Ubiquitin carboxyl-terminal hydrolase

Overview
NameUbiquitin carboxyl-terminal hydrolase
Smed IDSMED30019179
Length (bp)1648
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Human
Match: AC022966.1 (ubiquitin specific peptidase 36 [Source:NCBI gene;Acc:57602])

HSP 1 Score: 77.0258 bits (188), Expect = 3.469e-14
Identity = 75/280 (26.79%), Postives = 119/280 (42.50%), Query Frame = 1
Query:  379 NCYMNAAIQSIF---PALLYLNTIKETIEYDQSQECGAIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEE-LKGHSKLQRIP---------FEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDEV----EGFNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEI-PYKSDDKVLKQKYRLVSVVNHTG-SLKRGHYFTFLKHGNF-WYKADDDSV 1158
             C++NA IQ +    P   YL + +      Q   C   ++   ++QA+ N      P+       L+  +    + N EDAHEFL   +D + +  L G +KL R           F     SR  C+ C KS +D  +  +D  L +    N+   +E ++K +V      + C  C+ K   AS           L + +KRFA    +   KI   +   E + I PY S +      Y L +V+ H+G S   GHY+ ++K  N  WY+ +D  V
Sbjct:  130 TCFLNATIQCLTYTPPLANYLLSKEHARSCHQGSFCMLCVMQNHIVQAFANSGNAIKPVSFIRD--LKKIARHFRFGNQEDAHEFLRYTIDAMQKACLNGCAKLDRQTQATTLVHQIFGGYLRSRVKCSVC-KSVSDTYDPYLDVALEIRQAANIVRALELFVKADVLSGENAYMCAKCK-KKVPASKRFTIHRTSNVLTLSLKRFAN---FSGGKITKDVGYPEFLNIRPYMSQNNGDPVMYGLYAVLVHSGYSCHAGHYYCYVKASNGQWYQMNDSLV 402          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Human
Match: AC022966.1 (ubiquitin specific peptidase 36 [Source:NCBI gene;Acc:57602])

HSP 1 Score: 73.559 bits (179), Expect = 6.246e-13
Identity = 76/280 (27.14%), Postives = 120/280 (42.86%), Query Frame = 1
Query:  379 NCYMNAAIQSIF--PALL-YLNTIKETIEYDQSQECGAIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEE-LKGHSKLQRIP---------FEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDEV----EGFNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEI-PYKSDDKVLKQKYRLVSVVNHTG-SLKRGHYFTFLKHGNF-WYKADDDSV 1158
             C++NA IQ +   P L  YL + +      Q   C   ++   ++QA+ N      P+       L+  +    + N EDAHEFL   +D + +  L G +KL R           F     SR  C+ C KS +D  +  +D  L +    N+   +E ++K +V      + C  C+ K   AS           L + +KRFA    +   KI   +   E + I PY S +      Y L +V+ H+G S   GHY+ ++K  N  WY+ +D  V
Sbjct:  130 TCFLNATIQCLTYTPPLANYLLSKEHARSCHQGSFCMLCVMQNHIVQAFANSGNAIKPVSFIRD--LKKIARHFRFGNQEDAHEFLRYTIDAMQKACLNGCAKLDRQTQATTLVHQIFGGYLRSRVKCSVC-KSVSDTYDPYLDVALEIRQAANIVRALELFVKADVLSGENAYMCAKCK-KKVPASKRFTIHRTSNVLTLSLKRFAN---FSGGKITKDVGYPEFLNIRPYMSQNNGDPVMYGLYAVLVHSGYSCHAGHYYCYVKASNGQWYQMNDSLV 402          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Human
Match: AC022966.1 (ubiquitin specific peptidase 36 [Source:NCBI gene;Acc:57602])

HSP 1 Score: 72.7886 bits (177), Expect = 9.442e-13
Identity = 76/280 (27.14%), Postives = 120/280 (42.86%), Query Frame = 1
Query:  379 NCYMNAAIQSIF--PALL-YLNTIKETIEYDQSQECGAIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEE-LKGHSKLQRIP---------FEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDEV----EGFNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEI-PYKSDDKVLKQKYRLVSVVNHTG-SLKRGHYFTFLKHGNF-WYKADDDSV 1158
             C++NA IQ +   P L  YL + +      Q   C   ++   ++QA+ N      P+       L+  +    + N EDAHEFL   +D + +  L G +KL R           F     SR  C+ C KS +D  +  +D  L +    N+   +E ++K +V      + C  C+ K   AS           L + +KRFA    +   KI   +   E + I PY S +      Y L +V+ H+G S   GHY+ ++K  N  WY+ +D  V
Sbjct:  130 TCFLNATIQCLTYTPPLANYLLSKEHARSCHQGSFCMLCVMQNHIVQAFANSGNAIKPVSFIRD--LKKIARHFRFGNQEDAHEFLRYTIDAMQKACLNGCAKLDRQTQATTLVHQIFGGYLRSRVKCSVC-KSVSDTYDPYLDVALEIRQAANIVRALELFVKADVLSGENAYMCAKCK-KKVPASKRFTIHRTSNVLTLSLKRFAN---FSGGKITKDVGYPEFLNIRPYMSQNNGDPVMYGLYAVLVHSGYSCHAGHYYCYVKASNGQWYQMNDSLV 402          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Human
Match: AC022966.1 (ubiquitin specific peptidase 36 [Source:NCBI gene;Acc:57602])

HSP 1 Score: 72.7886 bits (177), Expect = 9.442e-13
Identity = 76/280 (27.14%), Postives = 120/280 (42.86%), Query Frame = 1
Query:  379 NCYMNAAIQSIF--PALL-YLNTIKETIEYDQSQECGAIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEE-LKGHSKLQRIP---------FEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDEV----EGFNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEI-PYKSDDKVLKQKYRLVSVVNHTG-SLKRGHYFTFLKHGNF-WYKADDDSV 1158
             C++NA IQ +   P L  YL + +      Q   C   ++   ++QA+ N      P+       L+  +    + N EDAHEFL   +D + +  L G +KL R           F     SR  C+ C KS +D  +  +D  L +    N+   +E ++K +V      + C  C+ K   AS           L + +KRFA    +   KI   +   E + I PY S +      Y L +V+ H+G S   GHY+ ++K  N  WY+ +D  V
Sbjct:  130 TCFLNATIQCLTYTPPLANYLLSKEHARSCHQGSFCMLCVMQNHIVQAFANSGNAIKPVSFIRD--LKKIARHFRFGNQEDAHEFLRYTIDAMQKACLNGCAKLDRQTQATTLVHQIFGGYLRSRVKCSVC-KSVSDTYDPYLDVALEIRQAANIVRALELFVKADVLSGENAYMCAKCK-KKVPASKRFTIHRTSNVLTLSLKRFAN---FSGGKITKDVGYPEFLNIRPYMSQNNGDPVMYGLYAVLVHSGYSCHAGHYYCYVKASNGQWYQMNDSLV 402          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Human
Match: AC022966.1 (ubiquitin specific peptidase 36 [Source:NCBI gene;Acc:57602])

HSP 1 Score: 72.7886 bits (177), Expect = 9.442e-13
Identity = 76/280 (27.14%), Postives = 120/280 (42.86%), Query Frame = 1
Query:  379 NCYMNAAIQSIF--PALL-YLNTIKETIEYDQSQECGAIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEE-LKGHSKLQRIP---------FEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDEV----EGFNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEI-PYKSDDKVLKQKYRLVSVVNHTG-SLKRGHYFTFLKHGNF-WYKADDDSV 1158
             C++NA IQ +   P L  YL + +      Q   C   ++   ++QA+ N      P+       L+  +    + N EDAHEFL   +D + +  L G +KL R           F     SR  C+ C KS +D  +  +D  L +    N+   +E ++K +V      + C  C+ K   AS           L + +KRFA    +   KI   +   E + I PY S +      Y L +V+ H+G S   GHY+ ++K  N  WY+ +D  V
Sbjct:  130 TCFLNATIQCLTYTPPLANYLLSKEHARSCHQGSFCMLCVMQNHIVQAFANSGNAIKPVSFIRD--LKKIARHFRFGNQEDAHEFLRYTIDAMQKACLNGCAKLDRQTQATTLVHQIFGGYLRSRVKCSVC-KSVSDTYDPYLDVALEIRQAANIVRALELFVKADVLSGENAYMCAKCK-KKVPASKRFTIHRTSNVLTLSLKRFAN---FSGGKITKDVGYPEFLNIRPYMSQNNGDPVMYGLYAVLVHSGYSCHAGHYYCYVKASNGQWYQMNDSLV 402          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Celegans
Match: usp-3 (Ubiquitinyl hydrolase 1 [Source:UniProtKB/TrEMBL;Acc:Q9GRV2])

HSP 1 Score: 62.003 bits (149), Expect = 5.628e-10
Identity = 74/338 (21.89%), Postives = 138/338 (40.83%), Query Frame = 1
Query:  337 ELDHAPVPLTNHRVNCYMNAAIQSIFPA------LLYLNTIKETIEYDQSQECGA--IILMESLLQAYINQ--EEFSIPICIYE-QSSLEYFSLELSWENMEDAHEFLNCYLDKLNEELKGHSKLQRIP----------FEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKN-----MTEMIENYLKDEV----EGFNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEIP--------YKSDDK-VLKQKYRLVSVVNHTG-SLKRGHYFTFLKHGNFWYKADDDSVRKCELEYMKMISTYSCYIEVFEKL 1230
            E+ + P  + N    C+MNA +Q++         ++ L+++++ I  ++  + G     L +   +  I+Q    F  P    E + +              D+HEF+  ++D L+ E++   KL  +P          FE    S   C  C   +N K +  +D  L +   +N     +++ +  + K E+    E   C  C+ K  + S ++   +LPQ L + +KRF  +              D II+ P        + +DD       Y L S++ H G     GHY  F K    W++ DD  V+  +  +   +S    Y+ ++ K+
Sbjct:  223 EIAYRPRGMRNVGNTCFMNAVLQALASISEFREYIMSLSSLEDYIHDEKEPKNGGNYCYLTDEYRKLLISQSARSFREPTAPNEFREAFISVCPRFRGFRQHDSHEFMRYFMDSLHTEMRKCRKLPGMPDDKHTPISKYFEGTLQSSVICQTCRNCSN-KIDEFMDLSLDIPAQRNASKVRLSDCLSTFFKLEMLEKGEKPECAKCKTKQ-TCSKQMFIRKLPQVLCLHMKRFRDNGGKN----------DAIIDFPMGQLDVTQFLTDDSDEAPCTYSLQSIIVHIGYGCGSGHYIAFGKRNGRWFQFDDTVVKGVDEAH---VSKQKAYVLLYTKI 545          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Celegans
Match: usp-33 (Ubiquitin carboxyl-terminal hydrolase [Source:UniProtKB/TrEMBL;Acc:Q93875])

HSP 1 Score: 54.6842 bits (130), Expect = 1.492e-7
Identity = 43/161 (26.71%), Postives = 72/161 (44.72%), Query Frame = 1
Query:  721 CNNCGKSNNDKPNIVVDQVLF--VSVGKNMTEMIENYLKDEVEGFNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEIPYKSDD------KVLKQKYRLVSVVNHTG-SLKRGHYFTFLKH--GNFWYKADDDSVRKCE 1170
            C +    +   P  +V Q  F   S+   +    +N    +   ++C  CEV   +  S      LP+ +++ +KRF  H+ + + K+       +++E P +S D            Y LV  V H G SL+ GHY ++ +H   N WYK DD  V +C+
Sbjct:  379 CTSSNIEDGQDPGFLVHQGAFNKTSLESCLDRFFQNSTLQDDNQYSCSKCEVLVDATKSTKAH-RLPEVIIIQLKRFR-HTMFGSCKVG------KVVEFPLRSQDFGRWTTSGEPALYDLVGFVVHEGRSLEFGHYVSYCRHEQDNQWYKFDDMVVTRCD 531          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Celegans
Match: usp-46 (Ubiquitin carboxyl-terminal hydrolase 46 [Source:UniProtKB/Swiss-Prot;Acc:P34547])

HSP 1 Score: 53.5286 bits (127), Expect = 2.341e-7
Identity = 39/120 (32.50%), Postives = 56/120 (46.67%), Query Frame = 1
Query:  853 CENCEVKNGSASSEVVFSELPQYLVVCIKRFA-THSYYQTKKINDRICIDEIIEIPYKSDDKVLKQK-YRLVSVVNHTGSL-KRGHYFTFLKHGNFWYKADDDSVRKCELEYMKMISTYS 1203
            CE C  K   A   +   + PQ L + +KRF       +  K++ R+     + +   SDD     + Y LV+ V H G+   RGHY T +K  +FW   DDD V K E+  M+  S  S
Sbjct:  246 CETCSSKQ-EAQKRMRIKKPPQLLALHLKRFKFVEPLNRHTKLSYRVVFPLELRLFNVSDDAEYGDRMYDLVATVVHCGATPNRGHYITLVKSNSFWLVFDDDIVEKLEVSSMEEFSGMS 364          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Celegans
Match: usp-46 (Ubiquitin carboxyl-terminal hydrolase 46 [Source:UniProtKB/Swiss-Prot;Acc:P34547])

HSP 1 Score: 53.5286 bits (127), Expect = 2.555e-7
Identity = 39/120 (32.50%), Postives = 56/120 (46.67%), Query Frame = 1
Query:  853 CENCEVKNGSASSEVVFSELPQYLVVCIKRFA-THSYYQTKKINDRICIDEIIEIPYKSDDKVLKQK-YRLVSVVNHTGSL-KRGHYFTFLKHGNFWYKADDDSVRKCELEYMKMISTYS 1203
            CE C  K   A   +   + PQ L + +KRF       +  K++ R+     + +   SDD     + Y LV+ V H G+   RGHY T +K  +FW   DDD V K E+  M+  S  S
Sbjct:  258 CETCSSKQ-EAQKRMRIKKPPQLLALHLKRFKFVEPLNRHTKLSYRVVFPLELRLFNVSDDAEYGDRMYDLVATVVHCGATPNRGHYITLVKSNSFWLVFDDDIVEKLEVSSMEEFSGMS 376          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Celegans
Match: usp-46 (Ubiquitin carboxyl-terminal hydrolase 46 [Source:UniProtKB/Swiss-Prot;Acc:P34547])

HSP 1 Score: 53.5286 bits (127), Expect = 2.555e-7
Identity = 39/120 (32.50%), Postives = 56/120 (46.67%), Query Frame = 1
Query:  853 CENCEVKNGSASSEVVFSELPQYLVVCIKRFA-THSYYQTKKINDRICIDEIIEIPYKSDDKVLKQK-YRLVSVVNHTGSL-KRGHYFTFLKHGNFWYKADDDSVRKCELEYMKMISTYS 1203
            CE C  K   A   +   + PQ L + +KRF       +  K++ R+     + +   SDD     + Y LV+ V H G+   RGHY T +K  +FW   DDD V K E+  M+  S  S
Sbjct:  258 CETCSSKQ-EAQKRMRIKKPPQLLALHLKRFKFVEPLNRHTKLSYRVVFPLELRLFNVSDDAEYGDRMYDLVATVVHCGATPNRGHYITLVKSNSFWLVFDDDIVEKLEVSSMEEFSGMS 376          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Fly
Match: Usp7 (gene:FBgn0030366 transcript:FBtr0342732)

HSP 1 Score: 76.2554 bits (186), Expect = 4.450e-14
Identity = 81/287 (28.22%), Postives = 122/287 (42.51%), Query Frame = 1
Query:  355 VPLTNHRVNCYMNAAIQSI-FPALLYLNTIKETIEYDQSQECGAIILMESLLQAYINQEEFS-IPICIYEQSSLEYFSLELSWENME-----DAHEFLNCYLDKLNEELKGHSKLQRIP--FEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDE-VEGFNCENCEVKN-GSASSEVVFSELPQYLVVCIKRFATHSYYQTK-KINDRICIDEIIEIP-YKSDDKVLKQKYRLVSVVNHTGSLKRGHYFTFL--KHGNFWYKADDDSVRKCE 1170
            V L N    CYMN+ +Q++ F   L L+  +   E D S +   + L     Q   ++ +F   P+        +  +    WE ++     D  EFL   LDKL  ++KG      IP  FE    S   C N    N+ +     D  L +   KN+ E  ++Y+  E +EG N  +  V     AS  V+F+  P  L + + RF       +  K NDR    E I +  Y ++ +     Y L +V+ H+G    GHY  F+  K    W+K DDD V  C 
Sbjct:  241 VGLKNQGATCYMNSLLQTLYFTNSLRLSVYRIPTEADDSSKSVGLSL-----QRVFHELQFGDRPV------GTKKLTKSFGWETLDSFMQHDVQEFLRVLLDKLESKMKGTILEGTIPGLFEGKMSSYIKCKNV-DYNSTRYETFYDIQLNIKDKKNIYESFQDYVAPETLEGDNKYDAGVHGLQEASKGVIFTSFPPVLHLHLMRFQYDPVTDSSIKYNDRFEFYEHINLDRYLAESENTLADYVLHAVLVHSGDNHGGHYVVFINPKADGRWFKFDDDVVSSCR 515          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Fly
Match: Usp7 (gene:FBgn0030366 transcript:FBtr0073641)

