Dedicator of cytokinesis

Overview
NameDedicator of cytokinesis
Smed IDSMED30019167
Length (bp)7921
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dedicator of cytokinesis (SMED30019167) t-SNE clustered cells

Violin plots show distribution of expression levels for Dedicator of cytokinesis (SMED30019167) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dedicator of cytokinesis (SMED30019167) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dedicator of cytokinesis (SMED30019167) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019167

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30019167h1SMcG0004111 dd_Smed_v4_2660_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30019167h1SMcG0004111 dd_Smed_v4_2660_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30019167h1SMcG0004111 dd_Smed_v4_2660_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30019167h1SMcG0004111 dd_Smed_v4_2660_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30019167h1SMcG0004111 dd_Smed_v4_2660_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dedicator of cytokinesis vs. Ensembl Human
Match: DOCK9 (dedicator of cytokinesis 9 [Source:HGNC Symbol;Acc:HGNC:14132])

HSP 1 Score: 434.106 bits (1115), Expect = 3.602e-122
Identity = 272/840 (32.38%), Postives = 426/840 (50.71%), Query Frame = 2
Query: 5120 LNDKTQKDIFVCLLHIFHTISSDDLKATICNLTVQERLEFLQLLILSIHHLKYQGRKVINNFESISTGCAKSKIQLRPHGPRSSVTAILDDVDHGD----HKAYLEGNVSTEVGLIVLDVLSAYCSAFKQEILTYTPDHVIFKKIVDIYLTLLSVNQSEIVLKHVFVSMRVFVSTFAKVLFANCHNVISDLSLHTLRFLDTRFTSVRIEACGFLYRMMRSSYDTFNKPGINRVHLQMIVAVSKLDRTV----GIRFKESLNYLKRLAEIEMXXXXXXXXXXXXXGTPTGTSKSITIGVHSTTKLSMQTFFEEVTDLTQRIRTVLMATVQMNEHVDDPEMQVDLQYSLAKSYSSNPALRRTWLEKIYAIHNKNNSRAEMAMCKAHIVAMIVEYLRRKEQYSMSCANFKAISPNIPLEESGMRDDSVQLEVHYTKEEVVKLLRELAHEFDAGCLWEVLRHVYKLVIPIYERKRDYEQLAEIYKHMSDGYNKIKTAESTNQRIIGSYYRVVLYGKP-FDSLAGKVFIYRLDSGKQFCVVREELQKLFSKKYGAGKVQMLVEN-HIDRSKLDPELASIQVTHVEPFFNEDEELERHSMFERQYNISKFMLETPFVKMNHVEHESRWKKYKEHDIDGVLKSKQTDDLSIQWKRRTILTVEASFPHLKRRLEVISIKEIDFSPIERAIDEIQLKNRQLAMHLAYXXXXXXXXXXXXXXXXXXXXXVGSSQTRANNIPLLMDMHMSGALLPQVNQGPMAYARVFLHKETQANYSQEKVKQLKIQFMEFLTLCYLLLRDFNELMSHIQQQKYIAMREALDSYRVELSNLINEEICVFEDISVISTSAL 7609
