Serine protease 12

Overview
NameSerine protease 12
Smed IDSMED30019187
Uniprot Best hitNeurotrypsin OS=Saguinus labiatus OX=78454 GN=PRSS12 PE=3 SV=1 (E=3.07542e-34)
Length (bp)3012
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Serine protease 12 (SMED30019187) t-SNE clustered cells

Violin plots show distribution of expression levels for Serine protease 12 (SMED30019187) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Serine protease 12 (SMED30019187) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Serine protease 12 (SMED30019187) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019187

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermal cellSMED30019187SMESG000075230.1 dd_Smed_v4_351_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30019187SMESG000075230.1 dd_Smed_v6_351_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30019187SMESG000075230.1 dd_Smed_v4_351_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30019187SMESG000075230.1 dd_Smed_v4_351_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30019187SMESG000075230.1 dd_Smed_v4_351_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30019187SMESG000075230.1 dd_Smed_v4_351_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
whole organismSMED30019187SMESG000075230.1 dd_Smed_v4_351_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
ciliated epithelial cellSMED30019187SMESG000075230.1 dd_Smed_v4_351_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
non-ciliated epidermisSMED30019187SMESG000075230.1 dd_Smed_v4_351_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30019187SMESG000075230.1 dd_Smed_v4_351_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30019187SMESG000075230.1 SmWIOct06_021650GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30019187SMESG000075230.1 SMED_00880_V2_2rGPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Serine protease 12 vs. Ensembl Human
Match: PRSS12 (serine protease 12 [Source:HGNC Symbol;Acc:HGNC:9477])

HSP 1 Score: 142.124 bits (357), Expect = 8.564e-34
Identity = 132/468 (28.21%), Postives = 203/468 (43.38%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYLGYP-GVRKSYSNPGNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQD------------VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVC-------SGN------ASSCGQVSTMENNWKYSNGYNTTFGATPWQARLMPSSVNE----WCSATIIDRNWLLTSANCFTMSYNNF--YVTVMSSRYYWDSSNFATTNSIQSVFIHPQYSTVTGDYNLALVKVNS-----IAFDANVQPLCLPA-GYIPVDGLS-CVTTGWNHGLNTYSRPLLGKPVLIQNSSYCKDHLQFDDTRMARYLCSDNNMDPSAY--FNGESGGPLTCSINGKN-VLXXXXXXXXXXXXXXXIRLYTRVDYWDSWIRNIMK 2893
            VC + + + NT V CR LG+  G + S ++   +T  + L  + C+G E     C   ++    C   + V + C              V L  G    EGRVEV+  G+ G +CDD +      VICRQLGY     A +     +G G G   +D + C GNE S+ DC  +     +C  ++ AG++C       SGN      +S CG         +   G N+  G  PWQ  L   S +      C AT++   W+LT+A+CF    N+   Y   +   +      F     +Q + IH +Y     DY++ALV++         F ++V P CLP     P    S C  TGW      YSR L    + +    +C++  ++      R LC+ N  +        G+SGGPL C   G++ V+ GV +         S  +YT+V  +  WI+++ K
Sbjct:  411 VCDDGWTELNTYVVCRQLGFKYGKQASANHFEESTGPIWLDDVSCSGKETRFLQCSRRQWGRHDCSHREDVSIACYPGGEGHRLSLGFPVRLMDGENKKEGRVEVFINGQWGTICDDGWTDKDAAVICRQLGYKGPARART--MAYFGEGKGPIHVDNVKCTGNERSLADCIKQDIGRHNCRHSEDAGVICDYFGKKASGNSNKESLSSVCGLRLLHRRQKRIIGGKNSLRGGWPWQVSLRLKSSHGDGRLLCGATLLSSCWVLTAAHCFKRYGNSTRSYAVRVGDYHTLVPEEFEEEIGVQQIVIHREYRPDRSDYDIALVRLQGPEEQCARFSSHVLPACLPLWRERPQKTASNCYITGWGDTGRAYSRTLQQAAIPLLPKRFCEE--RYKGRFTGRMLCAGNLHEHKRVDSCQGDSGGPLMCERPGESWVVYGVTSWGYGCGVKDSPGVYTKVSAFVPWIKSVTK 874          

HSP 2 Score: 93.2041 bits (230), Expect = 1.380e-18
Identity = 57/185 (30.81%), Postives = 89/185 (48.11%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYLGYPGVRKSYSNP--GNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQD-----VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVC 2149
            VC +++D  + +V CR LG  G+ K++     G  +  + L  ++C GNE S   CP   +    C   +  GV C       + LAGG+ ++EGR+EVYY+G+ G +CDD +      V+CRQLG+ Y   A++     +    G   LD + C G E     C  + W    C   +   + C
Sbjct:  304 VCDDQWDDADAEVICRQLGLSGIAKAWHQAYFGEGSGPVMLDEVRCTGNELSIEQCPKSSWGEHNCGHKEDAGVSCTPLTDGVIRLAGGKGSHEGRLEVYYRGQWGTVCDDGWTELNTYVVCRQLGFKYGKQASA---NHFEESTGPIWLDDVSCSGKETRFLQCSRRQWGRHDCSHREDVSIAC 485          

HSP 3 Score: 83.9593 bits (206), Expect = 1.070e-15
Identity = 59/189 (31.22%), Postives = 93/189 (49.21%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYLGYPGVRKSYSNPGNNTTYLPL--VSLKCNGNEQSPADCPVDRY--AYCYTAKPVGVICQ--------DVALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCS 2152
            VCS+ +D ++  V C  L   G   +   P +    +P+   +++C G+E++   C  D +    C       V C          + LAGG + +EGRVE+Y+ G+ G +CDD ++     VICRQL  G +  A +     +G G+G  +LD + C GNE SI  CP   W   +C   + AG+ C+
Sbjct:  194 VCSSHWDDSDASVICHQLQLGGKGIAKQTPFSGLGLIPIYWSNVRCRGDEENILLCEKDIWQGGVCPQKMAAAVTCSFSHGPTFPIIRLAGGSSVHEGRVELYHAGQWGTVCDDQWDDADAEVICRQL--GLSGIAKAWHQAYFGEGSGPVMLDEVRCTGNELSIEQCPKSSWGEHNCGHKEDAGVSCT 380          
BLAST of Serine protease 12 vs. Ensembl Human
Match: DMBT1 (deleted in malignant brain tumors 1 [Source:HGNC Symbol;Acc:HGNC:2926])

HSP 1 Score: 89.3521 bits (220), Expect = 1.785e-19
Identity = 63/198 (31.82%), Postives = 100/198 (50.51%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYLGYPGVRKSYSNP--GNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQD-----------------VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCS 2152
            VC + +D N+ +V CR LG      +  N   G  +  + L  ++C+G+E     CP + +    C  ++  GVIC D                 + L  G    +GRVEV Y+G  G +CDD ++ N  NV+CRQLG G+A++A       +G G+G  +LD + C G+E  +  CP   W + +C  ++ AG++CS
Sbjct:    7 VCDDSWDTNDANVVCRQLGCGWAMSAPGNARFGQGSGPIVLDDVRCSGHESYLWSCPHNGWLSHNCGHSEDAGVICSDTWPTSHASTAGSESSLALRLVNGGDRCQGRVEVLYRGSWGTVCDDYWDTNDANVVCRQLGCGWAMSAPG--NARFGQGSGPIVLDDVRCSGHESYLWSCPHNGWLSHNCGHHEDAGVICS 202          

HSP 2 Score: 53.1434 bits (126), Expect = 4.611e-7
Identity = 36/101 (35.64%), Postives = 60/101 (59.41%), Query Frame = 2
Query: 1901 GKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCS-----GNASSCGQVSTM 2188
            G  G +CDD+++ N  NV+CRQLG G+A++A       +G G+G  +LD + C G+E  +  CP   W + +C  ++ AG++CS      +AS+ G  S++
Sbjct:    2 GSWGTVCDDSWDTNDANVVCRQLGCGWAMSAPG--NARFGQGSGPIVLDDVRCSGHESYLWSCPHNGWLSHNCGHSEDAGVICSDTWPTSHASTAGSESSL 100          
BLAST of Serine protease 12 vs. Ensembl Human
Match: DMBT1 (deleted in malignant brain tumors 1 [Source:HGNC Symbol;Acc:HGNC:2926])

HSP 1 Score: 93.2041 bits (230), Expect = 1.791e-18
Identity = 65/200 (32.50%), Postives = 105/200 (52.50%), Query Frame = 2
Query: 1598 LTYNNSY-MVCSNEYDKNNTDVYCRYLG--YPGVRKSYSNPGNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQD------VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGNAS 2164
            + Y  S+  VC + +D N+ +V CR LG  +  +    +  G  +  + L  ++C+GNE     CP + +    C  ++  GVIC        + L  G    +GRVEV Y+G  G +CDD+++ N  NV+CRQLG G+A +A       +G G+G  +LD + C G+E  +  CP   W + +C  ++ AG++CS   S
Sbjct:  509 VLYRGSWGTVCDDSWDTNDANVVCRQLGCGWAMLAPGNARFGQGSGPIVLDDVRCSGNESYLWSCPHNGWLSHNCGHSEDAGVICSGPESSLALRLVNGGDRCQGRVEVLYRGSWGTVCDDSWDTNDANVVCRQLGCGWATSAPG--NARFGQGSGPIVLDDVRCSGHESYLWSCPNNGWLSHNCGHHEDAGVICSAAQS 706          

HSP 2 Score: 87.0409 bits (214), Expect = 1.779e-16
Identity = 73/249 (29.32%), Postives = 114/249 (45.78%), Query Frame = 2
Query: 1598 LTYNNSY-MVCSNEYDKNNTDVYCRYLGYPGVRKSYSNP--GNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQD-----------------------------VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGNASSCGQVSTMENNWKYSNGYNTTFGATP 2242
            + Y  S+  VC + +D N+ +V CR LG      +  N   G  +  + L  ++C+G+E     CP + +    C   +  GVIC                               + L  G     GRVEV Y+G  G +CDD+++ N  NV+CRQLG G+A++A       +G G+G  +LD + C GNE  +  CP K W T +C  ++ AG++CS       Q+++   +W +     TT  A P
Sbjct: 1524 VLYQGSWGTVCDDYWDTNDANVVCRQLGCGWAMSAPGNAQFGQGSGPIVLDDVRCSGHESYLWSCPHNGWLSHNCGHHEDAGVICSAAQSQSTPRPDTWLTTNLPALTVGSESSLALRLVNGGDRCRGRVEVLYRGSWGTVCDDSWDTNDANVVCRQLGCGWAMSAPG--NARFGQGSGPIVLDDVRCSGNESYLWSCPHKGWLTHNCGHHEDAGVICSAT-----QINSTTTDWWHP---TTTTTARP 1762          

HSP 3 Score: 83.9593 bits (206), Expect = 1.226e-15
Identity = 67/224 (29.91%), Postives = 105/224 (46.88%), Query Frame = 2
Query: 1598 LTYNNSY-MVCSNEYDKNNTDVYCRYLGYPGVRKSYSNP--GNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQD-----------------------------VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGNASS 2167
            + Y  S+  VC + +D ++ +V CR LG      +  N   G  +  + L  ++C+G E     CP + +    C  ++  GVIC                               + L  G    +GRVEV Y+G  G +CDD+++ N  NV+CRQLG G+A+ A       +G G+G  +LD + C GNE  +  CP   W + +C  ++ AG++CSG  SS
Sbjct:  378 VLYRGSWGTVCDDSWDTSDANVVCRQLGCGWATSAPGNARFGQGSGPIVLDDVRCSGYESYLWSCPHNGWLSHNCQHSEDAGVICSAAHSWSTPSPDTLPTITLPASTVGSESSLALRLVNGGDRCQGRVEVLYRGSWGTVCDDSWDTNDANVVCRQLGCGWAMLAPG--NARFGQGSGPIVLDDVRCSGNESYLWSCPHNGWLSHNCGHSEDAGVICSGPESS 599          

HSP 4 Score: 83.9593 bits (206), Expect = 1.257e-15
Identity = 68/237 (28.69%), Postives = 111/237 (46.84%), Query Frame = 2
Query: 1598 LTYNNSY-MVCSNEYDKNNTDVYCRYLGYPGVRKSYSNP--GNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQ---------------------------DVALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGNASSCGQVSTMENNWKYSN 2212
            + Y  S+  VC + +D N+ +V CR LG      +  N   G  +  + L  ++C+G+E     CP + +    C  ++  GVIC                             + L  G    +GRVEV Y+G  G +CDD ++ N  NV+CRQLG G+A++A       +G G+G  +LD + C G+E  +  CP   W + +C  ++ AG++CS + S   Q +   + W  S+
Sbjct: 1008 VLYQGSWGTVCDDSWDTNDANVVCRQLGCGWAMSAPGNARFGQGSGPIVLDDVRCSGHESYLWSCPHNGWLSHNCGHSEDAGVICSASQSRPTPSPDTWPTSHASTAGSESSLALRLVNGGDRCQGRVEVLYRGSWGTVCDDYWDTNDANVVCRQLGCGWAMSAPG--NARFGQGSGPIVLDDVRCSGHESYLWSCPHNGWLSHNCGHHEDAGVICSASQS---QPTPSPDTWPTSH 1239          

HSP 5 Score: 82.4185 bits (202), Expect = 3.531e-15
Identity = 66/224 (29.46%), Postives = 102/224 (45.54%), Query Frame = 2
Query: 1598 LTYNNSY-MVCSNEYDKNNTDVYCRYLGYPGVRKSYSNP--GNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQD------------------------------VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGNAS 2164
            + Y  S+  VC + +D N+ +V CR LG      +  N   G  +  + L  ++C+G+E     CP + +    C   +  GVIC                                + L  G     GRVEV Y+G  G +CDD ++ N  NV+CRQLG G+A++A       +G G+G  +LD + C G+E  +  CP   W T +C  ++ AG++CS   S
Sbjct:  117 ILYRGSWGTVCDDSWDTNDANVVCRQLGCGWAMSAPGNAWFGQGSGPIALDDVRCSGHESYLWSCPHNGWLSHNCGHGEDAGVICSAAQPQSTLRPESWPVRISPPVPTEGSESSLALRLVNGGDRCRGRVEVLYRGSWGTVCDDYWDTNDANVVCRQLGCGWAMSAPG--NAQFGQGSGPIVLDDVRCSGHESYLWSCPHNGWLTHNCGHSEDAGVICSAPQS 338          

HSP 6 Score: 82.0333 bits (201), Expect = 5.577e-15
Identity = 64/219 (29.22%), Postives = 102/219 (46.58%), Query Frame = 2
Query: 1598 LTYNNSY-MVCSNEYDKNNTDVYCRYLGYPGVRKSYSNP--GNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQ-----------------------------DVALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCS 2152
            + Y  S+  VC + +D N+ +V CR LG      +  N   G  +  + L  ++C+G+E     CP + +    C   +  GVIC                               + L  G    +GRVEV Y+G  G +CDD+++ N  NV+CRQLG G+A +A       +G G+G  +LD + C G+E  +  CP   W + +C  ++ AG++CS
Sbjct:  617 VLYRGSWGTVCDDSWDTNDANVVCRQLGCGWATSAPGNARFGQGSGPIVLDDVRCSGHESYLWSCPNNGWLSHNCGHHEDAGVICSAAQSRSTPRPDTLSTITLPPSTVGSESSLTLRLVNGSDRCQGRVEVLYRGSWGTVCDDSWDTNDANVVCRQLGCGWATSAPG--NARFGQGSGPIVLDDVRCSGHESYLWSCPHNGWLSHNCGHHEDAGVICS 833          

HSP 7 Score: 81.6481 bits (200), Expect = 7.692e-15
Identity = 68/237 (28.69%), Postives = 109/237 (45.99%), Query Frame = 2
Query: 1598 LTYNNSY-MVCSNEYDKNNTDVYCRYLGYPGVRKSYSNP--GNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQD---------------------------VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGNASSCGQVSTMENNWKYSN 2212
            + Y  S+  VC + +D N+ +V CR LG      +  N   G  +  + L  ++C+G+E     CP + +    C   +  GVIC                             + L  G    +GRVEV Y+G  G +CDD ++ N  NV+CRQLG G+A +A       +G G+G  +LD + C G+E  +  CP   W + +C  ++ AG++CS + S   Q +   + W  S+
Sbjct: 1137 VLYRGSWGTVCDDYWDTNDANVVCRQLGCGWAMSAPGNARFGQGSGPIVLDDVRCSGHESYLWSCPHNGWLSHNCGHHEDAGVICSASQSQPTPSPDTWPTSHASTAGSESSLALRLVNGGDRCQGRVEVLYRGSWGTVCDDYWDTNDANVVCRQLGCGWATSAPG--NARFGQGSGPIVLDDVRCSGHESYLWSCPHNGWLSHNCGHHEDAGVICSASQS---QPTPSPDTWPTSH 1368          

HSP 8 Score: 81.2629 bits (199), Expect = 8.093e-15
Identity = 70/245 (28.57%), Postives = 111/245 (45.31%), Query Frame = 2
Query: 1598 LTYNNSY-MVCSNEYDKNNTDVYCRYLGYPGVRKSYSNP--GNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQD---------------------------VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGNASSCGQVSTMENNWKYSNGYNTTFGA 2236
            + Y  S+  VC + +D N+ +V CR LG      +  N   G  +  + L  ++C+G+E     CP + +    C   +  GVIC                             + L  G     GRVEV Y+G  G +CDD ++ N  NV+CRQLG G+A++A       +G G+G  +LD + C G+E  +  CP   W + +C  ++ AG++CS   S   Q +   + W  +N    T G+
Sbjct: 1395 VLYRGSWGTVCDDYWDTNDANVVCRQLGCGWATSAPGNARFGQGSGPIVLDDVRCSGHESYLWSCPHNGWLSHNCGHHEDAGVICSASQSQPTPSPDTWPTSRASTAGSESTLALRLVNGGDRCRGRVEVLYQGSWGTVCDDYWDTNDANVVCRQLGCGWAMSAPG--NAQFGQGSGPIVLDDVRCSGHESYLWSCPHNGWLSHNCGHHEDAGVICSAAQS---QSTPRPDTWLTTNLPALTVGS 1634          

HSP 9 Score: 81.2629 bits (199), Expect = 9.749e-15
Identity = 68/236 (28.81%), Postives = 108/236 (45.76%), Query Frame = 2
Query: 1598 LTYNNSY-MVCSNEYDKNNTDVYCRYLGYPGVRKSYSNP--GNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQ---------------------------DVALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGNASSCGQVSTMENNWKYS 2209
            + Y  S+  VC + +D N+ +V CR LG      +  N   G  +  + L  ++C+G+E     CP + +    C   +  GVIC                             + L  G    +GRVEV Y+G  G +CDD ++ N  NV+CRQLG G+A +A       +G G+G  +LD + C G+E  +  CP   W + +C  ++ AG++CS + S   Q +   + W  S
Sbjct: 1266 VLYRGSWGTVCDDYWDTNDANVVCRQLGCGWATSAPGNARFGQGSGPIVLDDVRCSGHESYLWSCPHNGWLSHNCGHHEDAGVICSASQSQPTPSPDTWPTSHASTAGSESSLALRLVNGGDRCQGRVEVLYRGSWGTVCDDYWDTNDANVVCRQLGCGWATSAPG--NARFGQGSGPIVLDDVRCSGHESYLWSCPHNGWLSHNCGHHEDAGVICSASQS---QPTPSPDTWPTS 1496          

HSP 10 Score: 80.8777 bits (198), Expect = 1.333e-14
Identity = 64/223 (28.70%), Postives = 105/223 (47.09%), Query Frame = 2
Query: 1598 LTYNNSY-MVCSNEYDKNNTDVYCRYLGYPGVRKSYSNP--GNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQD-----------------------------VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGNAS 2164
            + Y  S+  VC + +D ++ +V CR LG      +  N   G  +  + L  ++C+G E     CP + +    C  ++  GVIC                               + L  G    +GRVEV Y+G  G +CDD+++ N  NV+CRQLG G+A++A       +G G+G  +LD + C G+E  +  CP   W + +C  ++ AG++CS + S
Sbjct:  877 VLYRGSWGTVCDDSWDTSDANVVCRQLGCGWATSAPGNARFGQGSGPIVLDDVRCSGYESYLWSCPHNGWLSHNCQHSEDAGVICSAAHSWSTPSPDTLPTITLPASTVGSESSLALRLVNGGDRCQGRVEVLYQGSWGTVCDDSWDTNDANVVCRQLGCGWAMSAPG--NARFGQGSGPIVLDDVRCSGHESYLWSCPHNGWLSHNCGHSEDAGVICSASQS 1097          

HSP 11 Score: 79.7221 bits (195), Expect = 2.979e-14
Identity = 64/221 (28.96%), Postives = 102/221 (46.15%), Query Frame = 2
Query: 1598 LTYNNSY-MVCSNEYDKNNTDVYCRYLGYPGVRKSYSNP--GNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQ---------------------------DVALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGNAS 2164
            + Y  S+  VC + +D N+ +V CR LG      +  N   G  +  + L  ++C+G+E     CP + +    C   +  GVIC                             + L  G    +GRVEV Y+G  G +CDD+++ +  NV+CRQLG G+A +A       +G G+G  +LD + C G E  +  CP   W + +C  ++ AG++CS   S
Sbjct:  748 VLYRGSWGTVCDDSWDTNDANVVCRQLGCGWATSAPGNARFGQGSGPIVLDDVRCSGHESYLWSCPHNGWLSHNCGHHEDAGVICSVSQSRPTPSPDTWPTSHASTAGPESSLALRLVNGGDRCQGRVEVLYRGSWGTVCDDSWDTSDANVVCRQLGCGWATSAPG--NARFGQGSGPIVLDDVRCSGYESYLWSCPHNGWLSHNCQHSEDAGVICSAAHS 966          

HSP 12 Score: 79.337 bits (194), Expect = 3.297e-14
Identity = 64/221 (28.96%), Postives = 103/221 (46.61%), Query Frame = 2
Query: 1598 LTYNNSY-MVCSNEYDKNNTDVYCRYLGYPGVRKSYSNP--GNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQD---------------------------VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGNAS 2164
            + Y  S+  VC + +D N+ +V CR LG      +  N   G  +  + L  ++C+G+E     CP + +    C  ++  GVIC                             + L  G    +GRVEV Y+G  G +CDD+++ +  NV+CRQLG G+A +A       +G G+G  +LD + C G E  +  CP   W + +C  ++ AG++CS   S
Sbjct:  249 VLYRGSWGTVCDDYWDTNDANVVCRQLGCGWAMSAPGNAQFGQGSGPIVLDDVRCSGHESYLWSCPHNGWLTHNCGHSEDAGVICSAPQSRPTPSPDTWPTSHASTAGPESSLALRLVNGGDRCQGRVEVLYRGSWGTVCDDSWDTSDANVVCRQLGCGWATSAPG--NARFGQGSGPIVLDDVRCSGYESYLWSCPHNGWLSHNCQHSEDAGVICSAAHS 467          

HSP 13 Score: 68.1662 bits (165), Expect = 8.230e-11
Identity = 39/103 (37.86%), Postives = 61/103 (59.22%), Query Frame = 2
Query: 1844 VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCS 2152
            + L  G    +GRVE+ Y+G  G +CDD+++ N  NV+CRQLG G+A++A       +G G+G   LD + C G+E  +  CP   W + +C   + AG++CS
Sbjct:  102 LRLVNGDGRCQGRVEILYRGSWGTVCDDSWDTNDANVVCRQLGCGWAMSAPG--NAWFGQGSGPIALDDVRCSGHESYLWSCPHNGWLSHNCGHGEDAGVICS 202          

HSP 14 Score: 67.0106 bits (162), Expect = 2.157e-10
Identity = 38/94 (40.43%), Postives = 56/94 (59.57%), Query Frame = 2
Query: 1877 GRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGN 2158
            GRVE+Y+ G  G +CDD++ I    V+CRQLG G AV+A       +G G+G   LD + C G E ++  C  + W + +C   + AG++CSGN
Sbjct: 1897 GRVEIYHGGTWGTVCDDSWTIQEAEVVCRQLGCGRAVSALG--NAYFGSGSGPITLDDVECSGTESTLWQCRNRGWFSHNCNHREDAGVICSGN 1988          
BLAST of Serine protease 12 vs. Ensembl Human
Match: DMBT1 (deleted in malignant brain tumors 1 [Source:HGNC Symbol;Acc:HGNC:2926])

HSP 1 Score: 93.2041 bits (230), Expect = 1.791e-18
Identity = 65/200 (32.50%), Postives = 105/200 (52.50%), Query Frame = 2
Query: 1598 LTYNNSY-MVCSNEYDKNNTDVYCRYLG--YPGVRKSYSNPGNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQD------VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGNAS 2164
            + Y  S+  VC + +D N+ +V CR LG  +  +    +  G  +  + L  ++C+GNE     CP + +    C  ++  GVIC        + L  G    +GRVEV Y+G  G +CDD+++ N  NV+CRQLG G+A +A       +G G+G  +LD + C G+E  +  CP   W + +C  ++ AG++CS   S
Sbjct:  509 VLYRGSWGTVCDDSWDTNDANVVCRQLGCGWAMLAPGNARFGQGSGPIVLDDVRCSGNESYLWSCPHNGWLSHNCGHSEDAGVICSGPESSLALRLVNGGDRCQGRVEVLYRGSWGTVCDDSWDTNDANVVCRQLGCGWATSAPG--NARFGQGSGPIVLDDVRCSGHESYLWSCPNNGWLSHNCGHHEDAGVICSAAQS 706          

HSP 2 Score: 87.0409 bits (214), Expect = 1.779e-16
Identity = 73/249 (29.32%), Postives = 114/249 (45.78%), Query Frame = 2
Query: 1598 LTYNNSY-MVCSNEYDKNNTDVYCRYLGYPGVRKSYSNP--GNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQD-----------------------------VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGNASSCGQVSTMENNWKYSNGYNTTFGATP 2242
            + Y  S+  VC + +D N+ +V CR LG      +  N   G  +  + L  ++C+G+E     CP + +    C   +  GVIC                               + L  G     GRVEV Y+G  G +CDD+++ N  NV+CRQLG G+A++A       +G G+G  +LD + C GNE  +  CP K W T +C  ++ AG++CS       Q+++   +W +     TT  A P
Sbjct: 1524 VLYQGSWGTVCDDYWDTNDANVVCRQLGCGWAMSAPGNAQFGQGSGPIVLDDVRCSGHESYLWSCPHNGWLSHNCGHHEDAGVICSAAQSQSTPRPDTWLTTNLPALTVGSESSLALRLVNGGDRCRGRVEVLYRGSWGTVCDDSWDTNDANVVCRQLGCGWAMSAPG--NARFGQGSGPIVLDDVRCSGNESYLWSCPHKGWLTHNCGHHEDAGVICSAT-----QINSTTTDWWHP---TTTTTARP 1762          

HSP 3 Score: 83.9593 bits (206), Expect = 1.226e-15
Identity = 67/224 (29.91%), Postives = 105/224 (46.88%), Query Frame = 2
Query: 1598 LTYNNSY-MVCSNEYDKNNTDVYCRYLGYPGVRKSYSNP--GNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQD-----------------------------VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGNASS 2167
            + Y  S+  VC + +D ++ +V CR LG      +  N   G  +  + L  ++C+G E     CP + +    C  ++  GVIC                               + L  G    +GRVEV Y+G  G +CDD+++ N  NV+CRQLG G+A+ A       +G G+G  +LD + C GNE  +  CP   W + +C  ++ AG++CSG  SS
Sbjct:  378 VLYRGSWGTVCDDSWDTSDANVVCRQLGCGWATSAPGNARFGQGSGPIVLDDVRCSGYESYLWSCPHNGWLSHNCQHSEDAGVICSAAHSWSTPSPDTLPTITLPASTVGSESSLALRLVNGGDRCQGRVEVLYRGSWGTVCDDSWDTNDANVVCRQLGCGWAMLAPG--NARFGQGSGPIVLDDVRCSGNESYLWSCPHNGWLSHNCGHSEDAGVICSGPESS 599          

HSP 4 Score: 83.9593 bits (206), Expect = 1.257e-15
Identity = 68/237 (28.69%), Postives = 111/237 (46.84%), Query Frame = 2
Query: 1598 LTYNNSY-MVCSNEYDKNNTDVYCRYLGYPGVRKSYSNP--GNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQ---------------------------DVALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGNASSCGQVSTMENNWKYSN 2212
            + Y  S+  VC + +D N+ +V CR LG      +  N   G  +  + L  ++C+G+E     CP + +    C  ++  GVIC                             + L  G    +GRVEV Y+G  G +CDD ++ N  NV+CRQLG G+A++A       +G G+G  +LD + C G+E  +  CP   W + +C  ++ AG++CS + S   Q +   + W  S+
Sbjct: 1008 VLYQGSWGTVCDDSWDTNDANVVCRQLGCGWAMSAPGNARFGQGSGPIVLDDVRCSGHESYLWSCPHNGWLSHNCGHSEDAGVICSASQSRPTPSPDTWPTSHASTAGSESSLALRLVNGGDRCQGRVEVLYRGSWGTVCDDYWDTNDANVVCRQLGCGWAMSAPG--NARFGQGSGPIVLDDVRCSGHESYLWSCPHNGWLSHNCGHHEDAGVICSASQS---QPTPSPDTWPTSH 1239          

HSP 5 Score: 82.4185 bits (202), Expect = 3.531e-15
Identity = 66/224 (29.46%), Postives = 102/224 (45.54%), Query Frame = 2
Query: 1598 LTYNNSY-MVCSNEYDKNNTDVYCRYLGYPGVRKSYSNP--GNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQD------------------------------VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGNAS 2164
            + Y  S+  VC + +D N+ +V CR LG      +  N   G  +  + L  ++C+G+E     CP + +    C   +  GVIC                                + L  G     GRVEV Y+G  G +CDD ++ N  NV+CRQLG G+A++A       +G G+G  +LD + C G+E  +  CP   W T +C  ++ AG++CS   S
Sbjct:  117 ILYRGSWGTVCDDSWDTNDANVVCRQLGCGWAMSAPGNAWFGQGSGPIALDDVRCSGHESYLWSCPHNGWLSHNCGHGEDAGVICSAAQPQSTLRPESWPVRISPPVPTEGSESSLALRLVNGGDRCRGRVEVLYRGSWGTVCDDYWDTNDANVVCRQLGCGWAMSAPG--NAQFGQGSGPIVLDDVRCSGHESYLWSCPHNGWLTHNCGHSEDAGVICSAPQS 338          

HSP 6 Score: 82.0333 bits (201), Expect = 5.577e-15
Identity = 64/219 (29.22%), Postives = 102/219 (46.58%), Query Frame = 2
Query: 1598 LTYNNSY-MVCSNEYDKNNTDVYCRYLGYPGVRKSYSNP--GNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQ-----------------------------DVALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCS 2152
            + Y  S+  VC + +D N+ +V CR LG      +  N   G  +  + L  ++C+G+E     CP + +    C   +  GVIC                               + L  G    +GRVEV Y+G  G +CDD+++ N  NV+CRQLG G+A +A       +G G+G  +LD + C G+E  +  CP   W + +C  ++ AG++CS
Sbjct:  617 VLYRGSWGTVCDDSWDTNDANVVCRQLGCGWATSAPGNARFGQGSGPIVLDDVRCSGHESYLWSCPNNGWLSHNCGHHEDAGVICSAAQSRSTPRPDTLSTITLPPSTVGSESSLTLRLVNGSDRCQGRVEVLYRGSWGTVCDDSWDTNDANVVCRQLGCGWATSAPG--NARFGQGSGPIVLDDVRCSGHESYLWSCPHNGWLSHNCGHHEDAGVICS 833          

HSP 7 Score: 81.6481 bits (200), Expect = 7.692e-15
Identity = 68/237 (28.69%), Postives = 109/237 (45.99%), Query Frame = 2
Query: 1598 LTYNNSY-MVCSNEYDKNNTDVYCRYLGYPGVRKSYSNP--GNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQD---------------------------VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGNASSCGQVSTMENNWKYSN 2212
            + Y  S+  VC + +D N+ +V CR LG      +  N   G  +  + L  ++C+G+E     CP + +    C   +  GVIC                             + L  G    +GRVEV Y+G  G +CDD ++ N  NV+CRQLG G+A +A       +G G+G  +LD + C G+E  +  CP   W + +C  ++ AG++CS + S   Q +   + W  S+
Sbjct: 1137 VLYRGSWGTVCDDYWDTNDANVVCRQLGCGWAMSAPGNARFGQGSGPIVLDDVRCSGHESYLWSCPHNGWLSHNCGHHEDAGVICSASQSQPTPSPDTWPTSHASTAGSESSLALRLVNGGDRCQGRVEVLYRGSWGTVCDDYWDTNDANVVCRQLGCGWATSAPG--NARFGQGSGPIVLDDVRCSGHESYLWSCPHNGWLSHNCGHHEDAGVICSASQS---QPTPSPDTWPTSH 1368          

HSP 8 Score: 81.2629 bits (199), Expect = 8.093e-15
Identity = 70/245 (28.57%), Postives = 111/245 (45.31%), Query Frame = 2
Query: 1598 LTYNNSY-MVCSNEYDKNNTDVYCRYLGYPGVRKSYSNP--GNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQD---------------------------VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGNASSCGQVSTMENNWKYSNGYNTTFGA 2236
            + Y  S+  VC + +D N+ +V CR LG      +  N   G  +  + L  ++C+G+E     CP + +    C   +  GVIC                             + L  G     GRVEV Y+G  G +CDD ++ N  NV+CRQLG G+A++A       +G G+G  +LD + C G+E  +  CP   W + +C  ++ AG++CS   S   Q +   + W  +N    T G+
Sbjct: 1395 VLYRGSWGTVCDDYWDTNDANVVCRQLGCGWATSAPGNARFGQGSGPIVLDDVRCSGHESYLWSCPHNGWLSHNCGHHEDAGVICSASQSQPTPSPDTWPTSRASTAGSESTLALRLVNGGDRCRGRVEVLYQGSWGTVCDDYWDTNDANVVCRQLGCGWAMSAPG--NAQFGQGSGPIVLDDVRCSGHESYLWSCPHNGWLSHNCGHHEDAGVICSAAQS---QSTPRPDTWLTTNLPALTVGS 1634          

HSP 9 Score: 81.2629 bits (199), Expect = 9.749e-15
Identity = 68/236 (28.81%), Postives = 108/236 (45.76%), Query Frame = 2
Query: 1598 LTYNNSY-MVCSNEYDKNNTDVYCRYLGYPGVRKSYSNP--GNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQ---------------------------DVALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGNASSCGQVSTMENNWKYS 2209
            + Y  S+  VC + +D N+ +V CR LG      +  N   G  +  + L  ++C+G+E     CP + +    C   +  GVIC                             + L  G    +GRVEV Y+G  G +CDD ++ N  NV+CRQLG G+A +A       +G G+G  +LD + C G+E  +  CP   W + +C  ++ AG++CS + S   Q +   + W  S
Sbjct: 1266 VLYRGSWGTVCDDYWDTNDANVVCRQLGCGWATSAPGNARFGQGSGPIVLDDVRCSGHESYLWSCPHNGWLSHNCGHHEDAGVICSASQSQPTPSPDTWPTSHASTAGSESSLALRLVNGGDRCQGRVEVLYRGSWGTVCDDYWDTNDANVVCRQLGCGWATSAPG--NARFGQGSGPIVLDDVRCSGHESYLWSCPHNGWLSHNCGHHEDAGVICSASQS---QPTPSPDTWPTS 1496          

HSP 10 Score: 80.8777 bits (198), Expect = 1.333e-14
Identity = 64/223 (28.70%), Postives = 105/223 (47.09%), Query Frame = 2
Query: 1598 LTYNNSY-MVCSNEYDKNNTDVYCRYLGYPGVRKSYSNP--GNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQD-----------------------------VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGNAS 2164
            + Y  S+  VC + +D ++ +V CR LG      +  N   G  +  + L  ++C+G E     CP + +    C  ++  GVIC                               + L  G    +GRVEV Y+G  G +CDD+++ N  NV+CRQLG G+A++A       +G G+G  +LD + C G+E  +  CP   W + +C  ++ AG++CS + S
Sbjct:  877 VLYRGSWGTVCDDSWDTSDANVVCRQLGCGWATSAPGNARFGQGSGPIVLDDVRCSGYESYLWSCPHNGWLSHNCQHSEDAGVICSAAHSWSTPSPDTLPTITLPASTVGSESSLALRLVNGGDRCQGRVEVLYQGSWGTVCDDSWDTNDANVVCRQLGCGWAMSAPG--NARFGQGSGPIVLDDVRCSGHESYLWSCPHNGWLSHNCGHSEDAGVICSASQS 1097          

HSP 11 Score: 79.7221 bits (195), Expect = 2.979e-14
Identity = 64/221 (28.96%), Postives = 102/221 (46.15%), Query Frame = 2
Query: 1598 LTYNNSY-MVCSNEYDKNNTDVYCRYLGYPGVRKSYSNP--GNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQ---------------------------DVALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGNAS 2164
            + Y  S+  VC + +D N+ +V CR LG      +  N   G  +  + L  ++C+G+E     CP + +    C   +  GVIC                             + L  G    +GRVEV Y+G  G +CDD+++ +  NV+CRQLG G+A +A       +G G+G  +LD + C G E  +  CP   W + +C  ++ AG++CS   S
Sbjct:  748 VLYRGSWGTVCDDSWDTNDANVVCRQLGCGWATSAPGNARFGQGSGPIVLDDVRCSGHESYLWSCPHNGWLSHNCGHHEDAGVICSVSQSRPTPSPDTWPTSHASTAGPESSLALRLVNGGDRCQGRVEVLYRGSWGTVCDDSWDTSDANVVCRQLGCGWATSAPG--NARFGQGSGPIVLDDVRCSGYESYLWSCPHNGWLSHNCQHSEDAGVICSAAHS 966          

HSP 12 Score: 79.337 bits (194), Expect = 3.297e-14
Identity = 64/221 (28.96%), Postives = 103/221 (46.61%), Query Frame = 2
Query: 1598 LTYNNSY-MVCSNEYDKNNTDVYCRYLGYPGVRKSYSNP--GNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQD---------------------------VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGNAS 2164
            + Y  S+  VC + +D N+ +V CR LG      +  N   G  +  + L  ++C+G+E     CP + +    C  ++  GVIC                             + L  G    +GRVEV Y+G  G +CDD+++ +  NV+CRQLG G+A +A       +G G+G  +LD + C G E  +  CP   W + +C  ++ AG++CS   S
Sbjct:  249 VLYRGSWGTVCDDYWDTNDANVVCRQLGCGWAMSAPGNAQFGQGSGPIVLDDVRCSGHESYLWSCPHNGWLTHNCGHSEDAGVICSAPQSRPTPSPDTWPTSHASTAGPESSLALRLVNGGDRCQGRVEVLYRGSWGTVCDDSWDTSDANVVCRQLGCGWATSAPG--NARFGQGSGPIVLDDVRCSGYESYLWSCPHNGWLSHNCQHSEDAGVICSAAHS 467          

HSP 13 Score: 68.1662 bits (165), Expect = 8.230e-11
Identity = 39/103 (37.86%), Postives = 61/103 (59.22%), Query Frame = 2
Query: 1844 VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCS 2152
            + L  G    +GRVE+ Y+G  G +CDD+++ N  NV+CRQLG G+A++A       +G G+G   LD + C G+E  +  CP   W + +C   + AG++CS
Sbjct:  102 LRLVNGDGRCQGRVEILYRGSWGTVCDDSWDTNDANVVCRQLGCGWAMSAPG--NAWFGQGSGPIALDDVRCSGHESYLWSCPHNGWLSHNCGHGEDAGVICS 202          

HSP 14 Score: 67.0106 bits (162), Expect = 2.157e-10
Identity = 38/94 (40.43%), Postives = 56/94 (59.57%), Query Frame = 2
Query: 1877 GRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGN 2158
            GRVE+Y+ G  G +CDD++ I    V+CRQLG G AV+A       +G G+G   LD + C G E ++  C  + W + +C   + AG++CSGN
Sbjct: 1897 GRVEIYHGGTWGTVCDDSWTIQEAEVVCRQLGCGRAVSALG--NAYFGSGSGPITLDDVECSGTESTLWQCRNRGWFSHNCNHREDAGVICSGN 1988          
BLAST of Serine protease 12 vs. Ensembl Human
Match: DMBT1 (deleted in malignant brain tumors 1 [Source:HGNC Symbol;Acc:HGNC:2926])

HSP 1 Score: 93.2041 bits (230), Expect = 1.791e-18
Identity = 65/200 (32.50%), Postives = 105/200 (52.50%), Query Frame = 2
Query: 1598 LTYNNSY-MVCSNEYDKNNTDVYCRYLG--YPGVRKSYSNPGNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQD------VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGNAS 2164
            + Y  S+  VC + +D N+ +V CR LG  +  +    +  G  +  + L  ++C+GNE     CP + +    C  ++  GVIC        + L  G    +GRVEV Y+G  G +CDD+++ N  NV+CRQLG G+A +A       +G G+G  +LD + C G+E  +  CP   W + +C  ++ AG++CS   S
Sbjct:  509 VLYRGSWGTVCDDSWDTNDANVVCRQLGCGWAMLAPGNARFGQGSGPIVLDDVRCSGNESYLWSCPHNGWLSHNCGHSEDAGVICSGPESSLALRLVNGGDRCQGRVEVLYRGSWGTVCDDSWDTNDANVVCRQLGCGWATSAPG--NARFGQGSGPIVLDDVRCSGHESYLWSCPNNGWLSHNCGHHEDAGVICSAAQS 706          

HSP 2 Score: 87.0409 bits (214), Expect = 1.779e-16
Identity = 73/249 (29.32%), Postives = 114/249 (45.78%), Query Frame = 2
Query: 1598 LTYNNSY-MVCSNEYDKNNTDVYCRYLGYPGVRKSYSNP--GNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQD-----------------------------VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGNASSCGQVSTMENNWKYSNGYNTTFGATP 2242
            + Y  S+  VC + +D N+ +V CR LG      +  N   G  +  + L  ++C+G+E     CP + +    C   +  GVIC                               + L  G     GRVEV Y+G  G +CDD+++ N  NV+CRQLG G+A++A       +G G+G  +LD + C GNE  +  CP K W T +C  ++ AG++CS       Q+++   +W +     TT  A P
Sbjct: 1524 VLYQGSWGTVCDDYWDTNDANVVCRQLGCGWAMSAPGNAQFGQGSGPIVLDDVRCSGHESYLWSCPHNGWLSHNCGHHEDAGVICSAAQSQSTPRPDTWLTTNLPALTVGSESSLALRLVNGGDRCRGRVEVLYRGSWGTVCDDSWDTNDANVVCRQLGCGWAMSAPG--NARFGQGSGPIVLDDVRCSGNESYLWSCPHKGWLTHNCGHHEDAGVICSAT-----QINSTTTDWWHP---TTTTTARP 1762          

HSP 3 Score: 83.9593 bits (206), Expect = 1.226e-15
Identity = 67/224 (29.91%), Postives = 105/224 (46.88%), Query Frame = 2
Query: 1598 LTYNNSY-MVCSNEYDKNNTDVYCRYLGYPGVRKSYSNP--GNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQD-----------------------------VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGNASS 2167
            + Y  S+  VC + +D ++ +V CR LG      +  N   G  +  + L  ++C+G E     CP + +    C  ++  GVIC                               + L  G    +GRVEV Y+G  G +CDD+++ N  NV+CRQLG G+A+ A       +G G+G  +LD + C GNE  +  CP   W + +C  ++ AG++CSG  SS
Sbjct:  378 VLYRGSWGTVCDDSWDTSDANVVCRQLGCGWATSAPGNARFGQGSGPIVLDDVRCSGYESYLWSCPHNGWLSHNCQHSEDAGVICSAAHSWSTPSPDTLPTITLPASTVGSESSLALRLVNGGDRCQGRVEVLYRGSWGTVCDDSWDTNDANVVCRQLGCGWAMLAPG--NARFGQGSGPIVLDDVRCSGNESYLWSCPHNGWLSHNCGHSEDAGVICSGPESS 599          