HSP 1 Score: 75.8702 bits (185), Expect = 4.901e-14
Identity = 81/287 (28.22%), Postives = 122/287 (42.51%), Query Frame = 1
Query:  355 VPLTNHRVNCYMNAAIQSI-FPALLYLNTIKETIEYDQSQECGAIILMESLLQAYINQEEFS-IPICIYEQSSLEYFSLELSWENME-----DAHEFLNCYLDKLNEELKGHSKLQRIP--FEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDE-VEGFNCENCEVKN-GSASSEVVFSELPQYLVVCIKRFATHSYYQTK-KINDRICIDEIIEIP-YKSDDKVLKQKYRLVSVVNHTGSLKRGHYFTFL--KHGNFWYKADDDSVRKCE 1170
            V L N    CYMN+ +Q++ F   L L+  +   E D S +   + L     Q   ++ +F   P+        +  +    WE ++     D  EFL   LDKL  ++KG      IP  FE    S   C N    N+ +     D  L +   KN+ E  ++Y+  E +EG N  +  V     AS  V+F+  P  L + + RF       +  K NDR    E I +  Y ++ +     Y L +V+ H+G    GHY  F+  K    W+K DDD V  C 
Sbjct:  241 VGLKNQGATCYMNSLLQTLYFTNSLRLSVYRIPTEADDSSKSVGLSL-----QRVFHELQFGDRPV------GTKKLTKSFGWETLDSFMQHDVQEFLRVLLDKLESKMKGTILEGTIPGLFEGKMSSYIKCKNV-DYNSTRYETFYDIQLNIKDKKNIYESFQDYVAPETLEGDNKYDAGVHGLQEASKGVIFTSFPPVLHLHLMRFQYDPVTDSSIKYNDRFEFYEHINLDRYLAESENTLADYVLHAVLVHSGDNHGGHYVVFINPKADGRWFKFDDDVVSSCR 515          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Fly
Match: faf (gene:FBgn0005632 transcript:FBtr0085843)

HSP 1 Score: 63.1586 bits (152), Expect = 5.852e-10
Identity = 55/221 (24.89%), Postives = 95/221 (42.99%), Query Frame = 1
Query:  607 EDAHEFLNCYLDKLNEELK--GHSKLQRIPFEAAHDSRYFCNNCG-KSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDEV----EGFNCENCEVKNGSASSEVVFSELPQYLVVCIKRF----------ATHSYYQTKKIND---------RICIDEIIEIPYKSDDKVLKQKYRLVSVVNHTGSLKRGHYFTFLKHGNF------WYKADDDSVRKCEL 1173
            +DA EF    L+ L+E LK  G  +L       +   +  C  C  + + ++P  V    + +    ++TE +E Y+K E+    + ++C+ C+ K       V   +LP  L + +KRF            + Y++  +I D              E++E+       V   KY L  +V H+G    GHYF+++   N       WYK DD  V +C++
Sbjct: 1799 QDAVEFFMSLLESLDEGLKALGQPQLMNATLGGSFSDQKICQECPHRYSKEEPFSVFS--VDIRNHSSLTESLEQYVKGELLEGADAYHCDKCD-KKVVTVKRVCVKKLPPVLAIQLKRFEYDYERVCAIKFNDYFEFPRILDMEPYTVSGLAKLEGEVVEVGDNCQTNVETTKYELTGIVVHSGQASGGHYFSYILSKNPANGKCQWYKFDDGEVTECKM 2016          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Fly
Match: faf (gene:FBgn0005632 transcript:FBtr0085844)

HSP 1 Score: 63.1586 bits (152), Expect = 6.146e-10
Identity = 55/221 (24.89%), Postives = 95/221 (42.99%), Query Frame = 1
Query:  607 EDAHEFLNCYLDKLNEELK--GHSKLQRIPFEAAHDSRYFCNNCG-KSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDEV----EGFNCENCEVKNGSASSEVVFSELPQYLVVCIKRF----------ATHSYYQTKKIND---------RICIDEIIEIPYKSDDKVLKQKYRLVSVVNHTGSLKRGHYFTFLKHGNF------WYKADDDSVRKCEL 1173
            +DA EF    L+ L+E LK  G  +L       +   +  C  C  + + ++P  V    + +    ++TE +E Y+K E+    + ++C+ C+ K       V   +LP  L + +KRF            + Y++  +I D              E++E+       V   KY L  +V H+G    GHYF+++   N       WYK DD  V +C++
Sbjct: 1799 QDAVEFFMSLLESLDEGLKALGQPQLMNATLGGSFSDQKICQECPHRYSKEEPFSVFS--VDIRNHSSLTESLEQYVKGELLEGADAYHCDKCD-KKVVTVKRVCVKKLPPVLAIQLKRFEYDYERVCAIKFNDYFEFPRILDMEPYTVSGLAKLEGEVVEVGDNCQTNVETTKYELTGIVVHSGQASGGHYFSYILSKNPANGKCQWYKFDDGEVTECKM 2016          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Fly
Match: faf (gene:FBgn0005632 transcript:FBtr0307547)

HSP 1 Score: 63.1586 bits (152), Expect = 6.213e-10
Identity = 55/221 (24.89%), Postives = 95/221 (42.99%), Query Frame = 1
Query:  607 EDAHEFLNCYLDKLNEELK--GHSKLQRIPFEAAHDSRYFCNNCG-KSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDEV----EGFNCENCEVKNGSASSEVVFSELPQYLVVCIKRF----------ATHSYYQTKKIND---------RICIDEIIEIPYKSDDKVLKQKYRLVSVVNHTGSLKRGHYFTFLKHGNF------WYKADDDSVRKCEL 1173
            +DA EF    L+ L+E LK  G  +L       +   +  C  C  + + ++P  V    + +    ++TE +E Y+K E+    + ++C+ C+ K       V   +LP  L + +KRF            + Y++  +I D              E++E+       V   KY L  +V H+G    GHYF+++   N       WYK DD  V +C++
Sbjct: 1799 QDAVEFFMSLLESLDEGLKALGQPQLMNATLGGSFSDQKICQECPHRYSKEEPFSVFS--VDIRNHSSLTESLEQYVKGELLEGADAYHCDKCD-KKVVTVKRVCVKKLPPVLAIQLKRFEYDYERVCAIKFNDYFEFPRILDMEPYTVSGLAKLEGEVVEVGDNCQTNVETTKYELTGIVVHSGQASGGHYFSYILSKNPANGKCQWYKFDDGEVTECKM 2016          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Zebrafish
Match: usp36 (ubiquitin specific peptidase 36 [Source:ZFIN;Acc:ZDB-GENE-030131-5450])

HSP 1 Score: 73.9442 bits (180), Expect = 3.121e-13
Identity = 77/306 (25.16%), Postives = 130/306 (42.48%), Query Frame = 1
Query:  379 NCYMNAAIQSIF---PALLYLNTIKETIEYDQSQECGAIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEE-LKGHSKLQRIP---------FEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDEV----EGFNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEI-PYKSDDKVLKQKYRLVSVVNHTG-SLKRGHYFTFLKHGNF-WYKADDDSVRKCELEYMKMISTYSC-YIEVFEKLN 1233
             C++N+ +Q +    P   YL + + +    QS  C   ++   ++QA+ N      P+       L+  +    + + EDAHEFL   +D + +  L G+ KL R           F     SR  C+ C KS +D  +  +D  L +    N+   +E ++K +V      + C  C+ K   A+           L + +KRFA    +   KI   +   E + I PY S        Y L +V+ H+G S   GHY+ ++K  N  WY+ +D  V    ++ +     Y   Y+ + EK N
Sbjct:  130 TCFLNSTVQCLTYTPPLANYLLSKEHSRSCHQSGFCMICVMQNHIIQAFANTANAIKPVSFIRD--LKKIARHFRFGSQEDAHEFLRYTIDAMQKACLNGYPKLDRQTQATTLVHQIFGGYLRSRVKCSIC-KSVSDTYDPYLDIALEIRQAANIVRALELFVKPDVLSGENAYMCAKCK-KKVPATKRFTVHRTSNVLTLSLKRFAN---FSGGKITKDVGYPEFLNIRPYMSQSSGDPVMYGLYAVLVHSGYSCHAGHYYCYVKASNGQWYQMNDSMVHSSNIKVVLNQQAYVLFYLRIPEKKN 428          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Zebrafish
Match: usp42 (ubiquitin specific peptidase 42 [Source:ZFIN;Acc:ZDB-GENE-030131-5739])

HSP 1 Score: 69.3218 bits (168), Expect = 7.194e-12
Identity = 68/278 (24.46%), Postives = 122/278 (43.88%), Query Frame = 1
Query:  382 CYMNAAIQSI---FPALLYLNTIKETIEYDQSQECGAIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEELKGHSKLQRIP---------FEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDE-VEG---FNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEI-PYKSDDKVLKQKYRLVSVVNHTG-SLKRGHYFTFLKHGNF-WYKADDDSV 1158
            C++N+ +Q +    P   Y+ T + +    +   C    +   ++Q + N      PI +  +  L+       + + EDAHEFL   +D + +     +KL R           F     SR  C NC K+ +D  +  +D  L +   + +++  E ++K E ++G   + C  C+ K  +AS           L + +KRF     +   KI   +   E +++ P+ S      Q Y L +V+ H+G S   GHY+ ++K  N  WY+ +D SV
Sbjct:  123 CFLNSTLQCLTYTAPLANYMLTREHSKTCHEPGFCMMCTMQNHIIQVFANSGNVIKPISVLNE--LKRIGKHFRFGSQEDAHEFLRYTVDAMQKSCLPGNKLDRQTQATTFVHQIFGGYLRSRVKCLNC-KAVSDTFDPYLDISLEIKTAQTLSKAFEQFVKPEQLDGDNAYKCSKCK-KMVTASKRFTVHRSSNVLTISLKRFTN---FNGGKITKDVRYAEHLDLRPFMSQSHGEPQIYALYAVLVHSGFSCHAGHYYCYIKASNGQWYQMNDSSV 393          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Zebrafish
Match: usp42 (ubiquitin specific peptidase 42 [Source:ZFIN;Acc:ZDB-GENE-030131-5739])

HSP 1 Score: 69.3218 bits (168), Expect = 7.194e-12
Identity = 68/278 (24.46%), Postives = 122/278 (43.88%), Query Frame = 1
Query:  382 CYMNAAIQSI---FPALLYLNTIKETIEYDQSQECGAIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEELKGHSKLQRIP---------FEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDE-VEG---FNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEI-PYKSDDKVLKQKYRLVSVVNHTG-SLKRGHYFTFLKHGNF-WYKADDDSV 1158
            C++N+ +Q +    P   Y+ T + +    +   C    +   ++Q + N      PI +  +  L+       + + EDAHEFL   +D + +     +KL R           F     SR  C NC K+ +D  +  +D  L +   + +++  E ++K E ++G   + C  C+ K  +AS           L + +KRF     +   KI   +   E +++ P+ S      Q Y L +V+ H+G S   GHY+ ++K  N  WY+ +D SV
Sbjct:  123 CFLNSTLQCLTYTAPLANYMLTREHSKTCHEPGFCMMCTMQNHIIQVFANSGNVIKPISVLNE--LKRIGKHFRFGSQEDAHEFLRYTVDAMQKSCLPGNKLDRQTQATTFVHQIFGGYLRSRVKCLNC-KAVSDTFDPYLDISLEIKTAQTLSKAFEQFVKPEQLDGDNAYKCSKCK-KMVTASKRFTVHRSSNVLTISLKRFTN---FNGGKITKDVRYAEHLDLRPFMSQSHGEPQIYALYAVLVHSGFSCHAGHYYCYIKASNGQWYQMNDSSV 393          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Zebrafish
Match: usp48 (ubiquitin specific peptidase 48 [Source:ZFIN;Acc:ZDB-GENE-050522-197])

HSP 1 Score: 67.3958 bits (163), Expect = 1.868e-11
Identity = 86/327 (26.30%), Postives = 142/327 (43.43%), Query Frame = 1
Query:  283 LLEMETNEIQNMVSNQSEELD-HAPVPLTNHRVNCYMNAAIQSIFPAL-------LYLNTIKETIEYDQSQE----CGAIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEELKGHSK--LQRI---PFEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDE-VEGFN---CENCEVKNGSASSEVVFSELPQYLVVCIKRFA-THSYYQTKKINDRICIDEIIEIPYKSDDKVLKQKYRLVSVVNHTG-SLKRGHYFTFLK--HGNFWYKADDDSVRKCELEYMKM 1188
            L E++ N   N+    SE  D +  V LTN    CY+N  +Q  F  L        + N+  E    D   E    C  +  + +LLQ   +   +  P  + +       +L L     +DA EF   +L  L + L       LQ +    F         CN CG+ +   P+   +  L +   KN+TE +  +LK+E ++G N   CE+C+ K  +A+  +    LP+ L   + RF         KK+N  I   E++++    + +  K  Y L +V+ H G S   GHY   ++  H N WYK +D+ + K E + +++
Sbjct:   65 LGEIDENTFHNIDDPNSERRDKNTFVGLTNLGATCYVNTFLQVWFHNLELRRALYRFQNSRAEGHNTDSDYEPRTICEHLQYLFALLQN--SNRRYIDPSGLVK-------ALGLDTGQQQDAQEFSKLFLSLLEDTLSKQKDPNLQNVIQQQFCGQFSYVTVCNKCGRES-PLPSRFYELELNIQGHKNLTECVTEFLKEEKLDGDNRYYCESCQSKQ-NATRRIKLQSLPRTLNFQLMRFVFDRQSGHKKKLNTFISFPEVLDMEPFLEGREEKCTYELSAVLIHRGVSAYSGHYIAHVRDAHTNDWYKFNDEEIEKMEGKKLQL 380          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Zebrafish
Match: usp48 (ubiquitin specific peptidase 48 [Source:ZFIN;Acc:ZDB-GENE-050522-197])

HSP 1 Score: 66.6254 bits (161), Expect = 5.191e-11
Identity = 86/327 (26.30%), Postives = 142/327 (43.43%), Query Frame = 1
Query:  283 LLEMETNEIQNMVSNQSEELD-HAPVPLTNHRVNCYMNAAIQSIFPAL-------LYLNTIKETIEYDQSQE----CGAIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEELKGHSK--LQRI---PFEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDE-VEGFN---CENCEVKNGSASSEVVFSELPQYLVVCIKRFA-THSYYQTKKINDRICIDEIIEIPYKSDDKVLKQKYRLVSVVNHTG-SLKRGHYFTFLK--HGNFWYKADDDSVRKCELEYMKM 1188
            L E++ N   N+    SE  D +  V LTN    CY+N  +Q  F  L        + N+  E    D   E    C  +  + +LLQ   +   +  P  + +       +L L     +DA EF   +L  L + L       LQ +    F         CN CG+ +   P+   +  L +   KN+TE +  +LK+E ++G N   CE+C+ K  +A+  +    LP+ L   + RF         KK+N  I   E++++    + +  K  Y L +V+ H G S   GHY   ++  H N WYK +D+ + K E + +++
Sbjct:   64 LGEIDENTFHNIDDPNSERRDKNTFVGLTNLGATCYVNTFLQVWFHNLELRRALYRFQNSRAEGHNTDSDYEPRTICEHLQYLFALLQN--SNRRYIDPSGLVK-------ALGLDTGQQQDAQEFSKLFLSLLEDTLSKQKDPNLQNVIQQQFCGQFSYVTVCNKCGRES-PLPSRFYELELNIQGHKNLTECVTEFLKEEKLDGDNRYYCESCQSKQ-NATRRIKLQSLPRTLNFQLMRFVFDRQSGHKKKLNTFISFPEVLDMEPFLEGREEKCTYELSAVLIHRGVSAYSGHYIAHVRDAHTNDWYKFNDEEIEKMEGKKLQL 379          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Xenopus
Match: ENSXETT00000030414.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:5:124917763:124921450:-1 gene:ENSXETG00000003555.1 transcript:ENSXETT00000030414.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.559 bits (179), Expect = 1.416e-13
Identity = 79/305 (25.90%), Postives = 127/305 (41.64%), Query Frame = 1
Query:  361 LTNHRVNCYMNAAIQSI---FPALLYLNTIKETIEYDQSQECGAIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEE-LKGHSKLQRIP------FEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDEVEGFNCENCEVKNGSASSEVVFS--ELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEI-PYKSDDKVLKQKYRLVSVVNHTG-SLKRGHYFTFLKHGNF-WYKADDDSVRKCELEYMKMISTYSCYIEVFEKL 1230
            L N    CYMN+ +Q +    P   Y  T + +    +   C     M  L+Q +I Q              ++  +        EDAHEFL   +D L +  L G+  L R        F     S   C NC    +D  +  +D  L +    ++ E ++ Y++ E  G +C  C   N   ++   FS  + P  L +C+ RF   S     KI+  +   E I+I PY S+       YRL +V+ H G +   GHY+ +++  N  WYK +DD V   ++  +  +  Y  +   +E L
Sbjct:   36 LRNLGNTCYMNSVLQCLTYTAPLANYFLTCEHSKRCVKKGFC-----MMCLMQKHIAQ--------------VKRIAGHFKQGRQEDAHEFLRYAVDALQQACLTGYDSLDRTTTFIHQVFGGYLRSEVRCLNC-SGVSDTFDQFLDLQLDIKKANSVIEALKEYVRPENLGESCYKCSKCNKMVTATKTFSIHQPPNVLTLCLNRFDVFS---ENKISKMVTYPEFIDIHPYTSEKSEGTINYRLYAVLVHAGNTCNSGHYYCYVQAPNSKWYKMNDDCVTPVDINTVLKLEAYLLFYIRYELL 317          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Xenopus
Match: ENSXETT00000031190.1 (ubiquitin carboxyl-terminal hydrolase 42-like [Source:NCBI gene;Acc:101735032])

