGIVGKYGTRYGASLRKMVKKIEIS 58          
BLAST of 60S ribosomal protein L37a vs. TrEMBL
Match: A0A087SN70 (60S ribosomal protein L37a OS=Auxenochlorella protothecoides OX=3075 GN=APUTEX25_002357 PE=3 SV=1)

HSP 1 Score: 57.7658 bits (138), Expect = 1.491e-8
Identity = 28/32 (87.50%), Postives = 30/32 (93.75%), Query Frame = 2
Query:   35 MAKRTKKVGIVGKYGTRYGSSIRKNIKKIEXS 130
            MAKRTKKVGIVGKYGTRYG+S+RK IKKIE S
Sbjct:    1 MAKRTKKVGIVGKYGTRYGASLRKQIKKIEVS 32          
BLAST of 60S ribosomal protein L37a vs. TrEMBL
Match: A0A078HTJ8 (BnaA09g38330D protein OS=Brassica napus OX=3708 GN=BnaA09g38330D PE=3 SV=1)

HSP 1 Score: 59.3066 bits (142), Expect = 1.515e-8
Identity = 28/35 (80.00%), Postives = 31/35 (88.57%), Query Frame = 2
Query:   26 IISMAKRTKKVGIVGKYGTRYGSSIRKNIKKIEXS 130
            +  MAKRTKKVGIVGKYGTRYG+SIRK IKK+E S
Sbjct:   51 VFEMAKRTKKVGIVGKYGTRYGASIRKQIKKMEVS 85          
BLAST of 60S ribosomal protein L37a vs. TrEMBL
Match: A0A0E9NG45 (SRP72 domain-containing protein OS=Saitoella complicata (strain BCRC 22490 / CBS 7301 / JCM 7358 / NBRC 10748 / NRRL Y-17804) OX=698492 GN=G7K_2957-t1 PE=3 SV=1)

HSP 1 Score: 56.6102 bits (135), Expect = 1.647e-8
Identity = 24/34 (70.59%), Postives = 29/34 (85.29%), Query Frame = 2
Query:   29 ISMAKRTKKVGIVGKYGTRYGSSIRKNIKKIEXS 130
            + M KRTKKVG+ GKYGTRYG+S+RK +KKIE S
Sbjct:  662 LKMTKRTKKVGVTGKYGTRYGASLRKQVKKIEIS 695          

HSP 2 Score: 29.6462 bits (65), Expect = 1.647e-8
Identity = 12/16 (75.00%), Postives = 12/16 (75.00%), Query Frame = 1
Query:  187 KEXCVGIWHCKGCKKV 234
            K   VGIW CKGCKKV
Sbjct:  711 KRQAVGIWSCKGCKKV 726          
BLAST of 60S ribosomal protein L37a vs. Ensembl Cavefish
Match: zgc:171772 (ribosomal protein L37a [Source:NCBI gene;Acc:103037274])

HSP 1 Score: 55.8398 bits (133), Expect = 3.273e-11
Identity = 27/32 (84.38%), Postives = 30/32 (93.75%), Query Frame = 2
Query:   35 MAKRTKKVGIVGKYGTRYGSSIRKNIKKIEXS 130
            MAKRTKKVGIVGKYGTRYG+S+RK +KKIE S
Sbjct:    1 MAKRTKKVGIVGKYGTRYGASLRKMVKKIEIS 32          
BLAST of 60S ribosomal protein L37a vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000001.1 (pep scaffold:Pmarinus_7.0:GL476426:6020:9121:-1 gene:ENSPMAG00000000001.1 transcript:ENSPMAT00000000001.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.8398 bits (133), Expect = 8.236e-12
Identity = 27/32 (84.38%), Postives = 30/32 (93.75%), Query Frame = 2
Query:   35 MAKRTKKVGIVGKYGTRYGSSIRKNIKKIEXS 130
            MAKRTKKVGIVGKYGTRYG+S+RK +KKIE S
Sbjct:    1 MAKRTKKVGIVGKYGTRYGASLRKMVKKIEIS 32          
BLAST of 60S ribosomal protein L37a vs. Ensembl Yeast
Match: RPL43B (Ribosomal 60S subunit protein L43B; homologous to mammalian ribosomal protein L37A, no bacterial homolog; RPL43B has a paralog, RPL43A, that arose from the whole genome duplication; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000003855])

HSP 1 Score: 52.7582 bits (125), Expect = 7.919e-11
Identity = 27/45 (60.00%), Postives = 31/45 (68.89%), Query Frame = 2
Query:   35 MAKRTKKVGIVGKYGTRYGSSIRKNIKKIEXSIARLNXDCXLXCG 169
            MAKRTKKVGI GKYG RYGSS+R+ +KK+E        DC   CG
Sbjct:    1 MAKRTKKVGITGKYGVRYGSSLRRQVKKLEIQ-QHARYDCSF-CG 43          
BLAST of 60S ribosomal protein L37a vs. Ensembl Yeast
Match: RPL43A (Ribosomal 60S subunit protein L43A; null mutation confers a dominant lethal phenotype; homologous to mammalian ribosomal protein L37A, no bacterial homolog; RPL43A has a paralog, RPL43B, that arose from the whole genome duplication [Source:SGD;Acc:S000006247])