HSP 4 Score: 83.9593 bits (206), Expect = 1.257e-15
Identity = 68/237 (28.69%), Postives = 111/237 (46.84%), Query Frame = 2
Query: 1598 LTYNNSY-MVCSNEYDKNNTDVYCRYLGYPGVRKSYSNP--GNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQ---------------------------DVALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGNASSCGQVSTMENNWKYSN 2212
            + Y  S+  VC + +D N+ +V CR LG      +  N   G  +  + L  ++C+G+E     CP + +    C  ++  GVIC                             + L  G    +GRVEV Y+G  G +CDD ++ N  NV+CRQLG G+A++A       +G G+G  +LD + C G+E  +  CP   W + +C  ++ AG++CS + S   Q +   + W  S+
Sbjct: 1008 VLYQGSWGTVCDDSWDTNDANVVCRQLGCGWAMSAPGNARFGQGSGPIVLDDVRCSGHESYLWSCPHNGWLSHNCGHSEDAGVICSASQSRPTPSPDTWPTSHASTAGSESSLALRLVNGGDRCQGRVEVLYRGSWGTVCDDYWDTNDANVVCRQLGCGWAMSAPG--NARFGQGSGPIVLDDVRCSGHESYLWSCPHNGWLSHNCGHHEDAGVICSASQS---QPTPSPDTWPTSH 1239          

HSP 5 Score: 82.4185 bits (202), Expect = 3.531e-15
Identity = 66/224 (29.46%), Postives = 102/224 (45.54%), Query Frame = 2
Query: 1598 LTYNNSY-MVCSNEYDKNNTDVYCRYLGYPGVRKSYSNP--GNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQD------------------------------VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGNAS 2164
            + Y  S+  VC + +D N+ +V CR LG      +  N   G  +  + L  ++C+G+E     CP + +    C   +  GVIC                                + L  G     GRVEV Y+G  G +CDD ++ N  NV+CRQLG G+A++A       +G G+G  +LD + C G+E  +  CP   W T +C  ++ AG++CS   S
Sbjct:  117 ILYRGSWGTVCDDSWDTNDANVVCRQLGCGWAMSAPGNAWFGQGSGPIALDDVRCSGHESYLWSCPHNGWLSHNCGHGEDAGVICSAAQPQSTLRPESWPVRISPPVPTEGSESSLALRLVNGGDRCRGRVEVLYRGSWGTVCDDYWDTNDANVVCRQLGCGWAMSAPG--NAQFGQGSGPIVLDDVRCSGHESYLWSCPHNGWLTHNCGHSEDAGVICSAPQS 338          

HSP 6 Score: 82.0333 bits (201), Expect = 5.577e-15
Identity = 64/219 (29.22%), Postives = 102/219 (46.58%), Query Frame = 2
Query: 1598 LTYNNSY-MVCSNEYDKNNTDVYCRYLGYPGVRKSYSNP--GNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQ-----------------------------DVALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCS 2152
            + Y  S+  VC + +D N+ +V CR LG      +  N   G  +  + L  ++C+G+E     CP + +    C   +  GVIC                               + L  G    +GRVEV Y+G  G +CDD+++ N  NV+CRQLG G+A +A       +G G+G  +LD + C G+E  +  CP   W + +C  ++ AG++CS
Sbjct:  617 VLYRGSWGTVCDDSWDTNDANVVCRQLGCGWATSAPGNARFGQGSGPIVLDDVRCSGHESYLWSCPNNGWLSHNCGHHEDAGVICSAAQSRSTPRPDTLSTITLPPSTVGSESSLTLRLVNGSDRCQGRVEVLYRGSWGTVCDDSWDTNDANVVCRQLGCGWATSAPG--NARFGQGSGPIVLDDVRCSGHESYLWSCPHNGWLSHNCGHHEDAGVICS 833          

HSP 7 Score: 81.6481 bits (200), Expect = 7.692e-15
Identity = 68/237 (28.69%), Postives = 109/237 (45.99%), Query Frame = 2
Query: 1598 LTYNNSY-MVCSNEYDKNNTDVYCRYLGYPGVRKSYSNP--GNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQD---------------------------VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGNASSCGQVSTMENNWKYSN 2212
            + Y  S+  VC + +D N+ +V CR LG      +  N   G  +  + L  ++C+G+E     CP + +    C   +  GVIC                             + L  G    +GRVEV Y+G  G +CDD ++ N  NV+CRQLG G+A +A       +G G+G  +LD + C G+E  +  CP   W + +C  ++ AG++CS + S   Q +   + W  S+
Sbjct: 1137 VLYRGSWGTVCDDYWDTNDANVVCRQLGCGWAMSAPGNARFGQGSGPIVLDDVRCSGHESYLWSCPHNGWLSHNCGHHEDAGVICSASQSQPTPSPDTWPTSHASTAGSESSLALRLVNGGDRCQGRVEVLYRGSWGTVCDDYWDTNDANVVCRQLGCGWATSAPG--NARFGQGSGPIVLDDVRCSGHESYLWSCPHNGWLSHNCGHHEDAGVICSASQS---QPTPSPDTWPTSH 1368          

HSP 8 Score: 81.2629 bits (199), Expect = 8.093e-15
Identity = 70/245 (28.57%), Postives = 111/245 (45.31%), Query Frame = 2
Query: 1598 LTYNNSY-MVCSNEYDKNNTDVYCRYLGYPGVRKSYSNP--GNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQD---------------------------VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGNASSCGQVSTMENNWKYSNGYNTTFGA 2236
            + Y  S+  VC + +D N+ +V CR LG      +  N   G  +  + L  ++C+G+E     CP + +    C   +  GVIC                             + L  G     GRVEV Y+G  G +CDD ++ N  NV+CRQLG G+A++A       +G G+G  +LD + C G+E  +  CP   W + +C  ++ AG++CS   S   Q +   + W  +N    T G+
Sbjct: 1395 VLYRGSWGTVCDDYWDTNDANVVCRQLGCGWATSAPGNARFGQGSGPIVLDDVRCSGHESYLWSCPHNGWLSHNCGHHEDAGVICSASQSQPTPSPDTWPTSRASTAGSESTLALRLVNGGDRCRGRVEVLYQGSWGTVCDDYWDTNDANVVCRQLGCGWAMSAPG--NAQFGQGSGPIVLDDVRCSGHESYLWSCPHNGWLSHNCGHHEDAGVICSAAQS---QSTPRPDTWLTTNLPALTVGS 1634          

HSP 9 Score: 81.2629 bits (199), Expect = 9.749e-15
Identity = 68/236 (28.81%), Postives = 108/236 (45.76%), Query Frame = 2
Query: 1598 LTYNNSY-MVCSNEYDKNNTDVYCRYLGYPGVRKSYSNP--GNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQ---------------------------DVALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGNASSCGQVSTMENNWKYS 2209
            + Y  S+  VC + +D N+ +V CR LG      +  N   G  +  + L  ++C+G+E     CP + +    C   +  GVIC                             + L  G    +GRVEV Y+G  G +CDD ++ N  NV+CRQLG G+A +A       +G G+G  +LD + C G+E  +  CP   W + +C  ++ AG++CS + S   Q +   + W  S
Sbjct: 1266 VLYRGSWGTVCDDYWDTNDANVVCRQLGCGWATSAPGNARFGQGSGPIVLDDVRCSGHESYLWSCPHNGWLSHNCGHHEDAGVICSASQSQPTPSPDTWPTSHASTAGSESSLALRLVNGGDRCQGRVEVLYRGSWGTVCDDYWDTNDANVVCRQLGCGWATSAPG--NARFGQGSGPIVLDDVRCSGHESYLWSCPHNGWLSHNCGHHEDAGVICSASQS---QPTPSPDTWPTS 1496          

HSP 10 Score: 80.8777 bits (198), Expect = 1.333e-14
Identity = 64/223 (28.70%), Postives = 105/223 (47.09%), Query Frame = 2
Query: 1598 LTYNNSY-MVCSNEYDKNNTDVYCRYLGYPGVRKSYSNP--GNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQD-----------------------------VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGNAS 2164
            + Y  S+  VC + +D ++ +V CR LG      +  N   G  +  + L  ++C+G E     CP + +    C  ++  GVIC                               + L  G    +GRVEV Y+G  G +CDD+++ N  NV+CRQLG G+A++A       +G G+G  +LD + C G+E  +  CP   W + +C  ++ AG++CS + S
Sbjct:  877 VLYRGSWGTVCDDSWDTSDANVVCRQLGCGWATSAPGNARFGQGSGPIVLDDVRCSGYESYLWSCPHNGWLSHNCQHSEDAGVICSAAHSWSTPSPDTLPTITLPASTVGSESSLALRLVNGGDRCQGRVEVLYQGSWGTVCDDSWDTNDANVVCRQLGCGWAMSAPG--NARFGQGSGPIVLDDVRCSGHESYLWSCPHNGWLSHNCGHSEDAGVICSASQS 1097          

HSP 11 Score: 79.7221 bits (195), Expect = 2.979e-14
Identity = 64/221 (28.96%), Postives = 102/221 (46.15%), Query Frame = 2
Query: 1598 LTYNNSY-MVCSNEYDKNNTDVYCRYLGYPGVRKSYSNP--GNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQ---------------------------DVALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGNAS 2164
            + Y  S+  VC + +D N+ +V CR LG      +  N   G  +  + L  ++C+G+E     CP + +    C   +  GVIC                             + L  G    +GRVEV Y+G  G +CDD+++ +  NV+CRQLG G+A +A       +G G+G  +LD + C G E  +  CP   W + +C  ++ AG++CS   S
Sbjct:  748 VLYRGSWGTVCDDSWDTNDANVVCRQLGCGWATSAPGNARFGQGSGPIVLDDVRCSGHESYLWSCPHNGWLSHNCGHHEDAGVICSVSQSRPTPSPDTWPTSHASTAGPESSLALRLVNGGDRCQGRVEVLYRGSWGTVCDDSWDTSDANVVCRQLGCGWATSAPG--NARFGQGSGPIVLDDVRCSGYESYLWSCPHNGWLSHNCQHSEDAGVICSAAHS 966          

HSP 12 Score: 79.337 bits (194), Expect = 3.297e-14
Identity = 64/221 (28.96%), Postives = 103/221 (46.61%), Query Frame = 2
Query: 1598 LTYNNSY-MVCSNEYDKNNTDVYCRYLGYPGVRKSYSNP--GNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQD---------------------------VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGNAS 2164
            + Y  S+  VC + +D N+ +V CR LG      +  N   G  +  + L  ++C+G+E     CP + +    C  ++  GVIC                             + L  G    +GRVEV Y+G  G +CDD+++ +  NV+CRQLG G+A +A       +G G+G  +LD + C G E  +  CP   W + +C  ++ AG++CS   S
Sbjct:  249 VLYRGSWGTVCDDYWDTNDANVVCRQLGCGWAMSAPGNAQFGQGSGPIVLDDVRCSGHESYLWSCPHNGWLTHNCGHSEDAGVICSAPQSRPTPSPDTWPTSHASTAGPESSLALRLVNGGDRCQGRVEVLYRGSWGTVCDDSWDTSDANVVCRQLGCGWATSAPG--NARFGQGSGPIVLDDVRCSGYESYLWSCPHNGWLSHNCQHSEDAGVICSAAHS 467          

HSP 13 Score: 68.1662 bits (165), Expect = 8.230e-11
Identity = 39/103 (37.86%), Postives = 61/103 (59.22%), Query Frame = 2
Query: 1844 VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCS 2152
            + L  G    +GRVE+ Y+G  G +CDD+++ N  NV+CRQLG G+A++A       +G G+G   LD + C G+E  +  CP   W + +C   + AG++CS
Sbjct:  102 LRLVNGDGRCQGRVEILYRGSWGTVCDDSWDTNDANVVCRQLGCGWAMSAPG--NAWFGQGSGPIALDDVRCSGHESYLWSCPHNGWLSHNCGHGEDAGVICS 202          

HSP 14 Score: 67.0106 bits (162), Expect = 2.157e-10
Identity = 38/94 (40.43%), Postives = 56/94 (59.57%), Query Frame = 2
Query: 1877 GRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGN 2158
            GRVE+Y+ G  G +CDD++ I    V+CRQLG G AV+A       +G G+G   LD + C G E ++  C  + W + +C   + AG++CSGN
Sbjct: 1897 GRVEIYHGGTWGTVCDDSWTIQEAEVVCRQLGCGRAVSALG--NAYFGSGSGPITLDDVECSGTESTLWQCRNRGWFSHNCNHREDAGVICSGN 1988          
BLAST of Serine protease 12 vs. Ensembl Celegans
Match: svh-1 (HGF/MSP/plasminogen-like protein [Source:UniProtKB/TrEMBL;Acc:Q17800])

HSP 1 Score: 69.3218 bits (168), Expect = 1.301e-11
Identity = 64/235 (27.23%), Postives = 106/235 (45.11%), Query Frame = 2
Query: 2213 GYNTTFGATPWQARLM-PSSVNEWCSATIIDRNWLLTSANCFTMSYN-NFYVTVMSSRYYWDSSNFATTNSI---QSVFIHPQYSTVTGDYNLALVKV--NSIAFDANVQPLCLPAG-YIPVDGLSCVTTGWNHGLNTYSRPLLGKPVLIQNSSYCKDHLQFDDTRMARYLCSDNNMDPSAYFNGESGGPLTCSI-NGKNVLXXXXXXXXXXXXXXXIRLYTRVDYWDSWIRNIM 2890
            G+ T  GA PW A L   ++    C A+I+D+  L+T+A+CF      + Y  V+     WD++       I   Q +  +P Y  +   +++A++++    I F+   QP+CLP+  ++   G  CV +GW      Y+  L    + I N   C +  Q   +      C+           G+SGGP  C   +G  VL GV++     A+     +YT V  + SWI  I+
Sbjct:  716 GFETVPGAFPWTAALRNKATKAHHCGASILDKTHLITAAHCFEEDERVSSYEVVVGD---WDNNQTDGNEQIFYLQRIHFYPLYKDIFS-HDIAILEIPYPGIEFNEYAQPICLPSKDFVYTPGRQCVVSGWGSMGLRYAERLQAALIPIINRFDCVNSSQIYSSMSRSAFCAGYLEGGIDSCQGDSGGPFACRREDGAFVLAGVISWGDGCAQKKQPGIYTMVAPYLSWISAII 946          
BLAST of Serine protease 12 vs. Ensembl Celegans
Match: try-1 (TRYpsin-like protease [Source:UniProtKB/TrEMBL;Acc:Q23528])

HSP 1 Score: 61.6178 bits (148), Expect = 6.834e-10
Identity = 49/188 (26.06%), Postives = 91/188 (48.40%), Query Frame = 2
Query: 2240 PWQARLMPSSVNEWCSATIIDRNWLLTSANCFTMSYNNFYVTVMSSRYYWDSSNFATTNSIQSVFIHPQYST-VTGDYNLALVKVN-SIAFDANVQPLCLPAGYIP-VDGLSCVTTGWNHGL--NTYSRPLLGK-PVLIQNSSYCKDHLQF-DDTRMARYLCSDNNMDPSAYFNGESGGPLTCSINGK 2782
            PW  +L+    +  C  ++ID N++LT+A+CF     +   T  S R     S   + + + +V IHP Y+      Y+ A+++++  +      +P+CLP+  +P V+   CV TGW   +  ++ S P L +  V + ++ +C     +     +   LC+  +        G+SGGPL C+ +G 
Sbjct:   70 PWTVQLLSRLGHHRCGGSLIDPNFVLTAAHCFA---KDRRPTSYSVRVGGHRSGSGSPHRVTAVSIHPWYNIGFPSSYDFAIMRIHPPVNTSTTARPICLPS--LPAVENRLCVVTGWGSTIEGSSLSAPTLREIHVPLLSTLFCSSLPNYIGRIHLPSMLCAGYSYGKIDSCQGDSGGPLMCARDGH 252          
BLAST of Serine protease 12 vs. Ensembl Celegans
Match: try-3 (TRYpsin-like protease [Source:UniProtKB/TrEMBL;Acc:Q94176])

HSP 1 Score: 49.6766 bits (117), Expect = 5.462e-6
Identity = 29/100 (29.00%), Postives = 52/100 (52.00%), Query Frame = 2
Query: 2243 WQARLMPSSVNE---WCSATIIDRNWLLTSANCFTMSYNNFYVTVMSSRYYWDSSNFATTNSIQSVFIHPQYSTVTGDYNLALVKVNSIAFDANVQPLCL 2533
            W A+L+    N     C AT+ID  WL+T+A+C        +V V   +     +N   + S++  +IH  Y+  T D ++AL++++S      ++P+CL
Sbjct:   50 WMAKLVSYGDNGQGILCGATVIDDFWLVTAAHCALQLQTRSFVYVREPK-----NNRERSFSVKEAYIHSGYNNQTADNDIALLRISSDLSKLGIKPVCL 144          
BLAST of Serine protease 12 vs. Ensembl Celegans
Match: try-3 (TRYpsin-like protease [Source:UniProtKB/TrEMBL;Acc:Q94176])

HSP 1 Score: 48.9062 bits (115), Expect = 7.654e-6
Identity = 25/84 (29.76%), Postives = 46/84 (54.76%), Query Frame = 2
Query: 2282 CSATIIDRNWLLTSANCFTMSYNNFYVTVMSSRYYWDSSNFATTNSIQSVFIHPQYSTVTGDYNLALVKVNSIAFDANVQPLCL 2533
            C AT+ID  WL+T+A+C        +V V   +     +N   + S++  +IH  Y+  T D ++AL++++S      ++P+CL
Sbjct:   16 CGATVIDDFWLVTAAHCALQLQTRSFVYVREPK-----NNRERSFSVKEAYIHSGYNNQTADNDIALLRISSDLSKLGIKPVCL 94          
BLAST of Serine protease 12 vs. Ensembl Fly
Match: teq (gene:FBgn0023479 transcript:FBtr0344980)

HSP 1 Score: 110.153 bits (274), Expect = 7.020e-24
Identity = 128/533 (24.02%), Postives = 205/533 (38.46%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYLGYP----GVRKS--YSNPGNNTTYLPLVSLKCNGNEQSPADC----------------------PVDR----YAYCYTAK---PVGVICQDVA--------------------LAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGNAS---------------SCGQVSTMEN-----NWKYSN-----------------------------GYNTTFGATPWQARLMPSS----VNEWCSATIIDRNWLLTSANCFTMSYNNFYVTVMSSRYYWDSSNFATTNSIQSVFIHPQYSTVTGDYN-LALVKVNS-IAFDANVQPLCLPAGYIP-VDGLSCVTTGW---NHGLNTYSRPLLGKPVLIQNSSYCKDHLQFDDTRMARYLCSDNNMDPSAYFNGESGGPLTCSINGKNVLXXXXXXXXXXXXXXXIRLYTRVDYWDSWI 2878
            VC +++   + DV CR LG+      VR S  Y+ P  +  YL +  ++C+GNE     C                      PV +    Y  C+T+K   P   +C +                      L GGR +NEGR+EV + G  G +CDD+FN+ +  V C  +G+            ++G  NG   LD + C+GNE SI  C    W   +C   +   L CS                   S G+ +T +       W+ S+                             G     G  PWQA +         + WC A +I +  LLT+A+C   S    Y   +   Y   + +    + I++ ++H  +   T   N +ALV + + + F   VQP+CLP      V+   C  +GW     G++T ++ L    + I     CK    +         C+ +  +      G+SGGPL CS +    L G+++        +   +Y RV+++  WI
Sbjct: 1840 VCDDKFGLKDADVVCRELGFQMGAQEVRGSSFYAPPNQDFNYL-MDEVECHGNETKLGQCAFKGWGVHNCGVDEVAGVTCKVPVMKCPNNYWLCHTSKECIPPAFVCDNTPDCADKSDECAAVCQAPVQYRLEGGRNSNEGRLEVKHHGVWGSVCDDDFNLKSAQVACNSMGF---FGPAKIEKNIFGNSNGPIWLDQVMCFGNETSIDQCNHWNWGEHNCNHTEDVALHCSAGPPPRSQRYSQTQIKGGRSLGRETTPKTYSQIGLWERSSKAVHTPRRCGIFKDDLTDEYAHREERVVRGNVAQRGRHPWQATIRTRGRGGISSHWCGAVVISKRHLLTAAHCLYGSPKGAYFVRVGDHYANIAESSEVDSFIENWYLHENFRKGTHMNNDIALVVLKTPLKFSDYVQPICLPDKNAELVEDRKCTISGWGSIKSGVSTPAQVLGSAELPILADHVCKQSNVYGSAMSEGMFCAGSMDESVDACEGDSGGPLVCSDDDGETLYGLISWGQHCGFKNRPGVYVRVNHYIDWI 2368          

HSP 2 Score: 72.7886 bits (177), Expect = 1.768e-12
Identity = 39/111 (35.14%), Postives = 62/111 (55.86%), Query Frame = 2
Query: 1841 DVALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGY-AVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGNASSC 2170
            +V L+GG + N GR+EV   G+ G +CDD F +   +V+CR+LG+   A     ++ Y     + N+L+D + C+GNE  +G C  K W   +C  ++VAG+ C      C
Sbjct: 1815 EVRLSGGESPNMGRIEVKANGQWGYVCDDKFGLKDADVVCRELGFQMGAQEVRGSSFYAPPNQDFNYLMDEVECHGNETKLGQCAFKGWGVHNCGVDEVAGVTCKVPVMKC 1925          
BLAST of Serine protease 12 vs. Ensembl Fly
Match: teq (gene:FBgn0023479 transcript:FBtr0344981)

HSP 1 Score: 108.612 bits (270), Expect = 2.048e-23
Identity = 128/533 (24.02%), Postives = 205/533 (38.46%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYLGYP----GVRKS--YSNPGNNTTYLPLVSLKCNGNEQSPADC----------------------PVDR----YAYCYTAK---PVGVICQDVA--------------------LAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGNAS---------------SCGQVSTMEN-----NWKYSN-----------------------------GYNTTFGATPWQARLMPSS----VNEWCSATIIDRNWLLTSANCFTMSYNNFYVTVMSSRYYWDSSNFATTNSIQSVFIHPQYSTVTGDYN-LALVKVNS-IAFDANVQPLCLPAGYIP-VDGLSCVTTGW---NHGLNTYSRPLLGKPVLIQNSSYCKDHLQFDDTRMARYLCSDNNMDPSAYFNGESGGPLTCSINGKNVLXXXXXXXXXXXXXXXIRLYTRVDYWDSWI 2878
            VC +++   + DV CR LG+      VR S  Y+ P  +  YL +  ++C+GNE     C                      PV +    Y  C+T+K   P   +C +                      L GGR +NEGR+EV + G  G +CDD+FN+ +  V C  +G+            ++G  NG   LD + C+GNE SI  C    W   +C   +   L CS                   S G+ +T +       W+ S+                             G     G  PWQA +         + WC A +I +  LLT+A+C   S    Y   +   Y   + +    + I++ ++H  +   T   N +ALV + + + F   VQP+CLP      V+   C  +GW     G++T ++ L    + I     CK    +         C+ +  +      G+SGGPL CS +    L G+++        +   +Y RV+++  WI
Sbjct: 2253 VCDDKFGLKDADVVCRELGFQMGAQEVRGSSFYAPPNQDFNYL-MDEVECHGNETKLGQCAFKGWGVHNCGVDEVAGVTCKVPVMKCPNNYWLCHTSKECIPPAFVCDNTPDCADKSDECAAVCQAPVQYRLEGGRNSNEGRLEVKHHGVWGSVCDDDFNLKSAQVACNSMGF---FGPAKIEKNIFGNSNGPIWLDQVMCFGNETSIDQCNHWNWGEHNCNHTEDVALHCSAGPPPRSQRYSQTQIKGGRSLGRETTPKTYSQIGLWERSSKAVHTPRRCGIFKDDLTDEYAHREERVVRGNVAQRGRHPWQATIRTRGRGGISSHWCGAVVISKRHLLTAAHCLYGSPKGAYFVRVGDHYANIAESSEVDSFIENWYLHENFRKGTHMNNDIALVVLKTPLKFSDYVQPICLPDKNAELVEDRKCTISGWGSIKSGVSTPAQVLGSAELPILADHVCKQSNVYGSAMSEGMFCAGSMDESVDACEGDSGGPLVCSDDDGETLYGLISWGQHCGFKNRPGVYVRVNHYIDWI 2781          

HSP 2 Score: 72.7886 bits (177), Expect = 1.564e-12
Identity = 39/111 (35.14%), Postives = 62/111 (55.86%), Query Frame = 2
Query: 1841 DVALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGY-AVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGNASSC 2170
            +V L+GG + N GR+EV   G+ G +CDD F +   +V+CR+LG+   A     ++ Y     + N+L+D + C+GNE  +G C  K W   +C  ++VAG+ C      C
Sbjct: 2228 EVRLSGGESPNMGRIEVKANGQWGYVCDDKFGLKDADVVCRELGFQMGAQEVRGSSFYAPPNQDFNYLMDEVECHGNETKLGQCAFKGWGVHNCGVDEVAGVTCKVPVMKC 2338          
BLAST of Serine protease 12 vs. Ensembl Fly
Match: teq (gene:FBgn0023479 transcript:FBtr0076525)

HSP 1 Score: 107.457 bits (267), Expect = 3.413e-23
Identity = 130/534 (24.34%), Postives = 208/534 (38.95%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYLGYP----GVRKS--YSNPGNNTTYLPLVSLKCNGNEQSPADC----------------------PVDR----YAYCYTAK---PVGVICQDVA--------------------LAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGNAS---------------SCGQVSTMEN-----NWKYSN-----------------------------GYNTTFGATPWQARLMPSSV----NEWCSATIIDRNWLLTSANCFTMSYNNFYVTVMSSRYYWDSSNFATTNSIQSVFIHPQYSTVTG-DYNLALVKVNS-IAFDANVQPLCLPAGYIP-VDGLSCVTTGW---NHGLNTYSRPLLGKPVLIQNSSYCKDHLQFDDTRMARYLCSDNNMDPSAYF-NGESGGPLTCSINGKNVLXXXXXXXXXXXXXXXIRLYTRVDYWDSWI 2878
            VC +++   + DV CR LG+      VR S  Y+ P  +  YL +  ++C+GNE     C                      PV +    Y  C+T+K   P   +C +                      L GGR +NEGR+EV + G  G +CDD+FN+ +  V C  +G+            ++G  NG   LD + C+GNE SI  C    W   +C   +   L CS                   S G+ +T +       W+ S+                             G     G  PWQA +         + WC A +I +  LLT+A+C   S    Y   +   Y   + +    + I++ ++H  +   T  + ++ALV + + + F   VQP+CLP      V+   C  +GW     G++T ++ L    + I     CK    +         C+  +MD S     G+SGGPL CS +    L G+++        +   +Y RV+++  WI
Sbjct:  911 VCDDKFGLKDADVVCRELGFQMGAQEVRGSSFYAPPNQDFNYL-MDEVECHGNETKLGQCAFKGWGVHNCGVDEVAGVTCKVPVMKCPNNYWLCHTSKECIPPAFVCDNTPDCADKSDECAAVCQAPVQYRLEGGRNSNEGRLEVKHHGVWGSVCDDDFNLKSAQVACNSMGF---FGPAKIEKNIFGNSNGPIWLDQVMCFGNETSIDQCNHWNWGEHNCNHTEDVALHCSAGPPPRSQRYSQTQIKGGRSLGRETTPKTYSQIGLWERSSKAVHTPRRCGIFKDDLTDEYAHREERVVRGNVAQRGRHPWQATIRTRGRGGISSHWCGAVVISKRHLLTAAHCLYGSPKGAYFVRVGDHYANIAESSEVDSFIENWYLHENFRKGTHMNNDIALVVLKTPLKFSDYVQPICLPDKNAELVEDRKCTISGWGSIKSGVSTPAQVLGSAELPILADHVCKQSNVYGSAMSEGMFCA-GSMDESVDACEGDSGGPLVCSDDDGETLYGLISWGQHCGFKNRPGVYVRVNHYIDWI 1439          

HSP 2 Score: 72.4034 bits (176), Expect = 1.761e-12
Identity = 39/111 (35.14%), Postives = 62/111 (55.86%), Query Frame = 2
Query: 1841 DVALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGY-AVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGNASSC 2170
            +V L+GG + N GR+EV   G+ G +CDD F +   +V+CR+LG+   A     ++ Y     + N+L+D + C+GNE  +G C  K W   +C  ++VAG+ C      C
Sbjct:  886 EVRLSGGESPNMGRIEVKANGQWGYVCDDKFGLKDADVVCRELGFQMGAQEVRGSSFYAPPNQDFNYLMDEVECHGNETKLGQCAFKGWGVHNCGVDEVAGVTCKVPVMKC 996          
BLAST of Serine protease 12 vs. Ensembl Fly
Match: Loxl2 (gene:FBgn0034660 transcript:FBtr0071745)

HSP 1 Score: 84.7297 bits (208), Expect = 1.279e-16
Identity = 66/217 (30.41%), Postives = 95/217 (43.78%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYLGYPGVRK----SYSNPGNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVIC-----------------QD-------------VALAGGRTANEGRVEVYYKGKK-GLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDC--PTKYWETKSCYGN--DVAGLVC 2149
            VC +E+D    D+ CR LG+PG+R+     +  P     ++   +L C G+EQ   DC  + +    C   +  GV+C                 +D             V L GGR+  EGRVEV   G + G +C D +++   NV+CRQLG GYA  A     +     +   L     CYGNE  + DC          SC+GN   VA ++C
Sbjct:   85 VCDDEWDSTEADIVCRQLGFPGMRRYTRSGFFGPARRRFWMD--NLFCEGHEQELVDCHFEGWGENDCEPGEAAGVVCYPPENALIPMATPIIRDEDLPKYPIHSRSRLYVRLRGGRSRIEGRVEVSLDGGRWGSVCADGWSLLEANVVCRQLGLGYASEAFQTDFFGGFNVSRPVLSGS-ECYGNETELADCLHHDASQGIISCHGNRQHVAAVIC 298          

HSP 2 Score: 59.6918 bits (143), Expect = 8.715e-9
Identity = 33/102 (32.35%), Postives = 52/102 (50.98%), Query Frame = 2
Query: 1844 VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVC 2149
            + L GG    EG +EV + GK G +CDD ++    +++CRQLG+      T      +G     F +D ++C G+E  + DC  + W    C   + AG+VC
Sbjct:   61 IRLVGGDNEYEGNIEVLHNGKWGAVCDDEWDSTEADIVCRQLGFPGMRRYTR--SGFFGPARRRFWMDNLFCEGHEQELVDCHFEGWGENDCEPGEAAGVVC 160          
BLAST of Serine protease 12 vs. Ensembl Fly
Match: CG8172 (gene:FBgn0033362 transcript:FBtr0301191)

HSP 1 Score: 83.1889 bits (204), Expect = 1.477e-16
Identity = 66/263 (25.10%), Postives = 119/263 (45.25%), Query Frame = 2
Query: 2156 NASSCGQVSTMENNWKYSNGYNTTFGATPWQARLMPS---SVNEWCSATIIDRNWLLTSANCFTMSYNNFYVTVMSSRYYWDSSNFATTN-----SIQSVFIHPQYSTVTGDYNLALVKVNS-IAFDANVQPLCLPAGYIPVDGLSCVTTGW---NHGLNTYSRPLLGKPVLIQNSSYCKDHLQFDDTRMA---RYLCSDNNMDPSAYFNGESGGPLTCSINGKNVLXXXXXXXXXXXXXXXIRLYTRVDYWDSWIRNIMKNN 2899
            N +SCG+V T  N  +   G++T FG+ PWQ  L+ S   +    C   +I   W++T+A+C   + N+     +     WD              I+   +HP Y+      ++AL++++  + +  ++ P+CLP     + G      GW    HG +T    L    V + ++  C+   +    R A    +LC+           G+SGGPLT +++G+  L+G+V+  +   R     +YT +  +  WI  +M N+
Sbjct:  112 NNTSCGEVYTRSN--RIVGGHSTGFGSHPWQVALIKSGFLTRKLSCGGALISNRWVITAAHCVASTPNSNMKIRLGE---WDVRGQEERLNHEEYGIERKEVHPHYNPADFVNDVALIRLDRNVVYKQHIIPVCLPPSTTKLTGKMATVAGWGRTRHGQSTVPSVLQEVDVEVISNDRCQRWFRAAGRREAIHDVFLCAGYKDGGRDSCQGDSGGPLTLTMDGRKTLIGLVSWGIGCGREHLPGVYTNIQRFVPWINKVMAND 369          
BLAST of Serine protease 12 vs. Ensembl Zebrafish
Match: prss12 (serine protease 12 [Source:ZFIN;Acc:ZDB-GENE-090313-45])

HSP 1 Score: 147.902 bits (372), Expect = 3.167e-36
Identity = 128/474 (27.00%), Postives = 205/474 (43.25%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYLGY-PGVRKSYSNPGNNTTYLPLVSLKCNGNEQSPADCPVDRYAY----CYTAKPVGVICQD------------VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVC------------SGNASSCGQVSTMENNWKYSNGYNTTFGATPWQA--RLMPSSVNEW--CSATIIDRNWLLTSANCFTMSYNN--FYVTVMSSRYYWDSSNFATTNSIQSVFIHPQYSTVTGDYNLALVKVNS-----------IAFDANVQPLCLPAGY--IPVDGLSCVTTGWNHGLNTYSRPLLGKPVLIQNSSYCKDHLQFDDTRMARYLCSDNNMDPSAY--FNGESGGPLTCSI-NGKNVLXXXXXXXXXXXXXXXIRLYTRVDYWDSWIRNIM 2890
            VC + + + NT V CR LG+  G   S    G     + L  ++C G E +   C   R  +    C   + V ++C              V L GG    EGRVE+   G+ G +CDD +      V+CRQLGY     A +     +G G G   +D + C G E S+ DC  + + T +C  ++ AG++C                S CG   +     +   G N+  G  PWQA  RL  S  +    C AT+I   W+LTSA+CF    N+   Y   +   +      +    +++ + +HP+Y   + DY+LAL++V+            +    +V P CLP     +P    +C  TGW      YS+ L    + + +   C+   ++ +    R LC+ ++ D        G+SGGPL C   +G  V+ GV +   A     +  +YT+V  +  WI+ ++
Sbjct:  198 VCDDGWTQTNTQVVCRQLGFRSGESVSAGRFGIAAGPVLLDDVRCTGKEPTVTHC--SRRGWFKHDCTHRQDVAIVCSPQCSRHGVPNSLPVRLVGGENEREGRVEILVGGQWGTVCDDGWTDRDAEVVCRQLGYSGL--AKARVMAYFGEGEGPIHIDNVKCTGGEHSLTDCIKQPFGTHNCRHSEDAGVICNYGLQQDSPGVKEAVGSMCGLRLSHTRQKRIIGGENSLRGGWPWQAAVRLRGSQADGRLVCGATLISSCWILTSAHCFKRYGNSTGLYKVRVGDYHSLVPEEYEEEYAVEKIVLHPRYHADSSDYDLALLRVSGHRAHRGVTGQCVTLSRSVLPACLPVRREKVPKGIANCYITGWGDTGRAYSKTLQQASISVLSKRQCEQ--RYSEQFTNRMLCAGSSHDAQRVDSCRGDSGGPLVCERPSGSWVVYGVTSWGHACRLQEAPGVYTKVSAFVPWIKKVI 665          

HSP 2 Score: 90.8929 bits (224), Expect = 3.232e-18
Identity = 72/235 (30.64%), Postives = 101/235 (42.98%), Query Frame = 2
Query: 1529 AVKVQCHSNSTKYFLSPGYNQGYLTYNNSY---------MVCSNEYDKNNTDVYCRYLGYPGVRKS----YSNPGNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVIC-----QDVALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGNASSCG 2173
            A  V C    T  F+    + G   Y              VC +++D N+ +V CR LG  G+ K+    Y   G+   +L  VS  C GNE S   CP   +    C   +  GV C       V L GG    EGR+EV+Y+G+ G +CDD +      V+CRQLG+    +  S +   +G   G  LLD + C G E ++  C  + W    C       +VCS   S  G
Sbjct:   51 AAAVSCMPVETSVFVPVRLSGGPSAYEGRVEVYHAGQWGTVCDDQWDDNDAEVVCRQLGLGGIAKAWVGAYFGAGSGRVFLDEVS--CTGNELSIEQCPKTAWGEHNCDHTEDAGVSCVPLTDGAVRLVGGVKGYEGRLEVHYRGQWGTVCDDGWTQTNTQVVCRQLGF---RSGESVSAGRFGIAAGPVLLDDVRCTGKEPTVTHCSRRGWFKHDCTHRQDVAIVCSPQCSRHG 280          

HSP 3 Score: 72.7886 bits (177), Expect = 1.346e-12
Identity = 53/136 (38.97%), Postives = 74/136 (54.41%), Query Frame = 2
Query: 1745 LKCNGNEQSPADCPVDRYAYCYTAKPVGV-ICQDVALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVC 2149
            L+CN    +  +C  +R A   +  PV   +   V L+GG +A EGRVEVY+ G+ G +CDD ++ N   V+CRQLG G    A +  G  +G G+G   LD + C GNE SI  CP   W   +C   + AG+ C
Sbjct:   34 LQCNRTVWNGGECE-NRQAAAVSCMPVETSVFVPVRLSGGPSAYEGRVEVYHAGQWGTVCDDQWDDNDAEVVCRQLGLGGI--AKAWVGAYFGAGSGRVFLDEVSCTGNELSIEQCPKTAWGEHNCDHTEDAGVSC 166          
BLAST of Serine protease 12 vs. Ensembl Zebrafish
Match: BX511095.2 (serine protease 12 [Source:NCBI gene;Acc:566809])

HSP 1 Score: 147.517 bits (371), Expect = 7.654e-36
Identity = 128/472 (27.12%), Postives = 207/472 (43.86%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYLGY-PGVRKSYSNPGNNTTYLPLVSLKCNGNEQSPADCPVDRYAY----CYTAKPVGVICQD------------VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCS----------GNASSCGQVSTMENNWKYSNGYNTTFGATPWQA--RLMPSSVNEW--CSATIIDRNWLLTSANCFTMSYNN--FYVTVMSSRYYWDSSNFATTNSIQSVFIHPQYSTVTGDYNLALVKVNS-----------IAFDANVQPLCLPAGY--IPVDGLSCVTTGWNHGLNTYSRPLLGKPVLIQNSSYCKDHLQFDDTRMARYLCSDNNMDPSAY--FNGESGGPLTCSI-NGKNVLXXXXXXXXXXXXXXXIRLYTRVDYWDSWIRNIM 2890
            VC + + + NT V CR LG+  G   S    G     + L  ++C G E +   C   R  +    C   + V ++C              V L GG    EGRVE+   G+ G +CDD +      V+CRQL  GY+  A +     +G G G   +D + C G E S+ DC  + + T +C  ++ AG++C+             S CG   +     +   G N+  G  PWQA  RL  S  +    C AT+I   W+LTSA+CF    N+   Y   +   +      +    +++ + +HP+Y   + DY+LAL++V+            +    +V P CLP     +P    +C  TGW      YS+ L    + + +   C+   ++ +    R LC+ ++ D        G+SGGPL C   +G  V+ GV +   A     +  +YT+V  +  WI+ ++
Sbjct:  349 VCDDGWTQTNTQVVCRQLGFRSGESVSAGRFGIAAGPVLLDDVRCTGKEPTVTHC--SRRGWFKHDCTHRQDVAIVCSPQCSRHGVPNSLPVRLVGGENEREGRVEILVGGQWGTVCDDGWTDRDAEVVCRQL--GYSGLAKARVMAYFGEGEGPIHIDNVKCTGGEHSLTDCIKQPFGTHNCRHSEDAGVICNYGLQQDSPGVKVGSMCGLRLSHTRQKRIIGGENSLRGGWPWQAAVRLRGSQADGRLVCGATLISSCWILTSAHCFKRYGNSTGLYKVRVGDYHSLVPEEYEEEYAVEKIVLHPRYHADSSDYDLALLRVSGHRAHRGVTGQCVTLSRSVLPACLPVRREKVPKGIANCYITGWGDTGRAYSKTLQQASISVLSKRQCEQ--RYSEQFTNRMLCAGSSHDAQRVDSCRGDSGGPLVCERPSGSWVVYGVTSWGHACRLQEAPGVYTKVSAFVPWIKKVI 814          

HSP 2 Score: 90.8929 bits (224), Expect = 3.832e-18
Identity = 72/235 (30.64%), Postives = 101/235 (42.98%), Query Frame = 2
Query: 1529 AVKVQCHSNSTKYFLSPGYNQGYLTYNNSY---------MVCSNEYDKNNTDVYCRYLGYPGVRKS----YSNPGNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVIC-----QDVALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGNASSCG 2173
            A  V C    T  F+    + G   Y              VC +++D N+ +V CR LG  G+ K+    Y   G+   +L  VS  C GNE S   CP   +    C   +  GV C       V L GG    EGR+EV+Y+G+ G +CDD +      V+CRQLG+    +  S +   +G   G  LLD + C G E ++  C  + W    C       +VCS   S  G
Sbjct:  202 AAAVSCMPVETSVFVPVRLSGGPSAYEGRVEVYHAGQWGTVCDDQWDDNDAEVVCRQLGLGGIAKAWVGAYFGAGSGRVFLDEVS--CTGNELSIEQCPKTAWGEHNCDHTEDAGVSCVPLTDGAVRLVGGVKGYEGRLEVHYRGQWGTVCDDGWTQTNTQVVCRQLGF---RSGESVSAGRFGIAAGPVLLDDVRCTGKEPTVTHCSRRGWFKHDCTHRQDVAIVCSPQCSRHG 431          

HSP 3 Score: 80.8777 bits (198), Expect = 5.497e-15
Identity = 63/188 (33.51%), Postives = 89/188 (47.34%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYLGYPGVRKSYSNPGNN--TTYLPLVSLKCNGNEQSPADC--PVDRYAYCYTAKPVGVICQDVA--------LAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVC 2149
            +CSN +D  +  V CR LG      +  +P +    + +   ++ C G E     C   V     C   +   V C  V         L+GG +A EGRVEVY+ G+ G +CDD ++ N   V+CRQLG G    A +  G  +G G+G   LD + C GNE SI  CP   W   +C   + AG+ C
Sbjct:  132 ICSNGWDDQDAAVVCRQLGQGYRAHARMSPLSRLVVSVVHWQTVGCEGQEDDLLQCNRTVWNGGECENRQAAAVSCMPVETSVFVPVRLSGGPSAYEGRVEVYHAGQWGTVCDDQWDDNDAEVVCRQLGLGGI--AKAWVGAYFGAGSGRVFLDEVSCTGNELSIEQCPKTAWGEHNCDHTEDAGVSC 317          

HSP 4 Score: 51.2174 bits (121), Expect = 6.223e-6
Identity = 31/102 (30.39%), Postives = 43/102 (42.16%), Query Frame = 2
Query: 1844 VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVC 2149
            + L GGR+  +G VEVY  G  G +C + ++     V+CRQLG GY  +A      L            + C G ED +  C    W    C     A + C
Sbjct:  108 LRLQGGRSKLDGTVEVYLNGVWGTICSNGWDDQDAAVVCRQLGQGYRAHAR--MSPLSRLVVSVVHWQTVGCEGQEDDLLQCNRTVWNGGECENRQAAAVSC 207          
BLAST of Serine protease 12 vs. Ensembl Zebrafish
Match: prss12 (serine protease 12 [Source:ZFIN;Acc:ZDB-GENE-090313-45])