HSP 1 Score: 73.559 bits (179), Expect = 1.434e-13
Identity = 79/305 (25.90%), Postives = 127/305 (41.64%), Query Frame = 1
Query:  361 LTNHRVNCYMNAAIQSI---FPALLYLNTIKETIEYDQSQECGAIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEE-LKGHSKLQRIP------FEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDEVEGFNCENCEVKNGSASSEVVFS--ELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEI-PYKSDDKVLKQKYRLVSVVNHTG-SLKRGHYFTFLKHGNF-WYKADDDSVRKCELEYMKMISTYSCYIEVFEKL 1230
            L N    CYMN+ +Q +    P   Y  T + +    +   C     M  L+Q +I Q              ++  +        EDAHEFL   +D L +  L G+  L R        F     S   C NC   + D  +  +D  L +    ++ E ++ Y++ E  G +C  C   N   ++   FS  + P  L +C+ RF   S     KI+  +   E I+I PY S+       YRL +V+ H G +   GHY+ +++  N  WYK +DD V   ++  +  +  Y  +   +E L
Sbjct:   51 LRNLGNTCYMNSVLQCLTYTAPLANYFLTCEHSKRCVKKGFC-----MMCLMQKHIAQ--------------VKRIAGHFKQGRQEDAHEFLRYAVDALQQACLTGYDSLDRTTTFIHQVFGGYLRSEVRCLNCSGVS-DTFDQFLDLQLDIKKANSVIEALKEYVRPENLGESCYKCSKCNEMVTATKTFSIHQPPNVLTLCLNRFDVFS---ENKISKMVTYPEFIDIHPYTSEKSEGTINYRLYAVLVHAGNTCNSGHYYCYVQAPNSKWYKMNDDCVTPVDINTVLKLEAYLLFYIRYELL 332          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Xenopus
Match: rpl7l1 (ribosomal protein L7 like 1 [Source:Xenbase;Acc:XB-GENE-5911163])

HSP 1 Score: 71.633 bits (174), Expect = 4.922e-13
Identity = 81/305 (26.56%), Postives = 131/305 (42.95%), Query Frame = 1
Query:  361 LTNHRVNCYMNAAIQSI---FPALLYLNTIKETIEYDQSQECGAIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEE-LKGHSKLQRIP------FEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDEVEGFNCENCEVKNGSASSEVVFS--ELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEI-PYKSDDKVLKQKYRLVSVVNHTG-SLKRGHYFTFLKHGNF-WYKADDDSVRKCELEYMKMISTYSCYIEVFEKL 1230
            L N    CYMN+ +Q +    P   Y  T + +    +   C     M  L+Q +I Q + S+      Q+ +   +        EDAHEFL   +D L +  L G+  L R        F     S   C NC    +D  +  +D  L +    ++ E ++ Y++ E  G +C  C   N   ++   FS  + P  L +C+ RF   S     KI+  +   E I+I PY S+       YRL +V+ H G +   GHY+ +++  N  WYK +DD V   ++  +  +  Y  +   +E L
Sbjct:   36 LRNLGNTCYMNSVLQCLTYTAPLANYFLTCEHSKRCVKKGFC-----MMCLMQKHIAQVK-SVSGRGANQARI---AGHFKQGRQEDAHEFLRYAVDALQQACLTGYDSLDRTTTFIHQVFGGYLRSEVRCLNC-SGVSDTFDQFLDLQLDIKKANSVIEALKEYVRPENLGESCYKCSKCNEMVTATKTFSIHQPPNVLTLCLNRFDVFS---DNKISKMVTYPEFIDIHPYTSEKSEGTINYRLYAVLVHAGNTCNSGHYYCYVQAPNSKWYKMNDDCVTPVDINTVLKLEAYLLFYIRYELL 327          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Xenopus
Match: ENSXETT00000014911.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:5:124917318:124921450:-1 gene:ENSXETG00000003555.1 transcript:ENSXETT00000014911.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 72.0182 bits (175), Expect = 6.715e-13
Identity = 63/220 (28.64%), Postives = 100/220 (45.45%), Query Frame = 1
Query:  607 EDAHEFLNCYLDKLNEE-LKGHSKLQRIP------FEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDEVEGFNCENCEVKNGSASSEVVFS--ELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEI-PYKSDDKVLKQKYRLVSVVNHTG-SLKRGHYFTFLKHGNF-WYKADDDSVRKCELEYMKMISTYSCYIEVFEKL 1230
            EDAHEFL   +D L +  L G+  L R        F     S   C NC   + D  +  +D  L +    ++ E ++ Y++ E  G +C  C   N   ++   FS  + P  L +C+ RF   S     KI+  +   E I+I PY S+       YRL +V+ H G +   GHY+ +++  N  WYK +DD V   ++  +  +  Y  +   +E L
Sbjct:  102 EDAHEFLRYAVDALQQACLTGYDSLDRTTTFIHQVFGGYLRSEVRCLNCSGVS-DTFDQFLDLQLDIKKANSVIEALKEYVRPENLGESCYKCSKCNKMVTATKTFSIHQPPNVLTLCLNRFDVFS---ENKISKMVTYPEFIDIHPYTSEKSEGTINYRLYAVLVHAGNTCNSGHYYCYVQAPNSKWYKMNDDCVTPVDINTVLKLEAYLLFYIRYELL 317          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Xenopus
Match: eif1b (eukaryotic translation initiation factor 1B [Source:Xenbase;Acc:XB-GENE-1010215])

HSP 1 Score: 66.2402 bits (160), Expect = 9.397e-11
Identity = 72/286 (25.17%), Postives = 130/286 (45.45%), Query Frame = 1
Query:  382 CYMNAAIQSI---FPALLYLNTIKETIEYDQSQE-CGAIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEE-LKGHSKLQRIP---------FEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDE-VEG---FNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEI-PYKSDDKVLKQKYRLVSVVNHTG-SLKRGHYFTFLKHGN-FWYKADDDSVRKCELE 1176
            C++N+ +Q +    P   YL + +E  E   SQ+ C   ++   +  A  N      P  +     L   S    + + EDAHEFL   +D++ +  L+G  +L R           F     SR  C +C K+ +D  +  +D  L + +  ++ + +E +++ E ++G   + C  C+ +  +AS           L + +KRFA+   +   K++  I   E +++ PY SD       Y L +V+ HTG S   GHY+ ++K  N  WY  +D +V   ++ 
Sbjct:  107 CFVNSVLQCLTYTAPLSNYLIS-REHSETCHSQDFCMMCVMQTHISMALSNSGGVIKPSAVVND--LRRISKNFRYGSQEDAHEFLRYTVDEMQKSCLRGSCRLDRHTQATTLIHQVFGGYLRSRVTCLSC-KAVSDTYDQYLDLTLEIKMAHSVNQALEQFVRPEQLDGDNAYKCSKCK-QMVTASKRFTIHRTSNVLTLSLKRFAS---FNGGKLSKEIKYPEYLDLRPYTSDPNGEPVIYVLYAVLIHTGFSCHGGHYYCYVKACNDQWYLMNDSTVSTTDIR 384          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Mouse
Match: Usp36 (ubiquitin specific peptidase 36 [Source:MGI Symbol;Acc:MGI:1919594])

HSP 1 Score: 73.559 bits (179), Expect = 4.435e-13
Identity = 75/280 (26.79%), Postives = 120/280 (42.86%), Query Frame = 1
Query:  379 NCYMNAAIQSIF--PALL-YLNTIKETIEYDQSQECGAIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEE-LKGHSKLQRIP---------FEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDEV----EGFNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEI-PYKSDDKVLKQKYRLVSVVNHTG-SLKRGHYFTFLKHGNF-WYKADDDSV 1158
             C++N+ IQ +   P L  YL + +      Q   C   ++   ++QA+ N      P+       L+  +    + N EDAHEFL   +D + +  L G++KL R           F     SR  C+ C KS +D  +  +D  L +    N+   +E ++K +V      + C  C+ K   AS           L + +KRFA    +   KI   +   E + I PY S        Y L +V+ H+G S   GHY+ ++K  N  WY+ +D  V
Sbjct:  130 TCFLNSTIQCLTYTPPLANYLLSKEHARSCHQGGFCMLCLMQNHMVQAFANSGNAIKPVSFIRD--LKKIARHFRFGNQEDAHEFLRYTIDAMQKACLNGYAKLDRQTQATTLVHQIFGGYLRSRVKCSVC-KSVSDTYDPYLDIALEIRQAANIVRALELFVKSDVLSGENAYMCAKCK-KKVPASKRFTIHRTSNVLTLSLKRFAN---FSGGKITKDVGYPEFLNIRPYMSQSSGDPVMYGLYAVLVHSGYSCHAGHYYCYVKASNGQWYQMNDSLV 402          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Mouse
Match: Usp36 (ubiquitin specific peptidase 36 [Source:MGI Symbol;Acc:MGI:1919594])

HSP 1 Score: 73.559 bits (179), Expect = 4.435e-13
Identity = 75/280 (26.79%), Postives = 120/280 (42.86%), Query Frame = 1
Query:  379 NCYMNAAIQSIF--PALL-YLNTIKETIEYDQSQECGAIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEE-LKGHSKLQRIP---------FEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDEV----EGFNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEI-PYKSDDKVLKQKYRLVSVVNHTG-SLKRGHYFTFLKHGNF-WYKADDDSV 1158
             C++N+ IQ +   P L  YL + +      Q   C   ++   ++QA+ N      P+       L+  +    + N EDAHEFL   +D + +  L G++KL R           F     SR  C+ C KS +D  +  +D  L +    N+   +E ++K +V      + C  C+ K   AS           L + +KRFA    +   KI   +   E + I PY S        Y L +V+ H+G S   GHY+ ++K  N  WY+ +D  V
Sbjct:  130 TCFLNSTIQCLTYTPPLANYLLSKEHARSCHQGGFCMLCLMQNHMVQAFANSGNAIKPVSFIRD--LKKIARHFRFGNQEDAHEFLRYTIDAMQKACLNGYAKLDRQTQATTLVHQIFGGYLRSRVKCSVC-KSVSDTYDPYLDIALEIRQAANIVRALELFVKSDVLSGENAYMCAKCK-KKVPASKRFTIHRTSNVLTLSLKRFAN---FSGGKITKDVGYPEFLNIRPYMSQSSGDPVMYGLYAVLVHSGYSCHAGHYYCYVKASNGQWYQMNDSLV 402          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Mouse
Match: Usp42 (ubiquitin specific peptidase 42 [Source:MGI Symbol;Acc:MGI:1924050])

HSP 1 Score: 72.0182 bits (175), Expect = 1.482e-12
Identity = 76/292 (26.03%), Postives = 127/292 (43.49%), Query Frame = 1
Query:  379 NCYMNAAIQSIFPALLYLNTIKE-TIEYDQSQECGA------IILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEE-LKGHSKLQRIP---------FEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDE-VEG---FNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEI-PYKSDDKVLKQKYRLVSVVNHTG-SLKRGHYFTFLKHGN-FWYKADDDSVRKCELEYM 1182
             C+ NAA+Q     L Y   +    + ++ S+ C A        +   + QA  N  +   P+ +  +  +   +    + N EDAHEFL   +D + +  L G +KL R           F     SR  C NC K  +D  +  +D  L +   +++T+ +E ++K E ++G   + C  C+ K   AS           L + +KRFA    +   KI   +   E ++I PY S        Y L +V+ HTG +   GHYF ++K  N  WY+ +D  V   ++  +
Sbjct:  118 TCFANAALQ----CLTYTPPLANYMLSHEHSKTCHAEGFCMMCTMQTHITQALSNPGDVIKPMFVINE--MRRIARHFRFGNQEDAHEFLQYTVDAMQKACLNGSNKLDRHTQATTLVCQIFGGYLRSRVKCLNC-KGVSDTFDPYLDITLEIKAAQSVTKALEQFVKPEQLDGENSYKCSKCK-KMVPASKRFTIHRSSNVLTISLKRFAN---FTGGKIAKDVKYPEYLDIRPYMSQPNGEPIIYVLYAVLVHTGFNCHAGHYFCYIKASNGLWYQMNDSIVSTSDIRAV 398          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Mouse
Match: Usp17le (ubiquitin specific peptidase 17-like E [Source:MGI Symbol;Acc:MGI:107697])

HSP 1 Score: 68.1662 bits (165), Expect = 1.298e-11
Identity = 81/332 (24.40%), Postives = 149/332 (44.88%), Query Frame = 1
Query:  244 PKTPKQSENSTKLLLEMETNEIQNMVSNQSEELDHAP-VPLTNHRVNCYMNAAIQSIF---PALLYLNTIKETIEYDQSQECGAIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEE-LKGHSKLQRIPFEAA--HD-------SRYFCNNC-GKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLK-DEVEGFN---CENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEI-PYKSDDKVLKQKYRLVSVVNHTGSLK-RGHYFTFLKHGNF-WYKADDDSVRKCEL 1173
            P  P+  ++  +++ E+ TN   ++    S E    P   L N   +CY+NAA+Q +    P   Y+ + + +      + C    +   + Q+ ++     +          +  +        EDAHEFL   L+ ++E  L+ H +    P + +  HD       S+  C +C G S+   P   +D  L +S  +++ + + +  K +E+ G N   C  C  K   AS  +     P+ L++ +KRF   S +   K++ ++   E +++ PY S+       Y L +V+ H G+    GHYF  +K G+  WYK DD  V +C++
Sbjct:   51 PDAPELHQDEAQVVEELTTNGKHSL----SWESPQGPGCGLQNTGNSCYLNAALQCLTHTPPLADYMLSQEHSQTCCSPEGCKMCAMEAHVTQSLLHSHSGDV------MKPSQILTSAFHKHQQEDAHEFLMFTLETMHESCLQVHRQSDPTPQDTSPIHDIFGGWWRSQIKCLHCQGTSHTFDP--FLDVPLDISSAQSVNQALWDTGKSEELLGENAYYCGRCRQKM-PASKTLHVHIAPKVLLLVLKRF---SAFTGNKLDRKVSYPEFLDLKPYLSEPTGGPLPYALYAVLVHDGATSNSGHYFCCVKAGHGKWYKMDDTKVTRCDV 366          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Mouse
Match: Usp17le (ubiquitin specific peptidase 17-like E [Source:MGI Symbol;Acc:MGI:107697])