HSP 1 Score: 52.7582 bits (125), Expect = 7.919e-11
Identity = 27/45 (60.00%), Postives = 31/45 (68.89%), Query Frame = 2
Query:   35 MAKRTKKVGIVGKYGTRYGSSIRKNIKKIEXSIARLNXDCXLXCG 169
            MAKRTKKVGI GKYG RYGSS+R+ +KK+E        DC   CG
Sbjct:    1 MAKRTKKVGITGKYGVRYGSSLRRQVKKLEIQ-QHARYDCSF-CG 43          
BLAST of 60S ribosomal protein L37a vs. Ensembl Nematostella
Match: EDO48962 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI41])

HSP 1 Score: 53.5286 bits (127), Expect = 2.953e-11
Identity = 25/30 (83.33%), Postives = 28/30 (93.33%), Query Frame = 2
Query:   35 MAKRTKKVGIVGKYGTRYGSSIRKNIKKIE 124
            MAKRTKKVG+ GKYGTRYG+S+RK IKKIE
Sbjct:    1 MAKRTKKVGVTGKYGTRYGASLRKMIKKIE 30          

HSP 2 Score: 29.261 bits (64), Expect = 2.953e-11
Identity = 12/16 (75.00%), Postives = 12/16 (75.00%), Query Frame = 1
Query:  187 KEXCVGIWHCKGCKKV 234
            K  CVGIWHCKGC K 
Sbjct:   48 KRKCVGIWHCKGCGKT 63          
BLAST of 60S ribosomal protein L37a vs. Ensembl Medaka
Match: zgc:171772 (ribosomal protein L37a [Source:NCBI gene;Acc:101161674])

HSP 1 Score: 53.1434 bits (126), Expect = 3.855e-10
Identity = 26/31 (83.87%), Postives = 29/31 (93.55%), Query Frame = 2
Query:   38 AKRTKKVGIVGKYGTRYGSSIRKNIKKIEXS 130
            AKRTKKVGIVGKYGTRYG+S+RK +KKIE S
Sbjct:    1 AKRTKKVGIVGKYGTRYGASLRKMVKKIEIS 31          
BLAST of 60S ribosomal protein L37a vs. Planmine SMEST
Match: SMESG000078736.1 (SMESG000078736.1)

HSP 1 Score: 60.8474 bits (146), Expect = 6.447e-14
Identity = 34/45 (75.56%), Postives = 35/45 (77.78%), Query Frame = 2
Query:   35 MAKRTKKVGIVGKYGTRYGSSIRKNIKKIEXSIARLNXDCXLXCG 169
            MAKRTKKVGIVGKYGTRYGSSIRKNIKKIE   +    DC   CG
Sbjct:    1 MAKRTKKVGIVGKYGTRYGSSIRKNIKKIEIQ-SHAKYDCSF-CG 43          