HSP 1 Score: 147.517 bits (371), Expect = 7.789e-36
Identity = 128/472 (27.12%), Postives = 207/472 (43.86%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYLGY-PGVRKSYSNPGNNTTYLPLVSLKCNGNEQSPADCPVDRYAY----CYTAKPVGVICQD------------VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCS----------GNASSCGQVSTMENNWKYSNGYNTTFGATPWQA--RLMPSSVNEW--CSATIIDRNWLLTSANCFTMSYNN--FYVTVMSSRYYWDSSNFATTNSIQSVFIHPQYSTVTGDYNLALVKVNS-----------IAFDANVQPLCLPAGY--IPVDGLSCVTTGWNHGLNTYSRPLLGKPVLIQNSSYCKDHLQFDDTRMARYLCSDNNMDPSAY--FNGESGGPLTCSI-NGKNVLXXXXXXXXXXXXXXXIRLYTRVDYWDSWIRNIM 2890
            VC + + + NT V CR LG+  G   S    G     + L  ++C G E +   C   R  +    C   + V ++C              V L GG    EGRVE+   G+ G +CDD +      V+CRQL  GY+  A +     +G G G   +D + C G E S+ DC  + + T +C  ++ AG++C+             S CG   +     +   G N+  G  PWQA  RL  S  +    C AT+I   W+LTSA+CF    N+   Y   +   +      +    +++ + +HP+Y   + DY+LAL++V+            +    +V P CLP     +P    +C  TGW      YS+ L    + + +   C+   ++ +    R LC+ ++ D        G+SGGPL C   +G  V+ GV +   A     +  +YT+V  +  WI+ ++
Sbjct:  349 VCDDGWTQTNTQVVCRQLGFRSGESVSAGRFGIAAGPVLLDDVRCTGKEPTVTHC--SRRGWFKHDCTHRQDVAIVCSPQCSRHGVPNSLPVRLVGGENEREGRVEILVGGQWGTVCDDGWTDRDAEVVCRQL--GYSGLAKARVMAYFGEGEGPIHIDNVKCTGGEHSLTDCIKQPFGTHNCRHSEDAGVICNYGLQQDSPGVKVGSMCGLRLSHTRQKRIIGGENSLRGGWPWQAAVRLRGSQADGRLVCGATLISSCWILTSAHCFKRYGNSTGLYKVRVGDYHSLVPEEYEEEYAVEKIVLHPRYHADSSDYDLALLRVSGHRAHRGVTGQCVTLSRSVLPACLPVRREKVPKGIANCYITGWGDTGRAYSKTLQQASISVLSKRQCEQ--RYSEQFTNRMLCAGSSHDAQRVDSCRGDSGGPLVCERPSGSWVVYGVTSWGHACRLQEAPGVYTKVSAFVPWIKKVI 814          

HSP 2 Score: 90.8929 bits (224), Expect = 3.799e-18
Identity = 72/235 (30.64%), Postives = 101/235 (42.98%), Query Frame = 2
Query: 1529 AVKVQCHSNSTKYFLSPGYNQGYLTYNNSY---------MVCSNEYDKNNTDVYCRYLGYPGVRKS----YSNPGNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVIC-----QDVALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGNASSCG 2173
            A  V C    T  F+    + G   Y              VC +++D N+ +V CR LG  G+ K+    Y   G+   +L  VS  C GNE S   CP   +    C   +  GV C       V L GG    EGR+EV+Y+G+ G +CDD +      V+CRQLG+    +  S +   +G   G  LLD + C G E ++  C  + W    C       +VCS   S  G
Sbjct:  202 AAAVSCMPVETSVFVPVRLSGGPSAYEGRVEVYHAGQWGTVCDDQWDDNDAEVVCRQLGLGGIAKAWVGAYFGAGSGRVFLDEVS--CTGNELSIEQCPKTAWGEHNCDHTEDAGVSCVPLTDGAVRLVGGVKGYEGRLEVHYRGQWGTVCDDGWTQTNTQVVCRQLGF---RSGESVSAGRFGIAAGPVLLDDVRCTGKEPTVTHCSRRGWFKHDCTHRQDVAIVCSPQCSRHG 431          

HSP 3 Score: 80.8777 bits (198), Expect = 5.404e-15
Identity = 63/188 (33.51%), Postives = 89/188 (47.34%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYLGYPGVRKSYSNPGNN--TTYLPLVSLKCNGNEQSPADC--PVDRYAYCYTAKPVGVICQDVA--------LAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVC 2149
            +CSN +D  +  V CR LG      +  +P +    + +   ++ C G E     C   V     C   +   V C  V         L+GG +A EGRVEVY+ G+ G +CDD ++ N   V+CRQLG G    A +  G  +G G+G   LD + C GNE SI  CP   W   +C   + AG+ C
Sbjct:  132 ICSNGWDDQDAAVVCRQLGQGYRAHARMSPLSRLVVSVVHWQTVGCEGQEDDLLQCNRTVWNGGECENRQAAAVSCMPVETSVFVPVRLSGGPSAYEGRVEVYHAGQWGTVCDDQWDDNDAEVVCRQLGLGGI--AKAWVGAYFGAGSGRVFLDEVSCTGNELSIEQCPKTAWGEHNCDHTEDAGVSC 317          

HSP 4 Score: 51.2174 bits (121), Expect = 6.330e-6
Identity = 31/102 (30.39%), Postives = 43/102 (42.16%), Query Frame = 2
Query: 1844 VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVC 2149
            + L GGR+  +G VEVY  G  G +C + ++     V+CRQLG GY  +A      L            + C G ED +  C    W    C     A + C
Sbjct:  108 LRLQGGRSKLDGTVEVYLNGVWGTICSNGWDDQDAAVVCRQLGQGYRAHAR--MSPLSRLVVSVVHWQTVGCEGQEDDLLQCNRTVWNGGECENRQAAAVSC 207          
BLAST of Serine protease 12 vs. Ensembl Zebrafish
Match: si:ch211-51a6.2 (si:ch211-51a6.2 [Source:ZFIN;Acc:ZDB-GENE-090313-118])

HSP 1 Score: 144.436 bits (363), Expect = 1.078e-35
Identity = 137/475 (28.84%), Postives = 216/475 (45.47%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYLGYPGVRKSYSNP----GNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQD-----------------VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVC----------SGNASSCG-QVSTMENNWKYSNGYNTTFGATPWQARLMPSSVNE----WCSATIIDRNWLLTSANCFTM--SYNNFYVTVMSSRYYWDSSNFATTNSIQSVFIHPQYSTVTGDYNLALVKV-----NSIAFDANVQPLCLP-----AGYIPVDGLSCVTTGWNHGLNTYSRPLLGKPVLIQNSSYCKDHLQFDDTRMARYLC--SDNNMDPSAYFNGESGGPLTCSINGKN-VLXXXXXXXXXXXXXXXIRLYTRVDYWDSWIRNI 2887
            VC + +   +  V CR LGY G  ++  +P    G  T  + L  + C G E S  DC   ++    C  ++ VG+ C+                  V L  G +  EGRVEV+   + G +CDD +N     V+CRQLG+     A S     +G G G+  LD + C G E S+G+C     +   C  ++ AG++C          S     CG + +T     +   G  +  G  PWQ  L   S ++     C AT+I+  W++T+A+CF    S  + YV  +   +  +  +F  + S + + IH +Y +   +Y++AL+K+     N +AF+ +   +CLP      G  P+   +CV TGW    + YSR LL   V +  S  CK   ++     +R LC  S +N        G+SGGPL C  +G + +L GV++        S   +YTRV  +  WI  +
Sbjct:   88 VCDDNWTGRHAQVVCRQLGYRG--RAEVSPVGMYGEGTGMILLDEVTCEGGESSLLDCDHSQWGQHDCSHSEDVGIRCEREGQNNEIPEVAPVTGPLVRLVDGESRKEGRVEVFINAQWGSVCDDGWNDINAQVVCRQLGFVGVSKARS--MAYFGEGQGSIHLDNVKCVGTEVSLGECSAVGSDAHDCRHSEDAGVICDYVTEPVKMNSFGKHECGLRPNTQRRRRRIIGGDKSLRGDWPWQVSLWLRSQSKGSHPLCGATLINSCWVITAAHCFKRFGSDASRYVLRLGDYHTEERDDFERSLSPERIVIHKKYHSQGWEYDIALLKLKGTDENCVAFNPHTNAVCLPPQSSKKGKRPI---ACVITGWGITDSEYSRTLLQAWVPLLPSWKCKK--RYGSRFTSRMLCAGSLSNHRRVDSCQGDSGGPLVCQGDGGHWMLTGVISWGHGCGDPSYPGVYTRVGRFLKWIEKV 553          

HSP 2 Score: 72.4034 bits (176), Expect = 1.380e-12
Identity = 53/159 (33.33%), Postives = 77/159 (48.43%), Query Frame = 2
Query: 1697 SYSNPGNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQD-----VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCS 2152
            ++++ G  T  + L  + C GNE S  +CP   +    C   +  GV C       + L G  +  EGR+EVY+ G+ G +CDDN+      V+CRQL  GY   A  +   +YG G G  LLD + C G E S+ DC    W    C  ++  G+ C 
Sbjct:    8 TWAHFGQGTGPIALDGVHCTGNELSLEECPHAPWGRHNCDHMEDAGVSCNPFTDGVLRLVGADSPWEGRLEVYHAGEWGTVCDDNWTGRHAQVVCRQL--GYRGRAEVSPVGMYGEGTGMILLDEVTCEGGESSLLDCDHSQWGQHDCSHSEDVGIRCE 164          
BLAST of Serine protease 12 vs. Ensembl Zebrafish
Match: si:ch211-51a6.2 (si:ch211-51a6.2 [Source:ZFIN;Acc:ZDB-GENE-090313-118])

HSP 1 Score: 145.591 bits (366), Expect = 4.099e-35
Identity = 136/475 (28.63%), Postives = 215/475 (45.26%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYLGYPGVRKSYSNP----GNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQD-----------------VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVC----------SGNASSCGQVSTMENNWKYSNGYNTTF-GATPWQARLMPSSVNE----WCSATIIDRNWLLTSANCFTM--SYNNFYVTVMSSRYYWDSSNFATTNSIQSVFIHPQYSTVTGDYNLALVKV-----NSIAFDANVQPLCLP-----AGYIPVDGLSCVTTGWNHGLNTYSRPLLGKPVLIQNSSYCKDHLQFDDTRMARYLC--SDNNMDPSAYFNGESGGPLTCSINGKN-VLXXXXXXXXXXXXXXXIRLYTRVDYWDSWIRNI 2887
            VC + +   +  V CR LGY G  ++  +P    G  T  + L  + C G E S  DC   ++    C  ++ VG+ C+                  V L  G +  EGRVEV+   + G +CDD +N     V+CRQLG+     A S     +G G G+  LD + C G E S+G+C     +   C  ++ AG++C          S     CG     +   +   G + +  G  PWQ  L   S ++     C AT+I+  W++T+A+CF    S  + YV  +   +  +  +F  + S + + IH +Y +   +Y++AL+K+     N +AF+ +   +CLP      G  P+   +CV TGW    + YSR LL   V +  S  CK   ++     +R LC  S +N        G+SGGPL C  +G + +L GV++        S   +YTRV  +  WI  +
Sbjct:  360 VCDDNWTGRHAQVVCRQLGYRG--RAEVSPVGMYGEGTGMILLDEVTCEGGESSLLDCDHSQWGQHDCSHSEDVGIRCEREGQNNEIPEVAPVTGPLVRLVDGESRKEGRVEVFINAQWGSVCDDGWNDINAQVVCRQLGFVGVSKARS--MAYFGEGQGSIHLDNVKCVGTEVSLGECSAVGSDAHDCRHSEDAGVICDYVTEPVKMNSFGKHECGLRPNTQRRRRRIIGGDKSLRGDWPWQVSLWLRSQSKGSHPLCGATLINSCWVITAAHCFKRFGSDASRYVLRLGDYHTEERDDFERSLSPERIVIHKKYHSQGWEYDIALLKLKGTDENCVAFNPHTNAVCLPPQSSKKGKRPI---ACVITGWGITDSEYSRTLLQAWVPLLPSWKCKK--RYGSRFTSRMLCAGSLSNHRRVDSCQGDSGGPLVCQGDGGHWMLTGVISWGHGCGDPSYPGVYTRVGRFLKWIEKV 825          

HSP 2 Score: 99.3673 bits (246), Expect = 9.231e-21
Identity = 83/259 (32.05%), Postives = 114/259 (44.02%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYL--GYPG--VRKSYSNPGNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQ-------DVALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGNASSCGQVSTMENNWKYSNGYNTTFGA-TPWQARLMPSSVNEWCSATIIDRNWLLTSAN--CFTMSYN 2350
            VC +     +  V CR L  G  G  +R SY  PG+   +     L C+GNE+S   C   +Y    C      GVIC         + L GG    EGRVEVYY G+ G +CDD ++     V+CRQLG G    A +     +G G G   LD ++C GNE S+ +CP   W   +C   + AG+ C+                 +++G     GA +PW+ RL      EW   T+ D NW    A   C  + Y 
Sbjct:  144 VCDSHLTDRDASVICRQLRLGEIGTALRHSYFGPGSGLFHFE--RLGCHGNEESLLKCRTRKYVSGDCNHGNEAGVICAVPEGNGAPLRLVGGLEDFEGRVEVYYNGRWGTICDDEWDDIDAEVVCRQLGLGGVPKAWT--WAHFGQGTGPIALDGVHCTGNELSLEECPHAPWGRHNCDHMEDAGVSCN----------------PFTDGVLRLVGADSPWEGRLEVYHAGEW--GTVCDDNWTGRHAQVVCRQLGYR 380          

HSP 3 Score: 92.0485 bits (227), Expect = 1.727e-18
Identity = 66/193 (34.20%), Postives = 96/193 (49.74%), Query Frame = 2
Query: 1604 YNNSY-MVCSNEYDKNNTDVYCRYLGYPGVRKSY--SNPGNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQD-----VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCS 2152
            YN  +  +C +E+D  + +V CR LG  GV K++  ++ G  T  + L  + C GNE S  +CP   +    C   +  GV C       + L G  +  EGR+EVY+ G+ G +CDDN+      V+CRQL  GY   A  +   +YG G G  LLD + C G E S+ DC    W    C  ++  G+ C 
Sbjct:  246 YNGRWGTICDDEWDDIDAEVVCRQLGLGGVPKAWTWAHFGQGTGPIALDGVHCTGNELSLEECPHAPWGRHNCDHMEDAGVSCNPFTDGVLRLVGADSPWEGRLEVYHAGEWGTVCDDNWTGRHAQVVCRQL--GYRGRAEVSPVGMYGEGTGMILLDEVTCEGGESSLLDCDHSQWGQHDCSHSEDVGIRCE 436          

HSP 4 Score: 59.6918 bits (143), Expect = 1.589e-8
Identity = 41/121 (33.88%), Postives = 65/121 (53.72%), Query Frame = 2
Query: 1841 DVALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCS---GNASSCGQVSTMEN 2194
            DV L GG +   GR+EVY  G+ G +CD +      +VICRQL  G     T+     +G G+G F  + + C+GNE+S+  C T+ + +  C   + AG++C+   GN +    V  +E+
Sbjct:  119 DVRLVGGSSNKSGRLEVYLNGRWGSVCDSHLTDRDASVICRQLRLGEI--GTALRHSYFGPGSGLFHFERLGCHGNEESLLKCRTRKYVSGDCNHGNEAGVICAVPEGNGAPLRLVGGLED 237          
BLAST of Serine protease 12 vs. Ensembl Xenopus
Match: ENSXETT00000001485.1 (neurotrypsin-like [Source:NCBI gene;Acc:100497588])

HSP 1 Score: 151.754 bits (382), Expect = 5.762e-37
Identity = 130/481 (27.03%), Postives = 211/481 (43.87%), Query Frame = 2
Query: 1577 PGYNQGYLTYNNSY-MVCSNEYDKNNTDVYCRYLGY--PGVRKSYSNPGNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQD---------VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVC-------------SGNASSCGQVSTMENNWKYSNGYNTTFGATPWQARLMPSSVNE----WCSATIIDRNWLLTSANCFTM--SYNNFYVTVMSSRYYWDSSNFATTNSIQSVFIHPQYSTVTGDYNLALVKVNS-----IAFDANVQPLCLPAGYIPVDGLS-CVTTGWNHGLNTYSRPLLGKPVLIQNSSYCKDHLQFDDTRMARYLCSDNNMDPSAY--FNGESGGPLTCS-INGKNVLXXXXXXXXXXXXXXXIRLYTRVDYWDSWIRNIMK 2893
            PG     + YN  +  VC + + + N  V CR LG+  P    S +  G+   ++ L  + C G E+S  +CP   +    C  ++ VGV C +         V L  G +  EGRVEV+  G+ G +CDD +  +   V+CRQLG+     A +     +G G G   +D + C G+E+++ +C  +     +C+ N+ AG++C              G +S CG         +   G  +  G+ PWQA L     ++     C AT+I+  W LT+A+CF       + Y   +   +      F     +Q + IH  Y + + D ++ALV+V         F  +V P+CLP      +    C  +GW     +YSR LL   V +     C   L++      R +C+    +        G+SGGPL C   NG+ ++VG+ +      R     +YT+V  +  WI+   K
Sbjct:  336 PGEGLVEVYYNGDWGSVCDDGWTELNAQVVCRQLGFSGPSSLSSKAEFGSGEGFIFLDDVTCTGEEESLLECPHSSWGQHDCSHSEDVGVRCSNESNDIIGPPVRLMDGESTKEGRVEVFLNGEWGSVCDDGWTDDDAAVVCRQLGHRGPAKART--MAYFGEGQGPIHMDNVECSGSENTLAECRKQDSGIHNCWHNEDAGVICDYIEKRDNQVKAKGGVSSVCGISLVPHRKKRIVGGTKSARGSWPWQASLRLKGFHKETRLLCGATLINNCWALTAAHCFKRFGKQVHRYSLRVGDYHTGVEDEFERELPLQKIVIHKNYRSTSNDNDIALVRVQGKEGHCFPFSLHVLPICLPEKKEKTNNWQPCFISGWGDTGTSYSRTLLQGAVSVLPKDTCI--LRYKGKFTNRMVCAGTLFEDRLIDSCQGDSGGPLMCQRSNGQWIIVGITSWGYGCGRKGYPGVYTKVSKFTPWIKKAAK 812          

HSP 2 Score: 87.8113 bits (216), Expect = 5.899e-17
Identity = 59/186 (31.72%), Postives = 93/186 (50.00%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYLGYPGVRKSY--SNPGNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQD-----VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCS 2152
            +C + +D ++ +V CR LG+ G  K++  ++ G  +  + L  + C GNE S   C   ++ +  C   +  GV C       + L+GG    EG VEVYY G  G +CDD +      V+CRQLG+    + +S     +G G G   LD + C G E+S+ +CP   W    C  ++  G+ CS
Sbjct:  245 ICDDHWDDSDAEVICRQLGFSGKPKAWVWAHYGQGSGPILLDEVHCIGNESSLDLCEKSKWEHHNCDHIEDAGVSCDPFTDGALRLSGGARPGEGLVEVYYNGDWGSVCDDGWTELNAQVVCRQLGFSGPSSLSS--KAEFGSGEGFIFLDDVTCTGEEESLLECPHSSWGQHDCSHSEDVGVRCS 428          

HSP 3 Score: 77.0258 bits (188), Expect = 1.186e-13
Identity = 61/216 (28.24%), Postives = 102/216 (47.22%), Query Frame = 2
Query: 1544 CHSNSTKYFLSPGYNQGY--LTYNNSY-MVCSNEYDKNNTDVYCRYLGYPGVRKSYSNPGNNTTYLP--LVSLKCNGNEQSPADCPVDRYAYCYTAKPV--GVICQD-------VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVC 2149
            C   + +      +NQG   L  N  +  +C  ++   +  V CR LG   +  +  +  + +   P  L +  C GNE++   C   +     ++  +   V C         + L GG+   EGRVEV+++G+ G +CDD+++ +   VICRQL  G++    +     YG G+G  LLD ++C GNE S+  C    WE  +C   + AG+ C
Sbjct:  107 CSQGAVRLVGDLSFNQGLVELYLNGQWGTICGEQWTDWDASVVCRQLGVSEIGTALISTRSGSWLAPEHLQAANCRGNEKALLHCHYSKSLNHRSSHGLIAAVTCSSSKDSQTPLRLVGGKERYEGRVEVFHEGRWGTICDDHWDDSDAEVICRQL--GFSGKPKAWVWAHYGQGSGPILLDEVHCIGNESSLDLCEKSKWEHHNCDHIEDAGVSC 320          

HSP 4 Score: 52.373 bits (124), Expect = 4.523e-6
Identity = 45/154 (29.22%), Postives = 70/154 (45.45%), Query Frame = 2
Query:  785 RGIPLLSYLGENYTIQFGSLSTYDGHVLCQTLGYGSVKSMRPYKNETGTKLI---YPTFDCRGSESRLTQCAELDGKKLHYEK---YYYTSPNVTNVTCSENFNMQ----LVGGDNR-SGVVQLNLGGGFSYICADNMDPSAADAICMEMGFQG 1213
            +G+  L   G+  TI     + +D  V+C+ LG   + +       +G+ L        +CRG+E  L  C        HY K   +  +   +  VTCS + + Q    LVGG  R  G V++   G +  IC D+ D S A+ IC ++GF G
Sbjct:  122 QGLVELYLNGQWGTICGEQWTDWDASVVCRQLGVSEIGTAL-ISTRSGSWLAPEHLQAANCRGNEKALLHC--------HYSKSLNHRSSHGLIAAVTCSSSKDSQTPLRLVGGKERYEGRVEVFHEGRWGTICDDHWDDSDAEVICRQLGFSG 266          
BLAST of Serine protease 12 vs. Ensembl Xenopus
Match: ENSXETT00000001537.1 (neurotrypsin-like [Source:NCBI gene;Acc:100497588])

HSP 1 Score: 150.214 bits (378), Expect = 1.711e-36
Identity = 130/485 (26.80%), Postives = 211/485 (43.51%), Query Frame = 2
Query: 1577 PGYNQGYLTYNNSY-MVCSNEYDKNNTDVYCRYLGY--PGVRKSYSNPGNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQD-------------VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVC-------------SGNASSCGQVSTMENNWKYSNGYNTTFGATPWQARLMPSSVNE----WCSATIIDRNWLLTSANCFTM--SYNNFYVTVMSSRYYWDSSNFATTNSIQSVFIHPQYSTVTGDYNLALVKVNS-----IAFDANVQPLCLPAGYIPVDGLS-CVTTGWNHGLNTYSRPLLGKPVLIQNSSYCKDHLQFDDTRMARYLCSDNNMDPSAY--FNGESGGPLTCS-INGKNVLXXXXXXXXXXXXXXXIRLYTRVDYWDSWIRNIMK 2893
            PG     + YN  +  VC + + + N  V CR LG+  P    S +  G+   ++ L  + C G E+S  +CP   +    C  ++ VGV C +             V L  G +  EGRVEV+  G+ G +CDD +  +   V+CRQLG+     A +     +G G G   +D + C G+E+++ +C  +     +C+ N+ AG++C              G +S CG         +   G  +  G+ PWQA L     ++     C AT+I+  W LT+A+CF       + Y   +   +      F     +Q + IH  Y + + D ++ALV+V         F  +V P+CLP      +    C  +GW     +YSR LL   V +     C   L++      R +C+    +        G+SGGPL C   NG+ ++VG+ +      R     +YT+V  +  WI+   K
Sbjct:  347 PGEGLVEVYYNGDWGSVCDDGWTELNAQVVCRQLGFSGPSSLSSKAEFGSGEGFIFLDDVTCTGEEESLLECPHSSWGQHDCSHSEDVGVRCSNESNDIIGIPTGPPVRLMDGESTKEGRVEVFLNGEWGSVCDDGWTDDDAAVVCRQLGHRGPAKART--MAYFGEGQGPIHMDNVECSGSENTLAECRKQDSGIHNCWHNEDAGVICDYIEKRDNQVKAKGGVSSVCGISLVPHRKKRIVGGTKSARGSWPWQASLRLKGFHKETRLLCGATLINNCWALTAAHCFKRFGKQVHRYSLRVGDYHTGVEDEFERELPLQKIVIHKNYRSTSNDNDIALVRVQGKEGHCFPFSLHVLPICLPEKKEKTNNWQPCFISGWGDTGTSYSRTLLQGAVSVLPKDTCI--LRYKGKFTNRMVCAGTLFEDRLIDSCQGDSGGPLMCQRSNGQWIIVGITSWGYGCGRKGYPGVYTKVSKFTPWIKKAAK 827          

HSP 2 Score: 87.8113 bits (216), Expect = 5.544e-17
Identity = 59/186 (31.72%), Postives = 93/186 (50.00%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYLGYPGVRKSY--SNPGNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQD-----VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCS 2152
            +C + +D ++ +V CR LG+ G  K++  ++ G  +  + L  + C GNE S   C   ++ +  C   +  GV C       + L+GG    EG VEVYY G  G +CDD +      V+CRQLG+    + +S     +G G G   LD + C G E+S+ +CP   W    C  ++  G+ CS
Sbjct:  256 ICDDHWDDSDAEVICRQLGFSGKPKAWVWAHYGQGSGPILLDEVHCIGNESSLDLCEKSKWEHHNCDHIEDAGVSCDPFTDGALRLSGGARPGEGLVEVYYNGDWGSVCDDGWTELNAQVVCRQLGFSGPSSLSS--KAEFGSGEGFIFLDDVTCTGEEESLLECPHSSWGQHDCSHSEDVGVRCS 439          

HSP 3 Score: 77.0258 bits (188), Expect = 1.169e-13
Identity = 61/216 (28.24%), Postives = 102/216 (47.22%), Query Frame = 2
Query: 1544 CHSNSTKYFLSPGYNQGY--LTYNNSY-MVCSNEYDKNNTDVYCRYLGYPGVRKSYSNPGNNTTYLP--LVSLKCNGNEQSPADCPVDRYAYCYTAKPV--GVICQD-------VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVC 2149
            C   + +      +NQG   L  N  +  +C  ++   +  V CR LG   +  +  +  + +   P  L +  C GNE++   C   +     ++  +   V C         + L GG+   EGRVEV+++G+ G +CDD+++ +   VICRQL  G++    +     YG G+G  LLD ++C GNE S+  C    WE  +C   + AG+ C
Sbjct:  118 CSQGAVRLVGDLSFNQGLVELYLNGQWGTICGEQWTDWDASVVCRQLGVSEIGTALISTRSGSWLAPEHLQAANCRGNEKALLHCHYSKSLNHRSSHGLIAAVTCSSSKDSQTPLRLVGGKERYEGRVEVFHEGRWGTICDDHWDDSDAEVICRQL--GFSGKPKAWVWAHYGQGSGPILLDEVHCIGNESSLDLCEKSKWEHHNCDHIEDAGVSC 331          

HSP 4 Score: 52.373 bits (124), Expect = 4.996e-6
Identity = 45/154 (29.22%), Postives = 70/154 (45.45%), Query Frame = 2
Query:  785 RGIPLLSYLGENYTIQFGSLSTYDGHVLCQTLGYGSVKSMRPYKNETGTKLI---YPTFDCRGSESRLTQCAELDGKKLHYEK---YYYTSPNVTNVTCSENFNMQ----LVGGDNR-SGVVQLNLGGGFSYICADNMDPSAADAICMEMGFQG 1213
            +G+  L   G+  TI     + +D  V+C+ LG   + +       +G+ L        +CRG+E  L  C        HY K   +  +   +  VTCS + + Q    LVGG  R  G V++   G +  IC D+ D S A+ IC ++GF G
Sbjct:  133 QGLVELYLNGQWGTICGEQWTDWDASVVCRQLGVSEIGTAL-ISTRSGSWLAPEHLQAANCRGNEKALLHC--------HYSKSLNHRSSHGLIAAVTCSSSKDSQTPLRLVGGKERYEGRVEVFHEGRWGTICDDHWDDSDAEVICRQLGFSG 277          
BLAST of Serine protease 12 vs. Ensembl Xenopus
Match: ENSXETT00000001560.1 (neurotrypsin-like [Source:NCBI gene;Acc:100497588])

HSP 1 Score: 149.058 bits (375), Expect = 3.493e-36
Identity = 130/485 (26.80%), Postives = 211/485 (43.51%), Query Frame = 2
Query: 1577 PGYNQGYLTYNNSY-MVCSNEYDKNNTDVYCRYLGY--PGVRKSYSNPGNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQD-------------VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVC-------------SGNASSCGQVSTMENNWKYSNGYNTTFGATPWQARLMPSSVNE----WCSATIIDRNWLLTSANCFTM--SYNNFYVTVMSSRYYWDSSNFATTNSIQSVFIHPQYSTVTGDYNLALVKVNS-----IAFDANVQPLCLPAGYIPVDGLS-CVTTGWNHGLNTYSRPLLGKPVLIQNSSYCKDHLQFDDTRMARYLCSDNNMDPSAY--FNGESGGPLTCS-INGKNVLXXXXXXXXXXXXXXXIRLYTRVDYWDSWIRNIMK 2893
            PG     + YN  +  VC + + + N  V CR LG+  P    S +  G+   ++ L  + C G E+S  +CP   +    C  ++ VGV C +             V L  G +  EGRVEV+  G+ G +CDD +  +   V+CRQLG+     A +     +G G G   +D + C G+E+++ +C  +     +C+ N+ AG++C              G +S CG         +   G  +  G+ PWQA L     ++     C AT+I+  W LT+A+CF       + Y   +   +      F     +Q + IH  Y + + D ++ALV+V         F  +V P+CLP      +    C  +GW     +YSR LL   V +     C   L++      R +C+    +        G+SGGPL C   NG+ ++VG+ +      R     +YT+V  +  WI+   K
Sbjct:  328 PGEGLVEVYYNGDWGSVCDDGWTELNAQVVCRQLGFSGPSSLSSKAEFGSGEGFIFLDDVTCTGEEESLLECPHSSWGQHDCSHSEDVGVRCSNESNDIIGIPTGPPVRLMDGESTKEGRVEVFLNGEWGSVCDDGWTDDDAAVVCRQLGHRGPAKART--MAYFGEGQGPIHMDNVECSGSENTLAECRKQDSGIHNCWHNEDAGVICDYIEKRDNQVKAKGGVSSVCGISLVPHRKKRIVGGTKSARGSWPWQASLRLKGFHKETRLLCGATLINNCWALTAAHCFKRFGKQVHRYSLRVGDYHTGVEDEFERELPLQKIVIHKNYRSTSNDNDIALVRVQGKEGHCFPFSLHVLPICLPEKKEKTNNWQPCFISGWGDTGTSYSRTLLQGAVSVLPKDTCI--LRYKGKFTNRMVCAGTLFEDRLIDSCQGDSGGPLMCQRSNGQWIIVGITSWGYGCGRKGYPGVYTKVSKFTPWIKKAAK 808          

HSP 2 Score: 87.4261 bits (215), Expect = 7.278e-17
Identity = 59/186 (31.72%), Postives = 93/186 (50.00%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYLGYPGVRKSY--SNPGNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQD-----VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCS 2152
            +C + +D ++ +V CR LG+ G  K++  ++ G  +  + L  + C GNE S   C   ++ +  C   +  GV C       + L+GG    EG VEVYY G  G +CDD +      V+CRQLG+    + +S     +G G G   LD + C G E+S+ +CP   W    C  ++  G+ CS
Sbjct:  237 ICDDHWDDSDAEVICRQLGFSGKPKAWVWAHYGQGSGPILLDEVHCIGNESSLDLCEKSKWEHHNCDHIEDAGVSCDPFTDGALRLSGGARPGEGLVEVYYNGDWGSVCDDGWTELNAQVVCRQLGFSGPSSLSS--KAEFGSGEGFIFLDDVTCTGEEESLLECPHSSWGQHDCSHSEDVGVRCS 420          

HSP 3 Score: 76.6406 bits (187), Expect = 1.621e-13
Identity = 61/216 (28.24%), Postives = 102/216 (47.22%), Query Frame = 2
Query: 1544 CHSNSTKYFLSPGYNQGY--LTYNNSY-MVCSNEYDKNNTDVYCRYLGYPGVRKSYSNPGNNTTYLP--LVSLKCNGNEQSPADCPVDRYAYCYTAKPV--GVICQD-------VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVC 2149
            C   + +      +NQG   L  N  +  +C  ++   +  V CR LG   +  +  +  + +   P  L +  C GNE++   C   +     ++  +   V C         + L GG+   EGRVEV+++G+ G +CDD+++ +   VICRQL  G++    +     YG G+G  LLD ++C GNE S+  C    WE  +C   + AG+ C
Sbjct:   99 CSQGAVRLVGDLSFNQGLVELYLNGQWGTICGEQWTDWDASVVCRQLGVSEIGTALISTRSGSWLAPEHLQAANCRGNEKALLHCHYSKSLNHRSSHGLIAAVTCSSSKDSQTPLRLVGGKERYEGRVEVFHEGRWGTICDDHWDDSDAEVICRQL--GFSGKPKAWVWAHYGQGSGPILLDEVHCIGNESSLDLCEKSKWEHHNCDHIEDAGVSC 312          

HSP 4 Score: 51.9878 bits (123), Expect = 5.044e-6
Identity = 45/154 (29.22%), Postives = 70/154 (45.45%), Query Frame = 2
Query:  785 RGIPLLSYLGENYTIQFGSLSTYDGHVLCQTLGYGSVKSMRPYKNETGTKLI---YPTFDCRGSESRLTQCAELDGKKLHYEK---YYYTSPNVTNVTCSENFNMQ----LVGGDNR-SGVVQLNLGGGFSYICADNMDPSAADAICMEMGFQG 1213
            +G+  L   G+  TI     + +D  V+C+ LG   + +       +G+ L        +CRG+E  L  C        HY K   +  +   +  VTCS + + Q    LVGG  R  G V++   G +  IC D+ D S A+ IC ++GF G
Sbjct:  114 QGLVELYLNGQWGTICGEQWTDWDASVVCRQLGVSEIGTAL-ISTRSGSWLAPEHLQAANCRGNEKALLHC--------HYSKSLNHRSSHGLIAAVTCSSSKDSQTPLRLVGGKERYEGRVEVFHEGRWGTICDDHWDDSDAEVICRQLGFSG 258          
BLAST of Serine protease 12 vs. Ensembl Xenopus
Match: tmem132a (transmembrane protein 132A [Source:Xenbase;Acc:XB-GENE-1009879])

HSP 1 Score: 135.191 bits (339), Expect = 7.860e-32
Identity = 127/467 (27.19%), Postives = 197/467 (42.18%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYLGYPGVRKSYSNP-GNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQD------------VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVC---------SGNAS----SCGQVSTMENNWKYSNGYNTTFGATPWQARLMPSSVNE----WCSATIIDRNWLLTSANCFTMSYNNF--YVTVMSSRYYWDSSNFATTNSIQSVFIHPQYSTVTGDYNLALVKVNSIA-----FDANVQPLCLPAGY-IPVDGLS-CVTTGWNHGLNTYSRPLLGKPVLIQNSSYCKDHLQFDDTRMARYLCSDNNMDPSAYFN---GESGGPLTCSINGKN-VLXXXXXXXXXXXXXXXIRLYTRVDYWDSWIRNI 2887
            VC + +   NT V CR LGY   +    N    +   + L  + C G E   + C    +    C   + V + C              + L  G T  EGRVE+Y  G+ G +CDD +     +V+CRQLGY     A +     +G G G   +D + C G E S+ DC  +   T +C  ++ AG++C         + N       CG         +   G N+  G  PWQ  L   S +      C AT+I   W+LT+A+CF    NN   YV  +   +      +    +IQ + IH  Y     DY++AL++++  A        +V P CLP     P    S C  TGW      YSR L    V +     C++  ++      R LC+  ++    + +   G+SGGPL C  +G + ++ GV +         S  +YT+V  +  WI+++
Sbjct:  280 VCDDGWTDLNTQVVCRQLGYKNGKILLENHYAGSAGVIWLDDISCTGKESMISQCSRRDWGKHDCSHQEDVHIACHPDNETHRPLSGPPLRLMDGETKKEGRVEIYLNGQWGTICDDGWTDKDASVVCRQLGYKGPAKART--MAYFGEGKGPIHVDNVRCTGYERSLADCIKQDIGTHNCRHSEDAGVICDYIIKKSTFAANKELSPLVCGSRLQHRRPKRIIGGKNSVRGGWPWQVALRLKSSHGDGRLLCGATLISSCWVLTAAHCFKRYGNNTRSYVIRVGDYHTLVPEEYEEDMTIQQIIIHNDYRPDGNDYDIALIRLHGTAEQCVQLSTHVLPACLPLRRERPQKTASNCYITGWGDTGRAYSRTLQQATVTLLPKRVCEE--RYRSQFTGRMLCA-GSVKTQKHVDSCQGDSGGPLVCERSGGSWIVYGVTSWGYGCGVKDSPGVYTKVSAFIPWIKSV 741          

HSP 2 Score: 94.7449 bits (234), Expect = 3.650e-19
Identity = 61/185 (32.97%), Postives = 89/185 (48.11%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYLGYPGVRKSYSNP--GNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQDVA-----LAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVC 2149
            VC +++D  + +V CR LGY GV K++S    G    ++ L  ++C GNE S  +C    +    C   +  GV C  +A     LAGG+ ++EGR+EV++K + G +CDD +      V+CRQLGY    N        Y    G   LD I C G E  I  C  + W    C   +   + C
Sbjct:  173 VCDDQWDDADAEVVCRQLGYGGVAKAWSQAHFGEGVGFILLDEVQCTGNELSIEECQRSPWGEHNCGHKEDAGVSCTPLADGAIRLAGGKGSHEGRLEVFHKARWGTVCDDGWTDLNTQVVCRQLGY---KNGKILLENHYAGSAGVIWLDDISCTGKESMISQCSRRDWGKHDCSHQEDVHIAC 354          

HSP 3 Score: 68.1662 bits (165), Expect = 5.098e-11
Identity = 56/193 (29.02%), Postives = 82/193 (42.49%), Query Frame = 2
Query: 1796 YAYCYTAKPVGVICQDVALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGNASSCGQVSTMENNWKYSNGYNTTFGATPWQARLMPSSVNEWCSATIIDRNW--LLTSANCFTMSYNNFYVTV 2368
            + YC   +    +     L GG +  EGR+EVY+ G  G +CDD ++     V+CRQLGYG    A S     +G G G  LLD + C GNE SI +C    W   +C   + AG+ C+  A    +++  + +     G    F    W               T+ D  W  L T   C  + Y N  + +
Sbjct:  133 WGYCDCKQAKDSVFIPARLVGGSSPYEGRIEVYHSGHWGTVCDDQWDDADAEVVCRQLGYGGVAKAWS--QAHFGEGVGFILLDEVQCTGNELSIEECQRSPWGEHNCGHKEDAGVSCTPLADGAIRLAGGKGS---HEGRLEVFHKARW--------------GTVCDDGWTDLNTQVVCRQLGYKNGKILL 306          
BLAST of Serine protease 12 vs. Ensembl Xenopus
Match: tmem132a (transmembrane protein 132A [Source:Xenbase;Acc:XB-GENE-1009879])

HSP 1 Score: 134.42 bits (337), Expect = 1.695e-31
Identity = 127/467 (27.19%), Postives = 197/467 (42.18%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYLGYPGVRKSYSNP-GNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQD------------VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVC---------SGNAS----SCGQVSTMENNWKYSNGYNTTFGATPWQARLMPSSVNE----WCSATIIDRNWLLTSANCFTMSYNNF--YVTVMSSRYYWDSSNFATTNSIQSVFIHPQYSTVTGDYNLALVKVNSIA-----FDANVQPLCLPAGY-IPVDGLS-CVTTGWNHGLNTYSRPLLGKPVLIQNSSYCKDHLQFDDTRMARYLCSDNNMDPSAYFN---GESGGPLTCSINGKN-VLXXXXXXXXXXXXXXXIRLYTRVDYWDSWIRNI 2887
            VC + +   NT V CR LGY   +    N    +   + L  + C G E   + C    +    C   + V + C              + L  G T  EGRVE+Y  G+ G +CDD +     +V+CRQLGY     A +     +G G G   +D + C G E S+ DC  +   T +C  ++ AG++C         + N       CG         +   G N+  G  PWQ  L   S +      C AT+I   W+LT+A+CF    NN   YV  +   +      +    +IQ + IH  Y     DY++AL++++  A        +V P CLP     P    S C  TGW      YSR L    V +     C++  ++      R LC+  ++    + +   G+SGGPL C  +G + ++ GV +         S  +YT+V  +  WI+++
Sbjct:  387 VCDDGWTDLNTQVVCRQLGYKNGKILLENHYAGSAGVIWLDDISCTGKESMISQCSRRDWGKHDCSHQEDVHIACHPDNETHRPLSGPPLRLMDGETKKEGRVEIYLNGQWGTICDDGWTDKDASVVCRQLGYKGPAKART--MAYFGEGKGPIHVDNVRCTGYERSLADCIKQDIGTHNCRHSEDAGVICDYIIKKSTFAANKELSPLVCGSRLQHRRPKRIIGGKNSVRGGWPWQVALRLKSSHGDGRLLCGATLISSCWVLTAAHCFKRYGNNTRSYVIRVGDYHTLVPEEYEEDMTIQQIIIHNDYRPDGNDYDIALIRLHGTAEQCVQLSTHVLPACLPLRRERPQKTASNCYITGWGDTGRAYSRTLQQATVTLLPKRVCEE--RYRSQFTGRMLCA-GSVKTQKHVDSCQGDSGGPLVCERSGGSWIVYGVTSWGYGCGVKDSPGVYTKVSAFIPWIKSV 848          

HSP 2 Score: 94.7449 bits (234), Expect = 4.048e-19
Identity = 61/185 (32.97%), Postives = 89/185 (48.11%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYLGYPGVRKSYSNP--GNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQDVA-----LAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVC 2149
            VC +++D  + +V CR LGY GV K++S    G    ++ L  ++C GNE S  +C    +    C   +  GV C  +A     LAGG+ ++EGR+EV++K + G +CDD +      V+CRQLGY    N        Y    G   LD I C G E  I  C  + W    C   +   + C
Sbjct:  280 VCDDQWDDADAEVVCRQLGYGGVAKAWSQAHFGEGVGFILLDEVQCTGNELSIEECQRSPWGEHNCGHKEDAGVSCTPLADGAIRLAGGKGSHEGRLEVFHKARWGTVCDDGWTDLNTQVVCRQLGY---KNGKILLENHYAGSAGVIWLDDISCTGKESMISQCSRRDWGKHDCSHQEDVHIAC 461          

HSP 3 Score: 87.4261 bits (215), Expect = 7.570e-17
Identity = 64/191 (33.51%), Postives = 87/191 (45.55%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYL--GYPGVRKSYSNPGNNTTYLPLVSLKCNGNEQSPADCPVD--RYAYCYTAKPVGVICQDVA----------LAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCS 2152
            +CS ++D N+  V CR L  G  G  K     G          ++C GNE++   C  D  R   C       V C  +           L GG +  EGR+EVY+ G  G +CDD ++     V+CRQLGYG    A S     +G G G  LLD + C GNE SI +C    W   +C   + AG+ C+
Sbjct:  168 ICSGQWDDNDASVICRQLELGDKGTAKKIVLSGVGQISAFWTDVQCRGNEENILQCAKDIWRSGACPQDTAAAVTCSVIQAKDSVFIPARLVGGSSPYEGRIEVYHSGHWGTVCDDQWDDADAEVVCRQLGYGGVAKAWS--QAHFGEGVGFILLDEVQCTGNELSIEECQRSPWGEHNCGHKEDAGVSCT 356          

HSP 4 Score: 52.373 bits (124), Expect = 4.143e-6
Identity = 48/197 (24.37%), Postives = 78/197 (39.59%), Query Frame = 2
Query: 1844 VALAGGRTANEGRV-EVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGNASSCGQVSTMENNWKYSNGYNTTFGATPWQARLMPSSVNEWCSATIIDRNWLLTSAN--CFTMSYNNFYVTVMSSRYYWDSSNFATTNSIQ 2425
            V L G ++ +EG V EVY  G  G +C   ++ N  +VICRQL  G     T+    L G G  +     + C GNE++I  C    W + +C  +  A + C          S ++             G++P++ R+       W   T+ D  W    A   C  + Y        S  ++ +   F   + +Q
Sbjct:  143 VRLRGSKSKSEGSVVEVYVNGAWGTICSGQWDDNDASVICRQLELGD--KGTAKKIVLSGVGQISAFWTDVQCRGNEENILQCAKDIWRSGACPQDTAAAVTC----------SVIQAKDSVFIPARLVGGSSPYEGRIEVYHSGHW--GTVCDDQWDDADAEVVCRQLGYGGV-AKAWSQAHFGEGVGFILLDEVQ 324          
BLAST of Serine protease 12 vs. Ensembl Mouse
Match: Prss12 (protease, serine 12 neurotrypsin (motopsin) [Source:MGI Symbol;Acc:MGI:1100881])