HSP 1 Score: 68.1662 bits (165), Expect = 1.501e-11
Identity = 81/332 (24.40%), Postives = 149/332 (44.88%), Query Frame = 1
Query:  244 PKTPKQSENSTKLLLEMETNEIQNMVSNQSEELDHAP-VPLTNHRVNCYMNAAIQSIF---PALLYLNTIKETIEYDQSQECGAIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEE-LKGHSKLQRIPFEAA--HD-------SRYFCNNC-GKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLK-DEVEGFN---CENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEI-PYKSDDKVLKQKYRLVSVVNHTGSLK-RGHYFTFLKHGNF-WYKADDDSVRKCEL 1173
            P  P+  ++  +++ E+ TN   ++    S E    P   L N   +CY+NAA+Q +    P   Y+ + + +      + C    +   + Q+ ++     +          +  +        EDAHEFL   L+ ++E  L+ H +    P + +  HD       S+  C +C G S+   P   +D  L +S  +++ + + +  K +E+ G N   C  C  K   AS  +     P+ L++ +KRF   S +   K++ ++   E +++ PY S+       Y L +V+ H G+    GHYF  +K G+  WYK DD  V +C++
Sbjct:   51 PDAPELHQDEAQVVEELTTNGKHSL----SWESPQGPGCGLQNTGNSCYLNAALQCLTHTPPLADYMLSQEHSQTCCSPEGCKMCAMEAHVTQSLLHSHSGDV------MKPSQILTSAFHKHQQEDAHEFLMFTLETMHESCLQVHRQSDPTPQDTSPIHDIFGGWWRSQIKCLHCQGTSHTFDP--FLDVPLDISSAQSVNQALWDTGKSEELLGENAYYCGRCRQKM-PASKTLHVHIAPKVLLLVLKRF---SAFTGNKLDRKVSYPEFLDLKPYLSEPTGGPLPYALYAVLVHDGATSNSGHYFCCVKAGHGKWYKMDDTKVTRCDV 366          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. UniProt/SwissProt
Match: sp|Q9VYQ8|UBP7_DROME (Ubiquitin carboxyl-terminal hydrolase 7 OS=Drosophila melanogaster OX=7227 GN=Usp7 PE=1 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 4.913e-13
Identity = 81/287 (28.22%), Postives = 122/287 (42.51%), Query Frame = 1
Query:  355 VPLTNHRVNCYMNAAIQSI-FPALLYLNTIKETIEYDQSQECGAIILMESLLQAYINQEEFS-IPICIYEQSSLEYFSLELSWENME-----DAHEFLNCYLDKLNEELKGHSKLQRIP--FEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDE-VEGFNCENCEVKN-GSASSEVVFSELPQYLVVCIKRFATHSYYQTK-KINDRICIDEIIEIP-YKSDDKVLKQKYRLVSVVNHTGSLKRGHYFTFL--KHGNFWYKADDDSVRKCE 1170
            V L N    CYMN+ +Q++ F   L L+  +   E D S +   + L     Q   ++ +F   P+        +  +    WE ++     D  EFL   LDKL  ++KG      IP  FE    S   C N    N+ +     D  L +   KN+ E  ++Y+  E +EG N  +  V     AS  V+F+  P  L + + RF       +  K NDR    E I +  Y ++ +     Y L +V+ H+G    GHY  F+  K    W+K DDD V  C 
Sbjct:  241 VGLKNQGATCYMNSLLQTLYFTNSLRLSVYRIPTEADDSSKSVGLSL-----QRVFHELQFGDRPV------GTKKLTKSFGWETLDSFMQHDVQEFLRVLLDKLESKMKGTILEGTIPGLFEGKMSSYIKCKNV-DYNSTRYETFYDIQLNIKDKKNIYESFQDYVAPETLEGDNKYDAGVHGLQEASKGVIFTSFPPVLHLHLMRFQYDPVTDSSIKYNDRFEFYEHINLDRYLAESENTLADYVLHAVLVHSGDNHGGHYVVFINPKADGRWFKFDDDVVSSCR 515          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. UniProt/SwissProt
Match: sp|Q09738|UBP8_SCHPO (Probable ubiquitin carboxyl-terminal hydrolase 8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp8 PE=3 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 1.268e-12
Identity = 71/283 (25.09%), Postives = 127/283 (44.88%), Query Frame = 1
Query:  361 LTNHRVNCYMNAAIQSIFPALLYLNTIKETIEYDQSQECG-------AIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEELKGHSKL------QRIPFEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKN---MTEMIENYLKDEVEGFNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEIPYK-SDDKVLKQKYRLVSVVNHTGSLKRGHYFTFLKHGNFWYKADDDSV 1158
            + N    C+M+  +QSI    L  N       +  S +C        AI  M S +    N+  F  P  +   + +   S  L   + +D HEF    LD+++ E  G + +       RI F  +  +   C +C      K  + VD ++ +S+  N   +   +E ++  E   ++C +C  KN  A  ++VF +LP  + + +KRF  +++  + KI+ ++     + + Y  + D V    Y+L SVV H G+L  GHY  +  + N W+  DD ++
Sbjct:  147 IQNLGATCFMSVILQSILHNPLVRNLFFSG--FHTSTDCKRPTCMTCAIDDMFSSIYNSKNKSTFYGPTAVL--NLMWKLSKSLCGYSQQDGHEFFVYLLDQMHTESGGGTSMPCTCPIHRI-FSGSLKNVVTCLDC-----KKERVAVDPLMDISLDINEPTLQGCLERFVSKEKVQYSCHSCGSKN--AIKQLVFDKLPPTICMQLKRFEQNNFAMSTKIDKQVSYPAFLRMRYNFNQDDV---DYQLYSVVCHKGTLDTGHYIAYTYYQNQWFLLDDTTI 414          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. UniProt/SwissProt
Match: sp|B1AQJ2|UBP36_MOUSE (Ubiquitin carboxyl-terminal hydrolase 36 OS=Mus musculus OX=10090 GN=Usp36 PE=1 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 3.102e-12
Identity = 75/280 (26.79%), Postives = 120/280 (42.86%), Query Frame = 1
Query:  379 NCYMNAAIQSIF--PALL-YLNTIKETIEYDQSQECGAIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEE-LKGHSKLQRIP---------FEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDEV----EGFNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEI-PYKSDDKVLKQKYRLVSVVNHTG-SLKRGHYFTFLKHGNF-WYKADDDSV 1158
             C++N+ IQ +   P L  YL + +      Q   C   ++   ++QA+ N      P+       L+  +    + N EDAHEFL   +D + +  L G++KL R           F     SR  C+ C KS +D  +  +D  L +    N+   +E ++K +V      + C  C+ K   AS           L + +KRFA    +   KI   +   E + I PY S        Y L +V+ H+G S   GHY+ ++K  N  WY+ +D  V
Sbjct:  130 TCFLNSTIQCLTYTPPLANYLLSKEHARSCHQGGFCMLCLMQNHMVQAFANSGNAIKPVSFIRD--LKKIARHFRFGNQEDAHEFLRYTIDAMQKACLNGYAKLDRQTQATTLVHQIFGGYLRSRVKCSVC-KSVSDTYDPYLDIALEIRQAANIVRALELFVKSDVLSGENAYMCAKCK-KKVPASKRFTIHRTSNVLTLSLKRFAN---FSGGKITKDVGYPEFLNIRPYMSQSSGDPVMYGLYAVLVHSGYSCHAGHYYCYVKASNGQWYQMNDSLV 402          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. UniProt/SwissProt
Match: sp|Q9P275|UBP36_HUMAN (Ubiquitin carboxyl-terminal hydrolase 36 OS=Homo sapiens OX=9606 GN=USP36 PE=1 SV=4)

HSP 1 Score: 72.7886 bits (177), Expect = 4.535e-12
Identity = 76/280 (27.14%), Postives = 120/280 (42.86%), Query Frame = 1
Query:  379 NCYMNAAIQSIF--PALL-YLNTIKETIEYDQSQECGAIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEE-LKGHSKLQRIP---------FEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDEV----EGFNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEI-PYKSDDKVLKQKYRLVSVVNHTG-SLKRGHYFTFLKHGNF-WYKADDDSV 1158
             C++NA IQ +   P L  YL + +      Q   C   ++   ++QA+ N      P+       L+  +    + N EDAHEFL   +D + +  L G +KL R           F     SR  C+ C KS +D  +  +D  L +    N+   +E ++K +V      + C  C+ K   AS           L + +KRFA    +   KI   +   E + I PY S +      Y L +V+ H+G S   GHY+ ++K  N  WY+ +D  V
Sbjct:  130 TCFLNATIQCLTYTPPLANYLLSKEHARSCHQGSFCMLCVMQNHIVQAFANSGNAIKPVSFIRD--LKKIARHFRFGNQEDAHEFLRYTIDAMQKACLNGCAKLDRQTQATTLVHQIFGGYLRSRVKCSVC-KSVSDTYDPYLDVALEIRQAANIVRALELFVKADVLSGENAYMCAKCK-KKVPASKRFTIHRTSNVLTLSLKRFAN---FSGGKITKDVGYPEFLNIRPYMSQNNGDPVMYGLYAVLVHSGYSCHAGHYYCYVKASNGQWYQMNDSLV 402          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. UniProt/SwissProt
Match: sp|B2RQC2|UBP42_MOUSE (Ubiquitin carboxyl-terminal hydrolase 42 OS=Mus musculus OX=10090 GN=Usp42 PE=1 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 1.036e-11
Identity = 76/292 (26.03%), Postives = 127/292 (43.49%), Query Frame = 1
Query:  379 NCYMNAAIQSIFPALLYLNTIKE-TIEYDQSQECGA------IILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEE-LKGHSKLQRIP---------FEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDE-VEG---FNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEI-PYKSDDKVLKQKYRLVSVVNHTG-SLKRGHYFTFLKHGN-FWYKADDDSVRKCELEYM 1182
             C+ NAA+Q     L Y   +    + ++ S+ C A        +   + QA  N  +   P+ +  +  +   +    + N EDAHEFL   +D + +  L G +KL R           F     SR  C NC K  +D  +  +D  L +   +++T+ +E ++K E ++G   + C  C+ K   AS           L + +KRFA    +   KI   +   E ++I PY S        Y L +V+ HTG +   GHYF ++K  N  WY+ +D  V   ++  +
Sbjct:  118 TCFANAALQ----CLTYTPPLANYMLSHEHSKTCHAEGFCMMCTMQTHITQALSNPGDVIKPMFVINE--MRRIARHFRFGNQEDAHEFLQYTVDAMQKACLNGSNKLDRHTQATTLVCQIFGGYLRSRVKCLNC-KGVSDTFDPYLDITLEIKAAQSVTKALEQFVKPEQLDGENSYKCSKCK-KMVPASKRFTIHRSSNVLTISLKRFAN---FTGGKIAKDVKYPEYLDIRPYMSQPNGEPIIYVLYAVLVHTGFNCHAGHYFCYIKASNGLWYQMNDSIVSTSDIRAV 398          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. TrEMBL
Match: A0EB12 (Uncharacterized protein OS=Paramecium tetraurelia OX=5888 GN=GSPATT00025213001 PE=3 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 3.801e-21
Identity = 96/362 (26.52%), Postives = 170/362 (46.96%), Query Frame = 1
Query:  250 TPKQSENSTKLLLE--METNEIQNMVSNQSEE----LDHAPVP---LTNHRVNCYMNAAIQSIFPALLYLNTIKETIEYDQSQECGA-IILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEELKGHSKLQR---------------------IPFEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVS---VGKNMTEMIENYLKDEV--EGFNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEIPYKSDDKVLKQKYRLVSVVNHTGSLKRGHYFTFLKHGNFWYKADDDSVRKCELEYMKMISTYSCYIEVFEK 1227
            TPK  +  T  ++E     +  QN      E+    +    +P   L N R  CY+N+A+Q     LL ++++ E I   Q ++    ++  + LL+       FS    I  QS  E  S +  +   +D+HEFL  +L K+ EEL G  K ++                       F     S+ FC +C +   +  + + D  L +S    G ++ + +++Y ++EV  + + C+ C+  N S    +  S+ P+YL++  KRF T  +  ++KIND I   E ++I  +   K L+ KY+L +++ H GS+  GHY  + +  + WY  DD++V K      K +S  S Y+ +++K
Sbjct:  223 TPKSVDRQTSQIIEPPQRNDSAQNYRKGYEEQKRPSISQGQLPIVGLRNPRYYCYLNSALQ----VLLSIDSLSEGILAVQPKQGQKYLVAYQELLRTIKRSGSFS---AIAAQSVWENCSGKFQFNQQQDSHEFLLFFLGKIQEELVGKYKNKQEFNSAEQAWSDYTSKNYDIVDTIFAGQSTSQSFCKSCNQVC-EGYDPIWDLSLPISKSYTGVDLMDCLKSYYREEVINDTWKCDKCKKTNKSVKRRMFISQTPKYLIIQFKRFTT--FPTSQKINDSISYPEKLDI-QEFCSKGLQTKYKLKALITHMGSINGGHYKAYAERYDNWYLFDDETVSKIN---GKQLSDRSAYVLLYQK 570          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. TrEMBL
Match: A0CPE0 (Uncharacterized protein OS=Paramecium tetraurelia OX=5888 GN=GSPATT00009048001 PE=3 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 1.395e-17
Identity = 81/318 (25.47%), Postives = 154/318 (48.43%), Query Frame = 1
Query:  355 VPLTNHRVNCYMNAAIQSIFPALLYLNTIKETIEYDQSQECGAIILM-ESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEELKGHSKLQR---------------------IPFEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVS---VGKNMTEMIENYLKDEV--EGFNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEIPYKSDDKVLKQKYRLVSVVNHTGSLKRGHYFTFLKHGNFWYKADDDSVRKCELEYMKMISTYSCYIEVFEK 1227
            + L+N R  CY+N+A+Q     LL ++++ E I   Q +     +   + LL++      +S    I  +S  +  S +  +   +D+HEFL  +L K+ EEL G  K ++                     + F     S+ +C +C +      + + D  L ++    G ++ + +++Y ++EV  + + C+ C+  N S    +  S+ P+YL++  KRF T  +  ++KIND I   E ++I  +   K L+ +Y+L +++ H G +  GHY  + +  + WY  DD++V K      K +S  S Y+ ++EK
Sbjct:  279 IGLSNPRYYCYLNSALQ----VLLSIDSLTEGILAIQPKYGQKFLTAYQELLRSIKKTGSYS---SIAAKSVWDACSGKFQFNQQQDSHEFLLFFLGKIQEELVGKYKNKQEFNSAEQAWSDYTSKNQDIIDLIFAGQSTSQSYCKSCNQVCEGY-DPIWDLSLSINKSYTGIDLMDCLKSYYREEVINDTWKCDKCKKSNKSVKRRMFISQTPRYLIIQFKRFTT--FPTSQKINDSISYPEKLDI-QEFCSKGLQTQYKLKALITHMGQINGGHYKAYAERYDNWYLFDDENVSKIN---GKQLSDRSAYVLLYEK 582          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. TrEMBL
Match: A0A093BZT1 (Ubiquitin carboxyl-terminal hydrolase 42 (Fragment) OS=Pterocles gutturalis OX=240206 GN=N339_03396 PE=4 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 2.709e-16
Identity = 82/290 (28.28%), Postives = 138/290 (47.59%), Query Frame = 1
Query:  349 APVPLTNHRVNCYMNAAIQSIF---PALLYLNTIKETIEYDQSQECGA-IILMESLLQAYINQEEFSIPICIYEQ---SSLEYFSLELSWENMEDAHEFLNCYLDKLNEELKGHSKLQRIPFEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLK----DEVEGFNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEI-PYKSDDKVLKQKYRLVSVVNHTGS-LKRGHYFTFLKHGNF-WYKADDDSVRKCELE 1176
            A   L N    C++N+ +Q +    P   YL      +  + SQ C      M  +L+A++N+   S    I+     S+L +          EDAHEFL C +D ++ E    + + +I F     SR  C +C K+ +D     +D +L +  G ++T  +E++++    D   G+ C  C  +  +AS  +        L VC+KRF   S     KIN  +   E +++  Y S+    +  Y L +V+ H GS  + GHY+ F+K G+  WY+ +DDSVR C+++
Sbjct:   26 AGAGLYNLYNTCFLNSILQCLTYTPPLANYL------LSREHSQTCCQQGFCMMCVLEAHVNEALNSSGTAIWPTAVLSALRWIGAHFQLGRQEDAHEFLRCTVDAISYE--APTVVHQI-FGGELRSRVTCFSC-KAVSDTYEPFLDILLDIKAGSSVTGALEDFVRPEQLDGKNGYRCSKCG-ELATASKRLTIYRSSNVLTVCLKRFDAFS---GTKINKVVEYPEHLDLGAYMSEASEERPLYSLYAVLVHEGSGCQAGHYYCFVKAGDGQWYQMNDDSVRLCDIK 301          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. TrEMBL
Match: A0A091N367 (Ubiquitin carboxyl-terminal hydrolase 36 (Fragment) OS=Acanthisitta chloris OX=57068 GN=N310_00584 PE=4 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 6.002e-16
Identity = 81/296 (27.36%), Postives = 129/296 (43.58%), Query Frame = 1
Query:  334 EELDHAPVPLTNHRVNCYMNAAIQSIF---PALLYLNTIKETIEYDQSQECGAIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEE-LKGHSKLQRIP---------FEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDEVEG----FNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEI-PYKSDDKVLKQKYRLVSVVNHTG-SLKRGHYFTFLKHGNF-WYKADDDSVR 1161
            E +      L+N    C++N+A+Q +    P   YL + +          C    +    +QA+ N      P+ +     L+  S  L +   EDAHEFL   +D + +  L G++KL R           F     SR  C+ C K+ +D  +  +D  L V    N+   +E +++ E  G    + C  C  K  SAS           L + +KRF + S  + +KI   +   E ++I PY S+ K     Y L +V+ H+G S   GHYF ++K  N  WY+ +D  VR
Sbjct:   25 ERIHRVGAGLSNLGNTCFLNSALQCLTYTPPLTNYLLSREHGRTCAHGSFCMMCTMQNHTIQAFANSGNAIKPLSVIR--DLKKISHNLQFGRQEDAHEFLRYTIDAMQKACLNGYTKLDRQTQATTLVHQIFGGYLRSRVKCSEC-KTVSDTYDPYLDMTLEVERAANVVRALELFVRPEQLGGENAYMCGKCR-KKVSASKRFTIHRASNVLTISLKRFGSCSTSRGRKITKDVGYPEYLDIRPYMSEPKGDPVAYGLYAVLVHSGYSCNAGHYFCYVKASNGQWYQMNDHEVR 316          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. TrEMBL
Match: A0A2T0FDV1 (Ubiquitin carboxyl-terminal hydrolase 10 OS=Wickerhamiella sorbophila OX=45607 GN=B9G98_00781 PE=3 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 1.638e-15
Identity = 93/317 (29.34%), Postives = 148/317 (46.69%), Query Frame = 1
Query:  349 APVPLTNHRVNCYMNAAIQSIF--PAL-LYLNTIKETIEYDQSQECGAIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELS-WENMEDAHEFLNCYLDKLNEE--LKG---HSKLQRIPFEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSV----GK-NMTEMIENYLKDEV------EGFNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEI-PYKSDDKVLKQKYRLVSVVNHTG-SLKRGHYFTFLKHGNF-WYKADDDSVRKCELEYMKMISTYSCYIEVFEKL 1230
            APV L N  V CYMNAA+Q +F  PA+  YL  + +  +++  +       +  L +     ++ S          LE  +  +S WE  ED+HE+L   L +L E+   KG    S +    F    + +  C NCG  +    +     V F       GK  +++ +E++   EV      EG+ CE C+ +   A  +    + P+YL V IKRF   S    +K+ D++     +++  Y   ++ L  +Y LV V+ H G +L  GHY   +K  N  WY+ DDD VRK    Y+K  +  + YI V+ +L
Sbjct:  156 APVGLENRGVTCYMNAAMQLLFHLPAIGRYLVEVSQG-KHNNVKTSSVTAELAKLFRRLTEGKKKSSVYPTRMIQRLEDINCMMSEWEQ-EDSHEYLMSLLGRLQEDSTPKGEKLRSSIMHDIFGGTVEQQVTCRNCGHVSTTNQDFYDIPVSFSRSERKQGKYTLSQSVEDFFSPEVIKPKDKEGYQCEKCK-QITKAIKQNAIQDAPEYLTVHIKRF-KFSGSLGQKVKDQMLYPLDLDLTAYSKTEEPL--RYSLVGVIVHEGRTLSSGHYIAIVKQPNMKWYEYDDDIVRKVSDSYVK--NQENAYILVYSRL 464          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Cavefish
Match: ENSAMXT00000052072.1 (ubiquitin carboxyl-terminal hydrolase 17-like protein 13 [Source:NCBI gene;Acc:111194559])