            L+    K + +C L+I  ++S D L       +  E ++F  +  + +H  +Y G++ I       TG   +++Q    G   +         H D    H++ LE N++TEV L  LD LS +  AFK ++L     + + KK+ D+YL  L  +QSE  LK+VF ++R  +  F    +    ++ + L    L+  +++ +S+R EA   LY +MR+++D   K    R HLQ+I++VS+L   V    G RF++SL+ +   A                               +S   +   +F  +V DLT+RIRTVLMAT QM EH +DPEM VDLQYSLAKSY+S P LR+TWL+ +  IH KN   +E AMC  H+ A++ EYL RK  +   C  F+ I+PNI  E S M D  +Q +VH+ ++ +++LL + A        +E++  +YKL+IPIYE++RD+E+LA +Y  +   Y+K+     + +R++G+Y+RV  +G+  F+   GK +IY+         + + L KL+S K+G+  V+M+ ++  ++   LD + A IQVTHV PFF+E E  ER + FER +NI +FM E PF +                        K+   +  Q KRRTILT    FP++K+R+ V+     D +PIE AIDE+  K  +L                              S    + I L   + + G++  QVN GP+AYAR FL       Y   KVK LK  F +F+  C   L     L+   Q +    M+        ELS +++E+IC  E+ + +  ++L
Sbjct: 1306 LDQSEIKSLLMCFLYILKSMSDDALFTYWNKASTSELMDFFTISEVCLHQFQYMGKRYIAR-----TGMMHARLQ--QLGSLDNSLTFNHSYGHSDADVLHQSLLEANIATEVCLTALDTLSLFTLAFKNQLLADHGHNPLMKKVFDVYLCFLQKHQSETALKNVFTALRSLIYKFPSTFYEGRADMCAALCYEILKCCNSKLSSIRTEASQLLYFLMRNNFDYTGKKSFVRTHLQVIISVSQLIADVVGIGGTRFQQSLSIINNCA-------------------------------NSDRLIKHTSFSSDVKDLTKRIRTVLMATAQMKEHENDPEMLVDLQYSLAKSYASTPELRKTWLDSMARIHVKNGDLSEAAMCYVHVTALVAEYLTRKGVFRQGCTAFRVITPNIDEEASMMEDVGMQ-DVHFNEDVLMELLEQCADGLWKAERYELIADIYKLIIPIYEKRRDFERLAHLYDTLHRAYSKVTEVMHSGRRLLGTYFRVAFFGQGFFEDEDGKEYIYKEPKLTPLSEISQRLLKLYSDKFGSENVKMIQDSGKVNPKDLDSKYAYIQVTHVIPFFDEKELQERKTEFERSHNIRRFMFEMPFTQT----------------------GKRQGGVEEQCKRRTILTAIHCFPYVKKRIPVMYQHHTDLNPIEVAIDEMSKKVAELRQL--------------------------CSSAEVDMIKL--QLKLQGSVSVQVNAGPLAYARAFLDDTNTKRYPDNKVKLLKEVFRQFVEACGQALAVNERLIKEDQLEYQEEMKANYREMAKELSEIMHEQICPLEEKTSVLPNSL 2056          

HSP 2 Score: 282.337 bits (721), Expect = 2.114e-75
Identity = 220/752 (29.26%), Postives = 340/752 (45.21%), Query Frame = 2
Query: 2387 PNLDFIHTLYIYPRTLNFSNQNVFHRARNLSCFVELRDVDKSDAPPLKVFYSRPSRKQPAFDYWSNTSVIYHDSSPTFNEEIKIALPLNLHSKHHLLFRFYHVSCDTAAIPNVREKGSNKKS--LETPVGVTWLTLMDQNLNLKSGSFSLPVATQLVPDYLEEKQQSIYYKKDSLWKLSTSFGQPKPRNSSTDKVIDESVNKRHSGPTFKSYINPRSSRDLEDIFSIKSDDVEQSHDTTVQWVDGQKSIFTVVIRPETTIFTQSTHLHKFFQVCSEKLDELTNPTVVEKKESIFTKPRSGSDPTTPKPVSDDTLLLQTSNKDVEIKNAIKALATVNVTNLIKFFAPTFNQLLHVVVCTAISHSEISKTAVTSMITLASSLRTPSMESLSSKATKRNTKIIKSYIKFAFDAEKIVPTKVKRTVHESLIQAISELIRPPFRDTXXXXXXXXXXXXXYSIITKSMIQSLTKQSKITIDKGGDKFFSTSYMDSLQNMIHLIINCILEITSTVGNQSGMNGQLRPNNSFQSLATSANKDLARFISRLFNVMDRGFIFQIIHQYMKIFIARINAYSGHREHLCRMKFDFLEIVTNHEHYLPLNLLKIINPSDKGQSVRKRQAPPSLELILSETYCRQHYLAGLLLQEVHRQMSDVYSHNAVRRLPFVMLRNLLAKHLFDDRYSSINMQARIAALYLPLVSIILENQKSFSLPGNLHTKVNLLNDIYDHSDRSLSARPLST-LSGDTL--STHSSINGS 4627