HSP 1 Score: 144.05 bits (362), Expect = 1.039e-34
Identity = 135/469 (28.78%), Postives = 203/469 (43.28%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYLGYP-GVRKSYSNPGNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQD------------VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVC---------SGN----ASSCGQVSTMENNWKYSNGYNTTFGATPWQARLMPSSVNE----WCSATIIDRNWLLTSANCFTMSYNN--FYVTVMSSRYYWDSSNFATTNSIQSVFIHPQYSTVTGDYNLALVKVNSIA-----FDANVQPLCLPA-GYIPVDGLS-CVTTGWNHGLNTYSRPLLGKPVLIQNSSYCKDHLQFDDTRMARYLCS-----DNNMDPSAYFNGESGGPLTCSINGKN-VLXXXXXXXXXXXXXXXIRLYTRVDYWDSWIRNI 2887
            VC + + + NT V CR LG+  G + S ++   +   + L  + C+G E S   C   ++    C   + VG+ C              + L  G    EGRVEV+  G+ G +CDD +      VICRQLGY     A +     +G G G   +D + C GNE ++ DC  +     +C  ++ AG++C         SGN    +S CG         +   G N+  GA PWQA L   S +      C AT++   W+LT+A+CF    NN   Y   +   +      F     +Q + IH  Y     DY++ALV++            +V P CLP     P    S C  TGW      YSR L    V +    +CK+  ++      R LC+     DN +D      G+SGGPL C    ++ V+ GV +         +  +YTRV  +  WI+++
Sbjct:  297 VCDDGWTEMNTYVACRLLGFKYGKQSSVNHFDGSNRPIWLDDVSCSGKEVSFIQCSRRQWGRHDCSHREDVGLTCYPDSDGHRLSPGFPIRLVDGENKKEGRVEVFVNGQWGTICDDGWTDKHAAVICRQLGYKGPARART--MAYFGEGKGPIHMDNVKCTGNEKALADCVKQDIGRHNCRHSEDAGVICDYLEKKASSSGNKEMLSSGCGLRLLHRRQKRIIGGNNSLRGAWPWQASLRLRSAHGDGRLLCGATLLSSCWVLTAAHCFKRYGNNSRSYAVRVGDYHTLVPEEFEQEIGVQQIVIHRNYRPDRSDYDIALVRLQGPGEQCARLSTHVLPACLPLWRERPQKTASNCHITGWGDTGRAYSRTLQQAAVPLLPKRFCKE--RYKGLFTGRMLCAGNLQEDNRVDSC---QGDSGGPLMCEKPDESWVVYGVTSWGYGCGVKDTPGVYTRVPAFVPWIKSV 758          

HSP 2 Score: 92.4337 bits (228), Expect = 1.416e-18
Identity = 59/185 (31.89%), Postives = 88/185 (47.57%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYLGYPGVRKSYSNP--GNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQD-----VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVC 2149
            +C +++D  + DV CR LG  G+ K++     G  +  + L  ++C GNE S   CP   +    C   +  GV C       + LAGG++ +EGR+EVYYKG+ G +CDD +      V CR LG+ Y   ++      +   N    LD + C G E S   C  + W    C   +  GL C
Sbjct:  190 ICDDQWDNADADVICRQLGLSGIAKAWHQAHFGEGSGPILLDEVRCTGNELSIEQCPKSSWGEHNCGHKEDAGVSCVPLTDGVIRLAGGKSTHEGRLEVYYKGQWGTVCDDGWTEMNTYVACRLLGFKYGKQSS---VNHFDGSNRPIWLDDVSCSGKEVSFIQCSRRQWGRHDCSHREDVGLTC 371          

HSP 3 Score: 67.3958 bits (163), Expect = 7.884e-11
Identity = 41/102 (40.20%), Postives = 59/102 (57.84%), Query Frame = 2
Query: 1844 VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVC 2149
            + L GG + +EGRVE+Y+ G+ G +CDD ++    +VICRQL  G +  A +     +G G+G  LLD + C GNE SI  CP   W   +C   + AG+ C
Sbjct:  166 IRLVGGNSGHEGRVELYHAGQWGTICDDQWDNADADVICRQL--GLSGIAKAWHQAHFGEGSGPILLDEVRCTGNELSIEQCPKSSWGEHNCGHKEDAGVSC 265          
BLAST of Serine protease 12 vs. Ensembl Mouse
Match: Cd163 (CD163 antigen [Source:MGI Symbol;Acc:MGI:2135946])

HSP 1 Score: 96.6709 bits (239), Expect = 9.464e-20
Identity = 75/246 (30.49%), Postives = 115/246 (46.75%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYLGYPGVRKS--YSNPGNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQDVALAGGRTANE------GRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGNASSCGQVSTMENNWKYSNGYNTTFGATPWQARLMPSSVNEWCSATIIDRNWLLTSAN 2329
            VCSN +  N   V C+ LG P   K+  ++N    + Y+ +  + C GNE +  DC  D +    C   K  GV C D +    R  N       GRVE+ ++GK G +CDDNF+ +  +VIC+QLG G A++ +       G G+G   LD + C GNE ++ DC  + W   +C   +  G++C         +   + + +  +G +   G      RL      EW   T+ D NW L  A+
Sbjct:   74 VCSNGWSMNEVSVVCQQLGCPTSIKALGWANSSAGSGYIWMDKVSCTGNESALWDCKHDGWGKHNCTHEKDAGVTCSDGSNLEMRLVNSAGHRCLGRVEIKFQGKWGTVCDDNFSKDHASVICKQLGCGSAISFSG--SAKLGAGSGPIWLDDLACNGNESALWDCKHRGWGKHNCDHAEDVGVIC---------LEGADLSLRLVDGVSRCSG------RLEVRFQGEW--GTVCDDNWDLRDAS 300          

HSP 2 Score: 90.1225 bits (222), Expect = 9.407e-18
Identity = 63/190 (33.16%), Postives = 98/190 (51.58%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYLGYPGVRKSYSNP---GNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQDVA-----LAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGNA 2161
            VC + + K++  V C+ LG  G   S+S     G  +  + L  L CNGNE +  DC    +    C  A+ VGVIC + A     L  G +   GR+EV ++G+ G +CDDN+++   +V+C+QLG   A++A          G+G   LD I C G+E ++ +C  + W    C+  + AG+ CS  A
Sbjct:  182 VCDDNFSKDHASVICKQLGC-GSAISFSGSAKLGAGSGPIWLDDLACNGNESALWDCKHRGWGKHNCDHAEDVGVICLEGADLSLRLVDGVSRCSGRLEVRFQGEWGTVCDDNWDLRDASVVCKQLGCPTAISAIG--RVNASEGSGQIWLDNISCEGHEATLWECKHQEWGKHYCHHREDAGVTCSDGA 368          

HSP 3 Score: 75.8702 bits (185), Expect = 2.400e-13
Identity = 59/190 (31.05%), Postives = 87/190 (45.79%), Query Frame = 2
Query: 1604 YNNSY-MVCSNEYDKNNTDVYCRYLGYPGVRKSYSNPGNNTTYLPLV--SLKCNGNEQSPADCPVDRYAYCYTAKPVG----VICQD-VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVC 2149
            YN ++  + S+        V CR LG          P + T   P+    ++C     +   CP   +     A P      +IC + + L  G T   GRVE+++KG  G +CDD++++N   V+C+QLG G AV A       +G G G   L+ I C GNE S+ DCP K W    C   + A + C
Sbjct:  843 YNGTWGSIGSSNMSPTTVGVVCRQLGCADNGTVKPIPSDKTPSRPMWVDRVQCPKGVDTLWQCPSSPWKQ-RQASPSSQESWIICDNKIRLQEGHTDCSGRVEIWHKGSWGTVCDDSWDLNDAKVVCKQLGCGQAVKALK--EAAFGPGTGPIWLNEIKCRGNESSLWDCPAKPWSHSDCGHKEDASIQC 1029          

HSP 4 Score: 72.4034 bits (176), Expect = 2.525e-12
Identity = 60/217 (27.65%), Postives = 89/217 (41.01%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYLGYPGVRKSY---SNPGNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQ-----------------------------------DVALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCS 2152
            +CS+ +D  +  V C+ L   GV +S    ++ G     +      C G E+   DC +       C   +   VIC                                     + L GG     GRVEVY++G  G +CDDN+++   NV+C+QL  G A+NAT      +G G G   LD + C G E  I  C +  W   +C   + AG++CS
Sbjct:  606 LCSSHWDMEDAHVLCQQL-KCGVAQSIPEGAHFGKGAGQVWSHMFHCTGTEEHIGDCLMTALGAPTCSEGQVASVICSGNQSQTLLPCSSLSPVQTTSSTIPKESEVPCIASGQLRLVGGGGRCAGRVEVYHEGSWGTVCDDNWDMTDANVVCKQLDCGVAINATG--SAYFGEGAGAIWLDEVICTGKESHIWQCHSHGWGRHNCRHKEDAGVICS 819          

HSP 5 Score: 71.633 bits (174), Expect = 4.857e-12
Identity = 57/190 (30.00%), Postives = 86/190 (45.26%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYLGYPGVRKSYSNP--GNNTTYLPLVSLKCNGNEQSPADC----PVDRYAYCYTAKPVGVICQ---DVALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGNAS 2164
            VC  +       V CR L    V         G  +  +     +C+G+E   + C    P+DR   C  ++ V V+C    D+ LAGG ++ EGRVE+   G  G LC  ++++   +V+C+QL  G A +    A +  G G         +C G E+ IGDC        +C    VA ++CSGN S
Sbjct:  501 VCDFDLSLEAASVVCRELQCGTVVSILGGAHFGEGSGQIWGEEFQCSGDESHLSLCSVAPPLDRT--CTHSRDVSVVCSRYIDIRLAGGESSCEGRVELKTLGAWGPLCSSHWDMEDAHVLCQQLKCGVAQSIPEGAHFGKGAGQVWSH--MFHCTGTEEHIGDCLMTALGAPTCSEGQVASVICSGNQS 686          

HSP 6 Score: 69.707 bits (169), Expect = 1.972e-11
Identity = 53/193 (27.46%), Postives = 86/193 (44.56%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYLGYP----GVRKSYSNPGNNTTYLPLVSLKCNGNEQSPADCPVDRYA--YCYTAKPVGVICQDVA-----LAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIY---CYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGN 2158
            VC + +D  +  V C+ LG P     + +  ++ G+   +L  +S  C G+E +  +C    +   YC+  +  GV C D A     L GG +   G VEV  +   G +C   + +   +V+CRQLG G A+   +      G  N      +++   C GNE +   C    W   SC   + A + CSG+
Sbjct:  289 VCDDNWDLRDASVVCKQLGCPTAISAIGRVNASEGSGQIWLDNIS--CEGHEATLWECKHQEWGKHYCHHREDAGVTCSDGADLELRLVGGGSRCAGIVEVEIQKLTGKMCSRGWTLADADVVCRQLGCGSALQTQAKIYSKTGATNT-----WLFPGSCNGNETTFWQCKNWQWGGLSCDNFEEAKVTCSGH 474          

HSP 7 Score: 54.6842 bits (130), Expect = 8.044e-7
Identity = 34/109 (31.19%), Postives = 56/109 (51.38%), Query Frame = 2
Query: 1826 GVICQDVALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCS 2152
            G + +++ LAGG     GRVE+    K G +C + +++N  +V+C+QLG   ++ A          G+G   +D + C GNE ++ DC    W   +C     AG+ CS
Sbjct:   44 GEMKKELRLAGGENNCSGRVELKIHDKWGTVCSNGWSMNEVSVVCQQLGCPTSIKALG--WANSSAGSGYIWMDKVSCTGNESALWDCKHDGWGKHNCTHEKDAGVTCS 150          

HSP 8 Score: 54.299 bits (129), Expect = 1.011e-6
Identity = 42/132 (31.82%), Postives = 61/132 (46.21%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYLGYPGV----RKSYSNPGNNTTYLPLVSLKCNGNEQSPADCPVDRYA--YCYTAKPVGVIC---QDVALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVN 1990
            +CS  +   + DV CR LG         K YS  G   T+L   S  CNGNE +   C   ++    C   +   V C   ++  L GG     GRVEV +    G +CD + ++ A +V+CR+L  G  V+
Sbjct:  396 MCSRGWTLADADVVCRQLGCGSALQTQAKIYSKTGATNTWLFPGS--CNGNETTFWQCKNWQWGGLSCDNFEEAKVTCSGHREPRLVGGEIPCSGRVEVKHGDVWGSVCDFDLSLEAASVVCRELQCGTVVS 525          
BLAST of Serine protease 12 vs. Ensembl Mouse
Match: Cd163 (CD163 antigen [Source:MGI Symbol;Acc:MGI:2135946])

HSP 1 Score: 96.2857 bits (238), Expect = 1.317e-19
Identity = 75/246 (30.49%), Postives = 115/246 (46.75%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYLGYPGVRKS--YSNPGNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQDVALAGGRTANE------GRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGNASSCGQVSTMENNWKYSNGYNTTFGATPWQARLMPSSVNEWCSATIIDRNWLLTSAN 2329
            VCSN +  N   V C+ LG P   K+  ++N    + Y+ +  + C GNE +  DC  D +    C   K  GV C D +    R  N       GRVE+ ++GK G +CDDNF+ +  +VIC+QLG G A++ +       G G+G   LD + C GNE ++ DC  + W   +C   +  G++C         +   + + +  +G +   G      RL      EW   T+ D NW L  A+
Sbjct:   74 VCSNGWSMNEVSVVCQQLGCPTSIKALGWANSSAGSGYIWMDKVSCTGNESALWDCKHDGWGKHNCTHEKDAGVTCSDGSNLEMRLVNSAGHRCLGRVEIKFQGKWGTVCDDNFSKDHASVICKQLGCGSAISFSG--SAKLGAGSGPIWLDDLACNGNESALWDCKHRGWGKHNCDHAEDVGVIC---------LEGADLSLRLVDGVSRCSG------RLEVRFQGEW--GTVCDDNWDLRDAS 300          

HSP 2 Score: 89.7373 bits (221), Expect = 1.194e-17
Identity = 63/190 (33.16%), Postives = 98/190 (51.58%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYLGYPGVRKSYSNP---GNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQDVA-----LAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGNA 2161
            VC + + K++  V C+ LG  G   S+S     G  +  + L  L CNGNE +  DC    +    C  A+ VGVIC + A     L  G +   GR+EV ++G+ G +CDDN+++   +V+C+QLG   A++A          G+G   LD I C G+E ++ +C  + W    C+  + AG+ CS  A
Sbjct:  182 VCDDNFSKDHASVICKQLGC-GSAISFSGSAKLGAGSGPIWLDDLACNGNESALWDCKHRGWGKHNCDHAEDVGVICLEGADLSLRLVDGVSRCSGRLEVRFQGEWGTVCDDNWDLRDASVVCKQLGCPTAISAIG--RVNASEGSGQIWLDNISCEGHEATLWECKHQEWGKHYCHHREDAGVTCSDGA 368          

HSP 3 Score: 75.485 bits (184), Expect = 3.358e-13
Identity = 59/190 (31.05%), Postives = 87/190 (45.79%), Query Frame = 2
Query: 1604 YNNSY-MVCSNEYDKNNTDVYCRYLGYPGVRKSYSNPGNNTTYLPLV--SLKCNGNEQSPADCPVDRYAYCYTAKPVG----VICQD-VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVC 2149
            YN ++  + S+        V CR LG          P + T   P+    ++C     +   CP   +     A P      +IC + + L  G T   GRVE+++KG  G +CDD++++N   V+C+QLG G AV A       +G G G   L+ I C GNE S+ DCP K W    C   + A + C
Sbjct:  843 YNGTWGSIGSSNMSPTTVGVVCRQLGCADNGTVKPIPSDKTPSRPMWVDRVQCPKGVDTLWQCPSSPWKQ-RQASPSSQESWIICDNKIRLQEGHTDCSGRVEIWHKGSWGTVCDDSWDLNDAKVVCKQLGCGQAVKALK--EAAFGPGTGPIWLNEIKCRGNESSLWDCPAKPWSHSDCGHKEDASIQC 1029          

HSP 4 Score: 72.0182 bits (175), Expect = 3.087e-12
Identity = 60/217 (27.65%), Postives = 89/217 (41.01%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYLGYPGVRKSY---SNPGNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQ-----------------------------------DVALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCS 2152
            +CS+ +D  +  V C+ L   GV +S    ++ G     +      C G E+   DC +       C   +   VIC                                     + L GG     GRVEVY++G  G +CDDN+++   NV+C+QL  G A+NAT      +G G G   LD + C G E  I  C +  W   +C   + AG++CS
Sbjct:  606 LCSSHWDMEDAHVLCQQL-KCGVAQSIPEGAHFGKGAGQVWSHMFHCTGTEEHIGDCLMTALGAPTCSEGQVASVICSGNQSQTLLPCSSLSPVQTTSSTIPKESEVPCIASGQLRLVGGGGRCAGRVEVYHEGSWGTVCDDNWDMTDANVVCKQLDCGVAINATG--SAYFGEGAGAIWLDEVICTGKESHIWQCHSHGWGRHNCRHKEDAGVICS 819          

HSP 5 Score: 71.2478 bits (173), Expect = 6.575e-12
Identity = 57/190 (30.00%), Postives = 86/190 (45.26%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYLGYPGVRKSYSNP--GNNTTYLPLVSLKCNGNEQSPADC----PVDRYAYCYTAKPVGVICQ---DVALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGNAS 2164
            VC  +       V CR L    V         G  +  +     +C+G+E   + C    P+DR   C  ++ V V+C    D+ LAGG ++ EGRVE+   G  G LC  ++++   +V+C+QL  G A +    A +  G G         +C G E+ IGDC        +C    VA ++CSGN S
Sbjct:  501 VCDFDLSLEAASVVCRELQCGTVVSILGGAHFGEGSGQIWGEEFQCSGDESHLSLCSVAPPLDRT--CTHSRDVSVVCSRYIDIRLAGGESSCEGRVELKTLGAWGPLCSSHWDMEDAHVLCQQLKCGVAQSIPEGAHFGKGAGQVWSH--MFHCTGTEEHIGDCLMTALGAPTCSEGQVASVICSGNQS 686          

HSP 6 Score: 69.3218 bits (168), Expect = 2.582e-11
Identity = 53/193 (27.46%), Postives = 86/193 (44.56%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYLGYP----GVRKSYSNPGNNTTYLPLVSLKCNGNEQSPADCPVDRYA--YCYTAKPVGVICQDVA-----LAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIY---CYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGN 2158
            VC + +D  +  V C+ LG P     + +  ++ G+   +L  +S  C G+E +  +C    +   YC+  +  GV C D A     L GG +   G VEV  +   G +C   + +   +V+CRQLG G A+   +      G  N      +++   C GNE +   C    W   SC   + A + CSG+
Sbjct:  289 VCDDNWDLRDASVVCKQLGCPTAISAIGRVNASEGSGQIWLDNIS--CEGHEATLWECKHQEWGKHYCHHREDAGVTCSDGADLELRLVGGGSRCAGIVEVEIQKLTGKMCSRGWTLADADVVCRQLGCGSALQTQAKIYSKTGATNT-----WLFPGSCNGNETTFWQCKNWQWGGLSCDNFEEAKVTCSGH 474          

HSP 7 Score: 53.9138 bits (128), Expect = 1.093e-6
Identity = 34/109 (31.19%), Postives = 56/109 (51.38%), Query Frame = 2
Query: 1826 GVICQDVALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCS 2152
            G + +++ LAGG     GRVE+    K G +C + +++N  +V+C+QLG   ++ A          G+G   +D + C GNE ++ DC    W   +C     AG+ CS
Sbjct:   44 GEMKKELRLAGGENNCSGRVELKIHDKWGTVCSNGWSMNEVSVVCQQLGCPTSIKALG--WANSSAGSGYIWMDKVSCTGNESALWDCKHDGWGKHNCTHEKDAGVTCS 150          

HSP 8 Score: 53.9138 bits (128), Expect = 1.210e-6
Identity = 42/132 (31.82%), Postives = 61/132 (46.21%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYLGYPGV----RKSYSNPGNNTTYLPLVSLKCNGNEQSPADCPVDRYA--YCYTAKPVGVIC---QDVALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVN 1990
            +CS  +   + DV CR LG         K YS  G   T+L   S  CNGNE +   C   ++    C   +   V C   ++  L GG     GRVEV +    G +CD + ++ A +V+CR+L  G  V+
Sbjct:  396 MCSRGWTLADADVVCRQLGCGSALQTQAKIYSKTGATNTWLFPGS--CNGNETTFWQCKNWQWGGLSCDNFEEAKVTCSGHREPRLVGGEIPCSGRVEVKHGDVWGSVCDFDLSLEAASVVCRELQCGTVVS 525          
BLAST of Serine protease 12 vs. Ensembl Mouse
Match: 5830411N06Rik (RIKEN cDNA 5830411N06 gene [Source:MGI Symbol;Acc:MGI:2443685])

HSP 1 Score: 89.7373 bits (221), Expect = 1.189e-17
Identity = 58/184 (31.52%), Postives = 94/184 (51.09%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYLGYPGVRKSYSNP--GNNTTYLPLVSLKCNGNEQSPADCPVDR--YAYCYTAKPVGVICQ---DVALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCS 2152
            V  + +D  +  V CR LG    + +Y  P  G+ T  + L  + C G+E     C V      +  T +  GV+C     + LA G+    GRVEV+Y+G  G +CDD +++   +V+CRQLG G+A++A       +G G G   +D + C G E ++ +C +  W  + C   + AG++CS
Sbjct:  586 VLDSAWDLRDAAVVCRQLGCGEAQLAYDAPAPGHKTIPVGLSLVHCLGSETHLTQCNVSASLLVHAGTLRDAGVVCSGSLHIRLAAGKNRCAGRVEVFYQGTWGTVCDDAWDLQDAHVVCRQLGCGHALSAPR--AAHFGAGTGRIWMDELGCMGEEAALWECQSGGWGQQDCGHKEDAGVICS 767          

HSP 2 Score: 60.8474 bits (146), Expect = 8.949e-9
Identity = 59/240 (24.58%), Postives = 103/240 (42.92%), Query Frame = 2
Query: 1532 VKVQCHSNSTKYFLSPGYNQGYLTYNNSYMVCSNEYDKNNTDVYCRYLGYPGVRKSYSNPGNNTTY--LPLVSLKCNGNE-----QSPADCPVDRYAYCYTAKPVGVICQD-------------------------VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSG 2155
            V++Q HS        P   +  + YN ++       +  +  V C +LG     +  + P  ++T   + L S++C         Q P++ P +R++ C   +   + C +                         + + GG     GRVE+++ G  G +CDD++++    V+CRQLG G A+ A       +G G+G   LD + C G+E S+G C  + W    C   + AG+ C G
Sbjct:  772 VRLQEHSQ-------PCTGRLEVFYNGTWGGVCQSLNAASLRVLCEHLGCGSQGQLLARPRGSSTIETVWLKSIQCRDKHDMSLWQCPSE-PWNRHS-CLRGEEAWLACAEKTEVSQDMEQIANCSSTLSCPEEGALRVLGGENGCSGRVELWHGGSWGTVCDDSWDLADAEVVCRQLGCGPAIAALQ--NAAFGPGSGPVWLDEVGCRGSELSLGACQAEPWGYGDCSHKEDAGVRCLG 1000          

HSP 3 Score: 58.9214 bits (141), Expect = 3.392e-8
Identity = 54/183 (29.51%), Postives = 79/183 (43.17%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYLGYPGVRKSY---SNPGNNTTYLPLVSLKCNGNEQSPADCPVDRYAYCYTAKPVGVIC--QDVALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSG 2155
            VC ++ D     V CR LG  G   S    S+ G  +  L   + +C GNE     C  +    C   +   +IC  +   L  G +  EGRVE+  +     LC  N+++    V+C QL  GYAV   +  G  +G   G    D  +C G E  +  CPT     ++C   + A  +CSG
Sbjct:  378 VCHDDLDLPMAHVVCRELGC-GTAVSILGSSHFGYGSGPLWTEAFRCMGNESLLFHCLREPGHQCGHDQDAALICSGEKFRLVNGSSRCEGRVELLVQDAWQPLCAANWDLADATVLCHQLNCGYAV--ATPQGGHFGNVEGPIRTDVFHCVGTEPHLLSCPTSTLGAQACALGNSASALCSG 557          

HSP 4 Score: 55.8398 bits (133), Expect = 3.559e-7
Identity = 51/187 (27.27%), Postives = 73/187 (39.04%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYLG----YPGVRKSYSNPGNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQ---DVALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNED-SIGDCPTKYWETKSCYGNDVAGLVCS 2152
            VC + +D  +  V CR LG        R ++   G    ++    L C G E +  +C    +    C   +  GVIC    DV L        GR+EV+Y G  G +C  + N  +  V+C  LG G        A            L  I C    D S+  CP++ W   SC   + A L C+
Sbjct:  691 VCDDAWDLQDAHVVCRQLGCGHALSAPRAAHFGAGTGRIWMD--ELGCMGEEAALWECQSGGWGQQDCGHKEDAGVICSEFIDVRLQEHSQPCTGRLEVFYNGTWGGVCQ-SLNAASLRVLCEHLGCGS--QGQLLARPRGSSTIETVWLKSIQCRDKHDMSLWQCPSEPWNRHSCLRGEEAWLACA 872          
BLAST of Serine protease 12 vs. Ensembl Mouse
Match: 5830411N06Rik (RIKEN cDNA 5830411N06 gene [Source:MGI Symbol;Acc:MGI:2443685])

HSP 1 Score: 89.7373 bits (221), Expect = 1.349e-17
Identity = 58/184 (31.52%), Postives = 94/184 (51.09%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYLGYPGVRKSYSNP--GNNTTYLPLVSLKCNGNEQSPADCPVDR--YAYCYTAKPVGVICQ---DVALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCS 2152
            V  + +D  +  V CR LG    + +Y  P  G+ T  + L  + C G+E     C V      +  T +  GV+C     + LA G+    GRVEV+Y+G  G +CDD +++   +V+CRQLG G+A++A       +G G G   +D + C G E ++ +C +  W  + C   + AG++CS
Sbjct:  470 VLDSAWDLRDAAVVCRQLGCGEAQLAYDAPAPGHKTIPVGLSLVHCLGSETHLTQCNVSASLLVHAGTLRDAGVVCSGSLHIRLAAGKNRCAGRVEVFYQGTWGTVCDDAWDLQDAHVVCRQLGCGHALSAPR--AAHFGAGTGRIWMDELGCMGEEAALWECQSGGWGQQDCGHKEDAGVICS 651          

HSP 2 Score: 60.8474 bits (146), Expect = 9.834e-9
Identity = 59/240 (24.58%), Postives = 103/240 (42.92%), Query Frame = 2
Query: 1532 VKVQCHSNSTKYFLSPGYNQGYLTYNNSYMVCSNEYDKNNTDVYCRYLGYPGVRKSYSNPGNNTTY--LPLVSLKCNGNE-----QSPADCPVDRYAYCYTAKPVGVICQD-------------------------VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSG 2155
            V++Q HS        P   +  + YN ++       +  +  V C +LG     +  + P  ++T   + L S++C         Q P++ P +R++ C   +   + C +                         + + GG     GRVE+++ G  G +CDD++++    V+CRQLG G A+ A       +G G+G   LD + C G+E S+G C  + W    C   + AG+ C G
Sbjct:  656 VRLQEHSQ-------PCTGRLEVFYNGTWGGVCQSLNAASLRVLCEHLGCGSQGQLLARPRGSSTIETVWLKSIQCRDKHDMSLWQCPSE-PWNRHS-CLRGEEAWLACAEKTEVSQDMEQIANCSSTLSCPEEGALRVLGGENGCSGRVELWHGGSWGTVCDDSWDLADAEVVCRQLGCGPAIAALQ--NAAFGPGSGPVWLDEVGCRGSELSLGACQAEPWGYGDCSHKEDAGVRCLG 884          

HSP 3 Score: 58.5362 bits (140), Expect = 4.241e-8
Identity = 54/183 (29.51%), Postives = 79/183 (43.17%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYLGYPGVRKSY---SNPGNNTTYLPLVSLKCNGNEQSPADCPVDRYAYCYTAKPVGVIC--QDVALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSG 2155
            VC ++ D     V CR LG  G   S    S+ G  +  L   + +C GNE     C  +    C   +   +IC  +   L  G +  EGRVE+  +     LC  N+++    V+C QL  GYAV   +  G  +G   G    D  +C G E  +  CPT     ++C   + A  +CSG
Sbjct:  262 VCHDDLDLPMAHVVCRELGC-GTAVSILGSSHFGYGSGPLWTEAFRCMGNESLLFHCLREPGHQCGHDQDAALICSGEKFRLVNGSSRCEGRVELLVQDAWQPLCAANWDLADATVLCHQLNCGYAV--ATPQGGHFGNVEGPIRTDVFHCVGTEPHLLSCPTSTLGAQACALGNSASALCSG 441          

HSP 4 Score: 55.4546 bits (132), Expect = 4.423e-7
Identity = 51/187 (27.27%), Postives = 73/187 (39.04%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYLG----YPGVRKSYSNPGNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQ---DVALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNED-SIGDCPTKYWETKSCYGNDVAGLVCS 2152
            VC + +D  +  V CR LG        R ++   G    ++    L C G E +  +C    +    C   +  GVIC    DV L        GR+EV+Y G  G +C  + N  +  V+C  LG G        A            L  I C    D S+  CP++ W   SC   + A L C+
Sbjct:  575 VCDDAWDLQDAHVVCRQLGCGHALSAPRAAHFGAGTGRIWMD--ELGCMGEEAALWECQSGGWGQQDCGHKEDAGVICSEFIDVRLQEHSQPCTGRLEVFYNGTWGGVCQ-SLNAASLRVLCEHLGCGS--QGQLLARPRGSSTIETVWLKSIQCRDKHDMSLWQCPSEPWNRHSCLRGEEAWLACA 756          
BLAST of Serine protease 12 vs. UniProt
Match: sp|Q5G265|NETR_SAGLB (Neurotrypsin OS=Saguinus labiatus OX=78454 GN=PRSS12 PE=3 SV=1)

HSP 1 Score: 145.591 bits (366), Expect = 3.075e-34
Identity = 132/468 (28.21%), Postives = 205/468 (43.80%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYLGYP-GVRKSYSNPGNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQD------------VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVC-------SGN------ASSCGQVSTMENNWKYSNGYNTTFGATPWQARLMPSSVNE----WCSATIIDRNWLLTSANCFTMSYNNF--YVTVMSSRYYWDSSNFATTNSIQSVFIHPQYSTVTGDYNLALVKVNS-----IAFDANVQPLCLPA-GYIPVDGLS-CVTTGWNHGLNTYSRPLLGKPVLIQNSSYCKDHLQFDDTRMARYLCSDNNMDPSAY--FNGESGGPLTCSINGKN-VLXXXXXXXXXXXXXXXIRLYTRVDYWDSWIRNIMK 2893
            VC + + + NT V CR LG+  G + S ++   +   + L  + C+G E     C   ++    C   + VG+ C              V L  G    EGRVEV+  G+ G +CDD +      VICRQLGY     A +     +G G G   +D + C GNE S+ DC  +     +C  ++ AG++C       SGN      +S CG         +   G N+  G  PWQ  L   S +      C AT++   W+LT+A+CF    N+   Y   +   +      F     +Q + IH +Y   + DY++ALV++         F+++V P CLP     P    S C  TGW      YSR L    + +    +C++  ++      R LC+ N  +        G+SGGPL C   G++ V+ GV +         S  +YT+V  +  WI+++ K
Sbjct:  411 VCDDGWTELNTYVVCRQLGFKYGKQASANHFEESAGPIWLDDVSCSGKETRFLQCSRRQWGRHDCSHREDVGIACYPGSEGHRLSLGFPVRLMDGENKKEGRVEVFINGQWGTICDDGWTDKDAAVICRQLGYKGPARART--MAYFGEGKGPIHVDNVKCTGNERSLADCIKQDIGRHNCRHSEDAGVICDYFGKKASGNSNKESLSSVCGLRLLHRRQKRIIGGKNSLRGGWPWQVSLRLKSSHRDGRLLCGATLLSSCWVLTAAHCFKRYGNSTRNYAVRVGDYHTLVPEEFEEEIGVQEIVIHREYRPDSSDYDIALVRLQGPEEQCARFNSHVLPACLPLWRERPQKTASNCYITGWGDTGQAYSRTLQQAAIHLLPKRFCEE--RYKGRFTGRMLCAGNLHEHKHVDSCQGDSGGPLMCERPGESWVVYGVTSWGYGCGVKDSPGVYTKVSAFVPWIKSVTK 874          

HSP 2 Score: 92.0485 bits (227), Expect = 1.547e-17
Identity = 56/185 (30.27%), Postives = 88/185 (47.57%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYLGYPGVRKSYSNP--GNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQD-----VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVC 2149
            +C +++D  + +V CR L   G+ K++     G  +  + L  ++C GNE S   CP   +    C   +  GV C       + LAGG+ ++EGR+EVYY G+ G +CDD +      V+CRQLG+ Y   A++     +    G   LD + C G E     C  + W    C   +  G+ C
Sbjct:  304 ICDDQWDDADAEVICRQLSLSGIAKAWHQAYFGEGSGPVMLDEVRCTGNELSIEQCPKSSWGEHNCGHKEDAGVSCTPLTDGVIRLAGGKGSHEGRLEVYYSGQWGTVCDDGWTELNTYVVCRQLGFKYGKQASA---NHFEESAGPIWLDDVSCSGKETRFLQCSRRQWGRHDCSHREDVGIAC 485          

HSP 3 Score: 80.8777 bits (198), Expect = 3.924e-14
Identity = 57/189 (30.16%), Postives = 92/189 (48.68%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYLGYPGVRKSYSNPGNNTTYLPL--VSLKCNGNEQSPADCPVDRY--AYCYTAKPVGVICQ--------DVALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCS 2152
            VCS+ +D ++  V C  L   G   +   P +    +P+   +++C G+E++   C  D +    C       V+C          + L GG + +EGRVE+Y+ G+ G +CDD ++     VICRQL    +  A +     +G G+G  +LD + C GNE SI  CP   W   +C   + AG+ C+
Sbjct:  194 VCSSHWDDSDASVICHQLQLGGKGIAKQTPFSGLGLIPVYWSNVRCRGDEENILLCEKDIWQGGVCPQKMAAAVMCSFSHGPAFPIIRLVGGSSVHEGRVELYHAGQWGTICDDQWDDADAEVICRQL--SLSGIAKAWHQAYFGEGSGPVMLDEVRCTGNELSIEQCPKSSWGEHNCGHKEDAGVSCT 380          
BLAST of Serine protease 12 vs. UniProt
Match: sp|G3V801|NETR_RAT (Neurotrypsin OS=Rattus norvegicus OX=10116 GN=Prss12 PE=1 SV=1)

HSP 1 Score: 144.05 bits (362), Expect = 5.932e-34
Identity = 134/469 (28.57%), Postives = 204/469 (43.50%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYLGYP-GVRKSYSNPGNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQD------------VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVC-------SGN------ASSCGQVSTMENNWKYSNGYNTTFGATPWQARLMPSSVNE----WCSATIIDRNWLLTSANCFTMSYNN--FYVTVMSSRYYWDSSNFATTNSIQSVFIHPQYSTVTGDYNLALVKVNS-----IAFDANVQPLCLPA-GYIPVDGLS-CVTTGWNHGLNTYSRPLLGKPVLIQNSSYCKDHLQFDDTRMARYLCS-----DNNMDPSAYFNGESGGPLTCSINGKN-VLXXXXXXXXXXXXXXXIRLYTRVDYWDSWIRNI 2887
            VC + + + NT V CR LG+  G + S ++   ++  + L  + C+G E S   C   ++    C   + VG+ C              + L  G    EGRVEV+  G+ G +CDD +      VICRQLGY     A +     +G G G   +D + C GNE ++ DC  +     +C  ++ AG++C       SG+      +S CG         +   G N+  GA PWQA L   S +      C AT++   W+LT+A+CF    NN   Y   +   +      F     +Q + IH  Y   + DY++ALV++            +V P CLP     P    S C  TGW      YSR L    V +    +CK+  ++      R LC+     DN +D      G+SGGPL C    +  V+ GV +         +  +YTRV  +  WI+++
Sbjct:  297 VCDDGWTEMNTYVACRLLGFKYGKQSSVNHFEGSSRPIWLDDVSCSGKEASFIQCSRRQWGRHDCSHREDVGLTCYPDSDGHRLSPGFPIRLMDGENKREGRVEVFVSGQWGTICDDGWTDKHAAVICRQLGYKGPARART--MAYFGEGKGPIHMDNVKCTGNEKALADCVKQDIGRHNCRHSEDAGVICDYYEKKTSGHGNKETLSSGCGLRLLHRRQKRIIGGNNSLRGAWPWQASLRLKSTHGDGRLLCGATLLSSCWVLTAAHCFKRYGNNSRSYAVRVGDYHTLVPEEFEQEIGVQQIVIHRNYRPDSSDYDIALVRLQGSGEQCARLSTHVLPACLPLWRERPQKTASNCHITGWGDTGRAYSRTLQQAAVPLLPKRFCKE--RYKGLFTGRMLCAGNLQEDNRVDSC---QGDSGGPLMCEKPDETWVVYGVTSWGYGCGIKDTPGVYTRVPAFVPWIKSV 758          

HSP 2 Score: 90.8929 bits (224), Expect = 2.949e-17
Identity = 55/185 (29.73%), Postives = 88/185 (47.57%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYLGYPGVRKSYSNP--GNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQD-----VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVC 2149
            +C +++D  + +V CR LG  G+ K++     G  +  + L  ++C GNE S   CP   +    C   +  GV C       + L+GG++ +EGR+EVYY+G+ G +CDD +      V CR LG+ Y   ++      +   +    LD + C G E S   C  + W    C   +  GL C
Sbjct:  190 ICDDQWDDADAEVICRQLGLSGIAKAWHQAHFGEGSGPILLDEVRCTGNELSIEQCPKSSWGEHNCGHKEDAGVSCAPLTDGVIRLSGGKSVHEGRLEVYYRGQWGTVCDDGWTEMNTYVACRLLGFKYGKQSS---VNHFEGSSRPIWLDDVSCSGKEASFIQCSRRQWGRHDCSHREDVGLTC 371          

HSP 3 Score: 69.3218 bits (168), Expect = 1.258e-10
Identity = 41/103 (39.81%), Postives = 60/103 (58.25%), Query Frame = 2
Query: 1844 VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCS 2152
            + L GG++ +EGRVE+Y+ G+ G +CDD ++     VICRQL  G +  A +     +G G+G  LLD + C GNE SI  CP   W   +C   + AG+ C+
Sbjct:  166 IRLVGGKSGHEGRVELYHAGQWGTICDDQWDDADAEVICRQL--GLSGIAKAWHQAHFGEGSGPILLDEVRCTGNELSIEQCPKSSWGEHNCGHKEDAGVSCA 266          
BLAST of Serine protease 12 vs. UniProt
Match: sp|O08762|NETR_MOUSE (Neurotrypsin OS=Mus musculus OX=10090 GN=Prss12 PE=1 SV=1)

HSP 1 Score: 144.05 bits (362), Expect = 7.264e-34
Identity = 135/469 (28.78%), Postives = 203/469 (43.28%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYLGYP-GVRKSYSNPGNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQD------------VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVC---------SGN----ASSCGQVSTMENNWKYSNGYNTTFGATPWQARLMPSSVNE----WCSATIIDRNWLLTSANCFTMSYNN--FYVTVMSSRYYWDSSNFATTNSIQSVFIHPQYSTVTGDYNLALVKVNSIA-----FDANVQPLCLPA-GYIPVDGLS-CVTTGWNHGLNTYSRPLLGKPVLIQNSSYCKDHLQFDDTRMARYLCS-----DNNMDPSAYFNGESGGPLTCSINGKN-VLXXXXXXXXXXXXXXXIRLYTRVDYWDSWIRNI 2887
            VC + + + NT V CR LG+  G + S ++   +   + L  + C+G E S   C   ++    C   + VG+ C              + L  G    EGRVEV+  G+ G +CDD +      VICRQLGY     A +     +G G G   +D + C GNE ++ DC  +     +C  ++ AG++C         SGN    +S CG         +   G N+  GA PWQA L   S +      C AT++   W+LT+A+CF    NN   Y   +   +      F     +Q + IH  Y     DY++ALV++            +V P CLP     P    S C  TGW      YSR L    V +    +CK+  ++      R LC+     DN +D      G+SGGPL C    ++ V+ GV +         +  +YTRV  +  WI+++
Sbjct:  297 VCDDGWTEMNTYVACRLLGFKYGKQSSVNHFDGSNRPIWLDDVSCSGKEVSFIQCSRRQWGRHDCSHREDVGLTCYPDSDGHRLSPGFPIRLVDGENKKEGRVEVFVNGQWGTICDDGWTDKHAAVICRQLGYKGPARART--MAYFGEGKGPIHMDNVKCTGNEKALADCVKQDIGRHNCRHSEDAGVICDYLEKKASSSGNKEMLSSGCGLRLLHRRQKRIIGGNNSLRGAWPWQASLRLRSAHGDGRLLCGATLLSSCWVLTAAHCFKRYGNNSRSYAVRVGDYHTLVPEEFEQEIGVQQIVIHRNYRPDRSDYDIALVRLQGPGEQCARLSTHVLPACLPLWRERPQKTASNCHITGWGDTGRAYSRTLQQAAVPLLPKRFCKE--RYKGLFTGRMLCAGNLQEDNRVDSC---QGDSGGPLMCEKPDESWVVYGVTSWGYGCGVKDTPGVYTRVPAFVPWIKSV 758          

HSP 2 Score: 92.4337 bits (228), Expect = 9.904e-18
Identity = 59/185 (31.89%), Postives = 88/185 (47.57%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYLGYPGVRKSYSNP--GNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQD-----VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVC 2149
            +C +++D  + DV CR LG  G+ K++     G  +  + L  ++C GNE S   CP   +    C   +  GV C       + LAGG++ +EGR+EVYYKG+ G +CDD +      V CR LG+ Y   ++      +   N    LD + C G E S   C  + W    C   +  GL C
Sbjct:  190 ICDDQWDNADADVICRQLGLSGIAKAWHQAHFGEGSGPILLDEVRCTGNELSIEQCPKSSWGEHNCGHKEDAGVSCVPLTDGVIRLAGGKSTHEGRLEVYYKGQWGTVCDDGWTEMNTYVACRLLGFKYGKQSS---VNHFDGSNRPIWLDDVSCSGKEVSFIQCSRRQWGRHDCSHREDVGLTC 371          