HSP 1 Score: 79.337 bits (194), Expect = 3.830e-15
Identity = 69/274 (25.18%), Postives = 121/274 (44.16%), Query Frame = 1
Query:  379 NCYMNAAIQSI---FPALLYLNTIKETIEYDQSQECGAIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEELKGHSKLQRIP------FEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDE--VEGFNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEI-PYKSDDKVLKQKYRLVSVVNHTGSLKR-GHYFTFLKHGNF-WYKADDDSV 1158
             C+MN+ +Q +    P   Y+ + +      +   C +  L   +    +N     +P  +  Q  L     +  +   EDAHEFL   +  L +       L R        FE    SR  C NC KS++D     +D  L ++  K++ E ++ ++K E   +G+ C  C V    AS  +        L +C+KRF     +  +KI+  +   + +++ P+ S+ +   Q Y+L +V+ H G  +  GHY+ ++K  +  WYK DD  V
Sbjct:   30 TCFMNSVLQCLSYTAPLANYMLSGEHLRTCSRYSFCMSCTLQNHITHTIMNSGTAIVPASVVTQ--LNLIGEQFCFGQQEDAHEFLRYTVRALQQSYPDGKMLGRETNLINQIFEGCMRSRVKCLNC-KSDSDTFEPYMDVALDITGAKDLNESLQRFVKPEQLSDGYKCTRCMV-TSPASKTLTIHRSSNVLTICLKRFD----FNGQKISTLVKYPKHLDMRPFMSESEGESQVYKLYAVLVHAGYNRHFGHYYCYVKASDRKWYKMDDKQV 295          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Cavefish
Match: ENSAMXT00000051328.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000029.1:6147300:6154718:-1 gene:ENSAMXG00000034576.1 transcript:ENSAMXT00000051328.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 76.2554 bits (186), Expect = 2.917e-14
Identity = 76/312 (24.36%), Postives = 140/312 (44.87%), Query Frame = 1
Query:  280 LLLEMETNEIQNMVSNQSEELDHAPVPLTNHRVNCYMNAAIQSIF---PALLYLNTIKETIEYDQSQECGAIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDK----------LNEELKGHSKLQRIPFEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDE-VEGFNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEI-PYKSDDKVL--KQKYRLVSVVNHTGS-LKRGHYFTFLKHGNF-WYKADDDSV 1158
             L EME       +  +  E       L N    C++N+ +Q +    P   Y+ + + +      + C    + +   Q + N     IP+ +   S L   S +      EDAHEF +  +            L+ E +G + +++I FE    SR  C +C ++ +D     +D  L +   +++T+ +  +++ E ++G+ C  C +K   AS           L +C+KRF   ++Y   KI+  +     +++ P+ SD      +Q Y+L +V+ H+GS  + GHY+ ++K G+  WYK DD  V
Sbjct:   13 FLTEMEDRSAAERLRLRWNERLPVGAGLWNLGNTCFLNSVLQCLTYTPPLANYILSGEHSNTCFSPESCITCSIQKHFTQVFANPGTVIIPVDMV--SKLTLISEQFCLGQQEDAHEFFSYTVSALEQSCLNRNMLDRETEGTNLIKQI-FEGCMRSRVKCLSC-RAESDTFEPYMDVALDIREAEDLTDALRQFVRSEQLDGYKCNVC-MKTSPASKTFAIFRSSNVLTICLKRF---NFY-GDKISKFVRYPTYLDMDPFMSDGGGSDERQTYKLYAVLVHSGSDCQIGHYYCYVKAGDSKWYKMDDSEV 315          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Cavefish
Match: ENSAMXT00000047058.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000029.1:6147300:6154718:-1 gene:ENSAMXG00000034576.1 transcript:ENSAMXT00000047058.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 76.2554 bits (186), Expect = 2.917e-14
Identity = 76/312 (24.36%), Postives = 140/312 (44.87%), Query Frame = 1
Query:  280 LLLEMETNEIQNMVSNQSEELDHAPVPLTNHRVNCYMNAAIQSIF---PALLYLNTIKETIEYDQSQECGAIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDK----------LNEELKGHSKLQRIPFEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDE-VEGFNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEI-PYKSDDKVL--KQKYRLVSVVNHTGS-LKRGHYFTFLKHGNF-WYKADDDSV 1158
             L EME       +  +  E       L N    C++N+ +Q +    P   Y+ + + +      + C    + +   Q + N     IP+ +   S L   S +      EDAHEF +  +            L+ E +G + +++I FE    SR  C +C ++ +D     +D  L +   +++T+ +  +++ E ++G+ C  C +K   AS           L +C+KRF   ++Y   KI+  +     +++ P+ SD      +Q Y+L +V+ H+GS  + GHY+ ++K G+  WYK DD  V
Sbjct:   13 FLTEMEDRSAAERLRLRWNERLPVGAGLWNLGNTCFLNSVLQCLTYTPPLANYILSGEHSNTCFSPESCITCSIQKHFTQVFANPGTVIIPVDMV--SKLTLISEQFCLGQQEDAHEFFSYTVSALEQSCLNRNMLDRETEGTNLIKQI-FEGCMRSRVKCLSC-RAESDTFEPYMDVALDIREAEDLTDALRQFVRSEQLDGYKCNVC-MKTSPASKTFAIFRSSNVLTICLKRF---NFY-GDKISKFVRYPTYLDMDPFMSDGGGSDERQTYKLYAVLVHSGSDCQIGHYYCYVKAGDSKWYKMDDSEV 315          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Cavefish
Match: ENSAMXT00000052035.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000029.1:6147300:6154718:-1 gene:ENSAMXG00000034576.1 transcript:ENSAMXT00000052035.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 75.485 bits (184), Expect = 5.847e-14
Identity = 76/312 (24.36%), Postives = 140/312 (44.87%), Query Frame = 1
Query:  280 LLLEMETNEIQNMVSNQSEELDHAPVPLTNHRVNCYMNAAIQSIF---PALLYLNTIKETIEYDQSQECGAIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDK----------LNEELKGHSKLQRIPFEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDE-VEGFNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEI-PYKSDDKVL--KQKYRLVSVVNHTGS-LKRGHYFTFLKHGNF-WYKADDDSV 1158
             L EME       +  +  E       L N    C++N+ +Q +    P   Y+ + + +      + C    + +   Q + N     IP+ +   S L   S +      EDAHEF +  +            L+ E +G + +++I FE    SR  C +C ++ +D     +D  L +   +++T+ +  +++ E ++G+ C  C +K   AS           L +C+KRF   ++Y   KI+  +     +++ P+ SD      +Q Y+L +V+ H+GS  + GHY+ ++K G+  WYK DD  V
Sbjct:   13 FLTEMEDRSAAERLRLRWNERLPVGAGLWNLGNTCFLNSVLQCLTYTPPLANYILSGEHSNTCFSPESCITCSIQKHFTQVFANPGTVIIPVDMV--SKLTLISEQFCLGQQEDAHEFFSYTVSALEQSCLNRNMLDRETEGTNLIKQI-FEGCMRSRVKCLSC-RAESDTFEPYMDVALDIREAEDLTDALRQFVRSEQLDGYKCNVC-MKTSPASKTFAIFRSSNVLTICLKRF---NFY-GDKISKFVRYPTYLDMDPFMSDGGGSDERQTYKLYAVLVHSGSDCQIGHYYCYVKAGDSKWYKMDDSEV 315          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Cavefish
Match: usp48 (ubiquitin specific peptidase 48 [Source:NCBI gene;Acc:103027634])

HSP 1 Score: 66.2402 bits (160), Expect = 5.520e-11
Identity = 89/327 (27.22%), Postives = 142/327 (43.43%), Query Frame = 1
Query:  283 LLEMETNEIQNMVSNQSEELD-HAPVPLTNHRVNCYMNAAIQSIF-----PALLYL--NTIKET----IEYDQSQECGAIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEELKGHS--KLQRI---PFEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDE-VEGFN---CENCEVKNGSASSEVVFSELPQYLVVCIKRFA-THSYYQTKKINDRICIDEIIEIPYKSDDKVLKQKYRLVSVVNHTG-SLKRGHYFTFLKHG--NFWYKADDDSVRKCELEYMKM 1188
            L E++ N   N+    SE  D +  V LTN    CY+N  +Q  F       +LY+  N+  E      +Y+    C  +  + +LLQ    +         Y   S    +L L     +DA EF   +L  L + L       LQ +    F         CN C +S+   P+   +  L +   KN+TE I  +LK+E ++G N   CE+C+ K  SA+  +    LP  L + + RF         KK+N  I   E++++    + K  K  Y L +V+ H G S   GHY   ++    N WYK +D+ + K E + +++
Sbjct:   64 LGEIDENTFHNIDDPNSERRDKNTFVGLTNLGATCYVNTFLQVWFHNLELRRMLYMCQNSRAEGHNIESDYEPRTICEHLQYLFALLQNSNRR---------YIDPSGLVKALGLDTGQQQDAQEFSKLFLSLLEDTLSKQKDPSLQNVIQQQFCGQFSYVTVCNQCSRSSA-LPSRFYELELNIQGHKNLTECITEFLKEEKLDGDNRYYCESCQSKQ-SATRRIKLHSLPPTLNLQLMRFVFDRQSGHKKKLNTFISFPEVLDMSPFLEAKDEKCTYELSAVLIHRGVSAYSGHYIAHVRDARTNDWYKFNDEEIEKMEGKKLQL 379          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008243.1 (pep scaffold:Pmarinus_7.0:GL481682:14201:19993:-1 gene:ENSPMAG00000007452.1 transcript:ENSPMAT00000008243.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.2174 bits (121), Expect = 3.925e-7
Identity = 37/131 (28.24%), Postives = 64/131 (48.85%), Query Frame = 1
Query:  853 CENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTK-KINDRICIDEIIEIPYKSDDKVLKQKYRLVSVVNHTGSLKRGHYFTFLKHG--NFWYKADDDSVRKCELEYMKMISTYSCYIEVFEKLNE 1236
            C +C+ +  S  +  ++ +LP  L++ +KRF+    ++ K + N    +  +   PY  +      +Y L +V NH GSL  GHY  +  +   + W+K DD  V   E  Y K +ST + YI  +  L +
Sbjct:  306 CSHCKQRRESVKTMEIW-KLPPVLIIHLKRFSYSGRWKQKLQTNVGFPLTSLDMKPYIINKDNRYSEYNLYAVSNHYGSLDGGHYTAYTHNTVRDSWFKFDDHEV---EFIYPKNVSTSAGYILFYSALPQ 432          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Sea Lamprey
Match: usp12a (ubiquitin specific peptidase 12a [Source:NCBI gene;Acc:565736])

HSP 1 Score: 47.7506 bits (112), Expect = 3.743e-6
Identity = 36/109 (33.03%), Postives = 51/109 (46.79%), Query Frame = 1
Query:  847 FNCENCEVKNGSASSEVVFSELPQYLVVCIKRFA-THSYYQTKKINDRICIDEIIEIPYKSDDKVLKQK-YRLVSVVNHTGS-LKRGHYFTFLKHGNFWYKADDDSVRK 1164
            + CE C  K   A   +   +LP  L + +KRF      ++  K++ R+     + +   S D     + Y LV+VV H GS   RGHY T +K   FW   DDD V K
Sbjct:  234 YYCEQCCSKQ-EAQKRMRVKKLPMILALHLKRFKYMEQLHRYTKLSYRVVFPLELRLFNTSGDATNPDRMYDLVAVVVHCGSGPNRGHYITIVKSHGFWLLFDDDIVEK 341          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Sea Lamprey
Match: usp22 (ubiquitin specific peptidase 22 [Source:NCBI gene;Acc:692275])

HSP 1 Score: 46.9802 bits (110), Expect = 5.059e-6
Identity = 37/138 (26.81%), Postives = 61/138 (44.20%), Query Frame = 1
Query:  799 NMTEMIENYLKDEVEG----FNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICID-EIIEIPYKSDDKVLK---------------QKYRLVSVVNHTGSLKRGHYFTFLK-HGNFWYKADD 1149
            ++T+ +  + + E  G      C  C     S + ++   +LP      +KRF  HS    KKI   +    E+   P+ +  K  +                KY L +VVNH G+L+ GHY +F++ H + W+K DD
Sbjct:  101 SLTDCLRRFTRPEYLGSSAKIKCSGCRSYQES-TKQLTMKKLPIVACFHLKRFE-HSAKLRKKITTYVSFPLELDMTPFMASSKESRVNGQHQVGGDALSSENKYSLFAVVNHQGTLESGHYTSFIRQHKDQWFKCDD 236          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Sea Lamprey
Match: usp4 (ubiquitin specific peptidase 4 (proto-oncogene) [Source:ZFIN;Acc:ZDB-GENE-041008-187])