HSP 2 Score: 32.3426 bits (72), Expect = 6.447e-14
Identity = 14/16 (87.50%), Postives = 14/16 (87.50%), Query Frame = 1
Query:  187 KEXCVGIWHCKGCKKV 234
            K  CVGIWHCKGCKKV
Sbjct:   48 KRKCVGIWHCKGCKKV 63          
The following BLAST results are available for this feature:
BLAST of 60S ribosomal protein L37a vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
RPL37A3.988e-1184.38ribosomal protein L37a [Source:HGNC Symbol;Acc:HGN... [more]
RPL37A6.196e-1184.38ribosomal protein L37a [Source:HGNC Symbol;Acc:HGN... [more]
RPL37A7.339e-1184.38ribosomal protein L37a [Source:HGNC Symbol;Acc:HGN... [more]
RPL37A7.863e-1184.38ribosomal protein L37a [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of 60S ribosomal protein L37a vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
rpl-434.912e-1078.1360S ribosomal protein L37a [Source:UniProtKB/Swis... [more]
rpl-434.912e-1078.1360S ribosomal protein L37a [Source:UniProtKB/Swis... [more]
rpl-434.912e-1078.1360S ribosomal protein L37a [Source:UniProtKB/Swis... [more]
back to top
BLAST of 60S ribosomal protein L37a vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
RpL37A1.628e-1083.33gene:FBgn0261608 transcript:FBtr0079017[more]
RpL37A1.628e-1083.33gene:FBgn0261608 transcript:FBtr0302570[more]
RpL37A1.628e-1083.33gene:FBgn0261608 transcript:FBtr0079016[more]
back to top
BLAST of 60S ribosomal protein L37a vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
zgc:1717722.456e-1161.54zgc:171772 [Source:ZFIN;Acc:ZDB-GENE-070928-31][more]
back to top
BLAST of 60S ribosomal protein L37a vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
abhd33.941e-1161.54abhydrolase domain containing 3 [Source:Xenbase;Ac... [more]
gtf3c51.040e-855.77general transcription factor IIIC subunit 5 [Sourc... [more]
back to top
BLAST of 60S ribosomal protein L37a vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Rpl37a5.398e-1184.38ribosomal protein L37a [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of 60S ribosomal protein L37a vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8RXU5|R37A2_ARATH1.272e-1087.5060S ribosomal protein L37a-2 OS=Arabidopsis thalia... [more]
sp|P43209|RL37A_BRARR1.288e-1087.5060S ribosomal protein L37a OS=Brassica rapa subsp.... [more]
sp|P32046|RL37A_CHICK1.936e-1061.5460S ribosomal protein L37a OS=Gallus gallus OX=903... [more]
sp|D4AAZ6|RL37A_RAT2.976e-1084.3860S ribosomal protein L37a OS=Rattus norvegicus OX... [more]
sp|Q90YT0|RL37A_ICTPU3.578e-1084.3860S ribosomal protein L37a OS=Ictalurus punctatus ... [more]
back to top
BLAST of 60S ribosomal protein L37a vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2K5JA444.004e-959.62Uncharacterized protein OS=Colobus angolensis pall... [more]
A0A4Z2C1021.414e-874.36Uncharacterized protein OS=Takifugu bimaculatus OX... [more]
A0A087SN701.491e-887.5060S ribosomal protein L37a OS=Auxenochlorella prot... [more]
A0A078HTJ81.515e-880.00BnaA09g38330D protein OS=Brassica napus OX=3708 GN... [more]
A0A0E9NG451.647e-870.59SRP72 domain-containing protein OS=Saitoella compl... [more]
back to top
BLAST of 60S ribosomal protein L37a vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
zgc:1717723.273e-1184.38ribosomal protein L37a [Source:NCBI gene;Acc:10303... [more]
back to top
BLAST of 60S ribosomal protein L37a vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000000001.18.236e-1284.38pep scaffold:Pmarinus_7.0:GL476426:6020:9121:-1 ge... [more]
back to top
BLAST of 60S ribosomal protein L37a vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
RPL43B7.919e-1160.00Ribosomal 60S subunit protein L43B; homologous to ... [more]
RPL43A7.919e-1160.00Ribosomal 60S subunit protein L43A; null mutation ... [more]
back to top
BLAST of 60S ribosomal protein L37a vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO489622.953e-1183.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of 60S ribosomal protein L37a vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
zgc:1717723.855e-1083.87ribosomal protein L37a [Source:NCBI gene;Acc:10116... [more]
back to top
BLAST of 60S ribosomal protein L37a vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000078736.16.447e-1475.56SMESG000078736.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019189 ID=SMED30019189|Name=60S ribosomal protein L37a|organism=Schmidtea mediterranea sexual|type=transcript|length=351bp
GATATATTCAAANACAAAATTNCAAATAATATCAATGGCCAAACGAACAA
AGAAGGTTGGCATAGTCGGTAAATATGGAACCAGATACGGTTCTTCAATC
AGAAAAAATATTAAGAAAATTGAAANTTCAATCGCACGNCTAAATANTGA
CTGTTNNCTTTNCTGTGGAANANGAAAGNCANTTAAAAAGAAANGTGTGT
CGGAATTTGGCACTGCAAAGGTTGCAAGAAAGTTATTGCTGGAGGTGCTT
ATACTCACACCACCACAGCAGCAGTTACTGCTCGGGCACATATTAGACGT
GTTAACGAAGGCCGTTAANTTTTTAAATAATAAATTTTGGAGTAATNANA
A
back to top

protein sequence of SMED30019189-orf-1

>SMED30019189-orf-1 ID=SMED30019189-orf-1|Name=SMED30019189-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=116bp
IYSXTKXQIISMAKRTKKVGIVGKYGTRYGSSIRKNIKKIEXSIAXLNXD
CXLXCGXXKXXKKKXVSEFGTAKVARKLLLEVLILTPPQQQLLLGHILDV
LTKAVXFLNNKFWSNX
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000039gamma neoblast
PLANA:0000418head
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR002674Ribosomal_L37ae
IPR011331Ribosomal_L37ae/L37e
IPR011332Ribosomal_zn-bd
Vocabulary: biological process
TermDefinition
GO:0006412translation
Vocabulary: cellular component
TermDefinition
GO:0005840ribosome
GO:0005622intracellular
GO:0005634nucleus
GO:0005925focal adhesion
GO:0022625cytosolic large ribosomal subunit
GO:0030529intracellular ribonucleoprotein complex
GO:0070062extracellular exosome
Vocabulary: molecular function
TermDefinition
GO:0003735structural constituent of ribosome
GO:0003723RNA binding
GO:0046872metal ion binding