            P   + + LY+YP+ L + +Q  F +ARN++  +E +D D+ D+ PLK  Y RP    P F   +  +V++H  +P F +EIKI LP  LH KHHLL  F+HVSCD ++      KGS KK   +ET VG +WL L+     + S    +PV+  L   YL  ++  +                                  RH GP  K                               WVDG K +  +     +T++TQ  HLH FFQ C                     K  SG+                      E+   +K+L  +    +I F     NQL  V+  T  +  E++      +I + +      +ES            ++SY+K+A+ AE  V ++ K TVHE L ++++ +++P   D    N  L  S+ F+ ++ KSM Q L + SK+ + +  ++ F  SY  +++ ++++++  I +             + R N      + +AN  LA FI R F  MDRGF+F+ I+ Y+  F        G  + L   KF+FL +V NHEHY+PLNL     P   G+   +R     L+  L++ +CR H+L GLLL+EV   + +      VR +   +L+NLL KH FDDRY+S + QARIA LYLPL  +++EN +  ++       VN    + D S    +  PL T   G TL  S H  + G+
Sbjct:  646 PYTIYTNHLYVYPKYLKYDSQKSFAKARNIAICIEFKDSDEEDSQPLKCIYGRPG--GPVFTRSAFAAVLHHHQNPEFYDEIKIELPTQLHEKHHLLLTFFHVSCDNSS------KGSTKKRDVVETQVGYSWLPLLKDGRVVTSEQ-HIPVSANLPSGYLGYQELGM---------------------------------GRHYGPEIK-------------------------------WVDGGKPLLKISTHLVSTVYTQDQHLHNFFQYCQ--------------------KTESGAQALGN-----------------ELVKYLKSLHAMEGHVMIAFLPTILNQLFRVL--TRATQEEVAVNVTRVIIHVVAQCHEEGLESH-----------LRSYVKYAYKAEPYVASEYK-TVHEELTKSMTTILKPS-ADFLTSNKLLKYSWFFFDVLIKSMAQHLIENSKVKLLR--NQRFPASYHHAVETVVNMLMPHITQ-------------KFRDN---PEASKNANHSLAVFIKRCFTFMDRGFVFKQINNYISCFAP------GDPKTLFEYKFEFLRVVCNHEHYIPLNL-----PMPFGKGRIQRYQDLQLDYSLTDEFCRNHFLVGLLLREVGTALQEF---REVRLIAISVLKNLLIKHSFDDRYASRSHQARIATLYLPLFGLLIENVQRINVRDVSPFPVNAGMTVKDESLALPAVNPLVTPQKGSTLDNSLHKDLLGA 1240          

HSP 3 Score: 68.9366 bits (167), Expect = 1.840e-10
Identity = 62/256 (24.22%), Postives = 100/256 (39.06%), Query Frame = 2
Query: 1118 EKSQLDDCHIRPQV----EQSIPKTFIKLTANRFITSVGISDENSNPKGVIPAEPFFISFSLFHIADGRRISEEFYWNPNRPQIEDLLPSDLFAYKFGGHPVHATINGNCDNRTPLNLPTMSDRVLQSTNSFILKVPCLPDKICLFIKSEKVFSGAIGPTVDKYIKSGGSLLKKKDREEELFVENPDVKTGASINKTMSVYCANIGHYRMPFGWTACRLNIKGKNCL----RF---HKYENNKTSEDDIIKLVQNM 1852
            +  +LD     P+V    E+   +  +K     F     +++    P   +  EPFF++ SLF I   R+IS +F+ + N   +  +L +   A   G     + + G            + +  +Q     I  V C    I L  + EKV  G+I    + Y+KS  S                  K    + K     C  +G YRMPF W A  L       L    RF   ++ ++NK S DD++KL+ + 