HSP 1 Score: 47.3654 bits (111), Expect = 8.671e-6
Identity = 46/170 (27.06%), Postives = 82/170 (48.24%), Query Frame = 1
Query:  691 FEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDE----VEGFNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEIPYKSDD--------KVLKQKYRLVSVVNHTGSLKRGHYFTFLKHG--NFWYKADDDSV 1158
            +++   +R++ NN  K   +K + ++ Q L       + E IE +   E     + + C NC+ K+  A+ +     LP+ LVV +KRF+ + Y++ K       +D +++ P +  D        + +   Y L++V NH G +  GHY  + K+   N WY  DD SV
Sbjct:  741 WDSETRARFYNNNVDKEF-EKHDSMLAQPLKKKNPVKLKECIELFTTKEELAATDPWYCPNCK-KHKQATKKFDLWALPKVLVVHLKRFSYNKYWRDK-------LDTLVDFPIRDLDMSEFVIGTQDVPCTYDLIAVSNHYGGMGGGHYTAYAKNKGENSWYYFDDSSV 901          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Yeast
Match: UBP15 (Ubiquitin-specific protease involved in protein deubiquitination; forms a complex with AAA peroxins Pex1p and Pex6p; deubiquitinates mono- and polyubiquitinated forms of Pex5p; deubiquitinates Clb5p, counteracting APC activity, and facilitating both Clb5p accumulation and S phase entry; physically interacts with anaphase-promoting complex/cyclosome (APC/C) activator, Cdh1p; catalytic activity regulated by an N-terminal TRAF-like domain and and C-terminal sequences [Source:SGD;Acc:S000004920])

HSP 1 Score: 70.4774 bits (171), Expect = 3.589e-13
Identity = 78/299 (26.09%), Postives = 119/299 (39.80%), Query Frame = 1
Query:  355 VPLTNHRVNCYMNAAIQSIFPALLYLNTIKET-IEYDQSQECGAIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENME-----DAHEFLNCYLDKLNEELKG---HSKLQRIPFEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDEVEGFNCENCEVKNG----SASSEVVFSELPQYLVVCIKRFA-THSYYQTKKINDRICIDEIIEIPYKSDDKVLKQK------------YRLVSVVNHTGSLKRGHYFTFLKHG--NFWYKADDDSVRKC 1167
            V   N    CY+N+ +QS F    +   + E   E++       + L  +  Q  ++     IP+   E       +    W+  E     D  E     +D+L   +KG     KL  I F     S   C N    +    +   D  L V   KN+ E  +NY+  E+E  N EN           A   V+F   P  L + +KRF    +Y Q  K+ND+    E I++    D  VLK+             Y L  V+ H+G +  GHY+T +K G  + WY+ DD+ V + 
Sbjct:  205 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYEIPTEHESPNNSVPLALQRAFYQLQVS----DIPLDTLE------LTRSFGWDTAESFTQHDVQELNRILMDRLENNMKGTPVEGKLNEI-FVGKMKSYIKCINVDYESARVEDFW-DLQLNVKNFKNLQESFDNYI--EMELMNGENQYAAQDYGLQDAQKGVIFESFPPVLHLQLKRFEYDFNYDQMVKVNDKYEFPETIDLSPFVDKDVLKKTLDSENKDKNPYVYNLHGVLVHSGDISTGHYYTLIKPGVEDQWYRFDDERVWRV 489          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Yeast
Match: UBP8 (Ubiquitin-specific protease component of the SAGA acetylation complex; required for SAGA (Spt-Ada-Gcn5-Acetyltransferase)-mediated deubiquitination of histone H2B [Source:SGD;Acc:S000004836])

HSP 1 Score: 52.7582 bits (125), Expect = 8.345e-8
Identity = 71/319 (22.26%), Postives = 125/319 (39.18%), Query Frame = 1
Query:  361 LTNHRVNCYMNAAIQSIFPALLYLNTIKETIEY--------DQSQECGAIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWE--------NMEDAHEFLNCYLDKLNE----ELKGHSKLQR-----------IPFEAAHDSRYFCNNCGKSNNDKPNI--VVDQVLFVSVGKNMTEMIENYLKDE-VEGFN--CENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEIP----------------YKSDDKVLKQKYRLVSVVNHTGSLKRGHYFTFLK-HGNFWYKADDDSV 1158
            L N    C+M++ +Q +     ++      I          D+   C    ++  L  A   ++  S       Q+   Y  L  +W+        + +DAHEF    ++++++    +L    ++ R             FE + +S   C  C   NN K  I   +D  L +   K + E ++++ K E ++ FN  C  C      A  ++   +LP  LV+ +KRF        +K+      D+ IE P                +  + KV    Y L+ +V+H G++  GHY  F K  G  W+K +D  V
Sbjct:  139 LINMGSTCFMSSILQCLIHNPYFIRHSMSQIHSNNCKVRSPDKCFSCALDKIVHELYGALNTKQASSSSTSTNRQTGFIYL-LTCAWKINQNLAGYSQQDAHEFWQFIINQIHQSYVLDLPNAKEVSRANNKQCECIVHTVFEGSLESSIVCPGC--QNNSKTTIDPFLDLSLDIKDKKKLYECLDSFHKKEQLKDFNYHCGECN-STQDAIKQLGIHKLPSVLVLQLKRFEHLLNGSNRKL------DDFIEFPTYLNMKNYCSTKEKDKHSENGKVPDIIYELIGIVSHKGTVNEGHYIAFCKISGGQWFKFNDSMV 447          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Yeast
Match: UBP7 (Ubiquitin-specific protease that cleaves ubiquitin-protein fusions; UBP7 has a paralog, UBP11, that arose from the whole genome duplication [Source:SGD;Acc:S000001418])

HSP 1 Score: 52.7582 bits (125), Expect = 1.255e-7
Identity = 45/140 (32.14%), Postives = 69/140 (49.29%), Query Frame = 1
Query:  850 NCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQ-TKKINDRICIDEIIEIPYKSDDKVLKQKYRLVSVVNHTGSLKRGHYFTF----LKHG-----NFWYKADDDSV---RKCELEYMKMISTYSCYIEVFEKL 1230
            N  + + K  +    + F  LP+ LV+ + RF    YY  TKK N  +    I+ I  K++D +   KY+L  VVNHTG+L  GHY +     L+H      + WY  DD+ V   RK   +    IS+   Y+  +E++
Sbjct:  937 NSSDYKNKKLTTVKTINFVTLPKILVIHLSRF----YYDLTKKNNTVVTYPLILNIILKNNDTM---KYKLFGVVNHTGTLISGHYTSLVNKDLEHNVNIGRSKWYYFDDEVVKADRKHGSDKNLKISSSDVYVLFYERV 1069          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Yeast
Match: UBP5 (Putative ubiquitin-specific protease; concentrates at the bud neck; UBP5 has a paralog, DOA4, that arose from the whole genome duplication [Source:SGD;Acc:S000000946])

HSP 1 Score: 50.8322 bits (120), Expect = 4.011e-7
Identity = 48/203 (23.65%), Postives = 85/203 (41.87%), Query Frame = 1
Query:  691 FEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGK-NMTEMIENYLKDEVEG----FNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATH----------------SYYQTKKINDRICIDEIIEIPYKSDDKVLKQKYRLVSVVNHTGSLKRGHYFTFLKHG--NFWYKADDDSVRKCELEYMKMISTYSCYIEVFEKL 1230
            F+  + SR  C  C  ++       V  V    V   N+ +    + K E  G    ++C  C +K   ++ ++  + LP+ L++ +KRF                   + Y  +  N    ++E  +IP +   +V   +YRL  V  H+GSL  GHY +++  G    WY  DD   R   + +     T S Y+  +E++
Sbjct:  609 FQGQYASRLQCQVCEHTSTTYQTFSVLSVPVPRVKTCNILDCFREFTKCERLGVDEQWSCPKC-LKKQPSTKQLKITRLPKKLIINLKRFDNQMNKNNVFVQYPYSLDLTPYWARDFNHEAIVNE--DIPTRG--QVPPFRYRLYGVACHSGSLYGGHYTSYVYKGPKKGWYFFDDSLYR--PITFSTEFITPSAYVLFYERI 804          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Nematostella
Match: EDO32736 (Ubiquitin carboxyl-terminal hydrolase [Source:UniProtKB/TrEMBL;Acc:A7SU92])

HSP 1 Score: 84.3445 bits (207), Expect = 1.443e-17
Identity = 82/292 (28.08%), Postives = 136/292 (46.58%), Query Frame = 1
Query:  361 LTNHRVNCYMNAAIQSI---FPALLYLNTIKETIEYDQSQECGAIILMESLLQAYINQEEFSI-PICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLN--------EELKGHSKLQRIP---FEAAHDSRYFCNNC-GKSNNDKP--NIVVDQVLFVSVGKNMTEMIENYLKDEVEGFNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEI-PYKSDDKVLKQKYRLVSVVNHTG-SLKRGHYFTFLKHGN-FWYKADDDSVRKCEL 1173
            L+N    C++N+ +Q +    P + YL T + T E      C    L   +L+ + +Q+  SI P+CI ++  L   +  L + + EDAHEFL   +D +         E++  +SK   I    F   + S+  C  C   SN   P   I+VD     SV + +  M +  L D    + C  C+ K   A  +V+    P  L + +KRF  H  +   K++  I   E +++ P+ ++ K    KY+L  V+ H+G S   GHY+ +++  N  WY  +D  VR+  L
Sbjct:   93 LSNLGNTCFLNSVVQVLTYTAPLVNYLATQEHTRECQMVGFCMMCELQRHILRTFNHQQNESIKPLCIIQR--LRSIAKHLRFGHQEDAHEFLRYVIDGMQKSCLAGQPEKMDRYSKETTIVHGIFGGYYRSQVQCLKCHNTSNTFDPLMEIMVDIKHSPSVVRAIQRMCKAELLDGDNLYQCPRCK-KKVPAHKQVLIHRPPNILTIQLKRFDYHHMF-GGKVSKEITYTEHLDLRPFMTNPKGPPLKYKLYGVLVHSGYSCNSGHYYCYVRGSNDCWYNMNDSMVRQVGL 380          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Nematostella
Match: EDO42651 (Ubiquitin carboxyl-terminal hydrolase [Source:UniProtKB/TrEMBL;Acc:A7S0W3])

HSP 1 Score: 57.3806 bits (137), Expect = 8.482e-9
Identity = 87/339 (25.66%), Postives = 142/339 (41.89%), Query Frame = 1
Query:  244 PKTPKQSENSTKLLLEMETNEIQNMVSNQSEELDHAPVPLTNHRVNCYMNAAIQSIFPALLYLNTIKETIEYDQ---SQECGAIIL--MESLLQAYINQEEFSIPICIYEQSSLEY-FSLELSWENMEDAHEFLNCYLDKLNEELK--GHSKLQRIP-------------FEAAHDSRYFCNNCG-KSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDEVEG----FNCENCEVKNGSASSEVVFSELPQYLVVC--IKRFATHSYYQTKKINDRICIDEIIEIPYKSDDKVLKQKYRLVSVVNHTGSLKRGHYFTFLKHGNFWYKADDDSVRKCELE 1176
            P  P +SE   KL LE   N  +  ++  S       + L N    C+MN  +Q    AL +   +++    DQ     + G  ++  M  L Q + + ++  +P   ++   L +  +  L+    +DAHEF    LD L+   K     KL   P             F     S   C  C   S    P    D  L +  G +   +   + + E  G      C  C+    S + ++   +LP  +VVC  +KRF  HS  ++KKI+  I   + +++        L  KY L +VVNH+G+L+ GHY  F++  N W+K DD  + K  ++
Sbjct:  130 PWEPTKSE--VKLFLE---NPKKVKITKNSTIGLRGLINLGN---TCFMNCIVQ----ALTHTPLLRDYFLSDQHNCKGDAGTCLVCEMGLLFQEFYSGQK--VPHSPFKLLHLVWTHARHLAGYEQQDAHEFFIAALDVLHNYCKEDAPDKLAVKPNNHNQCNCIIDRIFTGGLQSDVICQTCNCVSTTVDP--FWDISLDLGHGDHKLVIFCRFTRPESLGSESKIKCNKCQSYQES-TKQLSMRKLP--IVVCFHLKRFE-HSK-KSKKISTYIPFPQELDMA-----PFLSSKYSLFAVVNHSGTLEVGHYTAFIRQQNNWFKCDDAWITKATID 442          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Nematostella
Match: EDO35056 (Ubiquitin carboxyl-terminal hydrolase [Source:UniProtKB/TrEMBL;Acc:A7SMM5])

HSP 1 Score: 56.6102 bits (135), Expect = 2.224e-8
Identity = 60/262 (22.90%), Postives = 109/262 (41.60%), Query Frame = 1
Query:  520 NQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEELK--GHSKLQRIPFEAAHDSRYFCNNCG-KSNNDKPNIV--VDQVLFVSVGKNMTEMIENYLKDEVEGFNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTK-KINDRICIDEIIEI-PY------KSDDKVLKQ---------------------KYRLVSVVNHTGSLKRGHYFTFLKH---------GNFWYKADDDSVRKCELE 1176
            +Q +F IP   ++  + ++    ++     DA EF N  LD L+E +K  G+  +       +   +  C  C  + + + P I   VD     S+  +M + ++  L +    ++CE C+ K  +    +  S+LP+ + + +KRF      +   K ND       I++ PY      K++ K L Q                      YRL  ++ H+G    GHY+ ++            + WYK DD  V +C++E
Sbjct: 1666 SQLQFHIPKGFWK--TFKFLGEPVNLREQHDALEFFNNLLDNLDEGMKVLGNEPIFSKVLGGSFADQKICKGCPHRYSREAPFIALNVDIRNHQSLHDSMEQFVKGDLLEGANAYHCEKCDKKVDTV-KRMCISKLPRVMAIQLKRFDYDWERECAVKFNDYFEFPREIDMEPYTELGLAKAEGKALDQIPPELVAESEKHDPPPQALSTHYRLRGILVHSGQASGGHYYCYILQRYCILLSDDSHRWYKFDDGDVSECKME 1924          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Nematostella
Match: EDO44477 (Ubiquitin carboxyl-terminal hydrolase [Source:UniProtKB/TrEMBL;Acc:A7RVM0])

HSP 1 Score: 55.4546 bits (132), Expect = 2.610e-8
Identity = 42/109 (38.53%), Postives = 53/109 (48.62%), Query Frame = 1
Query:  853 CENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQT-KKINDRICIDEIIEIPYKSDDKVLK-QKYRLVSVVNHTGS-LKRGHYFTFLKHGNFWYKADDDSVRKCE 1170
            CE C  K   A   +   +LP+ L + +KRF      Q   K++ R+     + +   SDD V   Q Y LVSVV H GS   RGHY T +K   FW   DDD V K E
Sbjct:  249 CETCCTKQ-EAQKRMRVKKLPKLLALHLKRFKYMEQLQRYTKLSYRVVFPFELRLFNTSDDAVNNDQLYDLVSVVIHCGSGPNRGHYITIVKSHGFWLLFDDDIVEKIE 356          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Nematostella
Match: EDO37466 (Ubiquitin carboxyl-terminal hydrolase [Source:UniProtKB/TrEMBL;Acc:A7SFT1])

HSP 1 Score: 49.6766 bits (117), Expect = 2.242e-6
Identity = 58/235 (24.68%), Postives = 91/235 (38.72%), Query Frame = 1
Query:  607 EDAHEFLNCYLDKLNEELK-------GHSKLQRIPFEAAHDSRYFCNNCGKSNNDKPNIVVDQVL-----------------FVSVGKNMTEMIENYLKDEVEGFNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEIPYKSDDK---VLKQK---------YRLVSVVNHTGS-LKRGHYFTFLKHGNFWYKADDDSVRKCELEYMKMISTY 1200
            +DAHEF++  +D+L+ EL        G   +    F     S   C  C  + + K +  +D  L                 F  +   M   +      E E + C  C+ K  S + +     LP  L + +KRF   ++ ++K       ID  ++ P +  D     LK +         Y L +VV H GS +  GHY TF  H   WY  +D SV + + E +     Y
Sbjct:  208 QDAHEFMHYLMDRLHTELLLSQKACFGQDTIVTGIFGGILQSEVTCLTC-MTESRKLDPFLDLSLEIPPEFQTRKAKSRENPFCQLEDCMKHFVALEKLAESELYMCLKCKKKEQS-TKKFWIQRLPNVLCLHLKRFRFQAFLRSK-------IDTYVQFPIRGLDMSPYTLKGQEKGETKPVLYDLAAVVVHHGSGVSAGHYTTFAFHDGAWYNFNDSSVSRIDEEMVAKCKGY 433          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Medaka
Match: usp42 (ubiquitin specific peptidase 42 [Source:NCBI gene;Acc:101169567])