HSP 3 Score: 67.3958 bits (163), Expect = 5.515e-10
Identity = 41/102 (40.20%), Postives = 59/102 (57.84%), Query Frame = 2
Query: 1844 VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVC 2149
            + L GG + +EGRVE+Y+ G+ G +CDD ++    +VICRQL  G +  A +     +G G+G  LLD + C GNE SI  CP   W   +C   + AG+ C
Sbjct:  166 IRLVGGNSGHEGRVELYHAGQWGTICDDQWDNADADVICRQL--GLSGIAKAWHQAHFGEGSGPILLDEVRCTGNELSIEQCPKSSWGEHNCGHKEDAGVSC 265          
BLAST of Serine protease 12 vs. UniProt
Match: sp|Q5G268|NETR_NOMLE (Neurotrypsin OS=Nomascus leucogenys OX=61853 GN=PRSS12 PE=3 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 1.305e-33
Identity = 132/468 (28.21%), Postives = 204/468 (43.59%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYLGYP-GVRKSYSNPGNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQD------------VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVC-------SGN------ASSCGQVSTMENNWKYSNGYNTTFGATPWQARLMPSSVNE----WCSATIIDRNWLLTSANCFTMSYNNF--YVTVMSSRYYWDSSNFATTNSIQSVFIHPQYSTVTGDYNLALVKVNS-----IAFDANVQPLCLPA-GYIPVDGLS-CVTTGWNHGLNTYSRPLLGKPVLIQNSSYCKDHLQFDDTRMARYLCSDNNMDPSAY--FNGESGGPLTCSINGKN-VLXXXXXXXXXXXXXXXIRLYTRVDYWDSWIRNIMK 2893
            VC + + + NT V CR LG+  G + S ++   +T  + L  + C+G E     C   ++    C   + V + C              V L  G    EGRVEV+  G+ G +CDD +      VICRQLGY     A +     +G G G   +D + C GNE S+ DC  +     +C  ++ AG++C       SGN      +S CG         +   G N+  G  PWQ  L   S +      C AT++   W+LT+A+CF    N+   Y   +   +      F     +Q + IH +Y   + DY++ALV++         F ++V P CLP     P    S C  TGW      YSR L    + +    +C++  ++      R LC+ N  +        G+SGGPL C   G++ V+ GV +         S  +YT+V  +  WI+++ K
Sbjct:  411 VCDDGWTELNTYVVCRQLGFKYGKQASANHFEESTGPIWLDDVSCSGKETRFLQCSRRQWGRHDCSHREDVSIACYPGGEGHRLSLGFPVRLMDGENKKEGRVEVFINGQWGTICDDGWTDKDAAVICRQLGYKGPARART--MAYFGEGKGPIHVDNVKCTGNERSLADCIKQDIGRHNCRHSEDAGVICDYFGKKASGNSNKESLSSVCGLRLLHRRQKRIIGGKNSLRGGWPWQVSLRLKSSHGDGRLLCGATLLSSCWVLTAAHCFKRYGNSTRNYAVRVGDYHTLVPEEFEEEIGVQQIVIHREYRPDSSDYDIALVRLQGPEEQCARFSSHVLPACLPLWRERPQKTASNCYITGWGDTGRAYSRTLQQAAIPLLPKRFCEE--RYKGRFTGRMLCAGNLHEHKRVDSCQGDSGGPLMCERPGESWVVYGVTSWGHGCGVKDSPGVYTKVSAFVPWIKSVTK 874          

HSP 2 Score: 93.2041 bits (230), Expect = 6.138e-18
Identity = 57/185 (30.81%), Postives = 89/185 (48.11%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYLGYPGVRKSYSNP--GNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQD-----VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVC 2149
            VC +++D  + +V CR LG  G+ K++     G  +  + L  ++C GNE S   CP   +    C   +  GV C       + LAGG+ ++EGR+EVYY+G+ G +CDD +      V+CRQLG+ Y   A++     +    G   LD + C G E     C  + W    C   +   + C
Sbjct:  304 VCDDQWDDADAEVICRQLGLSGIAKAWHQAYFGEGSGPVMLDEVRCTGNELSIEQCPKSSWGEHNCGHKEDAGVSCTPLTDGVIRLAGGKGSHEGRLEVYYRGQWGTVCDDGWTELNTYVVCRQLGFKYGKQASA---NHFEESTGPIWLDDVSCSGKETRFLQCSRRQWGRHDCSHREDVSIAC 485          

HSP 3 Score: 82.4185 bits (202), Expect = 1.469e-14
Identity = 58/189 (30.69%), Postives = 92/189 (48.68%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYLGYPGVRKSYSNPGNNTTYLPL--VSLKCNGNEQSPADCPVDRY--AYCYTAKPVGVICQ--------DVALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCS 2152
            VCS+ +D ++  V C  L   G   +   P +    +P+   +++C G+E++   C  D +    C       V C          + L GG + +EGRVE+Y+ G+ G +CDD ++     VICRQL  G +  A +     +G G+G  +LD + C GNE SI  CP   W   +C   + AG+ C+
Sbjct:  194 VCSSHWDDSDASVICHQLQLGGKGIAKQTPFSGLGLIPIYWSNVRCRGDEENILLCEKDIWQGGVCPQKMAAAVTCSFSHGPTFPIIRLVGGSSVHEGRVELYHAGQWGTVCDDQWDDADAEVICRQL--GLSGIAKAWHQAYFGEGSGPVMLDEVRCTGNELSIEQCPKSSWGEHNCGHKEDAGVSCT 380          
BLAST of Serine protease 12 vs. UniProt
Match: sp|Q5G269|NETR_PONPY (Neurotrypsin OS=Pongo pygmaeus OX=9600 GN=PRSS12 PE=3 SV=1)

HSP 1 Score: 143.28 bits (360), Expect = 1.874e-33
Identity = 132/468 (28.21%), Postives = 204/468 (43.59%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYLGYP-GVRKSYSNPGNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQD------------VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVC-------SGN------ASSCGQVSTMENNWKYSNGYNTTFGATPWQARLMPSSVNE----WCSATIIDRNWLLTSANCFTMSYNNF--YVTVMSSRYYWDSSNFATTNSIQSVFIHPQYSTVTGDYNLALVKVNS-----IAFDANVQPLCLPA-GYIPVDGLS-CVTTGWNHGLNTYSRPLLGKPVLIQNSSYCKDHLQFDDTRMARYLCSDNNMDPSAY--FNGESGGPLTCSINGKN-VLXXXXXXXXXXXXXXXIRLYTRVDYWDSWIRNIMK 2893
            VC + + + NT V CR LG+  G + S ++   +T  + L  + C+G E     C   ++    C   + V + C              V L  G    EGRVEV+  G+ G +CDD +      VICRQLGY     A +     +G G G   +D + C GNE S+ DC  +     +C  ++ AG++C       SGN      +S CG         +   G N+  G  PWQ  L   S +      C AT++   W+LT+A+CF    N+   Y   +   +      F     +Q + IH +Y   + DY++ALV++         F ++V P CLP     P    S C  TGW      YSR L    + +    +C++  ++      R LC+ N  +        G+SGGPL C   G++ V+ GV +         S  +YT+V  +  WI+++ K
Sbjct:  413 VCDDGWTELNTYVVCRQLGFKFGKQASANHFEESTGPIWLDDVSCSGKETRFLQCSRRQWGRHDCSHREDVSIACYPGGEGHRLSLGFPVRLMDGENKKEGRVEVFINGQWGTICDDGWTDKDAAVICRQLGYKGPARART--MAYFGEGKGPIHVDNVRCTGNERSLADCIKQDIGRHNCRHSEDAGVICDYFGKKASGNSNKESLSSVCGLRLLHRRQKRIIGGKNSLRGGWPWQVSLRLKSSHGDGRLLCGATLLSSCWVLTAAHCFKRYGNSTRNYAVRVGDYHTLVPEEFEEEVGVQQIVIHREYRPDSSDYDIALVRLQGPEEQCARFSSHVLPACLPLWRERPQKTASNCYITGWGDTGRAYSRTLQQAAIPLLPKRFCEE--RYKGXFTGRMLCAGNLHEHKRVDSCQGDSGGPLMCERPGESWVVYGVTSWGYGCGVKDSPGVYTKVSAFVPWIKSVTK 876          

HSP 2 Score: 89.7373 bits (221), Expect = 6.808e-17
Identity = 55/185 (29.73%), Postives = 88/185 (47.57%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYLGYPGVRKSYSNP--GNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQD-----VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVC 2149
            VC +++D  + +V CR L   G+ K++     G  +  + L  ++C GNE S   CP   +    C   +  GV C       + LAGG+ ++EGR+EVYY+G+ G +CDD +      V+CRQLG+ +   A++     +    G   LD + C G E     C  + W    C   +   + C
Sbjct:  306 VCDDQWDDADAEVICRQLSLSGIAKAWHQAYFGEGSGPVMLDEVRCTGNELSIEQCPKSSWGEHNCGHKEDAGVSCTPLTDGVIRLAGGKGSHEGRLEVYYRGQWGTVCDDGWTELNTYVVCRQLGFKFGKQASA---NHFEESTGPIWLDDVSCSGKETRFLQCSRRQWGRHDCSHREDVSIAC 487          

HSP 3 Score: 79.7221 bits (195), Expect = 8.119e-14
Identity = 57/189 (30.16%), Postives = 91/189 (48.15%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYLGYPGVRKSYSNPGNNTTYLPL--VSLKCNGNEQSPADCPVDRY--AYCYTAKPVGVICQ--------DVALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCS 2152
            VCS+ +D ++  V C  L   G   +   P +    +P+   +++C G+E++   C  D +    C       V C          + L GG + +EGRVE+Y+ G+ G +CDD ++     VICRQL    +  A +     +G G+G  +LD + C GNE SI  CP   W   +C   + AG+ C+
Sbjct:  196 VCSSHWDDSDASVICHQLQLGGKGIAKQTPFSGLGLIPIYWSNVRCQGDEENILLCEKDIWQGGVCPQKMAAAVTCSFSHGPTFPIIRLVGGSSVHEGRVELYHAGQWGTVCDDQWDDADAEVICRQL--SLSGIAKAWHQAYFGEGSGPVMLDEVRCTGNELSIEQCPKSSWGEHNCGHKEDAGVSCT 382          
BLAST of Serine protease 12 vs. TrEMBL
Match: gnl|BL_ORD_ID|172573327 (tr|A0A3P9H0I4|A0A3P9H0I4_ORYLA Serine protease 12 OS=Oryzias latipes OX=8090 PE=3 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 2.967e-40
Identity = 187/723 (25.86%), Postives = 288/723 (39.83%), Query Frame = 2
Query:  941 YPTFDCRGSESRLTQCAE--LDGKKLHYEKYYYTSPNVTNVTCSENFNMQLVGGDNRS-GVVQLNLGGGFSYICADNMDPSAADAICMEMGFQGSLYYEGYMGNTNASNYYSSFSGDYYRYHYDTIMTNIRCNSNT-KLRNCKXXXXXXXXXXXXXXXXXXXXXXXXXXQASGTNSFHXXXXXXXXXXXXXXXXXXXXXGAVKVQCH---SNSTKYFLSPGYNQGYLT--YNNSY-MVCSNEYDKNNTDVYCRYLGY-PGVRKSYSNP--------GNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQ------------DVALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVC-------------SGNASSCGQVSTMENNWKYSNGYNTTFGATPWQA--RLMPSSVNEW--CSATIIDRNWLLTSANCFTMSYNN--FYVTVMSSRYYWDSSNFATTNSIQSVFIHPQYSTVTGDYNLALVKVNS----------IAFDANVQPLCLPA--GYIPVDGLSCVTTGWNHGLNTYSRPLLGKPVLIQNSSYCKDHLQFDDTRMARYLC-----SDNNMDPSAYFNGESGGPLTCSINGKN-VLXXXXXXXXXXXXXXXIRLYTRVDYWDSWIRNIMKNN 2899
            +    CRG E  L  C++   +G++             T VT      M+L+GG++ S G V++   G +  IC D  D S A+ +C ++G  G+    G         ++   SG  +       +  +RC  N   L  C    +  +                        N  H+                        V CH     +T+     G ++G L   Y   +  VC + + K+N+ V CR LGY  G       P        G  +  + L  + C G E S   C    +    C   + V + C              V LAGG ++ EGRVE+Y  G+ G +CDD +      V+CRQLGY  A  A +     +G G G   +D + C G+E SI DC  +   T +C  ++ AG++C                 S CG         +   G N+  G  PWQA  RL  S  +    C AT+ID  W+LTSA+CF    N+   Y   +   +      +     +  +  HP+Y + + DY+LALV ++           ++F  +V P+CLPA    +     +C  TGW     +YS+ L   P+ +    +C+ +  F     +R LC     SD  +D      G+SGGPL C   G   V+ GV +   A     S  +YT+V  +  WIR I++ +
Sbjct:  177 WKEVHCRGEEPDLLHCSKSTWNGEECLTAAAVTCIQQKTVVT----LPMRLIGGESESEGTVEVFHAGQWGSICDDQWDDSDAEVVCRQLGLSGAAKAWGQA-------HFGKSSGRVW-------LDEVRCTGNELSLEQCTKSAWGEH------------------------NCLHSED--------------------AGVSCHPLTDGATRLVGGAGSHEGRLEIFYQGQWGTVCDDGWTKSNSQVVCRQLGYRTGETLLLEGPDIPPGPRFGVGSGPILLDDVNCTGKEPSLLLCSRREWLCHDCSHQEDVHIACNPEINGESLPASLRVRLAGGESSREGRVELYLFGQWGTVCDDGWTDQDAEVVCRQLGYSGA--AKARLMAYFGEGTGPIHMDNVNCIGDERSIADCIKQMPGTHNCRHSEDAGVICDYGEPQHSTKEAKDPAISLCGLRLVHTRQRRIIGGENSLRGGWPWQAAIRLRGSKGDGRLVCGATLIDTCWVLTSAHCFKRYGNSTKLYKVRVGDYHSLVPEEYEEEYGVDKIVFHPRYHSHSNDYDLALVHLSPGAVRQTAGECVSFSRHVLPVCLPARKERLLKQASNCHITGWGDTGRSYSKTLQQAPLSLLPRRHCQQY--FHSAFTSRMLCAGSVQSDRRVDSC---RGDSGGPLVCERPGGGWVIYGVTSWGHACRTQQSPGVYTKVSAFSFWIRKIIRRD 830          

HSP 2 Score: 77.411 bits (189), Expect = 1.233e-10
Identity = 57/186 (30.65%), Postives = 85/186 (45.70%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYL--GYPGVRKSYSNPGNNTTYLPLVSLKCNGNEQSPADCPVDRY--AYCYTAKPVGVICQD------VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVC 2149
            VCSN++   +  V CR L  G  G  ++      + T +    + C G E     C    +    C TA  V  I Q       + L GG + +EG VEV++ G+ G +CDD ++ +   V+CRQLG   A  A       +G  +G   LD + C GNE S+  C    W   +C  ++ AG+ C
Sbjct:  137 VCSNDWGDEDAAVVCRQLDEGISGRARAVPLFRTSKTRIHWKEVHCRGEEPDLLHCSKSTWNGEECLTAAAVTCIQQKTVVTLPMRLIGGESESEGTVEVFHAGQWGSICDDQWDDSDAEVVCRQLGLSGAAKAWG--QAHFGKSSGRVWLDEVRCTGNELSLEQCTKSAWGEHNCLHSEDAGVSC 320          
BLAST of Serine protease 12 vs. TrEMBL
Match: gnl|BL_ORD_ID|172572255 (tr|A0A3P9LJR1|A0A3P9LJR1_ORYLA Serine protease 12 OS=Oryzias latipes OX=8090 PE=3 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 8.248e-40
Identity = 187/723 (25.86%), Postives = 287/723 (39.70%), Query Frame = 2
Query:  941 YPTFDCRGSESRLTQCAE--LDGKKLHYEKYYYTSPNVTNVTCSENFNMQLVGGDNRS-GVVQLNLGGGFSYICADNMDPSAADAICMEMGFQGSLYYEGYMGNTNASNYYSSFSGDYYRYHYDTIMTNIRCNSNT-KLRNCKXXXXXXXXXXXXXXXXXXXXXXXXXXQASGTNSFHXXXXXXXXXXXXXXXXXXXXXGAVKVQCH---SNSTKYFLSPGYNQGYLT--YNNSY-MVCSNEYDKNNTDVYCRYLGY-PGVRKSYSNP--------GNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQ------------DVALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVC-------------SGNASSCGQVSTMENNWKYSNGYNTTFGATPWQA--RLMPSSVNEW--CSATIIDRNWLLTSANCFTMSYNN--FYVTVMSSRYYWDSSNFATTNSIQSVFIHPQYSTVTGDYNLALVKVNS----------IAFDANVQPLCLPA--GYIPVDGLSCVTTGWNHGLNTYSRPLLGKPVLIQNSSYCKDHLQFDDTRMARYLC-----SDNNMDPSAYFNGESGGPLTCSINGKN-VLXXXXXXXXXXXXXXXIRLYTRVDYWDSWIRNIMKNN 2899
            +    CRG E  L  C++   +G++             T VT      M+L+GG++ S G V++   G +  IC D  D S A+ +C ++G  G+    G         ++   SG  +       +  +RC  N   L  C    +  +                        N  H+                        V CH     +T+     G ++G L   Y   +  VC + + K+N+ V CR LGY  G       P        G  +  + L  + C G E S   C    +    C   + V + C              V LAGG ++ EGRVE+Y  G+ G +CDD +      V+CRQLGY  A  A +     +G G G   +D + C G+E SI DC  +   T +C  ++ AG++C                 S CG         +   G N+  G  PWQA  RL  S  +    C AT+ID  W+LTSA+CF    N+   Y   +   +      +     +  +  HP+Y + + DY+LALV ++           ++F  +V P+CLPA    +     +C  TGW     +YS+ L   P+ +     C+ +  F     +R LC     SD  +D      G+SGGPL C   G   V+ GV +   A     S  +YT+V  +  WIR I++ +
Sbjct:  177 WKEVHCRGEEPDLLHCSKSTWNGEECLTAAAVTCIQQKTVVT----LPMRLIGGESESEGTVEVFHAGQWGSICDDQWDDSDAEVVCRQLGLSGAAKAWGQA-------HFGKSSGRVW-------LDEVRCTGNELSLEQCTKSAWGEH------------------------NCLHSED--------------------AGVSCHPLTDGATRLVGGAGSHEGRLEIFYQGQWGTVCDDGWTKSNSQVVCRQLGYRTGETLLLEGPDILPGPRFGVGSGPILLDDVNCTGKEPSLLLCSRREWLCHDCSHQEDVHIACNPEINGESLPASLRVRLAGGESSREGRVELYLFGQWGTVCDDGWTDQDAEVVCRQLGYSGA--AKARLMAYFGEGTGPIHMDNVNCIGDEHSIADCIKQMPGTHNCRHSEDAGVICDYGEPEHSTKEAKDPAISLCGLRLVHTRQRRIIGGENSLRGGWPWQAAIRLRGSKGDGRLVCGATLIDTCWVLTSAHCFKRYGNSTKLYKVRVGDYHSLVPEEYEEEYGVDKIVFHPRYHSHSNDYDLALVHLSPGAVRQTAGECVSFSRHVLPVCLPARKERLLKQASNCHITGWGDTGRSYSKTLQQAPLSLLPRRLCQQY--FHSAFTSRMLCAGSVQSDRRVDSC---RGDSGGPLVCERPGGGWVIYGVTSWGHACRTQQSPGVYTKVSAFSFWIRKIIRRD 830          

HSP 2 Score: 77.411 bits (189), Expect = 1.378e-10
Identity = 57/186 (30.65%), Postives = 85/186 (45.70%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYL--GYPGVRKSYSNPGNNTTYLPLVSLKCNGNEQSPADCPVDRY--AYCYTAKPVGVICQD------VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVC 2149
            VCSN++   +  V CR L  G  G  ++      + T +    + C G E     C    +    C TA  V  I Q       + L GG + +EG VEV++ G+ G +CDD ++ +   V+CRQLG   A  A       +G  +G   LD + C GNE S+  C    W   +C  ++ AG+ C
Sbjct:  137 VCSNDWGDEDAAVVCRQLDEGISGRARAVPLFRTSKTRIHWKEVHCRGEEPDLLHCSKSTWNGEECLTAAAVTCIQQKTVVTLPMRLIGGESESEGTVEVFHAGQWGSICDDQWDDSDAEVVCRQLGLSGAAKAWG--QAHFGKSSGRVWLDEVRCTGNELSLEQCTKSAWGEHNCLHSEDAGVSC 320          
BLAST of Serine protease 12 vs. TrEMBL
Match: gnl|BL_ORD_ID|28439542 (tr|A0A2K6GL16|A0A2K6GL16_PROCO Serine protease 12 OS=Propithecus coquereli OX=379532 GN=PRSS12 PE=3 SV=1)

HSP 1 Score: 169.474 bits (428), Expect = 1.038e-39
Identity = 134/460 (29.13%), Postives = 208/460 (45.22%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYLGYPGVRKSYSNP--GNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQD-----VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVC----SGNASSCGQVSTM-------ENNWKYSNGYNTTFGATPWQARLMPSSVNE----WCSATIIDRNWLLTSANCFTMSYNNF--YVTVMSSRYYWDSSNFATTNSIQSVFIHPQYSTVTGDYNLALVKVNS-----IAFDANVQPLCLPAGY-IPVDGLS-CVTTGWNHGLNTYSRPLLGKPVLIQNSSYCKDHLQFDDTRMARYLCSDNNMDPSAY--FNGESGGPLTCSINGKN-VLXXXXXXXXXXXXXXXIRLYTRVDYWDSWIRNIMK 2893
            VC +++D  + +V CR LG  G+ K++S    G  +  + L  ++C GNE S   CP   +    C   +  GV C       + LAGG+ ++EGR+EVYY+G+ G +CDD +      V+CRQLG+ Y   A++     +    G   LD + C G E S   C  K W    C   +  G+ C     G+  S G +S++           +   G N+  G  PWQ  L   S +      C AT++   W+LT+A+CF    N+   Y   +   +      F     IQ + IH +Y   + DY++ALV++         F ++V P CLP     P    S C  TGW      YSR L    + +    +C++  ++      R LC+ N  +        G+SGGPL C   G + V+ GV +         S  +YT+V  +  WI+++ K
Sbjct:  284 VCDDQWDDADAEVICRQLGLSGIAKAWSQAYFGEGSGPVVLDEVRCTGNELSIEQCPKSSWGEHNCGHKEDAGVSCTPLTDGAIRLAGGKGSHEGRLEVYYRGQWGTVCDDGWTELNTYVVCRQLGFKYGKQASA---NHFQESAGPIWLDDVSCSGKETSFLQCSRKQWGRHDCSHREDVGVACYPSSDGHRLSLGPLSSVCGLRLLHRRQKRIIGGKNSLRGGWPWQVSLRLKSAHGDGRLLCGATLLSSCWVLTAAHCFKRYGNSTKNYAVRVGDYHTLVPEEFEEEIGIQQIVIHREYRPDSSDYDIALVRLQGPEEHCARFSSHVLPACLPLRRERPQKTASNCYITGWGDTGQAYSRTLQQAAIPLLPKRFCEE--RYKGRFTGRMLCAGNLHEHRRVDSCQGDSGGPLMCERPGASWVVYGVTSWGHGCGVKDSPGVYTKVSAFVPWIKSVTK 738          

HSP 2 Score: 82.8037 bits (203), Expect = 2.990e-12
Identity = 61/189 (32.28%), Postives = 89/189 (47.09%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYLGYPGVRKSYSNPGNNTTYLPL--VSLKCNGNEQSPADCPVDRY--AYCYTAKPVGVICQ--------DVALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCS 2152
            VC + +D ++  V CR L   G   +   P +    +P+   ++ C G+E++   C  D +    C       V C          V LAGG +  EGRVE+Y  G+ G +CDD ++     VICRQLG      A S     +G G+G  +LD + C GNE SI  CP   W   +C   + AG+ C+
Sbjct:  174 VCGSHWDDSDASVICRQLQLGGKGIAKQTPFSGLGLIPIYWSNVHCRGDEENILLCEKDIWQGGVCPRKMVAAVTCSFSHGPAFPAVRLAGGSSPREGRVELYRAGQWGTVCDDQWDDADAEVICRQLGLSGIAKAWS--QAYFGEGSGPVVLDEVRCTGNELSIEQCPKSSWGEHNCGHKEDAGVSCT 360          
BLAST of Serine protease 12 vs. TrEMBL
Match: gnl|BL_ORD_ID|172567257 (tr|A0A3B3HNE2|A0A3B3HNE2_ORYLA Serine protease 12 OS=Oryzias latipes OX=8090 GN=prss12 PE=3 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 2.937e-39
Identity = 186/723 (25.73%), Postives = 287/723 (39.70%), Query Frame = 2
Query:  941 YPTFDCRGSESRLTQCAE--LDGKKLHYEKYYYTSPNVTNVTCSENFNMQLVGGDNRS-GVVQLNLGGGFSYICADNMDPSAADAICMEMGFQGSLYYEGYMGNTNASNYYSSFSGDYYRYHYDTIMTNIRCNSNT-KLRNCKXXXXXXXXXXXXXXXXXXXXXXXXXXQASGTNSFHXXXXXXXXXXXXXXXXXXXXXGAVKVQCH---SNSTKYFLSPGYNQGYLT--YNNSY-MVCSNEYDKNNTDVYCRYLGY-PGVRKSYSNP--------GNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQ------------DVALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVC-------------SGNASSCGQVSTMENNWKYSNGYNTTFGATPWQA--RLMPSSVNEW--CSATIIDRNWLLTSANCFTMSYNN--FYVTVMSSRYYWDSSNFATTNSIQSVFIHPQYSTVTGDYNLALVKVNS----------IAFDANVQPLCLPA--GYIPVDGLSCVTTGWNHGLNTYSRPLLGKPVLIQNSSYCKDHLQFDDTRMARYLC-----SDNNMDPSAYFNGESGGPLTCSINGKN-VLXXXXXXXXXXXXXXXIRLYTRVDYWDSWIRNIMKNN 2899
            +    CRG E  L  C++   +G++             T VT      M+L+GG++ S G V++   G +  IC D  D S A+ +C ++G  G+    G         ++   SG  +       +  +RC  N   L  C    +  +                        N  H+                        V CH     +T+     G ++G L   Y   +  VC + + K+N+ V CR LGY  G       P        G  +  + L  + C G E S   C    +    C   + V + C              V LAGG ++ EGRVE+Y  G+ G +CDD +      V+CRQLGY  A  A +     +G G G   +D + C G+E SI DC  +   T +C  ++ AG++C                 S CG         +   G N+  G  PWQA  RL  S  +    C AT+ID  W+LTSA+CF    N+   Y   +   +      +     +  +  HP+Y + + DY+LALV ++           ++F  +V P+CLPA    +     +C  TGW     +YS+ L   P+ +     C+ +  +     +R LC     SD  +D      G+SGGPL C   G   V+ GV +   A     S  +YT+V  +  WIR I++ +
Sbjct:  177 WKEVHCRGEEPDLLHCSKSTWNGEECLTAAAVTCIQQKTVVT----LPMRLIGGESESEGTVEVFHAGQWGSICDDQWDDSDAEVVCRQLGLSGAAKAWGQA-------HFGKSSGRVW-------LDEVRCTGNELSLEQCTKSAWGEH------------------------NCLHSED--------------------AGVSCHPLTDGATRLVGGAGSHEGRLEIFYQGQWGTVCDDGWTKSNSQVVCRQLGYRTGETLLLEGPDIPPGPRFGVGSGPILLDDVNCTGKEPSLLLCSRREWLCHDCSHQEDVHIACNPEINGESLPASLRVRLAGGESSREGRVELYLFGQWGTVCDDGWTDQDAEVVCRQLGYSGA--AKARLMAYFGEGTGPIHMDNVNCIGDERSIADCIKQMPGTHNCRHSEDAGVICDYGEPQHSTKEAKDPAISLCGLRLVHTRQRRIIGGENSLRGGWPWQAAIRLRGSKGDGRLVCGATLIDTCWVLTSAHCFKRYGNSTKLYKVRVGDYHSLVPEEYEEEYGVDKIVFHPRYHSHSNDYDLALVHLSPGAVRQTAGECVSFSRHVLPVCLPARKERLLKQASNCHITGWGDTGRSYSKTLQQAPLSLLPRRLCQQY--YHSAFTSRMLCAGSVQSDRRVDSC---RGDSGGPLVCERPGGGWVIYGVTSWGHACRTQQSPGVYTKVSAFSFWIRKIIRRD 830          

HSP 2 Score: 77.411 bits (189), Expect = 1.402e-10
Identity = 57/186 (30.65%), Postives = 85/186 (45.70%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYL--GYPGVRKSYSNPGNNTTYLPLVSLKCNGNEQSPADCPVDRY--AYCYTAKPVGVICQD------VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVC 2149
            VCSN++   +  V CR L  G  G  ++      + T +    + C G E     C    +    C TA  V  I Q       + L GG + +EG VEV++ G+ G +CDD ++ +   V+CRQLG   A  A       +G  +G   LD + C GNE S+  C    W   +C  ++ AG+ C
Sbjct:  137 VCSNDWGDEDAAVVCRQLDEGISGRARAVPLFRTSKTRIHWKEVHCRGEEPDLLHCSKSTWNGEECLTAAAVTCIQQKTVVTLPMRLIGGESESEGTVEVFHAGQWGSICDDQWDDSDAEVVCRQLGLSGAAKAWG--QAHFGKSSGRVWLDEVRCTGNELSLEQCTKSAWGEHNCLHSEDAGVSC 320          
BLAST of Serine protease 12 vs. TrEMBL
Match: gnl|BL_ORD_ID|176136419 (tr|A0A437DMG5|A0A437DMG5_ORYJA Uncharacterized protein OS=Oryzias javanicus OX=123683 GN=OJAV_G00006910 PE=3 SV=1)

HSP 1 Score: 166.007 bits (419), Expect = 2.984e-38
Identity = 180/690 (26.09%), Postives = 274/690 (39.71%), Query Frame = 2
Query: 1055 VTCSEN-----FNMQLVGGDNRS-GVVQLNLGGGFSYICADNMDPSAADAICMEMGFQGSLYYEGYMGNTNASNYYSSFSGDYYRYHYDTIMTNIRCNSNT-KLRNCKXXXXXXXXXXXXXXXXXXXXXXXXXXQASGTNSFHXXXXXXXXXXXXXXXXXXXXXGAVKVQCHSNSTKYFLSPGYNQGYLT--YNNSY-MVCSNEYDKNNTDVYCRYLGY--------------PGVRKSYSNPGNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQD------------VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVC-------------SGNASSCGQVSTMENNWKYSNGYNTTFGATPWQA--RLMPSSVNEW--CSATIIDRNWLLTSANCFTMSYNN--FYVTVMSSRYYWDSSNFATTNSIQSVFIHPQYSTVTGDYNLALVKVNS----------IAFDANVQPLCLPA--GYIPVDGLSCVTTGWNHGLNTYSRPLLGKPVLIQNSSYCKDHLQFDDTRMARYLC-----SDNNMDPSAYFNGESGGPLTCSINGKN-VLXXXXXXXXXXXXXXXIRLYTRVDYWDSWIRNIMKNN 2899
            VTC +        M+L+GG++ S G V++   G +  IC D  D S A+ +C ++G  G+    G         ++   SG  +       +  +RC  N   L  C    +  +                        N  H+  +                 G   +     +T+     G ++G L   Y   +  VC + + K+NT V CR LGY              PG R      G  +  + L  + C G E S   C    +    C   + V + C              V LAGG +  EGRVE+Y  G+ G +CDD +      V+CRQLGY  A  A +     +G G G    D + C G+E SI DC  +   T +C  ++ AG++C                 S CG         +   G N+  G  PWQA  RL  S  +    C AT+ID  W+LTSA+CF    N+   Y   +   +      +     +  +  HP+Y + + DY+LALV ++           ++F  +V P+CLPA    +     +C  TGW     +YS+ L   P+ +     C+ +  F     +R LC     SD  +D      G+SGGPL C   G   V+ GV +   A     S  +YT+V  + SWIR ++  +
Sbjct:  209 VTCIQQKTVVTLPMRLIGGESESEGTVEVFHAGQWGSICDDQWDDSDAEVVCRQLGLSGAARAWG-------QAHFGKSSGRVW-------LDEVRCTGNELSLEQCTKSAWGEH------------------------NCLHSEDA-----------------GVSCLPLTDGATRLVGGAGSHEGRLEVFYQGQWGTVCDDGWTKSNTLVVCRQLGYRIGETLLPEGPDIPPGQRF-----GVGSGPILLDDVNCTGKEPSLLLCNRKEWLRHDCTHQEDVHIACDPEINGESLPASLPVRLAGGESTKEGRVELYLFGQWGTVCDDGWTDQDAEVVCRQLGYSGA--AKARLMAYFGEGTGPIHTDNVNCLGDERSIADCIKQMPGTHNCRHSEDAGVICDYGEPHYSSKEVKDPVVSLCGLRLVHTRQRRIIGGENSLRGGWPWQAAIRLRGSKGDGRLVCGATLIDTCWVLTSAHCFKRYGNSTKLYKVRVGDYHSLVPEEYEEEYGVDEIVFHPRYHSHSNDYDLALVHLSPGAMGQTAGECVSFSRHVLPVCLPARKERLLKQASNCHITGWGDTGRSYSKTLQQAPLSLLPRRLCQQY--FHSAFTSRMLCAGSVQSDRRVDSC---RGDSGGPLVCERPGGGWVIYGVTSWGHACRTHQSPGVYTKVSAFSSWIRKVIGRD 831          

HSP 2 Score: 78.5666 bits (192), Expect = 5.576e-11
Identity = 57/186 (30.65%), Postives = 86/186 (46.24%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYL--GYPGVRKSYSNPGNNTTYLPLVSLKCNGNEQSPADCPVDRY--AYCYTAKPVGVICQD------VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVC 2149
            VCS+++   +  V CR L  G  G  ++      + T +    + C G E     CP   +    C TA  V  I Q       + L GG + +EG VEV++ G+ G +CDD ++ +   V+CRQLG   A  A       +G  +G   LD + C GNE S+  C    W   +C  ++ AG+ C
Sbjct:  138 VCSSDWGDEDAAVVCRQLDEGISGRARAVPLFRTSKTRIHWKEVHCQGEEPDLLHCPKTTWNGEECLTAAAVTCIQQKTVVTLPMRLIGGESESEGTVEVFHAGQWGSICDDQWDDSDAEVVCRQLGLSGAARAWG--QAHFGKSSGRVWLDEVRCTGNELSLEQCTKSAWGEHNCLHSEDAGVSC 321          
BLAST of Serine protease 12 vs. Ensembl Cavefish
Match: si:ch211-51a6.2 (neurotrypsin-like [Source:NCBI gene;Acc:103031031])

HSP 1 Score: 147.132 bits (370), Expect = 1.126e-35
Identity = 137/474 (28.90%), Postives = 217/474 (45.78%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYLGYPGVRKSYSNPG---NNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQD-----------------VALAGGRTANEGRVEVYYKGKKGLLCDDNFN-INAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVC----------SGNASSCG-QVSTMENNWKYSNGYNTTFGATPWQA----RLMPSSVNEWCSATIIDRNWLLTSANCFTM--SYNNFYVTVMSSRYYWDSSNFATTNSIQSVFIHPQYSTVTGDYNLALVKV-----NSIAFDANVQPLCLP--AGYIPVDGLSCVTTGWNHGLNTYSRPLLGKPVLIQNSSYCKDHLQFDDTRMARYLC--SDNNMDPSAYFNGESGGPLTCS-INGKNVLXXXXXXXXXXXXXXXIRLYTRVDYWDSWIRNIMK 2893
            VC + + +++  V CR LGY   R   +  G     T  + L  +KC G+E+S  +C    +    C  ++ VG+ C+                  V L  G +  EGRVEV+  G  G +CDD +N INAG V+CRQLG+     A S     +G G G   LD + C G E S+G+CP     T  C  ++ AG++C          S    SCG + +T     +   G  +  G  PWQ     R     ++  C AT+I+  W++T+A+CF    +  + Y+  +   +  +  +F  T S + + +H +Y +   + ++ALV++     N ++F+ +    CLP  +        +CV TGW    + YSR LL   + +  S  CK   ++     +R LC  S +N        G+SGGPL C   NG+  L GV++        S   +YTRV  +  WI  + +
Sbjct:  364 VCDDNWTEHHAQVVCRQLGYSRGRAEVAPDGAYEEGTGMILLDEVKCRGDERSLLECEHAVWGRHDCSHSEDVGIRCERAVETNDVPAVPPVAGPLVRLVAGESRKEGRVEVFINGLWGSVCDDGWNDINAG-VVCRQLGFVGMSKARS--MAYFGEGQGPIHLDNVRCVGTESSLGECPADGPNTHDCRHSEDAGVICDYVSQPADDSSMAMQSCGLRPNTQRRRRRIIGGDKSLRGDWPWQVSLWLRAQSKRIHPLCGATLINSCWVVTAAHCFKRFGTDPSRYILRLGDYHTEERDDFERTLSPERIELHRKYHSQGWENDIALVRLKGTDGNCVSFNPHTNAACLPNQSAKKVKRPAACVITGWGVTDSEYSRTLLQAWLPLLPSGKCKK--RYGSRFTSRMLCAGSLSNHRRVDSCQGDSGGPLVCQGTNGRWTLTGVISWGHGCGDPSYPGVYTRVSRFLKWIEKVTQ 832          

HSP 2 Score: 97.4413 bits (241), Expect = 3.808e-20
Identity = 89/313 (28.43%), Postives = 128/313 (40.89%), Query Frame = 2
Query: 1544 CHSNSTKYFLSPGYNQGYL-TYNNSY--MVCSNEYDKNNTDVYCRYLGY----PGVRKSYSNPGNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQ-------DVALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGNASSCGQVSTMENNWKYSNGYNTTFGAT-PWQARLMPSSVNEWCSATIIDRNWLLTSAN--CFTMSYNNFYVTVMSSRYYWDSSNFATTNSIQ 2425
            CH  + +         G L  Y N     VC       +  V CR LG       ++ SY  PG+   +     L C GNE S  +C   ++    C      GV+C         + L GG    EGRVEVY+ GK G +CDD+++     V+CRQLG G    A +     +G G+G  LLD + C GNE S+ +CP   W   +C   + AG+ C+                 Y++G     GA  PW+ RL      EW   T+ D NW    A   C  + Y+     V     Y + +     + ++
Sbjct:  119 CHQGAARLIGGQSNKSGRLEVYLNGRWGTVCDTHLTDRDASVICRQLGLGEIGTALQHSYFGPGSGLFHYE--RLGCRGNENSLLECKSRKFVSGDCNHGNEAGVVCAAPEGNGTPLRLVGGLEEFEGRVEVYHNGKWGTICDDHWDDIDAEVVCRQLGLGGVPKAWT--WSHFGKGSGPILLDGVQCTGNELSLEECPHMPWGQHNCDHMEDAGVSCN----------------PYTDGVLRLVGADGPWEGRLEIYHSGEW--GTVCDDNWTEHHAQVVCRQLGYSRGRAEVAPDGAYEEGTGMILLDEVK 409          

HSP 3 Score: 88.5817 bits (218), Expect = 2.107e-17
Identity = 60/186 (32.26%), Postives = 91/186 (48.92%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYLGYPGVRKSY--SNPGNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQD-----VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCS 2152
            +C + +D  + +V CR LG  GV K++  S+ G  +  + L  ++C GNE S  +CP   +    C   +  GV C       + L G     EGR+E+Y+ G+ G +CDDN+  +   V+CRQLGY     A       Y  G G  LLD + C G+E S+ +C    W    C  ++  G+ C 
Sbjct:  257 ICDDHWDDIDAEVVCRQLGLGGVPKAWTWSHFGKGSGPILLDGVQCTGNELSLEECPHMPWGQHNCDHMEDAGVSCNPYTDGVLRLVGADGPWEGRLEIYHSGEWGTVCDDNWTEHHAQVVCRQLGYSRG-RAEVAPDGAYEEGTGMILLDEVKCRGDERSLLECEHAVWGRHDCSHSEDVGIRCE 441          
BLAST of Serine protease 12 vs. Ensembl Cavefish
Match: prss12 (serine protease 12 [Source:ZFIN;Acc:ZDB-GENE-090313-45])

HSP 1 Score: 146.362 bits (368), Expect = 1.838e-35
Identity = 134/477 (28.09%), Postives = 202/477 (42.35%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYLGY---PGVRKSYSNPGNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQD------------VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCS------------GNASSCGQVSTMENNWKYSNGYNTTFGATPWQA--RLMPSSVNEW--CSATIIDRNWLLTSANCFTMSYNN--FYVTVMSSRYYWDSSNFATTNSIQSVFIHPQYSTVTGDYNLALVKV-----------NSIAFDANVQPLCLPA--GYIPVDGLSCVTTGWNHGLNTYSRPLLGKPVLIQNSSYCKDHLQFDDTRMARYLCSDNNMDPSAY--FNGESGGPLTCSINGKN-VLXXXXXXXXXXXXXXXIRLYTRVDYWDSWIRNIMKNN 2899
            VC++ +   NT V CR LGY   P +  + S P      + L  + C G E S   C    +    C  +  V V C              V L GG    EGRVE+   G+ G +CDD +      V+CRQL  G++  A +     +G G G   +D + C G E S+ DC  + + T +C  ++ AG++C+              +S CG   T     +   G N+  G  PWQA  RL  S  +    C AT+I+  W+LTSA+CF    N+   Y   +   +            +  + IHP YS  + DY+LALV +           + +    +V P+CLP     +P    +C  TGW      YS+ L    V + +   C+   ++     +R LC+   +D        G+SGGPL C   G   VL G+ +   +     +  +YT+V  +  WIR I    
Sbjct:  345 VCNDGWSTTNTQVVCRQLGYSVSPDMFGASSGP------ILLDDVICTGKEPSLTHCSRSDWLRHDCPHSNNVAVACSPQRTGHGVPTSLPVRLVGGENEREGRVEISVGGQWGTVCDDGWTDQDAEVVCRQL--GFSGLAKARVMAYFGEGEGPIHVDNVKCTGGERSLADCIKQPFGTHNCRHSEDAGVICNYGQQDNLAGVKDAVSSVCGLKPTHTRQKRIIGGENSLRGGWPWQAAVRLRGSQADGRLVCGATLINSCWVLTSAHCFKRYGNSTRMYKVRVGDYHTLVPEENEEEYGVDRIIIHPHYSAQSNDYDLALVHLIRHGGPEGRGGDCVRQSRSVLPVCLPGRRERVPKGSANCFITGWGDTGRAYSKTLQQAEVRVLSKRQCE--RRYAGHFTSRMLCAGAALDDRRVDSCRGDSGGPLVCERGGGGWVLYGITSWGHSCRLQDAPGVYTKVSAFLPWIRKITSQE 811          

HSP 2 Score: 82.4185 bits (202), Expect = 1.620e-15
Identity = 70/257 (27.24%), Postives = 114/257 (44.36%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYLGYPGVRKSYSNP--GNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQ-----DVALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSC-YGNDVAGLVCSGNASSCGQVSTMENNWKYSNGYNTTFGATPWQARLMPSSVNEWCSATIIDRNWLLTSAN--CFTMSYNNF 2356
            VC +++D N+ +V CR LG  G  ++++    G+    + L  + C GNE S   C    +    C   +  GV C       + L GG    EGR+EV+Y+G+ G +C+D ++     V+CRQLGY       S +  ++G  +G  LLD + C G E S+  C    W    C + N+VA + CS   +  G  +++              G    + R+  S   +W   T+ D  W    A   C  + ++  
Sbjct:  238 VCDDQWDDNDAEVVCRQLGLGGTARAWARAYFGSGVGRVLLDEVSCTGNELSIEQCSKSPWGEHNCDHTEDAGVSCTPLTDGSLRLVGGAAGFEGRLEVHYRGQWGTVCNDGWSTTNTQVVCRQLGY-------SVSPDMFGASSGPILLDDVICTGKEPSLTHCSRSDWLRHDCPHSNNVA-VACSPQRTGHGVPTSLP--------VRLVGGENEREGRVEISVGGQW--GTVCDDGWTDQDAEVVCRQLGFSGL 476          