Sbjct:  355 DAQKLDFSSAEPEVKSFEEKFGKRILVKCNDLSFNLQCCVAENEEGPTTNV--EPFFVTLSLFDIKYNRKISADFHVDLNHFSVRQMLATTSPALMNGSGQSPSVLKG-----------ILHEAAMQYPKQGIFSVTCPHPDIFLVARIEKVLQGSITHCAEPYMKSSDS-----------------SKVAQKVLKNAKQACQRLGQYRMPFAWAARTLFKDASGNLDKNARFSAIYRQDSNKLSNDDMLKLLADF 580          
BLAST of Dedicator of cytokinesis vs. Ensembl Human
Match: DOCK11 (dedicator of cytokinesis 11 [Source:HGNC Symbol;Acc:HGNC:23483])

HSP 1 Score: 426.787 bits (1096), Expect = 2.640e-120
Identity = 268/838 (31.98%), Postives = 425/838 (50.72%), Query Frame = 2
Query: 5138 KDIFVCLLHIFHTISSDDLKATICNLTVQERLEFLQLLILSIHHLKYQGRKVINNFESI--------------------STGCAKSKIQLRPHGPRSSVTAILDDVDHGD--HKAYLEGNVSTEVGLIVLDVLSAYCSAFKQEILTYTPDHVIFKKIVDIYLTLLSVNQSEIVLKHVFVSMRVFVSTFAKVLFANCHNVISDLSLHTLRFLDTRFTSVRIEACGFLYRMMRSSYDTFNKPGINRVHLQMIVAVSKLDRTV----GIRFKESLNYLKRLAEIEMXXXXXXXXXXXXXGTPTGTSKSITIGVHSTTKLSMQTFFEEVTDLTQRIRTVLMATVQMNEHVDDPEMQVDLQYSLAKSYSSNPALRRTWLEKIYAIHNKNNSRAEMAMCKAHIVAMIVEYLRRKEQYSMSCANFKAISPNIPLEESGMRDDSVQLEVHYTKEEVVKLLRELAHEFDAGCLWEVLRHVYKLVIPIYERKRDYEQLAEIYKHMSDGYNKIKTAESTNQRIIGSYYRVVLYGKP-FDSLAGKVFIYRLDSGKQFCVVREELQKLFSKKYGAGKVQMLVE-NHIDRSKLDPELASIQVTHVEPFFNEDEELERHSMFERQYNISKFMLETPFVKMNHVEHESRWKKYKEHDIDGVLKSKQTDDLSIQWKRRTILTVEASFPHLKRRLEVISIKEIDFSPIERAIDEIQLKNRQLAMHLAYXXXXXXXXXXXXXXXXXXXXXVGSSQTRANNIPLLMDMHMSGALLPQVNQGPMAYARVFLHKETQANYSQEKVKQLKIQFMEFLTLCYLLLRDFNELMSHIQQQKYIAMREALDSYRVELSNLINEEI 7567
            + + +C L+I   IS D L      ++ QE +  L LL + + H +Y G++ I                           +G  ++++Q       S            D  H+A LEGN +TEV L VLD +S +   FK ++L     + + KK+ DI+L  L   QSE+ LKHVF S+R F+S F    F    N+ +      L+   ++ +S R EA   LY +MR++++   +    R HLQ+I+AVS+L   V    G RF+ESL  +   A                               +S   +    F  EV DLT+RIRTVLMAT QM EH  DPEM +DLQYSLAKSY+S P LR+TWL+ +  IH KN   +E AMC  H+ A++ E+L RK+ +   C+ FK I+PNI  EE  M++D+  ++VHY++E +++LL +          +E++  + KL++PIYE++R++E+L ++Y+ +   Y KI     T +R++G+++RV  YG+  F+   GK +IY+         +   L KL+ +K+G   V+++ + + ++  +LDP+ A IQVT+V+P+F++ E  ER + FER +NIS+F+ E P+                       L  K+   +  Q KRRTILT   SFP++K+R+ +   ++I+  PI+ A DEI+ K  +L                              S T  + I L   + + G +  QVN GP+AYAR FL+    + Y  +KV +LK  F +F+  C + L     L+   Q + +  ++        ELS++I+E+I