HSP 1 Score: 78.5666 bits (192), Expect = 4.991e-15
Identity = 73/285 (25.61%), Postives = 128/285 (44.91%), Query Frame = 1
Query:  361 LTNHRVNCYMNAAIQSIFPALLYLNTIKETIEYDQSQE---CGAIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEELKGHSKLQRIP---------FEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDE-VEG---FNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEI-PYKSDDKVLKQKYRLVSVVNHTG-SLKRGHYFTFLKHGNF-WYKADDDSV 1158
            L N    C++N+A+Q +       N +         QE   C    +   ++Q + N      PI +  +  L+  +    + + EDAHEFL   +D + +     +KL R           F     SR  C +C K+ +D  +  +D  L + +  ++++ +E ++K E ++G   + C  C+ K  +AS        P  L + +KRFA    +   KI   +   E +++ P+ S  +   Q Y L +V+ H+G S   GHYF ++K  N  WY+ +D SV
Sbjct:   98 LQNMGNTCFLNSALQCLTYTPPLANHMLSREHSKTCQEPGFCMMCTMQNHIIQVFANSGNVIKPIGVLNE--LKRIAKHFRYGSQEDAHEFLRYTVDAMQKSCLPGTKLDRQTQATTFIHQVFGGYLRSRVKCLSC-KAVSDTFDPFLDITLEIKMAPSVSKALEQFVKPEQLDGENAYKCTKCK-KMVTASKRFTIHRSPNVLTLSLKRFAN---FTGGKITKDVKYPESLDLRPFMSQSQGEPQNYGLYAVLVHSGFSCHAGHYFCYIKASNGQWYQMNDSSV 375          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Medaka
Match: usp42 (ubiquitin specific peptidase 42 [Source:NCBI gene;Acc:101169567])

HSP 1 Score: 75.485 bits (184), Expect = 8.056e-14
Identity = 73/285 (25.61%), Postives = 128/285 (44.91%), Query Frame = 1
Query:  361 LTNHRVNCYMNAAIQSIFPALLYLNTIKETIEYDQSQECG---AIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEELKGHSKLQRIP---------FEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDE-VEG---FNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEI-PYKSDDKVLKQKYRLVSVVNHTG-SLKRGHYFTFLKHGNF-WYKADDDSV 1158
            L N    C++N+A+Q +       N +         QE G      +   ++Q + N      PI +  +  L+  +    + + EDAHEFL   +D + +     +KL R           F     SR  C +C K+ +D  +  +D  L + +  ++++ +E ++K E ++G   + C  C+ K  +AS        P  L + +KRFA    +   KI   +   E +++ P+ S  +   Q Y L +V+ H+G S   GHYF ++K  N  WY+ +D SV
Sbjct:  115 LQNMGNTCFLNSALQCLTYTPPLANHMLSREHSKTCQEPGFCMMCTMQNHIIQVFANSGNVIKPIGVLNE--LKRIAKHFRYGSQEDAHEFLRYTVDAMQKSCLPGTKLDRQTQATTFIHQVFGGYLRSRVKCLSC-KAVSDTFDPFLDITLEIKMAPSVSKALEQFVKPEQLDGENAYKCTKCK-KMVTASKRFTIHRSPNVLTLSLKRFAN---FTGGKITKDVKYPESLDLRPFMSQSQGEPQNYGLYAVLVHSGFSCHAGHYFCYIKASNGQWYQMNDSSV 392          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Medaka
Match: usp42 (ubiquitin specific peptidase 42 [Source:NCBI gene;Acc:101169567])

HSP 1 Score: 75.0998 bits (183), Expect = 9.235e-14
Identity = 73/285 (25.61%), Postives = 128/285 (44.91%), Query Frame = 1
Query:  361 LTNHRVNCYMNAAIQSIFPALLYLNTIKETIEYDQSQECG---AIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEELKGHSKLQRIP---------FEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDE-VEG---FNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEI-PYKSDDKVLKQKYRLVSVVNHTG-SLKRGHYFTFLKHGNF-WYKADDDSV 1158
            L N    C++N+A+Q +       N +         QE G      +   ++Q + N      PI +  +  L+  +    + + EDAHEFL   +D + +     +KL R           F     SR  C +C K+ +D  +  +D  L + +  ++++ +E ++K E ++G   + C  C+ K  +AS        P  L + +KRFA    +   KI   +   E +++ P+ S  +   Q Y L +V+ H+G S   GHYF ++K  N  WY+ +D SV
Sbjct:  115 LQNMGNTCFLNSALQCLTYTPPLANHMLSREHSKTCQEPGFCMMCTMQNHIIQVFANSGNVIKPIGVLNE--LKRIAKHFRYGSQEDAHEFLRYTVDAMQKSCLPGTKLDRQTQATTFIHQVFGGYLRSRVKCLSC-KAVSDTFDPFLDITLEIKMAPSVSKALEQFVKPEQLDGENAYKCTKCK-KMVTASKRFTIHRSPNVLTLSLKRFAN---FTGGKITKDVKYPESLDLRPFMSQSQGEPQNYGLYAVLVHSGFSCHAGHYFCYIKASNGQWYQMNDSSV 392          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Medaka
Match: usp36 (ubiquitin carboxyl-terminal hydrolase 36 [Source:NCBI gene;Acc:101172817])

HSP 1 Score: 67.781 bits (164), Expect = 1.868e-11
Identity = 73/305 (23.93%), Postives = 130/305 (42.62%), Query Frame = 1
Query:  382 CYMNAAIQSIF---PALLYLNTIKETIEYDQSQECGAIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEE-LKGHSKLQRIP---------FEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDEV----EGFNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEI-PYKSDDKVLKQKYRLVSVVNHTG-SLKRGHYFTFLKHGNF-WYKADDDSVRKCELEYMKMISTYSCYIEVFEKLNE 1236
            C++N+ +Q +    P   YL + + +    QS  C   ++   ++Q + N      P+       L+  +    + + EDAHEFL   +D + +  L G+ KL R           F     SR  C+ C KS +D  +  +D  + +    N+   +E ++K +V      + C  C+ K   A+           L + +KRFA    +   KI   +   E + I PY S        Y L +V+ H+G S   GHY+ ++K  N  WY+ +D  V+   +   K++     Y+  + ++ E
Sbjct:  131 CFLNSTVQCLTYTPPLANYLLSKEHSRTCHQSGFCMICVMQNHIIQTFANTGNAIKPVSFIRD--LKKIARHFRFGSQEDAHEFLRYTIDAMQKACLNGYPKLDRQTQATTLVHQIFGGYLRSRVKCSIC-KSVSDTYDPYLDIAVEIRQTANIVRALELFVKPDVLSGENAYMCAKCK-KKVPATKRFTVHRTSNVLTLSLKRFAN---FSGGKITKDVGYPEFLNIRPYMSQSSGDPVMYGLYAVLVHSGYSCHAGHYYCYIKASNGQWYQMNDSMVQSSNI---KVVLNQQAYVLFYLRIPE 425          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Medaka
Match: USP24 (ubiquitin specific peptidase 24 [Source:NCBI gene;Acc:101168776])

HSP 1 Score: 65.4698 bits (158), Expect = 1.170e-10
Identity = 76/317 (23.97%), Postives = 133/317 (41.96%), Query Frame = 1
Query:  355 VPLTNHRVNCYMNAAIQSIF--PALLYLNTIKETIEYDQSQECGAII---------LMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEELK--GHSKLQRIPFEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDEV-EGFN---CENCEVKNGSASSEVVFSELPQYLVVCIKRFA-THSYYQTKKINDRICIDEIIEI-PYKSDDKV--------------------------LKQKYRLVSVVNHTGSLKRGHYFTFLK----HGNFWYKADDDSV 1158
            V L N    CYMNA  Q ++  P L        +IE D  Q   ++          LMES LQ Y+ +  + I          + ++ EL     +DA+EF    +D+L+E LK  G  ++ +  F+     +  C +C     ++  + ++  L V+  +++   ++ +++ EV EG N   CE C+ K  +     + S LP  L + + RF       ++ K +++I    ++ + PY                                + + Y LV VV H+G    GHY++F+K        WYK +D+ V
Sbjct: 1675 VGLKNGGATCYMNAVFQQLYMQPGL---PEAVLSIEDDTDQPEESVFHQVQSLFGHLMESKLQYYVPENFWKI---------FKMWNRELYVREQQDAYEFFTSLVDQLDEHLKKIGREQIFKNTFQGIFSDQKICKDCPHYEREETFMALN--LGVTSCQSLEISLDQFVRGEVLEGSNAYYCEKCKEKRTTVKRTCIKS-LPSVLCIHLMRFGFDWESGRSIKYDEQIRFPWVLNMEPYTVSGMARQDCGGEGGEGRGDGASGGSPRKKVTISENYELVGVVVHSGQAHAGHYYSFIKDRGSSRGRWYKFNDNMV 1976          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Planmine SMEST
Match: SMESG000068557.1 (SMESG000068557.1)

HSP 1 Score: 789.26 bits (2037), Expect = 0.000e+0
Identity = 404/412 (98.06%), Postives = 407/412 (98.79%), Query Frame = 1
Query:    1 MAFNNKQDKLSVYKNENDFEIFKDHQKEENHIKEMNISFGPNFENVNMVEECNKNNLSEYITXXXXXXXXXXXXXXXXXXXPKTPKQSENSTKLLLEMETNEIQNMVSNQSEELDHAPVPLTNHRVNCYMNAAIQSIFPALLYLNTIKETIEYDQSQECGAIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEELKGHSKLQRIPFEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDEVEGFNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEIPYKSDDKVLKQKYRLVSVVNHTGSLKRGHYFTFLKHGNFWYKADDDSVRKCELEYMKMISTYSCYIEVFEKLNE 1236
            MAFNNKQDKLSVYKNENDFEIFKDHQKEENHIKEMNISFGPNFENVNMVEECNKNNLSEYITDNLSDSNNLSYSRSNSCSDPKTPK SENST LLLEMETNEIQNM SNQSEELDHAPVPLTNHRVNCYMNAAIQSIFPALLYLNTIKETIEYD+SQECGAIILMESLLQAY+N EEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEELKGHSKLQR PFEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDEVEGFNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQT+KINDRICIDEIIEIPYKSDDKVLKQKYRLVSVVNHTGSLKRGHYFTFLKHGNFWYKADDDSVRKCELEYMKMISTYSCYIEVFEKLNE
Sbjct:    1 MAFNNKQDKLSVYKNENDFEIFKDHQKEENHIKEMNISFGPNFENVNMVEECNKNNLSEYITDNLSDSNNLSYSRSNSCSDPKTPKHSENSTTLLLEMETNEIQNMASNQSEELDHAPVPLTNHRVNCYMNAAIQSIFPALLYLNTIKETIEYDKSQECGAIILMESLLQAYVNYEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEELKGHSKLQRTPFEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDEVEGFNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTRKINDRICIDEIIEIPYKSDDKVLKQKYRLVSVVNHTGSLKRGHYFTFLKHGNFWYKADDDSVRKCELEYMKMISTYSCYIEVFEKLNE 412          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Planmine SMEST
Match: SMESG000068529.1 (SMESG000068529.1)

HSP 1 Score: 545.428 bits (1404), Expect = 0.000e+0
Identity = 286/412 (69.42%), Postives = 328/412 (79.61%), Query Frame = 1
Query:    1 MAFNNKQDKLSVY--KNENDFEIFKDHQKEENHIKEMNISFGPNFENVNMVEECNKNNLSEYITXXXXXXXXXXXXXXXXXXXPKTPKQSENSTKLLLEMETNEIQNMVSNQSEELDHAPVPLTNHRVNCYMNAAIQSIFPALLYLNTIKETIEYDQSQECGAIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEELKGHSKLQRIPFEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDEVEGFNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEIPYKSDDKVLKQKYRLVSVVNHTGSLKRGHYFTFLKHGNFWYKADDDSVRKCELEYMKMISTYSCYIEVFEKL 1230
            MAF+N Q+   +Y  +N N F+IFK  Q E+ H + + I   P+    N+V+ECN NN  E ITDN S+   L +  S+     ++ ++  N+TK   E ET ++QNM S+  E +  +PVPL NH VNCYMNAAIQSIFPA+LYLNTIKETIEYDQS ECGAIILME LL+AY N E+FSIPICI+  S LEYFS ELSW+ MEDAHEFLNCYLDKLNEELKGHSKLQ+ PFEAAHDSRYFCNNCGKSNNDKPNI V+QVLFV+VGKNMTEMIEN  K+EVEGF+CENC VKNGSAS EVVFS+LPQYLVVCIKRFA  S YQ+ KINDRICIDE IEIPYKSDDKVLKQKYRLVSVVNH G L+ GHYFTFLKHGNFWYKADD SV+K E + ++ +S YS YIEVFEKL
Sbjct:    1 MAFDNNQEGQFIYNFENGNTFDIFKGLQTEDGHFECIIIVSEPDLHKANIVDECNGNNCLEIITDNNSNFEYLKFDCSSVQRAAES-REHLNATK---ERETEDLQNMASDHFE-VKLSPVPLINHGVNCYMNAAIQSIFPAMLYLNTIKETIEYDQSPECGAIILMERLLRAYTNDEDFSIPICIFTNSKLEYFSSELSWDTMEDAHEFLNCYLDKLNEELKGHSKLQKTPFEAAHDSRYFCNNCGKSNNDKPNIAVEQVLFVNVGKNMTEMIENSFKNEVEGFSCENCGVKNGSASREVVFSDLPQYLVVCIKRFAIDS-YQSIKINDRICIDETIEIPYKSDDKVLKQKYRLVSVVNHIGGLENGHYFTFLKHGNFWYKADDHSVQKYEFKNIEGVSNYSSYIEVFEKL 406          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Planmine SMEST
Match: SMESG000068574.1 (SMESG000068574.1)

HSP 1 Score: 536.954 bits (1382), Expect = 0.000e+0
Identity = 283/409 (69.19%), Postives = 322/409 (78.73%), Query Frame = 1
Query:    1 MAFNNKQDKLSVYKNENDFEIFKDHQKEENHIKEMNISFGPNFENVNMVEECNKNNLSEYITXXXXXXXXXXXXXXXXXXXPKTPKQSENSTKLLLEMETNEIQNMVSNQSEELDHAPVPLTNHRVNCYMNAAIQSIFPALLYLNTIKETIEYDQSQECGAIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEELKGHSKLQRIPFEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDEVEGFNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEIPYKSDDKVLKQKYRLVSVVNHTGSLKRGHYFTFLKHGNFWYKADDDSVRKCELEYMKMISTYSCYIEVFEK 1227
            M FNN Q  +     +N  +  K+  K E H    N++   +F + N V+E NK+N S+  TD  SD    +           + +  E+S   + + ETN+IQN  SNQSEELDH PV LTNHRVNC +NAAI  IFPALLYLNTIKETIEYDQSQECGAIILMESLLQAY NQEEFSI  CIYE+SSLEYFSLEL  ENMEDAH FLN YL +LNEELKGHS+LQ+ PFEAAHDSRYFCNNCGKSNNDKPNIVVDQ+LFVSVGKNMTEMIENYL +EVE FNCENCEVKNGSASSEVVFS++PQYLVVCIKRFATHSYYQT+KIN+RICIDE IEIPYKSDDKVLKQKYRLVSVVNH G ++   Y +FLK G+FWYK +DD+V+K +LE +K IS +SCYIEVFEK
Sbjct:    1 MNFNNDQGNI-----QNISKSSKNLPKAEGHSGTTNLNSEQDFVDENTVDEDNKDNFSKKRTDCKSDFKFSTSDE-------SSTESGEDSNDAMGKRETNDIQNTASNQSEELDHDPVSLTNHRVNCSINAAIHCIFPALLYLNTIKETIEYDQSQECGAIILMESLLQAYTNQEEFSILNCIYEKSSLEYFSLELLLENMEDAHVFLNNYLYRLNEELKGHSQLQKTPFEAAHDSRYFCNNCGKSNNDKPNIVVDQILFVSVGKNMTEMIENYLNNEVERFNCENCEVKNGSASSEVVFSDIPQYLVVCIKRFATHSYYQTRKINERICIDETIEIPYKSDDKVLKQKYRLVSVVNHIGGVEGEQYLSFLKLGDFWYKTEDDNVQKYKLEDVKNISEHSCYIEVFEK 397          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Planmine SMEST
Match: SMESG000068529.1 (SMESG000068529.1)