HSP 3 Score: 82.0333 bits (201), Expect = 2.130e-15
Identity = 61/184 (33.15%), Postives = 89/184 (48.37%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYLG--YPGVRKSYSNPGNNTTYLPLVSLKCNGNEQSPADCPVDRY--AYCYTAKPVGVICQ---DVALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCS 2152
            +CSN++D  +  V CR LG  Y    +  S      + +   ++ C+G E     CP   +    C   +   V       V L+GG++  EGRVEVY+ G+ G +CDD ++ N   V+CRQLG G    A +     +G G G  LLD + C GNE SI  C    W   +C   + AG+ C+
Sbjct:  133 ICSNDWDDKDATVVCRQLGQGYKARARVSSLVRMPLSVVHWRTVGCSGEEGDLLQCPHSVWNGGECANRQAAAVTSAVFIPVRLSGGQSVYEGRVEVYHAGQWGTVCDDQWDDNDAEVVCRQLGLGGTARAWA--RAYFGSGVGRVLLDEVSCTGNELSIEQCSKSPWGEHNCDHTEDAGVSCT 314          

HSP 4 Score: 55.0694 bits (131), Expect = 3.922e-7
Identity = 40/143 (27.97%), Postives = 65/143 (45.45%), Query Frame = 2
Query:  800 LSYLGENYTIQFGSLSTYDGHVLCQTLGYGSVKSMRPYKNETGTKLIYPTFDCRGSESRLTQCAELDGKKLHYEK----YYYTSPNVTNVTCSENFNMQLVGGDN-RSGVVQLNLGGGFSYICADNMDPSAADAICMEMGFQG 1213
            + Y G+  T+     ST +  V+C+ LGY     M  +   +G  L+     C G E  LT C+  D  +             SP  T      +  ++LVGG+N R G V++++GG +  +C D      A+ +C ++GF G
Sbjct:  336 VHYRGQWGTVCNDGWSTTNTQVVCRQLGYSVSPDM--FGASSGPILLDDVI-CTGKEPSLTHCSRSDWLRHDCPHSNNVAVACSPQRTGHGVPTSLPVRLVGGENEREGRVEISVGGQWGTVCDDGWTDQDAEVVCRQLGFSG 475          

HSP 5 Score: 52.373 bits (124), Expect = 2.733e-6
Identity = 31/100 (31.00%), Postives = 43/100 (43.00%), Query Frame = 2
Query: 1844 VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGL 2143
            V L GGR+  +G VEVY  G  G +C ++++     V+CRQLG GY   A +    L            + C G E  +  CP   W    C     A +
Sbjct:  109 VRLQGGRSKLDGTVEVYLNGVWGTICSNDWDDKDATVVCRQLGQGY--KARARVSSLVRMPLSVVHWRTVGCSGEEGDLLQCPHSVWNGGECANRQAAAV 206          
BLAST of Serine protease 12 vs. Ensembl Cavefish
Match: si:ch73-127m5.1 (si:ch73-127m5.1 [Source:ZFIN;Acc:ZDB-GENE-130531-25])

HSP 1 Score: 141.739 bits (356), Expect = 5.019e-34
Identity = 131/472 (27.75%), Postives = 207/472 (43.86%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYLGYPGVRKSYSNP--GNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVIC--------------QDVALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCS-----------GNASSCGQVSTMENNWK-YSNGYNTTFGATPWQARLMPSSVNE----WCSATIIDRNWLLTSANCFTMSYNNFYVTVMSSRYYWDSSNFATTNSIQSVFIHPQYSTVTGDYNLALVKVNS-----IAFDANVQPLCLPA-----GYIPVDGLSCVTTGWN-HGLNTYSRPLLGKPVLIQNSSYCKDHL--QFDDTRM--ARYLCSDNNMDPSAYFNGESGGPLTCSIN-GKNVLXXXXXXXXXXXXXXXIRLYTRVDYWDSWIRNI 2887
            VC + + + +  V CR LG+ G  +       G     + L  ++C G+E S  +C    +    C  ++ VG+ C              +D+ L  G +  EGRVEV+  G+ G +CD  +N     V+CRQLG+     A     +  G G  +     + C G E S+G+CP K  ++  C     AG+VC                +CG     E   K    GY +  G  PWQA L   S ++     C AT+I+  WLLT+A+CF    +  YV  +   +  +  +F     ++ V +H +YS  + ++++AL+++       ++F+ +    CLPA     G  P    SCV TGW   G   + R LL   V +  +  CK     +F    M  A  + SD+     +   G+SGGPL C    G+ VL GV++        S   +Y+RV  +  WI  +
Sbjct:  340 VCDDNWTEQHAQVVCRQLGFRGGAELAPAGMFGEGAGLILLDDVQCEGSESSLLECKHSVWGRHDCSHSEDVGIRCHRGGEGLREEGGEKKDMELVSGESRKEGRVEVFLNGEWGSVCDSGWNDVNAAVVCRQLGFTGVSKARPMGYFGAGKGPIHLAN--VRCTGKESSLGECPAKGSDSHVCKHGQDAGVVCDYVPEPETDIAIVGTHTCGIRGGAERRSKRIVGGYKSLRGDWPWQASLWLKSQSKGSQPLCGATLINSCWLLTAAHCFKRDASR-YVVKLGDYHTEEQDDFERVLPLERVEVHRKYSNESWEHDVALIRLKGAEGKCVSFNPHTNAACLPAPGSKWGKRPA---SCVITGWGVSGKMYHPRTLLQAWVPLLPTWQCKKRYGERFTSHSMLCAGSMSSDHRHHADS-CQGDSGGPLVCQGEAGRWVLTGVISWGHGCGDPSYPGVYSRVSRYLPWIEQV 804          

HSP 2 Score: 94.3597 bits (233), Expect = 3.223e-19
Identity = 84/281 (29.89%), Postives = 119/281 (42.35%), Query Frame = 2
Query: 1544 CHSNSTKYFLSPGYNQGYL-TYNNSYM--VCSNEYDKNNTDVYCRYLGYP-GV------RKSYSNPGNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQD-------VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGNASSCGQVSTMENNWKYSNGYNTTFGATPWQARLMPSSVNEWCSATIIDRNWLLTSAN 2329
            CH  + +         G L  Y N     VC   +   +  V CR LG   G+      + SY  PG+   +     L C GNE+S  +C   ++    C      G++C         + L GG    EGRVEVY+ G+ G +CDD ++     V+CRQLG G    A S     +G G+G   LD + C GNE S+ +CP   WE  +C   + AG+ C  N  + G V  ++             G  PW+ RL      +W   T+ D NW    A 
Sbjct:   92 CHQGAVRLVGGSSSKSGRLEVYLNGQWGSVCDTHWTDRDASVVCRQLGLGYGIPYTLNKQHSYFGPGSGLFHY--ARLGCRGNERSLLECRSRKFVTSDCSHGSEAGLVCSPPEGTGPPLRLVGGEEDFEGRVEVYHDGRWGSICDDQWDDMDAEVVCRQLGLGGIPKAWS--WAHFGQGSGPIQLDAVQCTGNELSLDECPHSGWEKHNCDHMEDAGVSC--NPYTDGVVRLVD-------------GDNPWEGRLEVYHSGDW--GTVCDDNWTEQHAQ 351          

HSP 3 Score: 87.4261 bits (215), Expect = 3.786e-17
Identity = 60/185 (32.43%), Postives = 93/185 (50.27%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYLGYPGVRKSYS--NPGNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQD-----VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVC 2149
            +C +++D  + +V CR LG  G+ K++S  + G  +  + L +++C GNE S  +CP   +    C   +  GV C       V L  G    EGR+EVY+ G  G +CDDN+      V+CRQL  G+   A      ++G G G  LLD + C G+E S+ +C    W    C  ++  G+ C
Sbjct:  233 ICDDQWDDMDAEVVCRQLGLGGIPKAWSWAHFGQGSGPIQLDAVQCTGNELSLDECPHSGWEKHNCDHMEDAGVSCNPYTDGVVRLVDGDNPWEGRLEVYHSGDWGTVCDDNWTEQHAQVVCRQL--GFRGGAELAPAGMFGEGAGLILLDDVQCEGSESSLLECKHSVWGRHDCSHSEDVGIRC 415          
BLAST of Serine protease 12 vs. Ensembl Cavefish
Match: si:ch73-127m5.1 (si:ch73-127m5.1 [Source:ZFIN;Acc:ZDB-GENE-130531-25])

HSP 1 Score: 140.198 bits (352), Expect = 1.373e-33
Identity = 132/463 (28.51%), Postives = 205/463 (44.28%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYLGYPGVRKSYSNPGNNTTYLPLVSLKCNGNEQSPADCPVDRYAYCYTAKPVGVICQD-------VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCS-----------GNASSCGQVSTMENNWK-YSNGYNTTFGATPWQARLMPSSVNE----WCSATIIDRNWLLTSANCFTMSYNNF--YVTVMSSRYYWDSSNFATTNSIQSVFIHPQYSTVTGDYNLALVKVNS-----IAFDANVQPLCLPA-----GYIPVDGLSCVTTGWN-HGLNTYSRPLLGKPVLIQNSSYCKDHL--QFDDTRM--ARYLCSDNNMDPSAYFNGESGGPLTCSIN-GKNVLXXXXXXXXXXXXXXXIRLYTRVDYWDSWIRNI 2887
            VC + + + +  V CR LG+   R ++S  G     L  V  +C G+E S  +C    +     +    V+C         V L  G +  EGRVEV+  G+ G +CD  +N     V+CRQLG+     A     +  G G  +     + C G E S+G+CP K  ++  C     AG+VC                +CG     E   K    GY +  G  PWQA L   S ++     C AT+I+  WLLT+A+CF  S ++   YV  +   +  +  +F     ++ V +H +YS  + ++++AL+++       ++F+ +    CLPA     G  P    SCV TGW   G   + R LL   V +  +  CK     +F    M  A  + SD+     +   G+SGGPL C    G+ VL GV++        S   +Y+RV  +  WI  +
Sbjct:  329 VCDDNWTEQHAQVVCRQLGF---RYNFSAEGAGLILLDDV--QCEGSESSLLECKHSVWGRHDCSHSEDVVCSSQATHCVLVRLVSGESRKEGRVEVFLNGEWGSVCDSGWNDVNAAVVCRQLGFTGVSKARPMGYFGAGKGPIHLAN--VRCTGKESSLGECPAKGSDSHVCKHGQDAGVVCDYVPEPETDIAIVGTHTCGIRGGAERRSKRIVGGYKSLRGDWPWQASLWLKSQSKGSQPLCGATLINSCWLLTAAHCFKRSGSDASRYVVKLGDYHTEEQDDFERVLPLERVEVHRKYSNESWEHDVALIRLKGAEGKCVSFNPHTNAACLPAPGSKWGKRPA---SCVITGWGVSGKMYHPRTLLQAWVPLLPTWQCKKRYGERFTSHSMLCAGSMSSDHRHHADS-CQGDSGGPLVCQGEAGRWVLTGVISWGHGCGDPSYPGVYSRVSRYLPWIEQV 780          

HSP 2 Score: 95.5153 bits (236), Expect = 1.383e-19
Identity = 81/266 (30.45%), Postives = 114/266 (42.86%), Query Frame = 2
Query: 1544 CHSNSTKYFLSPGYNQGYL-TYNNSYM--VCSNEYDKNNTDVYCRYLGYP-GVRKSYSNPGNNTTYLPLVSLKCNGNEQSPADCPVDRYAYCYTAKPVGVICQDVALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGNASSCGQVSTMENNWKYSNGYNTTFGATPWQARLMPSSVNEWCSATIIDRNWLLTSAN 2329
            CH  + +         G L  Y N     VC   +   +  V CR LG    ++ SY  PG+   +     L C GNE+S  +C   ++       P       + L GG    EGRVEVY+ G+ G +CDD ++     V+CRQLG G    A S     +G G+G   LD + C GNE S+ +CP   WE  +C   + AG+ C  N  + G V  ++             G  PW+ RL      +W   T+ D NW    A 
Sbjct:  102 CHQGAVRLVGGSSSKSGRLEVYLNGQWGSVCDTHWTDRDASVVCRQLGLGYALQHSYFGPGSGLFHY--ARLGCRGNERSLLECRSRKFVTSDCTGP------PLRLVGGEEDFEGRVEVYHDGRWGSICDDQWDDMDAEVVCRQLGLGGIPKAWS--WAHFGQGSGPIQLDAVQCTGNELSLDECPHSGWEKHNCDHMEDAGVSC--NPYTDGVVRLVD-------------GDNPWEGRLEVYHSGDW--GTVCDDNWTEQHAQ 340          

HSP 3 Score: 92.4337 bits (228), Expect = 1.164e-18
Identity = 64/193 (33.16%), Postives = 95/193 (49.22%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYLGYPGVRKSYS--NPGNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQD-----VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSC-YGNDVAGLVCSGNASSC 2170
            +C +++D  + +V CR LG  G+ K++S  + G  +  + L +++C GNE S  +CP   +    C   +  GV C       V L  G    EGR+EVY+ G  G +CDDN+      V+CRQLG+ Y  +A            G  LLD + C G+E S+ +C    W    C +  DV   VCS  A+ C
Sbjct:  222 ICDDQWDDMDAEVVCRQLGLGGIPKAWSWAHFGQGSGPIQLDAVQCTGNELSLDECPHSGWEKHNCDHMEDAGVSCNPYTDGVVRLVDGDNPWEGRLEVYHSGDWGTVCDDNWTEQHAQVVCRQLGFRYNFSAEG---------AGLILLDDVQCEGSESSLLECKHSVWGRHDCSHSEDV---VCSSQATHC 402          
BLAST of Serine protease 12 vs. Ensembl Cavefish
Match: si:ch73-127m5.1 (si:ch73-127m5.1 [Source:ZFIN;Acc:ZDB-GENE-130531-25])

HSP 1 Score: 129.798 bits (325), Expect = 2.043e-30
Identity = 131/474 (27.64%), Postives = 207/474 (43.67%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYLGYPGVRKSYSNP----GNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGV--------------ICQDVALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCS-----------GNASSCGQVSTMENNWK-YSNGYNTTFGATPWQARLMPSSVNE----WCSATIIDRNWLLTSANCFTMSYNNFYVTVMSSRYYWDSSNFATTNSIQSVFIHPQYSTVTGDYNLALVKVNS-----IAFDANVQPLCLPA-----GYIPVDGLSCVTTGWN-HGLNTYSRPLLGKPVLIQNSSYCKDHL--QFDDTRM--ARYLCSDNNMDPSAYFNGESGGPLTCSIN-GKNVLXXXXXXXXXXXXXXXIRLYTRVDYWDSWIRNI 2887
            VC + + + +  V CR LG+   R ++S      G     + L  ++C G+E S  +C    +    C  ++ VG+              +   V L  G +  EGRVEV+  G+ G +CD  +N     V+CRQLG+     A     +  G G  +     + C G E S+G+CP K  ++  C     AG+VC                +CG     E   K    GY +  G  PWQA L   S ++     C AT+I+  WLLT+A+CF    +  YV  +   +  +  +F     ++ V +H +YS  + ++++AL+++       ++F+ +    CLPA     G  P    SCV TGW   G   + R LL   V +  +  CK     +F    M  A  + SD+     +   G+SGGPL C    G+ VL GV++        S   +Y+RV  +  WI  +
Sbjct:  272 VCDDNWTEQHAQVVCRQLGF---RYNFSAGNCMFGEGAGLILLDDVQCEGSESSLLECKHSVWGRHDCSHSEDVGIPTYLNLTSGWFWVLLGVLVRLVSGESRKEGRVEVFLNGEWGSVCDSGWNDVNAAVVCRQLGFTGVSKARPMGYFGAGKGPIHLAN--VRCTGKESSLGECPAKGSDSHVCKHGQDAGVVCDYVPEPETDIAIVGTHTCGIRGGAERRSKRIVGGYKSLRGDWPWQASLWLKSQSKGSQPLCGATLINSCWLLTAAHCFKRDASR-YVVKLGDYHTEEQDDFERVLPLERVEVHRKYSNESWEHDVALIRLKGAEGKCVSFNPHTNAACLPAPGSKWGKRPA---SCVITGWGVSGKMYHPRTLLQAWVPLLPTWQCKKRYGERFTSHSMLCAGSMSSDHRHHADS-CQGDSGGPLVCQGEAGRWVLTGVISWGHGCGDPSYPGVYSRVSRYLPWIEQV 735          

HSP 2 Score: 87.8113 bits (216), Expect = 2.868e-17
Identity = 60/183 (32.79%), Postives = 95/183 (51.91%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYLGYPGVRKSYS--NPGNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQD-----VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGL 2143
            +C +++D  + +V CR LG  G+ K++S  + G  +  + L +++C GNE S  +CP   +    C   +  GV C       V L  G    EGR+EVY+ G  G +CDDN+      V+CRQLG+ Y  +A +    ++G G G  LLD + C G+E S+ +C    W    C  ++  G+
Sbjct:  165 ICDDQWDDMDAEVVCRQLGLGGIPKAWSWAHFGQGSGPIQLDAVQCTGNELSLDECPHSGWEKHNCDHMEDAGVSCNPYTDGVVRLVDGDNPWEGRLEVYHSGDWGTVCDDNWTEQHAQVVCRQLGFRYNFSAGN---CMFGEGAGLILLDDVQCEGSESSLLECKHSVWGRHDCSHSEDVGI 344          

HSP 3 Score: 77.0258 bits (188), Expect = 7.031e-14
Identity = 60/178 (33.71%), Postives = 83/178 (46.63%), Query Frame = 2
Query: 1796 YAYCYTAKPVGVICQDVALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGNASSCGQVSTMENNWKYSNGYNTTFGATPWQARLMPSSVNEWCSATIIDRNWLLTSAN 2329
            +AYC   +  G     + L GG    EGRVEVY+ G+ G +CDD ++     V+CRQLG G    A S     +G G+G   LD + C GNE S+ +CP   WE  +C   + AG+ C  N  + G V  ++             G  PW+ RL      +W   T+ D NW    A 
Sbjct:  128 WAYCDCHQGTG---PPLRLVGGEEDFEGRVEVYHDGRWGSICDDQWDDMDAEVVCRQLGLGGIPKAWS--WAHFGQGSGPIQLDAVQCTGNELSLDECPHSGWEKHNCDHMEDAGVSC--NPYTDGVVRLVD-------------GDNPWEGRLEVYHSGDW--GTVCDDNWTEQHAQ 283          
BLAST of Serine protease 12 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006929.1 (pep scaffold:Pmarinus_7.0:GL476378:525850:535660:-1 gene:ENSPMAG00000006267.1 transcript:ENSPMAT00000006929.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 100.908 bits (250), Expect = 4.815e-22
Identity = 87/276 (31.52%), Postives = 125/276 (45.29%), Query Frame = 2
Query: 1535 KVQCHSNSTKYFLSPGYNQGYLT--YNNSY-MVCSNEYDKNNTDVYCRYLG----YPGVRKSYSNPGNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQDVA--LAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGNASSCGQVSTMENNWKYSNGYNTTFGATPWQARLMPSSVNEWCSATIIDRNWLLTSAN 2329
             V C   + +     G  QG +   YN S+  VC + +D N+  V CR +G    +  V  +Y   G  T +L    ++CNG+E     C    +    C  ++   VIC + A  L GG    +GRVEV Y G  G +CDD +NIN   V+CR +G G A++A S     +G GNG   LD + C G+E S+G+CP   W   +C   + AG++CSG              W Y        G  P Q R+       W   T+ D +W +  A 
Sbjct:  121 SVICSETAIRLVGGGGACQGRVEVLYNGSWGTVCDDFWDINDAQVVCRKVGCGAAFSAVSNAYFGQGIGTIWLD--DVRCNGSESFLGPCSHRPWGQHDCSHSEDASVICSETAIRLVGGVGPCQGRVEVLYSGSWGTVCDDYWNINDARVVCRNVGCGAALSAQS--NAYFGQGNGTIWLDDVTCNGSESSLGNCPHLPWGQHNCVHAEDAGVICSG--------------WHYPT-IRLVGGGGPCQGRVEVLFDGSW--GTVCDDSWDINDAQ 375          

HSP 2 Score: 92.4337 bits (228), Expect = 2.324e-19
Identity = 73/219 (33.33%), Postives = 108/219 (49.32%), Query Frame = 2
Query: 1535 KVQCHSNSTKYFLSPGYNQGYLT--YNNSY-MVCSNEYDKNNTDVYCRYLGYPGVRKSYSNP--GNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQD----VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGN 2158
             V C   + +     G  QG +   Y++S+  VC + +D N+  V CR +G      + SN   G     + L  ++CNG+E     C    +    C  ++   VIC      + L GG    +GRVEV Y G  G +CDD +NIN   V+CR +G G A++A S     +G GNG   LD + C G+E S+G+CP   W   +C   + AG++CS N
Sbjct:  436 SVICSETAIRLVGGGGPCQGRVEVLYSDSWGTVCDDFWDINDAQVVCRKVGCGAALSAPSNAYFGQGIGTIWLDDVRCNGSESFLGPCSHRPWGQHDCSHSEDASVICSATETAIRLVGGVGPCQGRVEVLYSGSWGTVCDDYWNINDAQVVCRNVGCGAALSAQS--NAYFGQGNGTIWLDDVTCNGSESSLGNCPHLPWGQHNCVHAEDAGVICSVN 652          

HSP 3 Score: 91.2781 bits (225), Expect = 4.505e-19
Identity = 75/223 (33.63%), Postives = 110/223 (49.33%), Query Frame = 2
Query: 1535 KVQCHSNSTKYFLSPGYN--QGYLT--YNNSY-MVCSNEYDKNNTDVYCRYLGYPGVRKSYSNP----GNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQ-----DVALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSG 2155
             V C +  T   L  G    QG +   Y+ S+  VC + ++ N+  V CR +G      + SN     GN T +L  V+  CNG+E S  +CP   +    C  A+  GVIC       + L GG    +GRVEV + G  G +CDD+++IN   V+CR +G G A++A       +G GNG   LD + C G+E  +G C  + W    C   + A ++CSG
Sbjct:  540 SVICSATETAIRLVGGVGPCQGRVEVLYSGSWGTVCDDYWNINDAQVVCRNVGCGAALSAQSNAYFGQGNGTIWLDDVT--CNGSESSLGNCPHLPWGQHNCVHAEDAGVICSVNIYPTIRLVGGGGPCQGRVEVLFDGSWGTVCDDSWDINDAQVVCRMVGCGAAISAPQ--VAYFGQGNGPIWLDDVSCTGSESILGSCSHRPWGQHDCSHIEDASVICSG 758          

HSP 4 Score: 90.5077 bits (223), Expect = 9.351e-19
Identity = 73/223 (32.74%), Postives = 109/223 (48.88%), Query Frame = 2
Query: 1535 KVQCHSNSTKYFLSPGYNQGYLT--YNNSY-MVCSNEYDKNNTDVYCRYLGYPGVRKSYSNP----GNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQD-----VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGNA 2161
             V C   + +     G  QG +   Y+ S+  VC + ++ N+  V CR +G      + SN     GN T +L  V+  CNG+E S  +CP   +    C  A+  GVIC       + L GG    +GRVEV + G  G +CDD+++IN   V+CR +G G A++A       +G GNG   LD + C G+E  +G C  + W    C   + A ++CS  A
Sbjct:  225 SVICSETAIRLVGGVGPCQGRVEVLYSGSWGTVCDDYWNINDARVVCRNVGCGAALSAQSNAYFGQGNGTIWLDDVT--CNGSESSLGNCPHLPWGQHNCVHAEDAGVICSGWHYPTIRLVGGGGPCQGRVEVLFDGSWGTVCDDSWDINDAQVVCRMVGCGAAISAPQ--VAYFGQGNGPIWLDDVSCTGSESILGSCSHRPWGQHDCSHIEDASVICSETA 443          

HSP 5 Score: 90.1225 bits (222), Expect = 1.231e-18
Identity = 72/220 (32.73%), Postives = 106/220 (48.18%), Query Frame = 2
Query: 1529 AVKVQCHSNSTKYFLSPGYNQGYLT--YNNSY-MVCSNEYDKNNTDVYCRYLGYPGVRKSYSNP--GNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQDVA--LAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGNA 2161
            AV  Q   ++ +     G  QG +   Y  S+  VC + +D N+  V CR +G    R + SN   G     + L  ++CNG+E     C    +    C   +   VIC + A  L GG  A +GRVEV Y G  G +CDD ++IN   V+CR++G G A +A S     +G G G   LD + C G+E  +G C  + W    C  ++ A ++CS  A
Sbjct:   16 AVAAQ-QESAIRLIGGVGPCQGRVEVYYAGSWGTVCDDFWDINDAQVVCRKVGCGAARSALSNAYFGQGIGTIWLDDVRCNGSESFLGPCSHRPWGQHDCSHIEDASVICSETAIRLVGGGGACQGRVEVLYNGSWGTVCDDFWDINDAQVVCRKVGCGAAFSAVS--NAYFGQGIGTIWLDDVRCNGSESFLGPCSHRPWGQHDCSHSEDASVICSETA 232          

HSP 6 Score: 79.7221 bits (195), Expect = 1.821e-15
Identity = 62/199 (31.16%), Postives = 97/199 (48.74%), Query Frame = 2
Query: 1598 LTYNNSY-MVCSNEYDKNNTDVYCRYLGYPGV----RKSYSNPGNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQDVA--LAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGNASS 2167
            + ++ S+  VC + +D N+  V CR +G        + +Y   GN   +L  VS  C G+E     C    +    C   +   VIC + A  L GG    +GRVEV Y    G +CDD ++IN   V+CR++G G A++A S     +G G G   LD + C G+E  +G C  + W    C  ++ A ++CS   ++
Sbjct:  355 VLFDGSWGTVCDDSWDINDAQVVCRMVGCGAAISAPQVAYFGQGNGPIWLDDVS--CTGSESILGSCSHRPWGQHDCSHIEDASVICSETAIRLVGGGGPCQGRVEVLYSDSWGTVCDDFWDINDAQVVCRKVGCGAALSAPS--NAYFGQGIGTIWLDDVRCNGSESFLGPCSHRPWGQHDCSHSEDASVICSATETA 549          
BLAST of Serine protease 12 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006915.1 (pep scaffold:Pmarinus_7.0:GL476378:414701:424985:-1 gene:ENSPMAG00000006243.1 transcript:ENSPMAT00000006915.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 97.0561 bits (240), Expect = 1.045e-20
Identity = 70/206 (33.98%), Postives = 109/206 (52.91%), Query Frame = 2
Query: 1574 SPGYNQGYLTYNNSY-MVCSNEYDKNNTDVYCRYLGYPGVRKSYSNP----GNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQDVAL---AGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGNA 2161
            SP   +  + +N S+  VC + +D N+  V CR +G      + SN     GN T +L    ++CNG+E     C    +    C  ++   V+C + A+    GG +  +GRVEV Y G  G +CDD ++IN   V+CR++G G A++A S     +G GNG   LD + C G+E S+G+CP   W   +C   + AG++CS +A
Sbjct:  566 SPCQGRVEVLFNGSWGTVCDDYWDMNDAQVVCRKIGCGAALSAPSNAYFGRGNGTIWLD--DVRCNGSESFLGPCSHRPWGQHDCSHSEDASVVCSETAIRLVGGGGSPCQGRVEVLYAGSWGTVCDDFWDINDAQVVCRKVGCGAALSAPS--NAYFGQGNGIIWLDDVTCNGSEASLGNCPHLSWGQHNCVHAEDAGVICSESA 767          

HSP 2 Score: 94.7449 bits (234), Expect = 4.986e-20
Identity = 69/194 (35.57%), Postives = 103/194 (53.09%), Query Frame = 2
Query: 1598 LTYNNSY-MVCSNEYDKNNTDVYCRYLGYPGVRKS----YSNPGNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQDVA--LAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCS 2152
            + YN S+  VC + ++ N+  V CR +G      +    Y   GN T +L  V+  CNG+E S  +CP   +    C  A+  GVIC + A  L GG ++ +GRVEV Y G  G +CDD ++IN   V+CR +G G A++A S     +G G G   LD + C G+E  +G C  + W    C  ++ A ++CS
Sbjct:  363 VLYNGSWGTVCDDYWNINDAQVVCRKVGCGAALSAQSYAYFGQGNGTIWLDDVT--CNGSESSLGNCPHLPWGQHNCVHAEDAGVICSESAIRLIGGGSSCQGRVEVLYSGSWGSVCDDFWDINDAQVVCRMVGCGVALSAPS--NAYFGQGIGTIWLDDVRCNGSESFLGPCSHRPWGQHDCSHSEDASVICS 552          

HSP 3 Score: 94.3597 bits (233), Expect = 7.321e-20
Identity = 70/203 (34.48%), Postives = 102/203 (50.25%), Query Frame = 2
Query: 1574 SPGYNQGYLTYNNSY-MVCSNEYDKNNTDVYCRYLGYPGVRKSYSNP--GNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQDVA--LAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGNA 2161
            SP   +  + Y  S+  VC + +D N+  V CR +G      + SN   G     + L  + CNG+E S  +CP   +    C  A+  GVIC + A  L GG    +GRVEV+Y G  G +CDD ++I    V+CR +G G A++A S     +G G G   LD + C G+E  +G C  + W    C  ++ A +VCS N 
Sbjct:  671 SPCQGRVEVLYAGSWGTVCDDFWDINDAQVVCRKVGCGAALSAPSNAYFGQGNGIIWLDDVTCNGSEASLGNCPHLSWGQHNCVHAEDAGVICSESAIRLVGGGGPCQGRVEVFYSGSWGTVCDDFWDIIDAQVVCRMVGCGAALSAPS--NAYFGQGIGTIWLDDVRCNGSESFLGPCSHRPWGQHDCSHSEDASVVCSVNG 871          

HSP 4 Score: 93.5893 bits (231), Expect = 1.151e-19
Identity = 69/194 (35.57%), Postives = 103/194 (53.09%), Query Frame = 2
Query: 1598 LTYNNSY-MVCSNEYDKNNTDVYCRYLGYPGVRKS----YSNPGNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQDVA--LAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCS 2152
            + YN S+  VC + ++ N+  V CR +G      +    Y   GN T +L  V+  CNG+E S  +CP   +    C  A+  GVIC + A  L GG ++ +GRVEV Y G  G +CDD ++IN   V+CR +G G A++A S     +G G G   LD + C G+E  +G C  + W    C  ++ A ++CS
Sbjct:  151 VLYNGSWGTVCDDYWNINDAQVVCRKVGCGAALSAQSYAYFGQGNGTIWLDDVT--CNGSESSLGNCPHLPWGQHNCVHAEDAGVICSESAIRLIGGGSSCQGRVEVLYSGSWGTVCDDFWDINDAQVVCRMVGCGVALSAPS--NTYFGQGIGTIWLDDVRCNGSEYFLGPCSHRPWGQHDCSHSEDASVICS 340          

HSP 5 Score: 83.1889 bits (204), Expect = 1.939e-16
Identity = 71/216 (32.87%), Postives = 105/216 (48.61%), Query Frame = 2
Query: 1598 LTYNNSY-MVCSNEYDKNNTDVYCRYLGYPGVRKSYSNP--GNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQDVALAGGRTAN------EGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCS-------GNASSC-GQVSTM 2188
            + Y+ S+  VC + +D N+  V CR +G      + SN   G     + L  ++CNG+E     C    +    C  ++   VIC        R         +GRVEV Y G  G +CDD +NIN   V+CR++G G A++A S     +G GNG   LD + C G+E S+G+CP   W   +C   + AG++CS       G  SSC G+V  +
Sbjct:  255 VLYSGSWGTVCDDFWDINDAQVVCRMVGCGVALSAPSNTYFGQGIGTIWLDDVRCNGSEYFLGPCSHRPWGQHDCSHSEDASVICSVCTETAIRLVGGGGGPCQGRVEVLYNGSWGTVCDDYWNINDAQVVCRKVGCGAALSAQS--YAYFGQGNGTIWLDDVTCNGSESSLGNCPHLPWGQHNCVHAEDAGVICSESAIRLIGGGSSCQGRVEVL 468          

HSP 6 Score: 80.1073 bits (196), Expect = 1.512e-15
Identity = 75/230 (32.61%), Postives = 111/230 (48.26%), Query Frame = 2
Query: 1598 LTYNNSY-MVCSNEYDKNNTDVYCRYLGYPGVRKSYSNP--GNNTTYLPLVSLKCNGNEQSPADCPVDRYAY----CYTAKPVGVICQDVALA-----GGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCS-------GNASSC-GQVSTMENNWKYSNGYNTT 2227
            + Y+ S+  VC + +D N+  V CR +G      + SN   G     + L  ++CNG+E      P     +    C  ++   V+C     A     GG    +GRVEV Y G  G +CDD +NIN   V+CR++G G A++A S     +G GNG   LD + C G+E S+G+CP   W   +C   + AG++CS       G  SSC G+V  +     YS  + T 
Sbjct:   44 VLYSGSWGTVCDDFWDINDAQVVCRMVGCGVALSAPSNTYFGQGIGTIWLDDVRCNGSESFLG--PYSHRPWGQHDCSHSEDASVVCSATETAIRLVGGGGGPCQGRVEVLYNGSWGTVCDDYWNINDAQVVCRKVGCGAALSAQS--YAYFGQGNGTIWLDDVTCNGSESSLGNCPHLPWGQHNCVHAEDAGVICSESAIRLIGGGSSCQGRVEVL-----YSGSWGTV 264          

HSP 7 Score: 79.337 bits (194), Expect = 2.864e-15
Identity = 63/198 (31.82%), Postives = 98/198 (49.49%), Query Frame = 2
Query: 1598 LTYNNSY-MVCSNEYDKNNTDVYCRYLGYPGVRKSYSNP--GNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQDVALA-----GGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGNA 2161
            + Y+ S+  VC + +D N+  V CR +G      + SN   G     + L  ++CNG+E     C    +    C  ++   VIC     A     GG +  +GRVEV + G  G +CDD +++N   V+CR++G G A++A S     +G GNG   LD + C G+E  +G C  + W    C  ++ A +VCS  A
Sbjct:  467 VLYSGSWGSVCDDFWDINDAQVVCRMVGCGVALSAPSNAYFGQGIGTIWLDDVRCNGSESFLGPCSHRPWGQHDCSHSEDASVICSAAETAIRLVGGGGSPCQGRVEVLFNGSWGTVCDDYWDMNDAQVVCRKIGCGAALSAPS--NAYFGRGNGTIWLDDVRCNGSESFLGPCSHRPWGQHDCSHSEDASVVCSETA 662          

HSP 8 Score: 73.1738 bits (178), Expect = 2.418e-13
Identity = 66/238 (27.73%), Postives = 103/238 (43.28%), Query Frame = 2
Query: 1538 VQCHSNSTKYFLSPGYNQGYLT--YNNSY-MVCSNEYDKNNTDVYCRYLGYPGVRKSYSNP--GNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQ-------------------------DVALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSG 2155
            V C  ++ +     G  QG +   Y+ S+  VC + +D  +  V CR +G      + SN   G     + L  ++CNG+E     C    +    C  ++   V+C                           + L GG    +GRVEV+Y G  G +CDD ++I    V+CR +G G A++A S     +G G G   LD + C G+E  +G C  + W    C  ++ A +VCSG
Sbjct:  761 VICSESAIRLVGGGGPCQGRVEVFYSGSWGTVCDDFWDIIDAQVVCRMVGCGAALSAPSNAYFGQGIGTIWLDDVRCNGSESFLGPCSHRPWGQHDCSHSEDASVVCSVNGNVLLYIVYITKCSYTITFSPESAIRLVGGGGPCQGRVEVFYSGSWGTVCDDFWDIIDAQVVCRMVGCGAALSAPS--NAYFGQGIGTIWLDDVRCNGSESFLGPCSHRPWGQHDCSHSEDASVVCSG 996          

HSP 9 Score: 58.5362 bits (140), Expect = 7.676e-9
Identity = 39/108 (36.11%), Postives = 60/108 (55.56%), Query Frame = 2
Query: 1844 VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGNASS 2167
            + L GG ++ +GRVEV Y G  G +CDD ++IN   V+CR +G G A++A S     +G G G   LD + C G+E  +G    + W    C  ++ A +VCS   ++
Sbjct:   29 IRLIGGGSSCQGRVEVLYSGSWGTVCDDFWDINDAQVVCRMVGCGVALSAPS--NTYFGQGIGTIWLDDVRCNGSESFLGPYSHRPWGQHDCSHSEDASVVCSATETA 134          
BLAST of Serine protease 12 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008950.1 (pep scaffold:Pmarinus_7.0:GL497676:235:2038:-1 gene:ENSPMAG00000008100.1 transcript:ENSPMAT00000008950.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 91.6633 bits (226), Expect = 2.992e-20
Identity = 67/193 (34.72%), Postives = 100/193 (51.81%), Query Frame = 2
Query: 1604 YNNSY-MVCSNEYDKNNTDVYCRYLGYPGVRKSYSNP--GNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQD----VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSG 2155
            Y++S+  VC + +D N+  V CR +G      + SN   G     + L  ++CNG+E     C    +    C  ++   V+C      + L GG    +GRVEV Y G  G +CDD +NIN   V+CR +G G A++A S     +G GNG   LD + C G+E S+G+CP   W   +C   + AG++CSG
Sbjct:  126 YSDSWGTVCDDVWDINDAQVVCRKVGCGAALSAPSNAYFGQGIGTIWLDDVRCNGSESFLGPCSHRPWGQHDCSHSEDASVVCSATETAIRLVGGVGPCQGRVEVLYSGSWGTVCDDYWNINDAQVVCRNVGCGAALSAQS--NAYFGQGNGTIWLDDVTCNGSESSLGNCPHLPWGQHNCVHAEDAGVICSG 316          

HSP 2 Score: 78.1814 bits (191), Expect = 8.104e-16
Identity = 62/203 (30.54%), Postives = 97/203 (47.78%), Query Frame = 2
Query: 1598 LTYNNSY-MVCSNEYDKNNTDVYCRYLGYPGV----RKSYSNPGNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQDV------ALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGNASS 2167
            + ++ S+  VC + +D N+  V CR +G        + +Y   GN   +L  VS  C G+E     C    +    C   +   VIC  +       L GG    +GRVEV+Y    G +CDD ++IN   V+CR++G G A++A S     +G G G   LD + C G+E  +G C  + W    C  ++ A +VCS   ++
Sbjct:   16 VLFDGSWGTVCDDSWDINDAQVVCRMVGCGAAISAPQVAYFGQGNGPIWLDDVS--CTGSESILGSCSHRPWGQHDCSHIEDASVICSAIFFKTAIRLVGGGGPCQGRVEVFYSDSWGTVCDDVWDINDAQVVCRKVGCGAALSAPS--NAYFGQGIGTIWLDDVRCNGSESFLGPCSHRPWGQHDCSHSEDASVVCSATETA 214          

HSP 3 Score: 60.4622 bits (145), Expect = 6.435e-10
Identity = 38/103 (36.89%), Postives = 57/103 (55.34%), Query Frame = 2
Query: 1844 VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCS 2152
            + L GG    +GRVEV + G  G +CDD+++IN   V+CR +G G A++A       +G GNG   LD + C G+E  +G C  + W    C   + A ++CS
Sbjct:    1 IRLVGGGGPCQGRVEVLFDGSWGTVCDDSWDINDAQVVCRMVGCGAAISAPQ--VAYFGQGNGPIWLDDVSCTGSESILGSCSHRPWGQHDCSHIEDASVICS 101          
BLAST of Serine protease 12 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005967.1 (pep scaffold:Pmarinus_7.0:GL493532:543:4961:1 gene:ENSPMAG00000005399.1 transcript:ENSPMAT00000005967.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 94.3597 bits (233), Expect = 5.194e-20
Identity = 70/197 (35.53%), Postives = 102/197 (51.78%), Query Frame = 2
Query: 1598 LTYNNSY-MVCSNEYDKNNTDVYCRYLGYPGVRKSYSNP----GNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQDVA--LAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGNA 2161
            + +N S+  VC + +D N+  V CR +G      + SN     GN T +L    + CNG+E S  +CP   +    C  A+  GVIC + A  L GG    +GRVEV+Y G  G +CDD ++I    V+CR +G G A++A S     +G G G   LD + C G+E  +G C  + W    C  ++ A +VCS  A
Sbjct:    6 VLFNGSWGTVCDDYWDMNDAQVVCRKIGCGAALSAPSNAYFGQGNGTIWLD--DVICNGSESSLGNCPHLPWGQHNCVHAEDAGVICSESAIRLVGGGGPCQGRVEVFYSGSWGTVCDDFWDIIDAQVVCRMVGCGAALSAPS--NAYFGQGIGTIWLDDVRCNGSESFLGPCSHRPWGQHDCSHSEDASVVCSETA 198          

HSP 2 Score: 91.6633 bits (226), Expect = 3.555e-19
Identity = 82/267 (30.71%), Postives = 119/267 (44.57%), Query Frame = 2
Query: 1574 SPGYNQGYLTYNNSY-MVCSNEYDKNNTDVYCRYLGYPGVRKSYSNP----GNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQDVA--------LAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGNASSCGQVSTMENNWKYSNGYNTTFGATPWQARLMPSSVNEWCSATIIDRNWLLTSAN 2329
            SP   +  + Y  S+  VC + +D N+  V CR +G      + SN     GN T +L  V+  CNG+E S  +CP   +    C  A+  GVIC  +         L GG    +GRVEV Y G  G +CDD ++I    V+CR +G G A++A S     +G G G   LD + C G+E  +G C  + W    C  ++ A +VCSG  ++   V                 G +P Q R+       W   T+ D  W +  A 
Sbjct:  421 SPCQGRVEVLYAGSWGTVCDDFWDINDAQVVCRKVGCGAALSAPSNAYFGQGNGTIWLDDVT--CNGSEASLGNCPHLLWGQHNCVHAEDAGVICSAITFSPESAIRLVGGGGPCQGRVEVLYSGSWGTVCDDFWDIIDAQVVCRMVGCGAALSAPS--NAYFGQGIGTIWLDDVRCNGSESFLGPCSHRPWGQHDCSHSEDASVVCSGTETAIRLVGG---------------GGSPCQGRVEVLYAGSW--GTVCDDFWDINDAQ 666          

HSP 3 Score: 90.8929 bits (224), Expect = 5.377e-19
Identity = 72/210 (34.29%), Postives = 104/210 (49.52%), Query Frame = 2
Query: 1574 SPGYNQGYLTYNNSY-MVCSNEYDKNNTDVYCRYLGYPGVRKSYSNP----GNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQ-------DVALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGNA 2161
            SP   +  + Y  S+  VC + +D N+  V CR +G      + SN     GN T +L  V+  CNG+E S  +CP   +    C  A+  GVIC         + L GG    +GRVEV+Y G  G +CDD ++I    V+CR +G G A++A S     +G G G   LD + C G+E  +G C  + W    C  ++ A +VCS  A
Sbjct:  207 SPCQGRVEVLYAGSWGTVCDDFWDINDAQVVCRKVGCGAALSAPSNAYFGQGNGTIWLDDVT--CNGSEASLGNCPHLSWGQHNCVHAEDAGVICSVTFSPESAIRLVGGGGPCQGRVEVFYSGSWGTVCDDFWDIIDAQVVCRMVGCGAALSAPS--NAYFGQGIGTIWLDDVRCNGSESFLGPCSHRPWGQHDCSHSEDASVVCSETA 412          

HSP 4 Score: 90.5077 bits (223), Expect = 7.333e-19
Identity = 69/215 (32.09%), Postives = 109/215 (50.70%), Query Frame = 2
Query: 1538 VQCHSNSTKYFLSPGYNQGYLT--YNNSY-MVCSNEYDKNNTDVYCRYLGYPGVRKSYSNP--GNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQDVAL---AGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCS 2152
            V C  ++ +     G  QG +   Y+ S+  VC + +D  +  V CR +G      + SN   G     + L  ++CNG+E     C    +    C  ++   V+C + A+    GG +  +GRVEV Y G  G +CDD ++IN   V+CR++G G A++A S     +G GNG   LD + C G+E S+G+CP   W   +C   + AG++CS
Sbjct:   88 VICSESAIRLVGGGGPCQGRVEVFYSGSWGTVCDDFWDIIDAQVVCRMVGCGAALSAPSNAYFGQGIGTIWLDDVRCNGSESFLGPCSHRPWGQHDCSHSEDASVVCSETAIRLVGGGGSPCQGRVEVLYAGSWGTVCDDFWDINDAQVVCRKVGCGAALSAPS--NAYFGQGNGTIWLDDVTCNGSEASLGNCPHLSWGQHNCVHAEDAGVICS 300          