HSP 1 Score: 480.33 bits (1235), Expect = 5.202e-169
Identity = 233/281 (82.92%), Postives = 251/281 (89.32%), Query Frame = 1
Query:  388 MNAAIQSIFPALLYLNTIKETIEYDQSQECGAIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEELKGHSKLQRIPFEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDEVEGFNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEIPYKSDDKVLKQKYRLVSVVNHTGSLKRGHYFTFLKHGNFWYKADDDSVRKCELEYMKMISTYSCYIEVFEKL 1230
            MNAAIQSIFPA+LYLNTIKETIEYDQS ECGAIILME LL+AY N E+FSIPICI+  S LEYFS ELSW+ MEDAHEFLNCYLDKLNEELKGHSKLQ+ PFEAAHDSRYFCNNCGKSNNDKPNI V+QVLFV+VGKNMTEMIEN  K+EVEGF+CENC VKNGSAS EVVFS+LPQYLVVCIKRFA  S YQ+ KINDRICIDE IEIPYKSDDKVLKQKYRLVSVVNH G L+ GHYFTFLKHGNFWYKADD SV+K E + ++ +S YS YIEVFEKL
Sbjct:    1 MNAAIQSIFPAMLYLNTIKETIEYDQSPECGAIILMERLLRAYTNDEDFSIPICIFTNSKLEYFSSELSWDTMEDAHEFLNCYLDKLNEELKGHSKLQKTPFEAAHDSRYFCNNCGKSNNDKPNIAVEQVLFVNVGKNMTEMIENSFKNEVEGFSCENCGVKNGSASREVVFSDLPQYLVVCIKRFAIDS-YQSIKINDRICIDETIEIPYKSDDKVLKQKYRLVSVVNHIGGLENGHYFTFLKHGNFWYKADDHSVQKYEFKNIEGVSNYSSYIEVFEKL 280          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Planmine SMEST
Match: SMESG000068562.1 (SMESG000068562.1)

HSP 1 Score: 400.979 bits (1029), Expect = 3.576e-136
Identity = 226/409 (55.26%), Postives = 278/409 (67.97%), Query Frame = 1
Query:    1 MAFNNKQDKLSVYKNENDFEIFKDHQKEENHIKEMNISFGPNFENVNMVEECNKNNLSEYITXXXXXXXXXXXXXXXXXXXPKTPKQSENSTKLLLEMETNEIQNMVSNQSEELDHAPVPLTNHRVNCYMNAAIQSIFPALLYLNTIKETIEYDQSQECGAIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWENMEDAHEFLNCYLDKLNEELKGHSKLQRIPFEAAHDSRYFCNNCGKSNNDKPNIVVDQVLFVSVGKNMTEMIENYLKDEVEGFNCENCEVKNGSASSEVVFSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEIPYKSDDKVLKQKYRLVSVVNHTGSLKRGHYFTFLKHGNFWYKADDDSVRKCELEYMKMISTYSCYIEVFEK 1227
            M FNN QD +     +N  +  K   K E H +  N++   +F + N V+E NK+N S+  T   SD    +           + +  E+S   + E ETN+IQN    Q E     P    N +V   MNAAIQSIFPA+ Y NTIKETIEYDQS +CGAIILME+LLQAY N  EFSI  CIY+  S EY+S      NMEDAHEFL CYL KLNEELKGHSKL++ PFE A+D +YFCNNCGKS +D PNI +++V FV+VGKNM EMIEN LK+E E + CE C++KNGS S + VFSE+PQYL++ I RF   S     + ND+I  DEIIEIPYKSDDKVLKQKYR+VSVVNH GS + G+Y +FLK G+FWYK D+DS++KCELE +K IS +SCYIEVFEK
Sbjct:    1 MNFNNDQDNI-----QNISKSSKSLPKAEGHNETTNLNSEQDFVDENTVDEDNKDNFSKKRTGCKSDFKFSTSDE-------SSTESGEDSNDAMGERETNDIQNTADRQLEP-KLNPFSFINKKVYNSMNAAIQSIFPAMFYWNTIKETIEYDQSPDCGAIILMETLLQAYTNDREFSISNCIYKNCSFEYYSSGYMCLNMEDAHEFLRCYLYKLNEELKGHSKLKKTPFEVAYDLKYFCNNCGKSIDDDPNIDINEVFFVNVGKNMIEMIENSLKNEKELYYCEICQLKNGSKSRKFVFSEIPQYLIIYIFRFILFS---NIEYNDKIPFDEIIEIPYKSDDKVLKQKYRMVSVVNHIGSFENGYYLSFLKLGDFWYKTDEDSLQKCELEDVKNISEHSCYIEVFEK 393          
The following BLAST results are available for this feature:
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AC022966.13.469e-1426.79ubiquitin specific peptidase 36 [Source:NCBI gene;... [more]
AC022966.16.246e-1327.14ubiquitin specific peptidase 36 [Source:NCBI gene;... [more]
AC022966.19.442e-1327.14ubiquitin specific peptidase 36 [Source:NCBI gene;... [more]
AC022966.19.442e-1327.14ubiquitin specific peptidase 36 [Source:NCBI gene;... [more]
AC022966.19.442e-1327.14ubiquitin specific peptidase 36 [Source:NCBI gene;... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
usp-35.628e-1021.89Ubiquitinyl hydrolase 1 [Source:UniProtKB/TrEMBL;... [more]
usp-331.492e-726.71Ubiquitin carboxyl-terminal hydrolase [Source:Uni... [more]
usp-462.341e-732.50Ubiquitin carboxyl-terminal hydrolase 46 [Source:... [more]
usp-462.555e-732.50Ubiquitin carboxyl-terminal hydrolase 46 [Source:... [more]
usp-462.555e-732.50Ubiquitin carboxyl-terminal hydrolase 46 [Source:... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Usp74.450e-1428.22gene:FBgn0030366 transcript:FBtr0342732[more]
Usp74.901e-1428.22gene:FBgn0030366 transcript:FBtr0073641[more]
faf5.852e-1024.89gene:FBgn0005632 transcript:FBtr0085843[more]
faf6.146e-1024.89gene:FBgn0005632 transcript:FBtr0085844[more]
faf6.213e-1024.89gene:FBgn0005632 transcript:FBtr0307547[more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
usp363.121e-1325.16ubiquitin specific peptidase 36 [Source:ZFIN;Acc:Z... [more]
usp427.194e-1224.46ubiquitin specific peptidase 42 [Source:ZFIN;Acc:Z... [more]
usp427.194e-1224.46ubiquitin specific peptidase 42 [Source:ZFIN;Acc:Z... [more]
usp481.868e-1126.30ubiquitin specific peptidase 48 [Source:ZFIN;Acc:Z... [more]
usp485.191e-1126.30ubiquitin specific peptidase 48 [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000030414.11.416e-1325.90pep primary_assembly:Xenopus_tropicalis_v9.1:5:124... [more]
ENSXETT00000031190.11.434e-1325.90ubiquitin carboxyl-terminal hydrolase 42-like [Sou... [more]
rpl7l14.922e-1326.56ribosomal protein L7 like 1 [Source:Xenbase;Acc:XB... [more]
ENSXETT00000014911.16.715e-1328.64pep primary_assembly:Xenopus_tropicalis_v9.1:5:124... [more]
eif1b9.397e-1125.17eukaryotic translation initiation factor 1B [Sourc... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Usp364.435e-1326.79ubiquitin specific peptidase 36 [Source:MGI Symbol... [more]
Usp364.435e-1326.79ubiquitin specific peptidase 36 [Source:MGI Symbol... [more]
Usp421.482e-1226.03ubiquitin specific peptidase 42 [Source:MGI Symbol... [more]
Usp17le1.298e-1124.40ubiquitin specific peptidase 17-like E [Source:MGI... [more]
Usp17le1.501e-1124.40ubiquitin specific peptidase 17-like E [Source:MGI... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9VYQ8|UBP7_DROME4.913e-1328.22Ubiquitin carboxyl-terminal hydrolase 7 OS=Drosoph... [more]
sp|Q09738|UBP8_SCHPO1.268e-1225.09Probable ubiquitin carboxyl-terminal hydrolase 8 O... [more]
sp|B1AQJ2|UBP36_MOUSE3.102e-1226.79Ubiquitin carboxyl-terminal hydrolase 36 OS=Mus mu... [more]
sp|Q9P275|UBP36_HUMAN4.535e-1227.14Ubiquitin carboxyl-terminal hydrolase 36 OS=Homo s... [more]
sp|B2RQC2|UBP42_MOUSE1.036e-1126.03Ubiquitin carboxyl-terminal hydrolase 42 OS=Mus mu... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0EB123.801e-2126.52Uncharacterized protein OS=Paramecium tetraurelia ... [more]
A0CPE01.395e-1725.47Uncharacterized protein OS=Paramecium tetraurelia ... [more]
A0A093BZT12.709e-1628.28Ubiquitin carboxyl-terminal hydrolase 42 (Fragment... [more]
A0A091N3676.002e-1627.36Ubiquitin carboxyl-terminal hydrolase 36 (Fragment... [more]
A0A2T0FDV11.638e-1529.34Ubiquitin carboxyl-terminal hydrolase 10 OS=Wicker... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000052072.13.830e-1525.18ubiquitin carboxyl-terminal hydrolase 17-like prot... [more]
ENSAMXT00000051328.12.917e-1424.36pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000047058.12.917e-1424.36pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000052035.15.847e-1424.36pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
usp485.520e-1127.22ubiquitin specific peptidase 48 [Source:NCBI gene;... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000008243.13.925e-728.24pep scaffold:Pmarinus_7.0:GL481682:14201:19993:-1 ... [more]
usp12a3.743e-633.03ubiquitin specific peptidase 12a [Source:NCBI gene... [more]
usp225.059e-626.81ubiquitin specific peptidase 22 [Source:NCBI gene;... [more]
usp48.671e-627.06ubiquitin specific peptidase 4 (proto-oncogene) [S... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
UBP153.589e-1326.09Ubiquitin-specific protease involved in protein de... [more]
UBP88.345e-822.26Ubiquitin-specific protease component of the SAGA ... [more]
UBP71.255e-732.14Ubiquitin-specific protease that cleaves ubiquitin... [more]
UBP54.011e-723.65Putative ubiquitin-specific protease; concentrates... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO327361.443e-1728.08Ubiquitin carboxyl-terminal hydrolase [Source:Uni... [more]
EDO426518.482e-925.66Ubiquitin carboxyl-terminal hydrolase [Source:Uni... [more]
EDO350562.224e-822.90Ubiquitin carboxyl-terminal hydrolase [Source:Uni... [more]
EDO444772.610e-838.53Ubiquitin carboxyl-terminal hydrolase [Source:Uni... [more]
EDO374662.242e-624.68Ubiquitin carboxyl-terminal hydrolase [Source:Uni... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
usp424.991e-1525.61ubiquitin specific peptidase 42 [Source:NCBI gene;... [more]
usp428.056e-1425.61ubiquitin specific peptidase 42 [Source:NCBI gene;... [more]
usp429.235e-1425.61ubiquitin specific peptidase 42 [Source:NCBI gene;... [more]
usp361.868e-1123.93ubiquitin carboxyl-terminal hydrolase 36 [Source:N... [more]
USP241.170e-1023.97ubiquitin specific peptidase 24 [Source:NCBI gene;... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000068557.10.000e+098.06SMESG000068557.1[more]
SMESG000068529.10.000e+069.42SMESG000068529.1[more]
SMESG000068574.10.000e+069.19SMESG000068574.1[more]
SMESG000068529.15.202e-16982.92SMESG000068529.1[more]
SMESG000068562.13.576e-13655.26SMESG000068562.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019179 ID=SMED30019179|Name=Ubiquitin carboxyl-terminal hydrolase|organism=Schmidtea mediterranea sexual|type=transcript|length=1648bp
ATGGCCTTTAATAACAAACAGGACAAACTGTCAGTATACAAGAATGAAAA
TGACTTTGAAATATTCAAGGATCATCAGAAAGAAGAGAATCATATTAAAG
AGATGAATATAAGTTTTGGACCTAATTTTGAGAATGTAAATATGGTTGAG
GAATGCAATAAGAACAATTTATCAGAATATATAACTGACAATCTATCTGA
CAGTAATAATTTATCGTATTCAAGATCAAATTCTTGCTCTGATCCAAAAA
CTCCCAAACAAAGTGAGAATTCTACAAAATTATTGCTTGAAATGGAAACA
AATGAAATTCAGAATATGGTCAGCAATCAGTCAGAAGAACTTGATCATGC
TCCAGTGCCATTGACAAACCACAGAGTCAACTGCTACATGAATGCAGCTA
TTCAAAGTATTTTTCCTGCACTGCTCTACTTGAATACAATTAAAGAAACC
ATTGAATATGATCAATCTCAAGAGTGTGGAGCGATCATTTTAATGGAAAG
CCTTTTACAAGCTTACATCAATCAAGAAGAATTCTCAATTCCGATTTGTA
TTTACGAACAGTCCAGTTTGGAATATTTTAGTCTAGAATTATCATGGGAA
AATATGGAAGATGCTCACGAGTTTTTGAATTGTTATCTAGATAAATTAAA
CGAAGAGTTGAAAGGACATTCTAAATTGCAAAGGATTCCATTTGAAGCGG
CCCATGATTCGAGATATTTCTGTAACAATTGTGGGAAATCGAATAATGAT
AAGCCGAACATTGTTGTTGACCAAGTATTGTTTGTGAGTGTCGGTAAAAA
CATGACAGAAATGATAGAAAACTATTTAAAAGACGAAGTTGAAGGATTTA
ATTGTGAGAATTGTGAAGTCAAAAACGGCTCGGCTAGCAGTGAGGTTGTA
TTTTCTGAGCTTCCGCAATATCTGGTGGTTTGCATTAAACGGTTTGCTAC
ACATTCATATTATCAAACTAAAAAGATTAATGACAGAATATGTATTGACG
AGATTATTGAAATACCTTATAAATCTGACGACAAAGTTCTCAAACAAAAG
TATCGTTTGGTTTCAGTTGTAAATCATACCGGTAGCTTAAAAAGGGGGCA
CTATTTTACATTTTTGAAGCATGGGAACTTTTGGTACAAAGCTGATGACG
ATTCTGTACGGAAATGTGAATTGGAATACATGAAAATGATCAGTACATAT
TCGTGCTATATTGAGGTTTTTGAGAAACTAAATGAATGATGATTTCAATT
GTTTTAATCATAAATGTTTCATTTATATATCTGGTAAAGTAACAGCGGTA
AAGCTCATTATGATTTGAACCAAAAGCATATGCAATCAAAGCCCAAATTC
ACGCTGCATAACTCAACAGAAAAATTACCCAAGCGTTTTTGTTACATAAC
GCCAAGCAAATCATAAAAGCTATTTGCAAGAAAAAATTGTCTTATAGAGT
TCAAGATACCTTAGTCACAAAAACATCCAAAATATAATTTTTTATAAGTA
GCTTAACTTAATGAATACCAAAATTTACCCACACTTAAAATTTCCTTTTT
TTGATAAAAATTACACTTAAATTTAGTTCCAAACCAATAGCCCGGCTTAC
AGCAAGCGGAACTTTTGTGGAATCAAAATACGAAGGTTACAGGTACTC
back to top

protein sequence of SMED30019179-orf-1

>SMED30019179-orf-1 ID=SMED30019179-orf-1|Name=SMED30019179-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=413bp
MAFNNKQDKLSVYKNENDFEIFKDHQKEENHIKEMNISFGPNFENVNMVE
ECNKNNLSEYITDNLSDSNNLSYSRSNSCSDPKTPKQSENSTKLLLEMET
NEIQNMVSNQSEELDHAPVPLTNHRVNCYMNAAIQSIFPALLYLNTIKET
IEYDQSQECGAIILMESLLQAYINQEEFSIPICIYEQSSLEYFSLELSWE
NMEDAHEFLNCYLDKLNEELKGHSKLQRIPFEAAHDSRYFCNNCGKSNND
KPNIVVDQVLFVSVGKNMTEMIENYLKDEVEGFNCENCEVKNGSASSEVV
FSELPQYLVVCIKRFATHSYYQTKKINDRICIDEIIEIPYKSDDKVLKQK
YRLVSVVNHTGSLKRGHYFTFLKHGNFWYKADDDSVRKCELEYMKMISTY
SCYIEVFEKLNE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
GO:0016579protein deubiquitination
GO:0006511ubiquitin-dependent protein catabolic process
Vocabulary: molecular function
TermDefinition
GO:0008233peptidase activity
GO:0008234cysteine-type peptidase activity
GO:0036459thiol-dependent ubiquitinyl hydrolase activity
GO:0016787hydrolase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
Vocabulary: INTERPRO
TermDefinition
IPR001394Peptidase_C19_UCH
IPR018200USP_CS
IPR028889USP_dom