HSP 5 Score: 88.9669 bits (219), Expect = 2.670e-18
Identity = 64/191 (33.51%), Postives = 100/191 (52.36%), Query Frame = 2
Query: 1604 YNNSY-MVCSNEYDKNNTDVYCRYLGYPGVRKSYSNP--GNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQDVAL---AGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCS 2152
            Y+ S+  VC + +D  +  V CR +G      + SN   G     + L  ++CNG+E     C    +    C  ++   V+C + A+    GG +  +GRVEV Y G  G +CDD ++IN   V+CR++G G A++A S     +G GNG   LD + C G+E S+G+CP   W   +C   + AG++CS
Sbjct:  326 YSGSWGTVCDDFWDIIDAQVVCRMVGCGAALSAPSNAYFGQGIGTIWLDDVRCNGSESFLGPCSHRPWGQHDCSHSEDASVVCSETAIRLVGGGGSPCQGRVEVLYAGSWGTVCDDFWDINDAQVVCRKVGCGAALSAPS--NAYFGQGNGTIWLDDVTCNGSEASLGNCPHLLWGQHNCVHAEDAGVICS 514          

HSP 6 Score: 68.5514 bits (166), Expect = 5.386e-12
Identity = 45/144 (31.25%), Postives = 71/144 (49.31%), Query Frame = 2
Query: 1598 LTYNNSY-MVCSNEYDKNNTDVYCRYLGYPGVRKSYSNP--GNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQDVALA-----GGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATS 1999
            + Y+ S+  VC + +D  +  V CR +G      + SN   G     + L  ++CNG+E     C    +    C  ++   V+C     A     GG +  +GRVEV Y G  G +CDD ++IN   V+CR++G G A++A S
Sbjct:  539 VLYSGSWGTVCDDFWDIIDAQVVCRMVGCGAALSAPSNAYFGQGIGTIWLDDVRCNGSESFLGPCSHRPWGQHDCSHSEDASVVCSGTETAIRLVGGGGSPCQGRVEVLYAGSWGTVCDDFWDINDAQVVCRKVGCGAALSAPS 682          

HSP 7 Score: 63.5438 bits (153), Expect = 1.783e-10
Identity = 39/96 (40.62%), Postives = 60/96 (62.50%), Query Frame = 2
Query: 1874 EGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGNA 2161
            +GRVEV + G  G +CDD +++N   V+CR++G G A++A S     +G GNG   LD + C G+E S+G+CP   W   +C   + AG++CS +A
Sbjct:    1 QGRVEVLFNGSWGTVCDDYWDMNDAQVVCRKIGCGAALSAPS--NAYFGQGNGTIWLDDVICNGSESSLGNCPHLPWGQHNCVHAEDAGVICSESA 94          
BLAST of Serine protease 12 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008949.1 (pep scaffold:Pmarinus_7.0:GL497676:220:2038:-1 gene:ENSPMAG00000008100.1 transcript:ENSPMAT00000008949.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 90.1225 bits (222), Expect = 1.021e-19
Identity = 68/198 (34.34%), Postives = 100/198 (50.51%), Query Frame = 2
Query: 1604 YNNSY-MVCSNEYDKNNTDVYCRYLGYPGVRKSYSNP--GNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQDV--------ALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGN 2158
            Y++S+  VC + +D N+  V CR +G      + SN   G     + L  ++CNG+E     C    +    C  ++   V+C  V         L GG    +GRVEV Y G  G +CDD +NIN   V+CR +G G A++A S     +G GNG   LD + C G+E S+G+CP   W   +C   + AG++CSG 
Sbjct:  128 YSDSWGTVCDDVWDINDAQVVCRKVGCGAALSAPSNAYFGQGIGTIWLDDVRCNGSESFLGPCSHRPWGQHDCSHSEDASVVCSGVYISKETAIRLVGGVGPCQGRVEVLYSGSWGTVCDDYWNINDAQVVCRNVGCGAALSAQS--NAYFGQGNGTIWLDDVTCNGSESSLGNCPHLPWGQHNCVHAEDAGVICSGG 323          

HSP 2 Score: 79.337 bits (194), Expect = 4.088e-16
Identity = 64/201 (31.84%), Postives = 96/201 (47.76%), Query Frame = 2
Query: 1598 LTYNNSY-MVCSNEYDKNNTDVYCRYLG----YPGVRKSYSNPGNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQDV--------ALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSG 2155
            + ++ S+  VC + +D N+  V CR +G        + +Y   GN   +L  VS  C G+E     C    +    C   +   VIC  V         L GG    +GRVEV+Y    G +CDD ++IN   V+CR++G G A++A S     +G G G   LD + C G+E  +G C  + W    C  ++ A +VCSG
Sbjct:   16 VLFDGSWGTVCDDSWDINDAQVVCRMVGCGAAISAPQVAYFGQGNGPIWLDDVS--CTGSESILGSCSHRPWGQHDCSHIEDASVICSGVYISKETAIRLVGGGGPCQGRVEVFYSDSWGTVCDDVWDINDAQVVCRKVGCGAALSAPS--NAYFGQGIGTIWLDDVRCNGSESFLGPCSHRPWGQHDCSHSEDASVVCSG 212          

HSP 3 Score: 62.003 bits (149), Expect = 1.928e-10
Identity = 39/104 (37.50%), Postives = 58/104 (55.77%), Query Frame = 2
Query: 1844 VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSG 2155
            + L GG    +GRVEV + G  G +CDD+++IN   V+CR +G G A++A       +G GNG   LD + C G+E  +G C  + W    C   + A ++CSG
Sbjct:    1 IRLVGGGGPCQGRVEVLFDGSWGTVCDDSWDINDAQVVCRMVGCGAAISAPQ--VAYFGQGNGPIWLDDVSCTGSESILGSCSHRPWGQHDCSHIEDASVICSG 102          
BLAST of Serine protease 12 vs. Ensembl Nematostella
Match: EDO46872 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNK2])

HSP 1 Score: 119.783 bits (299), Expect = 2.471e-27
Identity = 106/367 (28.88%), Postives = 165/367 (44.96%), Query Frame = 2
Query: 1574 SPGYNQGYLTYNNSY-MVCSNEYDKNNTDVYCRYLGYPGVRKSY--SNPGNN-TTYLPLVSLKCNGNEQSPADCPVDRYAY--CY-----TAKPVGVICQDVALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVC-----SGNASSCGQVSTMENNWKYSNGYNTTFGAT----PWQARLMPSSVNEWCSATIIDRNWLLTSANCFTMSYNNFYVTV-------MSSRYYWD-SSNFATTNSIQSVFIHPQYSTVTGDYN-LALVKVNSIA-FDANVQPLCLPAGYIPVDGLSCVTTGW 2584
            SP   +  + +N  +  VC + ++  +  V CR LG+P        S  G++  + + L  +KC+G E S  DC         C+     T +P   +   V L GGR+A+EGR+EVY++G  G +CDD + I  GNVICR LGY  A  A +  G        N  LD + C GNE SI  C  + W   +C   ++AG+VC     + +  +CG   ++      S G+     A     PWQ  ++      +CS  +I    ++T+A+CF        + V        S R  W   S +    ++ ++  HP Y   T   N +A++K+   A  +  V  +C+        G  C TTGW
Sbjct:  981 SPNEGRVEIYHNGEWGAVCDDFWNLLDGHVVCRMLGFPKAESVSCCSTYGSHWASKMLLDDVKCSGMESSLLDCSHKEIGQHDCHPVSVPTTQPAVQVAVPVRLRGGRSAHEGRIEVYHEGVWGAVCDDGWRIPHGNVICRMLGYEKA-TAVTCCGAFVHDPPSNIWLDDVRCRGNERSIFRCAHRPWGINNCNMKELAGVVCHLVGATPSPPACGIKPSLP-----STGFARAGPARPEDWPWQTMILNRRRFPFCSGVLISARHVITAAHCFDRIIRTDQIIVRLGAYIARSGRLDWGMGSRWEQEIAVAAIHKHPSYQAPTRWANDIAVLKLARPAILNKRVNVVCMENETNIFPGTPCWTTGW 1341          

HSP 2 Score: 85.5001 bits (210), Expect = 8.821e-17
Identity = 60/203 (29.56%), Postives = 92/203 (45.32%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYLGYPGVRKSY---SNPGNNTTYLPLVSLKCNGNEQSPADCPVDRYAYCYTAKP----VGVICQDVA-------------------LAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCS 2152
            VC + +D  +  V CR LGY    ++Y    +  N T  + L  ++C G+E+S   C    +   +  +P      V C  VA                   L GG + NEGRVE++Y+G+ G +CDDN+ +  G+VICR LGY     + S         +    LD + C G E S+  C  +   + +C   + AG+VC 
Sbjct:  461 VCDDFWDLRDAHVVCRMLGYTHADRAYCCGRHRSNITRAIMLDDVQCRGDEESIFQCRTSEWGV-HNCQPGQEEASVSCVHVASFPSTPPPTLYAPTDVEFRLTGGPSPNEGRVEMFYRGEWGAVCDDNWRLRNGHVICRYLGYQMGARSVSCCSRYAASASRKIWLDDVVCRGTEKSLLRCIHRL-GSSNCNNFETAGVVCE 661          

HSP 3 Score: 83.5741 bits (205), Expect = 2.914e-16
Identity = 79/299 (26.42%), Postives = 130/299 (43.48%), Query Frame = 2
Query: 1571 LSPGYNQGYLTYNNSY-MVCSNEYDKNNTDVYCRYLGYPGVRKS------YSNPGNNTTYLPLVSLKCNGNEQSPADC---PVDRYAYCYTAKPVGVICQD---------VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCS-GNASSCGQVSTMENNWKYSNGYNTTFGATPWQARLMPSSVNEWCSATIIDRNWLLTSAN--CFTMSYNNFYVTVMSSRYYWDSSN 2401
            LSP   +  + Y   +  VC + ++ N+  V CR LGY    +S      Y +  +   +L    + C G+E S   C   P+  +      +  G++C+          V L  G    EGRVEV YK + G +CDD +++  G+V+CR LG+  A  +TS  G      +    LD + C G E SI +C  + W + +C  ++ AG+VC     ++  +V            +    G +P Q RL      +W    + D +W L++A+  C  + +         S+Y    SN
Sbjct:   33 LSPSEGRVEVQYRGVWGAVCDDYWELNDGHVACRSLGYRLGAESVSCCSRYGHSASGRIFLD--DVNCQGHEDSLDQCKSEPLGTHDCDPMREAAGLVCRSETRNTPEIPVRLMDGADLTEGRVEVMYKREWGAICDDMWDMRDGHVVCRMLGFDSA-TSTSCCGKYGPSKSRRVWLDDVQCKGEEKSISECNKREWGSNNCNYHETAGVVCKRAKPTTVPKVK-----------FRLEGGRSPNQGRLEVEYNGQW--GGVCDDHWTLSNAHVVCRELGFERGLSVACCSKYGTSLSN 315          

HSP 4 Score: 82.0333 bits (201), Expect = 9.463e-16
Identity = 56/196 (28.57%), Postives = 93/196 (47.45%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYLGYPGVRKS-----YSNPGNNTTYLPLVSLKCNGNEQSPADCPVDRY------------AYCYTAKPVGVICQDVALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSC-YGNDVAGLVCSG 2155
            +C + +D  +  V CR LG+     +     Y    +   +L    ++C G E+S ++C    +              C  AKP  V      L GGR+ N+GR+EV Y G+ G +CDD++ ++  +V+CR+LG+   ++    + Y     N  +L D I C GNE+S+  C  + W   +C    ++ GL C G
Sbjct:  165 ICDDMWDMRDGHVVCRMLGFDSATSTSCCGKYGPSKSRRVWLD--DVQCKGEEKSISECNKREWGSNNCNYHETAGVVCKRAKPTTVPKVKFRLEGGRSPNQGRLEVEYNGQWGGVCDDHWTLSNAHVVCRELGFERGLSVACCSKYGTSLSNRIWLDDVI-CDGNEESLASCSHRPWGRHNCDTLKEMVGLECVG 357          

HSP 5 Score: 73.9442 bits (180), Expect = 3.186e-13
Identity = 62/205 (30.24%), Postives = 88/205 (42.93%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYLGYPGVRKSY--SNPG-NNTTYLPLVSLKCNGNEQSPADC----------------------------------PVDRYAYCYTAK-PVGVICQDVALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCY 2122
            VC + +   N  V CR+LGYP        S  G + +  + L  + C GNE+S  DC                                  PV   A  ++ + PV    Q V L GG + NEGRVE+Y+ G+ G +CDD +N+  G+V+CR LG+  A  + S       +     LLD + C G E S+ DC  K      C+
Sbjct:  866 VCDDNWRIRNGHVICRHLGYPRALSVSCCSEFGISPSRRIWLDDVICRGNEKSLMDCRHRELGLNNCNQWEIASVKCDPGSNTASPVFTTVPVTSTAPSFSTRAPV----QRVRLVGGASPNEGRVEIYHNGEWGAVCDDFWNLLDGHVVCRMLGFPKA-ESVSCCSTYGSHWASKMLLDDVKCSGMESSLLDCSHKEIGQHDCH 1065          

HSP 6 Score: 67.781 bits (164), Expect = 2.069e-11
Identity = 47/149 (31.54%), Postives = 75/149 (50.34%), Query Frame = 2
Query: 1775 ADCPVDRYAYCYTAKPVG------------VICQDVALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGNASSCGQVST 2185
            +D PV R A+ + A   G            V+     L GG   +EGRVE++++G+ G +CDDN+ I  G+VICR LGY  A++ +  + +        +L D I C GNE S+ DC  +     +C   ++A + C   +++   V T
Sbjct:  809 SDAPVTRQAFPHVATGDGENMIAGMTSSPRVV--KFRLTGGSRESEGRVELFHRGEWGSVCDDNWRIRNGHVICRHLGYPRALSVSCCSEFGISPSRRIWLDDVI-CRGNEKSLMDCRHRELGLNNCNQWEIASVKCDPGSNTASPVFT 954          

HSP 7 Score: 67.781 bits (164), Expect = 2.430e-11
Identity = 40/104 (38.46%), Postives = 56/104 (53.85%), Query Frame = 2
Query: 1841 DVALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSC-YGNDVAGLVC 2149
             + L GG + +EGRVEV Y+G  G +CDD + +N G+V CR LGY     + S         +G   LD + C G+EDS+  C ++   T  C    + AGLVC
Sbjct:   26 QLRLRGGLSPSEGRVEVQYRGVWGAVCDDYWELNDGHVACRSLGYRLGAESVSCCSRYGHSASGRIFLDDVNCQGHEDSLDQCKSEPLGTHDCDPMREAAGLVC 129          

HSP 8 Score: 57.7658 bits (138), Expect = 2.399e-8
Identity = 37/108 (34.26%), Postives = 54/108 (50.00%), Query Frame = 2
Query: 1844 VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCY-GNDVAGLVCSGNAS 2164
            V L  G + NEG VEV+  G+   +CDD +++   +V+CR LGY +A  A     +         L D + C G+E+SI  C T  W   +C  G + A + C   AS
Sbjct:  437 VRLTNGPSPNEGTVEVFRDGQWATVCDDFWDLRDAHVVCRMLGYTHADRAYCCGRHRSNITRAIMLDD-VQCRGDEESIFQCRTSEWGVHNCQPGQEEASVSCVHVAS 543          
BLAST of Serine protease 12 vs. Ensembl Nematostella
Match: EDO39899 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8W0])

HSP 1 Score: 106.301 bits (264), Expect = 1.807e-23
Identity = 78/240 (32.50%), Postives = 116/240 (48.33%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYLGYPGVRKSYSNP--GNNTTYLPLVSLKCNGNEQSPADCPVDRYA---YCYTAKPVGVICQD----------VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVC-------------SGNASSCGQVSTMENNWKYSNGYNTTFGATPWQARL 2257
            VC + +  ++  V CR LG+PG ++++SN   G  T  + L  + C+G+E S  +C  +      +C   +  GV C++          V L+ G+T  EGRVE+YY GK G +CDD++ I+ G+V+CR LGY  A+ + + A +  G G    L D + C G E  + DC  K W   +C   + AG+VC              G  SS G+V        Y NG   T     W  RL
Sbjct:   26 VCDDFWSLDSARVVCRSLGFPGAKRAHSNAYFGAGTGPIQLDDVICDGSETSLTECERNGLGLKYFCGHHEDAGVECEEPITTPARQYEVRLSDGKTPYEGRVEIYYNGKWGTVCDDSWGIDDGHVVCRSLGYASALQSKTKAYFGPGTGVPIHLDD-VGCTGKETGLEDCRHKGWGVHNCGHQEDAGVVCNDGSVPVHFTRLVGGKTSSEGRVEV------YHNGAWGTVCDDEWSIRL 258          

HSP 2 Score: 100.908 bits (250), Expect = 7.556e-22
Identity = 63/189 (33.33%), Postives = 104/189 (55.03%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYLGYPGVR--KSYSNPGNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQ---------DVALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVC 2149
            VC +E+D N+ +V C+ LG+P  +    Y+  G     + L +++C G+E+S  +CP   +    C+ ++  GV C+            L GG   +EGRVEV+Y G  G +CDD ++    +V+C+ LGY  A +  +     +G G+G  +LD + C G ED+IG+CP++ W   +C   + AG+VC
Sbjct:  466 VCDDEWDFNDANVVCKSLGFPAAKAFHRYARYGQGAGRILLDNVECTGSERSVVECPHQGWGVQNCHHSEDAGVECRTENWTVPTHRTRLIGGSRPSEGRVEVFYNGAWGTVCDDLWDEADASVVCKSLGYPGARSFKT--MAYFGRGSGPIVLDNVECRGYEDAIGECPSRGWGVSNCGHKEDAGVVC 652          

HSP 3 Score: 98.9821 bits (245), Expect = 3.472e-21
Identity = 78/267 (29.21%), Postives = 124/267 (46.44%), Query Frame = 2
Query: 1604 YNNSY-MVCSNEYDKNNTDVYCRYLGYPGV----RKSYSNPGNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQD-------VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGNASSCGQVSTMENNWKYSNGYNTTFGATPWQARLMPSSV-NEWCSATIIDRNWLLTSAN--CFTMSYNN 2353
            YN  +  VC + +  ++  V CR LGY        K+Y  PG     + L  + C G E    DC    +    C   +  GV+C D         L GG+T++EGRVEVY+ G  G +CDD ++I   NV+CR LG+ +A+         +G G G   +D ++C G+E S+  C  + W   +C   +  G+VCS   +   QV  +  N             TP + R+  S + + W   T+ D +W +  A+  C ++ Y++
Sbjct:  132 YNGKWGTVCDDSWGIDDGHVVCRSLGYASALQSKTKAYFGPGTGVP-IHLDDVGCTGKETGLEDCRHKGWGVHNCGHQEDAGVVCNDGSVPVHFTRLVGGKTSSEGRVEVYHNGAWGTVCDDEWSIRLANVVCRSLGFSFALQVRD--RAAFGEGTGPIHMDNVHCTGSEMSLVKCGHRGWGISNCQHKEDVGVVCSERQA---QVRLVNGN-------------TPLEGRVELSYLPDTW--GTVCDDSWDIQDAHVVCRSLGYHH 377          

HSP 4 Score: 87.8113 bits (216), Expect = 9.914e-18
Identity = 63/188 (33.51%), Postives = 95/188 (50.53%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYLGYPGVRKSYSNPGNNTTY--LPLVSLKCNGNEQSPADCP---VDRYAYCYTAKPVGVICQDVA-------LAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVC 2149
            VC + +D  +  V CR LGY    ++  N         + L +L+C G E+S  DC      R   C      GV+C + +       L GGR   EGRVEV+Y  + G +CDD ++ N  NV+C+ LG+  A     +    YG G G  LLD + C G+E S+ +CP + W  ++C+ ++ AG+ C
Sbjct:  356 VCDDSWDIQDAHVVCRSLGYHHAVRAIGNGFFGRGRGNIYLSALRCRGTEKSLVDCEHTGFHRVPGCDHIDDAGVVCANQSVPKHRTRLVGGRGPYEGRVEVWYGEEWGTVCDDEWDFNDANVVCKSLGFPAA--KAFHRYARYGQGAGRILLDNVECTGSERSVVECPHQGWGVQNCHHSEDAGVEC 541          

HSP 5 Score: 76.2554 bits (186), Expect = 3.665e-14
Identity = 74/258 (28.68%), Postives = 110/258 (42.64%), Query Frame = 2
Query: 1604 YNNSY-MVCSNEYDKNNTDVYCRYLGYPGVRKSYSNP--GNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQD----VALAGGRTANEGRVEV-YYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCP-TKYWETKSCYGNDVAGLVCSGNASSCGQVSTMENNWKYSNGYNTTFGATPWQARLMPSSVNEWCSATIIDRNWLLTSANCFTMS 2344
            +N ++  VC +E+     +V CR LG+    +       G  T  + + ++ C G+E S   C    +    C   + VGV+C +    V L  G T  EGRVE+ Y     G +CDD+++I   +V+CR LGY +AV A  N  +  G GN       + C G E S+ DC  T +     C   D AG+VC+             N     +      G  P++ R+      EW   T+ D  W    AN    S
Sbjct:  242 HNGAWGTVCDDEWSIRLANVVCRSLGFSFALQVRDRAAFGEGTGPIHMDNVHCTGSEMSLVKCGHRGWGISNCQHKEDVGVVCSERQAQVRLVNGNTPLEGRVELSYLPDTWGTVCDDSWDIQDAHVVCRSLGYHHAVRAIGNGFFGRGRGNIYLSA--LRCRGTEKSLVDCEHTGFHRVPGCDHIDDAGVVCA-------------NQSVPKHRTRLVGGRGPYEGRVEVWYGEEW--GTVCDDEWDFNDANVVCKS 482          

HSP 6 Score: 51.9878 bits (123), Expect = 1.034e-6
Identity = 49/171 (28.65%), Postives = 82/171 (47.95%), Query Frame = 2
Query: 1844 VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETK-SCYGNDVAGLVCSGNASSCGQVSTMENNWKYSNGYNTTFGATPWQARLMPSSVNEWCSATIIDRNWLLTSAN--CFTMSY 2347
            + LAGG+   EGRVEV   G  G +CDD +++++  V+CR LG+  A  A S     +G G G   LD + C G+E S+ +C       K  C  ++ AG+ C         ++T    ++       + G TP++ R+      +W   T+ D +W +   +  C ++ Y
Sbjct:    2 IRLAGGKRPTEGRVEVAINGVWGTVCDDFWSLDSARVVCRSLGFPGAKRAHS--NAYFGAGTGPIQLDDVICDGSETSLTECERNGLGLKYFCGHHEDAGVECE------EPITTPARQYE----VRLSDGKTPYEGRVEIYYNGKW--GTVCDDSWGIDDGHVVCRSLGY 158          

HSP 7 Score: 51.9878 bits (123), Expect = 1.117e-6
Identity = 46/175 (26.29%), Postives = 73/175 (41.71%), Query Frame = 2
Query:  722 TGTVDMSYQSITLLPIDGNPLRGIPLLSYLGENY-TIQFGSLSTYDGHVLCQTLGYG-SVKSMRPYKNETGTKLIY-PTFDCRGSESRLTQCAELDGKKLHYEKYYYTSPNVTNVTCSENFNMQLVGGDNR-SGVVQLNLGGGFSYICADNMDPSAADAICMEMGFQGSLYYEGY 1234
             G V    Q+   L     PL G   LSYL + + T+   S    D HV+C++LGY  +V+++       G   IY     CRG+E  L  C      ++    +   +  V           +LVGG     G V++  G  +  +C D  D + A+ +C  +GF  +  +  Y
Sbjct:  320 VGVVCSERQAQVRLVNGNTPLEGRVELSYLPDTWGTVCDDSWDIQDAHVVCRSLGYHHAVRAIGNGFFGRGRGNIYLSALRCRGTEKSLVDCEHTGFHRVPGCDHIDDAGVVCANQSVPKHRTRLVGGRGPYEGRVEVWYGEEWGTVCDDEWDFNDANVVCKSLGFPAAKAFHRY 494          
BLAST of Serine protease 12 vs. Ensembl Nematostella
Match: EDO44639 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVH4])

HSP 1 Score: 97.4413 bits (241), Expect = 1.496e-21
Identity = 65/204 (31.86%), Postives = 102/204 (50.00%), Query Frame = 2
Query: 1598 LTYNNSY-MVCSNEYDKNNTDVYCRYLGYPGVRKSYSN----PGNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQDVA-------------LAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVC 2149
            + +NN +  +C + +D  +  V CR LG+ G  K+ S     PG    +L  V   C+G E S   C    +    C  ++  GV+C +V+             LAG    + GRVE+Y+ G+ G +CDD+++I   NV+CRQLGY        ++   +G G G   LDY+ C G E ++G C  K W + +C  ++ AG+ C
Sbjct:  176 ILHNNVWGTICDDNWDDMDATVVCRMLGFAGPSKAASGGKYGPGTGQIWLDEVG--CSGRESSLLQCRHREWGSNNCGHSEDAGVVCSNVSNGIFAAPGPEMVRLAGSSRKHRGRVEIYHNGEWGTVCDDSWDIRDANVVCRQLGY----QGKRSSCQTFGQGIGKIWLDYVRCTGTEKTLGSCAHKNWGSHNCGHSEDAGVTC 373          

HSP 2 Score: 57.7658 bits (138), Expect = 9.962e-9
Identity = 41/100 (41.00%), Postives = 55/100 (55.00%), Query Frame = 2
Query: 1844 VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGL 2143
            V L  G T  EGRVEVY+ G  G +CDDN++++   VIC+ LGY  A +A       YG G G   LD + C G+E SI  C    W   +C  ++ AG+
Sbjct:    1 VRLVNGPTQYEGRVEVYHAGHWGTICDDNWDMSEAIVICKMLGYPGAESAPR--SAAYGAGTGTIWLDELNCNGSETSISQCRHAGWGKNNCGHSEDAGV 98          

HSP 3 Score: 54.6842 bits (130), Expect = 9.946e-8
Identity = 38/103 (36.89%), Postives = 55/103 (53.40%), Query Frame = 2
Query: 1844 VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCS 2152
            V L  G  + EGR+E+ +    G +CDDN++     V+CR LG+     A S  G  YG G G   LD + C G E S+  C  + W + +C  ++ AG+VCS
Sbjct:  161 VRLRNGPNSMEGRIEILHNNVWGTICDDNWDDMDATVVCRMLGFAGPSKAAS--GGKYGPGTGQIWLDEVGCSGRESSLLQCRHREWGSNNCGHSEDAGVVCS 261          
BLAST of Serine protease 12 vs. Ensembl Nematostella
Match: EDO33055 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STB9])

HSP 1 Score: 92.4337 bits (228), Expect = 3.275e-20
Identity = 71/220 (32.27%), Postives = 107/220 (48.64%), Query Frame = 2
Query: 1526 GAVKVQCHSNSTKYFLSPGYNQGYLTYNNSY-MVCSNEYD-KNNTDVYCRYLGYPGVRKSYSNP--GNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQ-----DVALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCS 2152
            GA++V+   +  +     G  +  + YN  +  VC + +D + + +V CR LGY    K+      G  +  + L  ++C+G E S   C    +    C   +  GV+C+      V LAG R    GRVEV Y G  G +CDD ++I    V+CR LGY  AV AT      +G G+G  LLD + C G E +I DC    W   +C  ++ AG++C 
Sbjct:  113 GALRVRLAGSRVR-----GSGRVEVLYNGVWGTVCDDFWDIRKDGNVVCRMLGYKRAEKALPRAAFGRGSGQIWLDDVQCSGRESSIDYCAHKPWGKHNCGHHEDAGVVCEPRNPVRVRLAGSRVRGSGRVEVLYNGVWGTVCDDFWDIRDAKVVCRMLGYSRAVKATH--SASFGQGSGRILLDNVMCRGTEKTIADCTHSPWGKHNCRHSEDAGVICK 325          

HSP 2 Score: 66.2402 bits (160), Expect = 1.564e-11
Identity = 46/106 (43.40%), Postives = 59/106 (55.66%), Query Frame = 2
Query: 1844 VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINA---GNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCS 2152
            V L GGRT  EGRVEV++ G  G +CDD+F+IN    G+V+CR LGY  A  A   A +  G G      D + C G E SI  C  K W   +C  ++ AG+VC 
Sbjct:    6 VRLVGGRTPYEGRVEVFW-GVWGSVCDDHFDINDAHDGHVVCRMLGYKRAEKALPRAAFGRGSGQIWL--DDVQCSGRESSIDYCAHKPWGKHNCGHHEDAGVVCE 108          
BLAST of Serine protease 12 vs. Ensembl Nematostella
Match: EDO39811 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8Y4])

HSP 1 Score: 88.9669 bits (219), Expect = 6.531e-20
Identity = 66/207 (31.88%), Postives = 105/207 (50.72%), Query Frame = 2
Query: 1583 YNQGYLT--YNNSY-MVCSNEYDKNNTDVYCRYLGYPGVRKS--YSNPGNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQD-----------VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVC 2149
            +N+G +   +N ++  VC + +D ++  V CR LGYPG   S   ++ G     + +  + C G E+S   C    +    C  ++  GV+CQ              L  G + NEGRVE+Y+ G  G +CDD+++I+   V+C QLGY  AV  +S     +G GNG   +D ++C G E S+  C    W   +C  ++ AG+VC
Sbjct:    9 FNEGRVEIYHNGTWGTVCDDSWDISDAQVVCRQLGYPGAVSSPGRAHFGRGNGQIWMDDVHCMGYERSLDSCYFPGWGRHNCIHSEDAGVVCQTRNTTAIPPRPTTWLVNGSSFNEGRVEIYHNGTWGTVCDDSWDISDAQVVCHQLGYPGAV--SSPGRAHFGRGNGQIWMDDVHCMGYERSLDSCYFPGWGRHNCIHSEDAGVVC 213          

HSP 2 Score: 67.781 bits (164), Expect = 1.018e-12
Identity = 42/102 (41.18%), Postives = 61/102 (59.80%), Query Frame = 2
Query: 1844 VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVC 2149
            V L  G + NEGRVE+Y+ G  G +CDD+++I+   V+CRQLGY  AV  +S     +G GNG   +D ++C G E S+  C    W   +C  ++ AG+VC
Sbjct:    1 VRLVNGSSFNEGRVEIYHNGTWGTVCDDSWDISDAQVVCRQLGYPGAV--SSPGRAHFGRGNGQIWMDDVHCMGYERSLDSCYFPGWGRHNCIHSEDAGVVC 100          
BLAST of Serine protease 12 vs. Ensembl Medaka
Match: prss12 (serine protease 12 [Source:NCBI gene;Acc:105358156])

HSP 1 Score: 169.088 bits (427), Expect = 1.105e-42
Identity = 186/723 (25.73%), Postives = 287/723 (39.70%), Query Frame = 2
Query:  941 YPTFDCRGSESRLTQCAE--LDGKKLHYEKYYYTSPNVTNVTCSENFNMQLVGGDNRS-GVVQLNLGGGFSYICADNMDPSAADAICMEMGFQGSLYYEGYMGNTNASNYYSSFSGDYYRYHYDTIMTNIRCNSNT-KLRNCKXXXXXXXXXXXXXXXXXXXXXXXXXXQASGTNSFHXXXXXXXXXXXXXXXXXXXXXGAVKVQCH---SNSTKYFLSPGYNQGYLT--YNNSY-MVCSNEYDKNNTDVYCRYLGY-PGVRKSYSNP--------GNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQ------------DVALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVC-------------SGNASSCGQVSTMENNWKYSNGYNTTFGATPWQA--RLMPSSVNEW--CSATIIDRNWLLTSANCFTMSYNN--FYVTVMSSRYYWDSSNFATTNSIQSVFIHPQYSTVTGDYNLALVKVNS----------IAFDANVQPLCLPA--GYIPVDGLSCVTTGWNHGLNTYSRPLLGKPVLIQNSSYCKDHLQFDDTRMARYLC-----SDNNMDPSAYFNGESGGPLTCSINGKN-VLXXXXXXXXXXXXXXXIRLYTRVDYWDSWIRNIMKNN 2899
            +    CRG E  L  C++   +G++             T VT      M+L+GG++ S G V++   G +  IC D  D S A+ +C ++G  G+    G         ++   SG  +       +  +RC  N   L  C    +  +                        N  H+                        V CH     +T+     G ++G L   Y   +  VC + + K+N+ V CR LGY  G       P        G  +  + L  + C G E S   C    +    C   + V + C              V LAGG ++ EGRVE+Y  G+ G +CDD +      V+CRQLGY  A  A +     +G G G   +D + C G+E SI DC  +   T +C  ++ AG++C                 S CG         +   G N+  G  PWQA  RL  S  +    C AT+ID  W+LTSA+CF    N+   Y   +   +      +     +  +  HP+Y + + DY+LALV ++           ++F  +V P+CLPA    +     +C  TGW     +YS+ L   P+ +     C+ +  +     +R LC     SD  +D      G+SGGPL C   G   V+ GV +   A     S  +YT+V  +  WIR I++ +
Sbjct:  177 WKEVHCRGEEPDLLHCSKSTWNGEECLTAAAVTCIQQKTVVT----LPMRLIGGESESEGTVEVFHAGQWGSICDDQWDDSDAEVVCRQLGLSGAAKAWGQA-------HFGKSSGRVW-------LDEVRCTGNELSLEQCTKSAWGEH------------------------NCLHSED--------------------AGVSCHPLTDGATRLVGGAGSHEGRLEIFYQGQWGTVCDDGWTKSNSQVVCRQLGYRTGETLLLEGPDIPPGPRFGVGSGPILLDDVNCTGKEPSLLLCSRREWLCHDCSHQEDVHIACNPEINGESLPASLRVRLAGGESSREGRVELYLFGQWGTVCDDGWTDQDAEVVCRQLGYSGA--AKARLMAYFGEGTGPIHMDNVNCIGDERSIADCIKQMPGTHNCRHSEDAGVICDYGEPQHSTKEAKDPAISLCGLRLVHTRQRRIIGGENSLRGGWPWQAAIRLRGSKGDGRLVCGATLIDTCWVLTSAHCFKRYGNSTKLYKVRVGDYHSLVPEEYEEEYGVDKIVFHPRYHSHSNDYDLALVHLSPGAVRQTAGECVSFSRHVLPVCLPARKERLLKQASNCHITGWGDTGRSYSKTLQQAPLSLLPRRLCQQY--YHSAFTSRMLCAGSVQSDRRVDSC---RGDSGGPLVCERPGGGWVIYGVTSWGHACRTQQSPGVYTKVSAFSFWIRKIIRRD 830          

HSP 2 Score: 77.411 bits (189), Expect = 5.277e-14
Identity = 57/186 (30.65%), Postives = 85/186 (45.70%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYL--GYPGVRKSYSNPGNNTTYLPLVSLKCNGNEQSPADCPVDRY--AYCYTAKPVGVICQD------VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVC 2149
            VCSN++   +  V CR L  G  G  ++      + T +    + C G E     C    +    C TA  V  I Q       + L GG + +EG VEV++ G+ G +CDD ++ +   V+CRQLG   A  A       +G  +G   LD + C GNE S+  C    W   +C  ++ AG+ C
Sbjct:  137 VCSNDWGDEDAAVVCRQLDEGISGRARAVPLFRTSKTRIHWKEVHCRGEEPDLLHCSKSTWNGEECLTAAAVTCIQQKTVVTLPMRLIGGESESEGTVEVFHAGQWGSICDDQWDDSDAEVVCRQLGLSGAAKAWG--QAHFGKSSGRVWLDEVRCTGNELSLEQCTKSAWGEHNCLHSEDAGVSC 320          
BLAST of Serine protease 12 vs. Ensembl Medaka
Match: si:ch73-127m5.1 (neurotrypsin [Source:NCBI gene;Acc:101157816])

HSP 1 Score: 128.257 bits (321), Expect = 9.961e-30
Identity = 142/500 (28.40%), Postives = 213/500 (42.60%), Query Frame = 2
Query: 1574 SPGYNQGYLTYNNSY-MVCSNEYDKNNTDVYCRYLGYPGVRKSYSNP--GNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQD-------------------VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGY-GYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGNAS-----------SCGQVSTMENNWKYSNGYNTTFGAT--PWQARLMPSSVNE----WCSATIIDRNWLLTSANCFTM--SYNNFYVTVMSSRYYWDSSNFATTNSIQSVFIHPQYSTVTGDYNLALVKVNS-----IAFDANVQPLCLPA------GYIPVDGLSCVTTGWNHGLNTYSRPLLGKPVLIQNSSYCKDHLQFDDTRMAR-YLCSDNNMDPSAYF----NGESGGPLTCS-INGKNVLXXXXXXXXXXXXXXXIRLYTRVDYWDSWIRNIM 2890
            SP   +  + +N  +  VC + + + + +V CR LGY G  +  ++   G     + L  + C G+E S  DC    +    C  ++ VGV C+                    V L GG +  EGRVEVY  G  G +CD  +N     V+CRQLG+ G A  A       +G G G   LD + C G E+ +G+CP+     + C   + AG+ C                SCG    +E   K  N    +   T  PWQ  +   S  E     CS T+I   W+LTSA C +   S    YV  + +           T + + + +H ++   +G ++LAL+K+ S     + FD N    CLP       G IP   +  VTTGW          ++   V + +   CK   +F ++  +   LC+ +  D S        G SGG L C   +G+ VL GVV+     A  SS  LYTRV  + SW+  ++
Sbjct:  345 SPWEGRVEVFHNGDWGTVCDDHWSQQHAEVVCRQLGYRGHAEVVTDGLFGKGAGLILLDDVHCEGSETSLLDCRHGIWGRTDCSHSEDVGVRCRVRSSQETNEVPVISPSTGPLVRLVGGSSRKEGRVEVYLHGDWGSICDSGWNDLNAAVVCRQLGHSGRATAAVG-----FGQGKGPIHLDQVRCTGKEEFLGECPSLGQSIQGCGRREDAGVKCDATPHEAAVKTKPEELSCGLRKMVEVEGKKRNHEEESMSRTTWPWQVSVWLQSQKEGEGPLCSGTLISPCWVLTSAFCLSRFGSDPTIYVVRVGAS--------EQTLTPERLVLHRKFKGQSGGHDLALLKLPSTKGHCLTFDPNTNAACLPGTDGAKEGNIPASCVVMVTTGW-----AGPDSVVASWVPLMSPWQCKK--RFGNSFSSHGTLCAASPPDTSLLRGDGCQGNSGGGLVCQDESGRWVLTGVVSGGYGCADPSSPALYTRVSRFRSWMDEVI 824          

HSP 2 Score: 92.0485 bits (227), Expect = 1.746e-18
Identity = 65/186 (34.95%), Postives = 98/186 (52.69%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYLGYPGVRKSYS--NPGNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQD-----VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGY-GYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVC 2149
            VC +++D  + +V CR LG+ G+ K++S  + G  +  + L ++KC GNE     C    +    C   +  GV C       V L GG +  EGRVEV++ G  G +CDD+++     V+CRQLGY G+A   T     L+G G G  LLD ++C G+E S+ DC    W    C  ++  G+ C
Sbjct:  255 VCDDQWDDRDAEVVCRQLGFGGIAKAWSWAHFGQGSGPILLDAVKCTGNELFLDQCSHGDWEQHNCDHMEDAGVSCSPYTDGVVRLVGGDSPWEGRVEVFHNGDWGTVCDDHWSQQHAEVVCRQLGYRGHAEVVTD---GLFGKGAGLILLDDVHCEGSETSLLDCRHGIWGRTDCSHSEDVGVRC 437          

HSP 3 Score: 82.0333 bits (201), Expect = 2.120e-15
Identity = 76/292 (26.03%), Postives = 119/292 (40.75%), Query Frame = 2
Query: 1544 CHSNSTKYFLSP--GYNQGYLTYNNSY-MVCSNEYDKNNTDVYCRYLGYP--GVRKSYSNPGNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQD-------VALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGNASSCGQVSTMENNWKYSNGYNTTFGA-TPWQARLMPSSVNEWCSATIIDRNWLLTSAN--CFTMSYNNFYVTV 2368
            CH  + +   S   G  +  +  N  +  VC++ +   +  V CR LG+   G    +S  G+ +       L C G+E +   C    +    C       ++C         + L  G    EGRVEV++ G+ G +CDD ++     V+CRQLG+G    A S     +G G+G  LLD + C GNE  +  C    WE  +C   + AG+ CS                 Y++G     G  +PW+ R+      +W   T+ D +W    A   C  + Y      V
Sbjct:  117 CHQGAARLVGSSISGSGRVEIYLNGQWGAVCNSHWTDRDASVICRQLGFGDIGTALQHSQFGSGSGLFHYERLGCRGDEGTLMKCQSRTFVTGDCSHGNEATLVCAPPEGSGPPLRLVEGEEDFEGRVEVFHAGRWGTVCDDQWDDRDAEVVCRQLGFGGIAKAWS--WAHFGQGSGPILLDAVKCTGNELFLDQCSHGDWEQHNCDHMEDAGVSCS----------------PYTDGVVRLVGGDSPWEGRVEVFHNGDW--GTVCDDHWSQQHAEVVCRQLGYRGHAEVV 388          
BLAST of Serine protease 12 vs. Ensembl Medaka
Match: ENSORLT00000010945.2 (pep primary_assembly:ASM223467v1:20:17371788:17374100:1 gene:ENSORLG00000008718.2 transcript:ENSORLT00000010945.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 98.9821 bits (245), Expect = 2.803e-22
Identity = 74/236 (31.36%), Postives = 115/236 (48.73%), Query Frame = 2
Query: 2201 KYSNGYNTTFGATPWQARLMPSSVNEWCSATIIDRNWLLTSANCFTMS---YNNFYV--TVMSSRYYWDSSNFATTNSIQSVFIHPQYSTVTGDYNLALVKVNSIAFDAN-VQPLCLPA-GYIPVDGLSCVTTGWNHGL-NTYSRPLLGKPVLIQNSSYCKDHLQFDDTRMARYLCSDNNMDPSAYFNGESGGPLTCSINGKN-VLXXXXXXXXXXXXXXXIRLYTRVDYWDSWIR 2881
            K   G +   G+ PWQ  L        C AT++   WL+++A+CF  S   Y++ +     M  R     ++ A T  I+ + +HPQY   T DY++AL+++++  F ++ VQP+C+PA  +    G SC  TGW   + +  +  L    V I N   C     +DD    R +C+ N         G+SGGPL C   GK   L G+V+     AR +   +YT+V  +  WIR
Sbjct:   53 KIVGGSDALAGSWPWQVSLQMERYGHVCGATLVSNRWLISAAHCFQDSDAIYSDPHAWRAYMGMRVMARGNHGAATRLIRRILLHPQYDQFTSDYDIALLELSAPVFFSDLVQPVCVPASSHTFTTGTSCYVTGWGVLMEDELASRLQEASVKIINRKTCNK--LYDDAVTPRMMCAGNLQGGVDACQGDSGGPLVCLERGKRWFLAGIVSWGEGCARQNRPGVYTQVVKFTDWIR 286          
BLAST of Serine protease 12 vs. Ensembl Medaka
Match: corin (corin, serine peptidase [Source:NCBI gene;Acc:101175632])

HSP 1 Score: 88.1965 bits (217), Expect = 5.165e-18
Identity = 61/213 (28.64%), Postives = 95/213 (44.60%), Query Frame = 2
Query: 2162 SSCGQVS----TMENNWKYSNGYNTTFGATPWQARLMPSSVNEWCSATIIDRNWLLTSANCFT-MSYNNFYVTVMSSRYYWDSSNFATTNSIQSVFIHPQYSTVTGDYNLALVKVNS-IAFDANVQPLCLP-AGYIPVDGLSCVTTGWNHGLN---TYSRPLLGKPVLIQNSSYCKDHLQFDDTRMARYLCSDNNMDPSAYFNGESGGPLTCS 2770
            S CGQ      T     +   G  +  GA PWQ  L        C   +I R W+LT A+CF      + +  V+        +  + +  ++S+ +HP+Y+    DY++++V+++S +   A V+P+CLP  G +P     C  TGW H  N   +   P  G  V I +   C+ +     T  AR LC+           G+SGGPL C 
Sbjct:  132 SECGQRQVGGVTRHRRKRILGGRVSRQGAWPWQCSLQSGQSGHVCGCVLIARKWVLTVAHCFEGRESADLWKVVLGLTNLDHPAAHSQSRGVRSIIVHPRYNRAVVDYDISVVQLDSEVEETAFVRPVCLPRPGQLPSPDSYCYITGWGHMGNRSESTPSPRFGGVVRIISLPQCQSYFDM-KTITARMLCAGYEAGTVDSCMGDSGGPLVCE 343          
BLAST of Serine protease 12 vs. Ensembl Medaka
Match: ENSORLT00000033752.1 (pep primary_assembly:ASM223467v1:20:9844150:9845879:1 gene:ENSORLG00000004947.2 transcript:ENSORLT00000033752.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 88.1965 bits (217), Expect = 7.903e-18
Identity = 68/201 (33.83%), Postives = 105/201 (52.24%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYL--GYPGVRKSYSNPGNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQD-VALAG-GRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGNASSCGQVSTMENNWKY 2206
            VC N++D  + +V CR L  G        ++ G+ +  + L ++ C+GNE S  +C    Y    C   +   VIC   + L G G T   GRVEVY+ G  G +CDD++++N  NV+CRQL  G A+         +G G+    LD + C GNE S+  C  + + T +C   + AG++CSG   S   VS +++N+ Y
Sbjct:  217 VCDNDWDLKDANVVCRQLSCGTALQAPGSAHFGHGSDPIWLDNVACSGNESSLTECGHRGYGSHDCNHGEDAAVICSGPIRLVGSGSTRCSGRVEVYHNGSWGTVCDDDWDLNDANVVCRQLSCGPALQTPG--SSHFGQGSDKIWLDDVACSGNESSLIQCGHRGYGTHNCDHREDAGVICSGEEISYIIVSFIKSNFIY 415          

HSP 2 Score: 78.5666 bits (192), Expect = 9.542e-15
Identity = 61/187 (32.62%), Postives = 91/187 (48.66%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYL--GYPGVRKSYSNPGNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVICQDVALAG-GRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGNASS 2167
            VC N++D N+  V CR L  G        ++ G  +  + L  + C+G+E S   C    Y    C   +  G+I   + L G G     G VEVY  G  G +CDD++++N   V+CRQL  G A+ A       +G G+    LD + C GNE S+  C  + + T +C   + AG++CSG   S
Sbjct:   10 VCDNDWDLNDAKVVCRQLSCGTALQAPGSAHFGQGSDPIWLDDVACSGSESSLTQCGHRGYGTHNCNHGEDAGIIVSQIRLVGSGLPRCSGIVEVYDNGVWGTVCDDDWDLNDAIVVCRQLSCGTALQAPR--SAHFGQGSDPIWLDDVACSGNESSLTQCGHRGYGTHNCNHGEDAGVICSGEEIS 194          

HSP 3 Score: 72.7886 bits (177), Expect = 6.535e-13
Identity = 72/264 (27.27%), Postives = 116/264 (43.94%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYL----GYPGVRKSYSNPGNNTTYLPLVSLKCNGNEQSPADCPVDRYAY--CYTAKPVGVIC--QDVALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGNASSCGQVSTMENNWKYSNGYNTTFGATPWQARLMPSSVNEWCSATIIDRNWLLTSAN--CFTMSYNNFYVTVMSSRY 2383
            VC +++D N+  V CR L         R ++   G++  +L  V+  C+GNE S   C    Y    C   +  GVIC  ++++    +      VEVY+ G  G +CD+++++   NV+CRQL  G A+ A       +G+G+    LD + C GNE S+ +C  + + +  C   + A ++CSG     G                   G+T    R+       W   T+ D +W L  AN  C  +S      T  SS +
Sbjct:  113 VCDDDWDLNDAIVVCRQLSCGTALQAPRSAHFGQGSDPIWLDDVA--CSGNESSLTQCGHRGYGTHNCNHGEDAGVICSGEEISYIIEKIHFCDVVEVYHNGVWGTVCDNDWDLKDANVVCRQLSCGTALQAPG--SAHFGHGSDPIWLDNVACSGNESSLTECGHRGYGSHDCNHGEDAAVICSGPIRLVGS------------------GSTRCSGRVEVYHNGSW--GTVCDDDWDLNDANVVCRQLSCGPALQTPGSSHF 352          
BLAST of Serine protease 12 vs. Planmine SMEST
Match: SMESG000075230.1 (SMESG000075230.1)

HSP 1 Score: 1713.35 bits (4436), Expect = 0.000e+0
Identity = 929/952 (97.58%), Postives = 937/952 (98.42%), Query Frame = 2
Query:   44 SGQYVTEIDECIKNAVTIQYEYTITQNDLRNGTCGFLMRTNGYIVIQPILVNISQSARIRLYLLTGNASAPDKMKISEYYNRFLFRDLMFIGAGNLRIALVVLSKNESISIGNFQFLYRQSCLVEMNAEDYPKFMSPNFLPKKPXXXXXXXXXXXXXXXCTYRVSSRTNKSFSVNFDALYGRYKYDLIVNNTYIYSPVKVAVPGDQKLEFILRTYYSYSDSNLFGFTGTVDMSYQSITLLPIDGNPLRGIPLLSYLGENYTIQFGSLSTYDGHVLCQTLGYGSVKSMRPYKNETGTKLIYPTFDCRGSESRLTQCAELDGKKLHYEKYYYTSPNVTNVTCSENFNMQLVGGDNRSGVVQLNLGGGFSYICADNMDPSAADAICMEMGFQGSLYYEGYMGNTNASNYYSSFSGDYYRYHYDTIMTNIRCNSNTKLRNCKXXXXXXXXXXXXXXXXXXXXXXXXXXQASGTNSFHXXXXXXXXXXXXXXXXXXXXXGAVKVQCHSNSTKYFLSPGYNQGYLTYNNSYMVCSNEYDKNNTDVYCRYLGYPGVRKSYSNPGNNTTYLPLVSLKCNGNEQSPADCPVDRYAYCYTAKPVGVICQDVALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGNASSCGQVSTMENNWKYSNGYNTTFGATPWQARLMPSSVNEWCSATIIDRNWLLTSANCFTMSYNNFYVTVMSSRYYWDSSNFATTNSIQSVFIHPQYSTVTGDYNLALVKVNSIAFDANVQPLCLPAGYIPVDGLSCVTTGWNHGLNTYSRPLLGKPVLIQNSSYCKDHLQFDDTRMARYLCSDNNMDPSAYFNGESGGPLTCSINGKNVLXXXXXXXXXXXXXXXIRLYTRVDYWDSWIRNIMKNN 2899
            SGQYVTEIDECIKNAVTIQYEYTITQNDLRNGTCGFLMRTNGYIVIQPILVNISQSARIRLYLLTGNASAPDKMKISEYYNRFLFRDLMFIGAGNLRIALVVLSKNESISIGNFQFLYRQSCLVEMNAEDYPKFMSPNFLPKKPALAALLNNANQSNLNCTYRVSSRTNKSFSVNFDALYGRYKYDLIVNNTYIYSPVKVAVPGDQKLEFILR YYSY +SNL+GFTGTVDMSYQSITLLPIDGNPLRGIPLLSYLGENYTIQFGSLSTYDGHVLCQTLGYGSVKSMRPYKNETGTKLIYPTFDCRGSESRLTQCAELDGKKLHYEKYYYTSPNVTNVTCSENFNMQLVGGDNRSGVVQLNLGGGFSYICADNMDPSAADAICMEMGFQGSLYYEGYMGNTNASNYY  FSGDYYRYHYDTIMTNIRCNSNTKLRNCKYQIYRSYYN++N+YGYYGY+GSDYYNQASGTNSFHNNPSDYYN +   YYY     GAVKVQCHSNSTKY LSPGYNQGYLTYNNSYMVCSNEYDKNNTDVYCRYLGYPGVRKSYSNPGNNTTYLPLVSLKCNGNEQSPADCPVDRYAYCYTA+PVGVICQDVALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSN GYLYGYGNGNFLLDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGNASSCGQVSTMENNWKYSNGYNTTFGATPWQARLMPSSVNEWCSATIIDRNWLLTSANCFTMSYNNFYVTVMSSRYYWDSSNFATTNSIQSVFIHPQYSTVTGDYNLALVKVNSIAFDANVQPLCLPAGYIPVDGLSCVTTGWNHGLNTYSRPLLGKPVLIQNSSYCKDHLQFDDTRMARYLCSDNNMDPSAYFNGESGGPLTCSINGKNVLVGVVARSVAGARASSIRLYTRVDYWDSWIRNIMKNN
Sbjct:   15 SGQYVTEIDECIKNAVTIQYEYTITQNDLRNGTCGFLMRTNGYIVIQPILVNISQSARIRLYLLTGNASAPDKMKISEYYNRFLFRDLMFIGAGNLRIALVVLSKNESISIGNFQFLYRQSCLVEMNAEDYPKFMSPNFLPKKPALAALLNNANQSNLNCTYRVSSRTNKSFSVNFDALYGRYKYDLIVNNTYIYSPVKVAVPGDQKLEFILRNYYSYFESNLYGFTGTVDMSYQSITLLPIDGNPLRGIPLLSYLGENYTIQFGSLSTYDGHVLCQTLGYGSVKSMRPYKNETGTKLIYPTFDCRGSESRLTQCAELDGKKLHYEKYYYTSPNVTNVTCSENFNMQLVGGDNRSGVVQLNLGGGFSYICADNMDPSAADAICMEMGFQGSLYYEGYMGNTNASNYYDYFSGDYYRYHYDTIMTNIRCNSNTKLRNCKYQIYRSYYNFINHYGYYGYYGSDYYNQASGTNSFHNNPSDYYNYWNGYYYYYCYS-GAVKVQCHSNSTKYSLSPGYNQGYLTYNNSYMVCSNEYDKNNTDVYCRYLGYPGVRKSYSNPGNNTTYLPLVSLKCNGNEQSPADCPVDRYAYCYTARPVGVICQDVALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSNTGYLYGYGNGNFLLDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGNASSCGQVSTMENNWKYSNGYNTTFGATPWQARLMPSSVNEWCSATIIDRNWLLTSANCFTMSYNNFYVTVMSSRYYWDSSNFATTNSIQSVFIHPQYSTVTGDYNLALVKVNSIAFDANVQPLCLPAGYIPVDGLSCVTTGWNHGLNTYSRPLLGKPVLIQNSSYCKDHLQFDDTRMARYLCSDNNMDPSAYFNGESGGPLTCSINGKNVLVGVVARSVAGARASSIRLYTRVDYWDSWIRNIMKNN 965          
BLAST of Serine protease 12 vs. Planmine SMEST
Match: SMESG000016089.1 (SMESG000016089.1)

HSP 1 Score: 140.969 bits (354), Expect = 1.351e-33
Identity = 114/470 (24.26%), Postives = 188/470 (40.00%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYLGYPGVRKSYSNPGNN-----TTYLPLVSLKCNGNEQSPADCPVD--RYAYCYTAKPVGVICQ--------------------------------------------DVALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVC---------SGNASS-----------CGQVSTMENNWKYSNGYNTTFGATPWQARLMPSSVN---EWCSATIIDRNWLLTSANCFTMSYNNFYVTVMSSRYYWDSSN---FATTNSIQSVFIHPQYS-TVTGDYNLALVKVNS-----IAFDANVQPLCLPA-GYIPVDGLSCVTTGWNHGLNTYSRPLLGKPVLIQNSSYCKDHLQFDDTRMARYLCSDNNMDPSAYFNGESGGPLTCSING 2779
            +C + +  +   V C+ LG+    +     G          + L  LKC G E S  +CP D  R   C + +  GVIC+                                             V L  G  +  GRVE+     KG +CDD F  +  +VICR LG      A ++  +  G G          C GNE S+  C +  W    C   + AG++C         +  A+S           CG+    +   +   G+ T +GA PWQ  +     +    WC  +I+  +W++++++C+    N ++V        W+++    +  +  I+ +F++P+Y    T D++ AL+K+       I F+ +VQP+CLP  G +P     C+ +GW   L   +  LL   V +  +  CK+   + D    R  C+           G+SGGPL C +NG
Sbjct:  706 ICDDRFTISEAHVICKQLGFIEALEYVHGSGVKFGKVRDPIILLDELKCKGTEFSIEECPHDVWRKHNCKSEEIAGVICKVDRACTNTEFRCQKDKTCIKMSQMCDGKVDCSDRSDEPEGQCFLSVKLVNGPDSYSGRVEIQRSLSKGTVCDDGFTDSEASVICRMLGISGRAQAVTDTRFGSGVGEIVLSNP--RCRGNETSLVQCNSFKWGEHKCSHKEDAGVICGLPILEHPITTTATSLKKSEQVPGLTCGRKPITQRRGRVVGGFETVYGAFPWQVGVRHRVGDYDIHWCGGSILSEDWIISASHCYEKPKNRYFVRTGD----WNNNEMDIYEQSFEIEELFLNPKYKGPPTFDFDTALIKIKRNNGIGIIFNDHVQPVCLPKPGMVPDLKTKCLVSGWGDTLVETAEKLLAAEVPLIKAERCKEF--YKDRITDRMQCAGYEAGGIDTCQGDSGGPLVCQVNG 1167          

HSP 2 Score: 73.1738 bits (178), Expect = 8.144e-13
Identity = 36/105 (34.29%), Postives = 58/105 (55.24%), Query Frame = 2
Query: 1841 DVALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVN-ATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCS 2152
            ++ L G +   EG+VE+ Y+G+ G +CDD F I+  +VIC+QLG+  A+     +        +   LLD + C G E SI +CP   W   +C   ++AG++C 
Sbjct:  681 EIRLTGSKNDWEGKVEIRYQGEWGYICDDRFTISEAHVICKQLGFIEALEYVHGSGVKFGKVRDPIILLDELKCKGTEFSIEECPHDVWRKHNCKSEEIAGVICK 785          
BLAST of Serine protease 12 vs. Planmine SMEST
Match: SMESG000016089.1 (SMESG000016089.1)

HSP 1 Score: 140.584 bits (353), Expect = 1.761e-33
Identity = 114/470 (24.26%), Postives = 188/470 (40.00%), Query Frame = 2
Query: 1622 VCSNEYDKNNTDVYCRYLGYPGVRKSYSNPGNN-----TTYLPLVSLKCNGNEQSPADCPVD--RYAYCYTAKPVGVICQ--------------------------------------------DVALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVC---------SGNASS-----------CGQVSTMENNWKYSNGYNTTFGATPWQARLMPSSVN---EWCSATIIDRNWLLTSANCFTMSYNNFYVTVMSSRYYWDSSN---FATTNSIQSVFIHPQYS-TVTGDYNLALVKVNS-----IAFDANVQPLCLPA-GYIPVDGLSCVTTGWNHGLNTYSRPLLGKPVLIQNSSYCKDHLQFDDTRMARYLCSDNNMDPSAYFNGESGGPLTCSING 2779
            +C + +  +   V C+ LG+    +     G          + L  LKC G E S  +CP D  R   C + +  GVIC+                                             V L  G  +  GRVE+     KG +CDD F  +  +VICR LG      A ++  +  G G          C GNE S+  C +  W    C   + AG++C         +  A+S           CG+    +   +   G+ T +GA PWQ  +     +    WC  +I+  +W++++++C+    N ++V        W+++    +  +  I+ +F++P+Y    T D++ AL+K+       I F+ +VQP+CLP  G +P     C+ +GW   L   +  LL   V +  +  CK+   + D    R  C+           G+SGGPL C +NG
Sbjct:  705 ICDDRFTISEAHVICKQLGFIEALEYVHGSGVKFGKVRDPIILLDELKCKGTEFSIEECPHDVWRKHNCKSEEIAGVICKVDRACTNTEFRCQKDKTCIKMSQMCDGKVDCSDRSDEPEGQCFLSVKLVNGPDSYSGRVEIQRSLSKGTVCDDGFTDSEASVICRMLGISGRAQAVTDTRFGSGVGEIVLSNP--RCRGNETSLVQCNSFKWGEHKCSHKEDAGVICGLPILEHPITTTATSLKKSEQVPGLTCGRKPITQRRGRVVGGFETVYGAFPWQVGVRHRVGDYDIHWCGGSILSEDWIISASHCYEKPKNRYFVRTGD----WNNNEMDIYEQSFEIEELFLNPKYKGPPTFDFDTALIKIKRNNGIGIIFNDHVQPVCLPKPGMVPDLKTKCLVSGWGDTLVETAEKLLAAEVPLIKAERCKEF--YKDRITDRMQCAGYEAGGIDTCQGDSGGPLVCQVNG 1166          

HSP 2 Score: 73.1738 bits (178), Expect = 8.939e-13
Identity = 36/105 (34.29%), Postives = 58/105 (55.24%), Query Frame = 2
Query: 1841 DVALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVN-ATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCS 2152
            ++ L G +   EG+VE+ Y+G+ G +CDD F I+  +VIC+QLG+  A+     +        +   LLD + C G E SI +CP   W   +C   ++AG++C 
Sbjct:  680 EIRLTGSKNDWEGKVEIRYQGEWGYICDDRFTISEAHVICKQLGFIEALEYVHGSGVKFGKVRDPIILLDELKCKGTEFSIEECPHDVWRKHNCKSEEIAGVICK 784          
BLAST of Serine protease 12 vs. Planmine SMEST
Match: SMESG000016088.1 (SMESG000016088.1)

HSP 1 Score: 136.346 bits (342), Expect = 3.044e-32
Identity = 116/469 (24.73%), Postives = 185/469 (39.45%), Query Frame = 2
Query: 1619 MVCSNEYDKNNTDVYCRYLGYPGVRKSYSNP-----GNNTTYLPLVSLKCNGNEQSPADCPVD--RYAYCYTAKPVGVICQ--------------------------------------------DVALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVC------------------SGNASSCGQVSTMENNWKYSNGYNTTFGATPWQARLMPSSVN---EWCSATIIDRNWLLTSANCFTMSYNNFYVTVMSSRYYWDSS---NFATTNSIQSVFIHPQYSTVTGDYNLALVKVNS-----IAFDANVQPLCLPA-GYIPVDGLSCVTTGWNHGLNTYSRPLLGKPVLIQNSSYCKDHLQFDDTRM-ARYLCSDNNMDPSAYFNGESGGPLTCSING 2779
             VC + +D    +V C+ LG+ G  +S  +       N +  L +  +KC G E S  +C     R   C   +  GV+C+                                             V LA G  A  GRVE+   G KG +CDD+++     VICR L       A +     +G G G  +LD + C G E ++ +CP   W    C   +  G++C                        CG    +    +   G+   +GA PWQ  +     +    WC A+I+  +W++ +A+C+    +++ V        WD++    +     I+ + +HP ++    DY+ AL+K+       I F+  VQP+CLP  G +P     C+ +GW   L+TY   LL   V +     C    +F   R+  R  C+           G+SGGPL C +NG
Sbjct:  706 FVCDDGFDIKAAEVVCKQLGFLGAMESIHSAVNRFGKNRSPNLLVDEIKCTGTENSLEECKHSPWRSHNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCDDDYDDKDAAVICRML--QIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVICGLPDEVVTQPPKPTAKVDPAAGLKCGHRPIVHKRGRVVGGFEAVYGAFPWQVGVRQKVDDYDSHWCGASILSEDWIIGAAHCYARPKSDYRVRTGD----WDNASDDKYEQVFEIEELILHPNWNNANYDYDYALIKIERNDGVGIKFNNYVQPVCLPKLGMVPDPNSKCLVSGWGDTLSTYPEKLLAAEVPLIKHERC---FEFYKGRLTERMQCAGYEAGGIDTCQGDSGGPLVCKVNG 1165          

HSP 2 Score: 73.9442 bits (180), Expect = 5.324e-13
Identity = 38/105 (36.19%), Postives = 61/105 (58.10%), Query Frame = 2
Query: 1841 DVALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGNVICRQLGYGYAVNAT-SXXXXXXXXXXXXXXXDYIYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCS 2152
            ++ L G     EG+VEV Y+G+ G +CDD F+I A  V+C+QLG+  A+ +  S         + N L+D I C G E+S+ +C    W + +C  +++AG+VC 
Sbjct:  682 EIRLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGFLGAMESIHSAVNRFGKNRSPNLLVDEIKCTGTENSLEECKHSPWRSHNCRPDEIAGVVCK 786          

HSP 3 Score: 56.9954 bits (136), Expect = 8.437e-8
Identity = 48/134 (35.82%), Postives = 64/134 (47.76%), Query Frame = 2
Query: 1865 TANEGRVEVYYKGKK--GLLCDDNFNINAGNVICRQLGYGYAVNATSXXXXXXXXXXXXXXXDY----IYCYGNEDSIGDCPTKYWETKSCYGNDVAGLVCSGNA----------SSCGQVSTMENNWKYSNGY 2218
            TANEGRVEVY    K  GL+CDD +NI   NV CRQL  G+   A               + DY    I C GNE S+ DCP  +  T  C G   AG+ C  N            +C Q++T + ++K ++ +
Sbjct:   92 TANEGRVEVYDSNSKLWGLVCDDYWNILDANVTCRQL--GFRRKAREATRQDRYGRGDWSVNDYTVHKIQCTGNEKSLVDCP--HDSTSYCSGKS-AGVSCVYNLGCPNGWISFNGACYQINTQQMDYKQADKF 220          
BLAST of Serine protease 12 vs. Planmine SMEST
Match: SMESG000004375.1 (SMESG000004375.1)

HSP 1 Score: 82.0333 bits (201), Expect = 1.473e-15
Identity = 66/253 (26.09%), Postives = 115/253 (45.45%), Query Frame = 2
Query: 2147 CSGNASSCGQVSTMENNWKYSNGYNTTFGATPWQARLMPSSVNEWCSATIIDRNWLLTSANCFTMSYNNFYVTVMSSRYYWDSSNFATTNSIQSVFIHPQYSTVTGDYNLALVKVNSIA-FDANVQPLCLPAGYIPVDGLSCVTTGWNHGLNTYSRPLLGKPVL-IQNSSYCKDHLQFDDTRMARYLCSDNNMDPSAYFNGESGGPLTCSINGKNVLXXXXXXXXXXXXXXXIRLYTRVDYWDSWIRNIMKNN 2899
            CS    S  Q+    ++ +   G     G+ PW   L    ++  C  ++I  +++LT+A+CF M  N  Y  +   RY+          +++ +F+HP Y   T D++LA+VK+   A   A++Q +C+P    P+ G  CV  GW     T    +L + V+ I   + C +   + +    + LC+          +G+SGGPL C    K  + G+V+     A  +   +YT +  +  WI  I+  N
Sbjct:  254 CSYQYISPKQLDDTIDHSQIVGGSEANPGSWPWMISLKYGPLH-MCGGSLIAEDFVLTAAHCFIMDSNPDYYNIDLGRYFL-YKGLVENIAVEKIFLHPSYKIETQDFDLAIVKLKRKAKLTASIQTVCIPRDKEPIAGKKCVILGWGSTQGTGGEGVLKQAVVPIVERNVCNE--LYGNIITNQMLCAGYKTGGIDSCSGDSGGPLVCKTEKKFEIYGIVSFGQGCALPNRPGVYTNIVRFVDWIDKIIGRN 502          
The following BLAST results are available for this feature:
BLAST of Serine protease 12 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PRSS128.564e-3428.21serine protease 12 [Source:HGNC Symbol;Acc:HGNC:94... [more]
DMBT11.785e-1931.82deleted in malignant brain tumors 1 [Source:HGNC S... [more]
DMBT11.791e-1832.50deleted in malignant brain tumors 1 [Source:HGNC S... [more]
DMBT11.791e-1832.50deleted in malignant brain tumors 1 [Source:HGNC S... [more]
DMBT11.791e-1832.50deleted in malignant brain tumors 1 [Source:HGNC S... [more]
back to top
BLAST of Serine protease 12 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
svh-11.301e-1127.23HGF/MSP/plasminogen-like protein [Source:UniProtK... [more]
try-16.834e-1026.06TRYpsin-like protease [Source:UniProtKB/TrEMBL;Ac... [more]
try-35.462e-629.00TRYpsin-like protease [Source:UniProtKB/TrEMBL;Ac... [more]
try-37.654e-629.76TRYpsin-like protease [Source:UniProtKB/TrEMBL;Ac... [more]
back to top
BLAST of Serine protease 12 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
teq7.020e-2424.02gene:FBgn0023479 transcript:FBtr0344980[more]
teq2.048e-2324.02gene:FBgn0023479 transcript:FBtr0344981[more]
teq3.413e-2324.34gene:FBgn0023479 transcript:FBtr0076525[more]
Loxl21.279e-1630.41gene:FBgn0034660 transcript:FBtr0071745[more]
CG81721.477e-1625.10gene:FBgn0033362 transcript:FBtr0301191[more]
back to top
BLAST of Serine protease 12 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prss123.167e-3627.00serine protease 12 [Source:ZFIN;Acc:ZDB-GENE-09031... [more]
BX511095.27.654e-3627.12serine protease 12 [Source:NCBI gene;Acc:566809][more]
prss127.789e-3627.12serine protease 12 [Source:ZFIN;Acc:ZDB-GENE-09031... [more]
si:ch211-51a6.21.078e-3528.84si:ch211-51a6.2 [Source:ZFIN;Acc:ZDB-GENE-090313-1... [more]
si:ch211-51a6.24.099e-3528.63si:ch211-51a6.2 [Source:ZFIN;Acc:ZDB-GENE-090313-1... [more]
back to top
BLAST of Serine protease 12 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000001485.15.762e-3727.03neurotrypsin-like [Source:NCBI gene;Acc:100497588][more]
ENSXETT00000001537.11.711e-3626.80neurotrypsin-like [Source:NCBI gene;Acc:100497588][more]
ENSXETT00000001560.13.493e-3626.80neurotrypsin-like [Source:NCBI gene;Acc:100497588][more]
tmem132a7.860e-3227.19transmembrane protein 132A [Source:Xenbase;Acc:XB-... [more]
tmem132a1.695e-3127.19transmembrane protein 132A [Source:Xenbase;Acc:XB-... [more]
back to top
BLAST of Serine protease 12 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Prss121.039e-3428.78protease, serine 12 neurotrypsin (motopsin) [Sourc... [more]
Cd1639.464e-2030.49CD163 antigen [Source:MGI Symbol;Acc:MGI:2135946][more]
Cd1631.317e-1930.49CD163 antigen [Source:MGI Symbol;Acc:MGI:2135946][more]
5830411N06Rik1.189e-1731.52RIKEN cDNA 5830411N06 gene [Source:MGI Symbol;Acc:... [more]
5830411N06Rik1.349e-1731.52RIKEN cDNA 5830411N06 gene [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Serine protease 12 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5G265|NETR_SAGLB3.075e-3428.21Neurotrypsin OS=Saguinus labiatus OX=78454 GN=PRSS... [more]
sp|G3V801|NETR_RAT5.932e-3428.57Neurotrypsin OS=Rattus norvegicus OX=10116 GN=Prss... [more]
sp|O08762|NETR_MOUSE7.264e-3428.78Neurotrypsin OS=Mus musculus OX=10090 GN=Prss12 PE... [more]
sp|Q5G268|NETR_NOMLE1.305e-3328.21Neurotrypsin OS=Nomascus leucogenys OX=61853 GN=PR... [more]
sp|Q5G269|NETR_PONPY1.874e-3328.21Neurotrypsin OS=Pongo pygmaeus OX=9600 GN=PRSS12 P... [more]
back to top
BLAST of Serine protease 12 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|1725733272.967e-4025.86tr|A0A3P9H0I4|A0A3P9H0I4_ORYLA Serine protease 12 ... [more]
gnl|BL_ORD_ID|1725722558.248e-4025.86tr|A0A3P9LJR1|A0A3P9LJR1_ORYLA Serine protease 12 ... [more]
gnl|BL_ORD_ID|284395421.038e-3929.13tr|A0A2K6GL16|A0A2K6GL16_PROCO Serine protease 12 ... [more]
gnl|BL_ORD_ID|1725672572.937e-3925.73tr|A0A3B3HNE2|A0A3B3HNE2_ORYLA Serine protease 12 ... [more]
gnl|BL_ORD_ID|1761364192.984e-3826.09tr|A0A437DMG5|A0A437DMG5_ORYJA Uncharacterized pro... [more]
back to top
BLAST of Serine protease 12 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-51a6.21.126e-3528.90neurotrypsin-like [Source:NCBI gene;Acc:103031031][more]
prss121.838e-3528.09serine protease 12 [Source:ZFIN;Acc:ZDB-GENE-09031... [more]
si:ch73-127m5.15.019e-3427.75si:ch73-127m5.1 [Source:ZFIN;Acc:ZDB-GENE-130531-2... [more]
si:ch73-127m5.11.373e-3328.51si:ch73-127m5.1 [Source:ZFIN;Acc:ZDB-GENE-130531-2... [more]
si:ch73-127m5.12.043e-3027.64si:ch73-127m5.1 [Source:ZFIN;Acc:ZDB-GENE-130531-2... [more]
back to top
BLAST of Serine protease 12 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000006929.14.815e-2231.52pep scaffold:Pmarinus_7.0:GL476378:525850:535660:-... [more]
ENSPMAT00000006915.11.045e-2033.98pep scaffold:Pmarinus_7.0:GL476378:414701:424985:-... [more]
ENSPMAT00000008950.12.992e-2034.72pep scaffold:Pmarinus_7.0:GL497676:235:2038:-1 gen... [more]
ENSPMAT00000005967.15.194e-2035.53pep scaffold:Pmarinus_7.0:GL493532:543:4961:1 gene... [more]
ENSPMAT00000008949.11.021e-1934.34pep scaffold:Pmarinus_7.0:GL497676:220:2038:-1 gen... [more]
back to top
BLAST of Serine protease 12 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Serine protease 12 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO468722.471e-2728.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO398991.807e-2332.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO446391.496e-2131.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO330553.275e-2032.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO398116.531e-2031.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Serine protease 12 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prss121.105e-4225.73serine protease 12 [Source:NCBI gene;Acc:105358156... [more]
si:ch73-127m5.19.961e-3028.40neurotrypsin [Source:NCBI gene;Acc:101157816][more]
ENSORLT00000010945.22.803e-2231.36pep primary_assembly:ASM223467v1:20:17371788:17374... [more]
corin5.165e-1828.64corin, serine peptidase [Source:NCBI gene;Acc:1011... [more]
ENSORLT00000033752.17.903e-1833.83pep primary_assembly:ASM223467v1:20:9844150:984587... [more]
back to top
BLAST of Serine protease 12 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000075230.10.000e+097.58SMESG000075230.1[more]
SMESG000016089.11.351e-3324.26SMESG000016089.1[more]
SMESG000016089.11.761e-3324.26SMESG000016089.1[more]
SMESG000016088.13.044e-3224.73SMESG000016088.1[more]
SMESG000004375.11.473e-1526.09SMESG000004375.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019187 ID=SMED30019187|Name=Serine protease 12|organism=Schmidtea mediterranea sexual|type=transcript|length=3012bp
AATGCTCTTTATATTTATAATTGGTATTTTTTGTGGATTTTGCAGTGGGC
AATACGTGACCGAAATTGATGAGTGCATCAAGAACGCCGTTACGATTCAA
TATGAATATACGATAACCCAAAATGACCTCCGGAACGGAACTTGCGGATT
CCTAATGCGCACAAATGGGTATATTGTTATCCAACCAATTTTGGTAAACA
TCAGTCAGAGTGCCCGAATAAGACTATATTTATTGACTGGGAATGCGAGT
GCACCAGACAAGATGAAAATTTCTGAATATTATAACCGGTTCTTATTCCG
AGACTTGATGTTCATTGGGGCGGGAAATCTGCGGATCGCATTGGTTGTTC
TATCAAAGAACGAGTCAATCAGCATTGGAAATTTTCAATTTCTCTACAGG
CAATCCTGCCTGGTGGAGATGAATGCTGAGGATTATCCGAAGTTTATGTC
ACCGAATTTCTTACCAAAAAAGCCAGCTTTGGCAGCTCTATTGAACAATG
CTAATCAGTCAAATTTGAATTGCACTTACAGGGTCTCCTCGCGTACTAAC
AAATCATTTTCTGTTAATTTCGATGCACTTTATGGAAGATATAAATACGA
TCTTATCGTTAATAATACATATATTTATAGTCCGGTAAAAGTCGCAGTTC
CTGGAGACCAGAAATTAGAATTTATTTTGAGAACTTACTATTCTTATTCC
GACTCAAATCTATTTGGATTCACTGGCACTGTCGACATGTCATATCAGTC
AATTACATTGCTGCCAATTGATGGAAATCCTTTGAGAGGAATTCCCCTCC
TGTCATATCTCGGGGAGAATTATACAATTCAGTTCGGGTCTTTGTCGACT
TATGATGGCCATGTTTTGTGTCAAACTCTTGGCTACGGATCCGTAAAGTC
AATGAGGCCATATAAAAACGAAACAGGAACGAAGTTAATTTACCCCACGT
TTGATTGCAGAGGTAGCGAAAGTCGCCTTACCCAATGCGCAGAACTTGAT
GGGAAAAAGCTGCATTATGAAAAATATTATTACACTTCTCCAAATGTCAC
AAATGTCACTTGCTCCGAAAATTTTAACATGCAACTGGTGGGAGGAGACA
ACCGCTCGGGAGTTGTTCAGTTGAATTTAGGAGGGGGGTTCTCATATATT
TGTGCAGACAACATGGATCCGAGTGCCGCAGATGCCATTTGCATGGAAAT
GGGATTCCAGGGATCTCTGTATTATGAAGGATACATGGGAAATACTAATG
CATCCAACTATTATAGTTCTTTTAGTGGGGATTATTACCGATATCACTAT
GATACCATAATGACGAATATCCGCTGCAACTCGAATACAAAATTGAGAAA
CTGCAAATATCAAATTTATCGCTCTTATTATAACTACCTAAACTACTATG
GATATTATGGATATTTTGGCAGTGATTACTATAATCAGGCCTCCGGGACA
AATAGCTTTCACAATAATCCTTCTGATTATTATAATAATTACTGGAATAG
TTATTATTATTCTTATTGCTATTCTGGAGCAGTGAAAGTCCAATGCCATA
GCAACAGCACGAAATACTTCCTCAGCCCCGGCTACAACCAAGGGTACCTC
ACCTACAATAACAGCTACATGGTCTGCTCAAATGAATATGACAAAAATAA
TACGGACGTTTACTGCCGCTATCTTGGATATCCGGGAGTGAGGAAATCTT
ATTCTAATCCTGGAAACAACACTACATATTTACCCTTGGTCAGTCTGAAA
TGTAATGGAAATGAGCAAAGCCCTGCAGACTGTCCTGTTGATCGTTACGC
ATATTGCTATACTGCCAAGCCTGTGGGAGTCATTTGTCAAGATGTGGCAT
TAGCTGGAGGACGAACTGCAAATGAAGGTCGGGTAGAGGTTTATTACAAA
GGGAAAAAAGGACTTCTGTGTGATGATAACTTTAATATTAATGCTGGAAA
TGTAATTTGCAGACAACTAGGATACGGTTATGCTGTGAATGCCACAAGTA
ATGCCGGCTATTTGTATGGCTATGGTAATGGAAACTTCCTCTTGGACTAT
ATCTACTGCTATGGAAATGAGGATTCAATTGGTGACTGTCCGACTAAGTA
CTGGGAAACTAAAAGCTGTTACGGCAATGATGTTGCTGGTTTGGTCTGTA
GTGGCAATGCATCGTCCTGTGGCCAAGTTTCTACAATGGAGAACAACTGG
AAATACAGCAATGGGTATAACACAACCTTTGGTGCTACTCCGTGGCAAGC
TCGGTTGATGCCGTCGTCAGTAAATGAATGGTGCAGTGCCACAATTATTG
ATAGGAATTGGTTGCTGACTTCAGCAAACTGCTTTACAATGTCTTACAAC
AATTTCTATGTAACAGTGATGTCTTCGAGATATTATTGGGATTCCTCAAA
TTTTGCGACAACGAACTCGATTCAATCGGTCTTCATTCATCCTCAATACT
CAACCGTAACCGGTGATTACAATTTGGCTCTGGTCAAGGTTAATTCTATC
GCTTTTGATGCAAATGTGCAACCACTTTGCCTTCCGGCCGGTTATATACC
TGTTGATGGACTGAGTTGCGTAACCACTGGATGGAATCATGGGCTAAATA
CATATTCGAGGCCATTGTTGGGTAAGCCTGTTTTAATCCAAAACAGTTCG
TATTGCAAAGATCATCTGCAATTTGATGACACCAGAATGGCCAGATATTT
GTGCTCGGACAACAACATGGATCCTAGTGCATATTTCAACGGAGAAAGCG
GTGGTCCCTTAACCTGTTCTATTAATGGTAAAAATGTACTTGTCGGTGTG
GTTGCAAGATCAGTAGCTGGAGCCAGGGCATCAAGCATTCGGCTGTACAC
GAGAGTTGACTATTGGGATTCTTGGATCAGAAATATAATGAAAAATAACT
AATGAATATTTTATAGGATTCTGATAGAATATAAAGACATTAGTTTTTCG
TTGACATCAACATTTCATTTTGTTAGCACATTTAATTATTAATAAATAAA
GCTTCCTAACAG
back to top

protein sequence of SMED30019187-orf-1

>SMED30019187-orf-1 ID=SMED30019187-orf-1|Name=SMED30019187-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=967bp
MLFIFIIGIFCGFCSGQYVTEIDECIKNAVTIQYEYTITQNDLRNGTCGF
LMRTNGYIVIQPILVNISQSARIRLYLLTGNASAPDKMKISEYYNRFLFR
DLMFIGAGNLRIALVVLSKNESISIGNFQFLYRQSCLVEMNAEDYPKFMS
PNFLPKKPALAALLNNANQSNLNCTYRVSSRTNKSFSVNFDALYGRYKYD
LIVNNTYIYSPVKVAVPGDQKLEFILRTYYSYSDSNLFGFTGTVDMSYQS
ITLLPIDGNPLRGIPLLSYLGENYTIQFGSLSTYDGHVLCQTLGYGSVKS
MRPYKNETGTKLIYPTFDCRGSESRLTQCAELDGKKLHYEKYYYTSPNVT
NVTCSENFNMQLVGGDNRSGVVQLNLGGGFSYICADNMDPSAADAICMEM
GFQGSLYYEGYMGNTNASNYYSSFSGDYYRYHYDTIMTNIRCNSNTKLRN
CKYQIYRSYYNYLNYYGYYGYFGSDYYNQASGTNSFHNNPSDYYNNYWNS
YYYSYCYSGAVKVQCHSNSTKYFLSPGYNQGYLTYNNSYMVCSNEYDKNN
TDVYCRYLGYPGVRKSYSNPGNNTTYLPLVSLKCNGNEQSPADCPVDRYA
YCYTAKPVGVICQDVALAGGRTANEGRVEVYYKGKKGLLCDDNFNINAGN
VICRQLGYGYAVNATSNAGYLYGYGNGNFLLDYIYCYGNEDSIGDCPTKY
WETKSCYGNDVAGLVCSGNASSCGQVSTMENNWKYSNGYNTTFGATPWQA
RLMPSSVNEWCSATIIDRNWLLTSANCFTMSYNNFYVTVMSSRYYWDSSN
FATTNSIQSVFIHPQYSTVTGDYNLALVKVNSIAFDANVQPLCLPAGYIP
VDGLSCVTTGWNHGLNTYSRPLLGKPVLIQNSSYCKDHLQFDDTRMARYL
CSDNNMDPSAYFNGESGGPLTCSINGKNVLVGVVARSVAGARASSIRLYT
RVDYWDSWIRNIMKNN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005886plasma membrane
GO:0030424axon
GO:0030425dendrite
GO:0031410cytoplasmic vesicle
GO:0043083synaptic cleft
GO:0043195terminal bouton
GO:0045202synapse
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0006887exocytosis
GO:0006897endocytosis
GO:0031638zymogen activation
GO:0006508proteolysis
GO:0006898receptor-mediated endocytosis
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000096ventral epidermis
PLANA:0000106ciliated epithelial cell
PLANA:0000136whole organism
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002063non-ciliated epidermis
Vocabulary: INTERPRO
TermDefinition
IPR036772SRCR-like_dom_sf
IPR001190SRCR
IPR001254Trypsin_dom
IPR017448SRCR-like_dom
IPR009003Peptidase_S1_PA
IPR007087Znf_C2H2
Vocabulary: molecular function
TermDefinition
GO:0005044scavenger receptor activity
GO:0004252serine-type endopeptidase activity
GO:0046872metal ion binding
GO:0008233peptidase activity
GO:0008236serine-type peptidase activity
GO:0016787hydrolase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001190SRCR domainPRINTSPR00258SPERACTRCPTRcoord: 681..695
score: 40.38
coord: 614..630
score: 42.73
coord: 633..644
score: 43.08
coord: 704..716
score: 37.16
coord: 648..658
score: 60.89
IPR001190SRCR domainPFAMPF00530SRCRcoord: 618..716
e-value: 3.1E-22
score: 79.0
coord: 364..454
e-value: 1.8E-6
score: 28.4
coord: 539..612
e-value: 4.1E-8
score: 33.6
IPR001190SRCR domainPROSITEPS50287SRCR_2coord: 230..355
score: 8.99
IPR001190SRCR domainPROSITEPS50287SRCR_2coord: 540..612
score: 11.535
IPR001190SRCR domainPROSITEPS50287SRCR_2coord: 360..454
score: 10.214
IPR001190SRCR domainPROSITEPS50287SRCR_2coord: 614..716
score: 24.831
IPR001254Serine proteases, trypsin domainSMARTSM00020trypsin_2coord: 733..958
e-value: 3.5E-24
score: 96.3
IPR001254Serine proteases, trypsin domainPFAMPF00089Trypsincoord: 736..958
e-value: 1.6E-28
score: 100.1
IPR001254Serine proteases, trypsin domainPROSITEPS50240TRYPSIN_DOMcoord: 734..963
score: 21.801
IPR001254Serine proteases, trypsin domainCDDcd00190Tryp_SPccoord: 736..961
e-value: 6.79117E-38
score: 139.719
IPR017448SRCR-like domainSMARTSM00202SR_3coord: 360..443
e-value: 0.0011
score: 5.4
coord: 521..612
e-value: 8.5E-5
score: 18.0
coord: 614..716
e-value: 3.8E-35
score: 132.8
NoneNo IPR availableGENE3DG3DSA:2.40.10.10coord: 726..964
e-value: 1.6E-38
score: 134.4
NoneNo IPR availablePANTHERPTHR19331:SF454SI:CH211-51A6.2-RELATEDcoord: 539..945
NoneNo IPR availablePANTHERPTHR19331LYSYL OXIDASE-RELATEDcoord: 539..945
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..16
score: 0.89
IPR036772SRCR-like domain superfamilyGENE3DG3DSA:3.10.250.10coord: 614..724
e-value: 1.3E-28
score: 101.2
coord: 257..357
e-value: 2.8E-6
score: 29.1
coord: 358..470
e-value: 6.6E-9
score: 37.6
coord: 505..613
e-value: 4.7E-11
score: 44.5
IPR036772SRCR-like domain superfamilySUPERFAMILYSSF56487SRCR-likecoord: 260..356
IPR036772SRCR-like domain superfamilySUPERFAMILYSSF56487SRCR-likecoord: 536..614
IPR036772SRCR-like domain superfamilySUPERFAMILYSSF56487SRCR-likecoord: 354..459
IPR036772SRCR-like domain superfamilySUPERFAMILYSSF56487SRCR-likecoord: 613..718
IPR009003Peptidase S1, PA clanSUPERFAMILYSSF50494Trypsin-like serine proteasescoord: 722..963