Sbjct: 1109 RSLLMCYLYIVKMISEDTLLTYWNKVSPQELINILILLEVCLFHFRYMGKRNIARVHDAWLSKHFGIDRKSQTMPALRNRSGVMQARLQHLSSLESSFTLNHSSTTTEADIFHQALLEGNTATEVSLTVLDTISFFTQCFKTQLLNNDGHNPLMKKVFDIHLAFLKNGQSEVSLKHVFASLRAFISKFPSAFFKGRVNMCAAFCYEVLKCCTSKISSTRNEASALLYLLMRNNFEYTKRKTFLRTHLQIIIAVSQLIADVALSGGSRFQESLFIINNFA-------------------------------NSDRPMKATAFPAEVKDLTKRIRTVLMATAQMKEHEKDPEMLIDLQYSLAKSYASTPELRKTWLDSMAKIHVKNGDFSEAAMCYVHVAALVAEFLHRKKLFPNGCSAFKKITPNID-EEGAMKEDAGMMDVHYSEEVLLELLEQCVDGLWKAERYEIISEISKLIVPIYEKRREFEKLTQVYRTLHGAYTKILEVMHTKKRLLGTFFRVAFYGQSFFEEEDGKEYIYKEPKLTGLSEISLRLVKLYGEKFGTENVKIIQDSDKVNAKELDPKYAHIQVTYVKPYFDDKELTERKTEFERNHNISRFVFEAPY----------------------TLSGKKQGCIEEQCKRRTILTTSNSFPYVKKRIPINCEQQINLKPIDVATDEIKDKTAELQKL--------------------------CSSTDVDMIQL--QLKLQGCVSVQVNAGPLAYARAFLNDSQASKYPPKKVSELKDMFRKFIQACSIALELNERLIKEDQVEYHEGLKSNFRDMVKELSDIIHEQI 1864          

HSP 2 Score: 160.999 bits (406), Expect = 1.894e-38
Identity = 153/565 (27.08%), Postives = 248/565 (43.89%), Query Frame = 2
Query: 3098 VQWVDGQKSIFTVVIRPETTIFTQSTHLHKFFQVCSEKLDELTNPTVVEKKESIFTKPRSGSDPTTPKPVSDDTLLLQTSNKDV--EIKNAIKALATVNVTNLIKFFAPTFNQLLHVVVCTAISHSEISKTAVTSMITLASSLRTPSMESLSSKATKRNTKIIKSYIKFAFDAEKIVPTKVKRTVHESLIQAISELIRPPFRDTXXXXXXXXXXXXXYSIITKSMIQSLTKQSKITIDKGGDKFFSTSYMDSLQNMIHLIINCILEITSTVGNQSGMNGQLRPNNSFQSLATSANKDLARFISRLFNVMDRGFIFQIIHQYMKIFIARINAYSGHREHLCRMKFDFLEIVTNHEHYLPLNL-LKIINPSDKGQSV---------RKRQAPPSLELILSETYCRQHYLAGLLLQEVHRQMSDVYSHNAVRRLPFVMLRNLLAKHLFDDRYSSINMQARIAALYLPLVSIILENQKSFSLPGNLHTKVNLLN----DIYDHSDRSLSARPLSTLSGDTLSTHSSINGSSG------------DGAGGSVYGLGFGTNSSKSARSSQV 4708
            ++WVDG K +  +    E+TI+TQ  H+HKFF  C                                        L+Q+ +K+V  E+   +K L  + +  +I+F      QL  V+  T ++H +     +   + L   +     E L S         ++S+IK++F  EK    + +  +HE+L   +  +++    D   +N  L  S+ F+ II KSM   L +++KI + +G  + F  +Y   L +++  II  +    + + ++S                 + N  LA F+ R   +MDRGFIF +I+ Y+  F  +        + L   KF+FL+ + NHEHY+PLNL +    P  K Q V         R      +LE  LS+ YC+ H+L GLLL+E    + D Y    +R     +++NLL KH FD RY   N QA+IA LYLP V ++LEN +  +    L++   + N    D +     S + R   +LS D  + + S     G            +GA G       G N+ +S+  S V
Sbjct:  617 IKWVDGAKPLLKIKSHLESTIYTQDLHVHKFFHHCQ---------------------------------------LIQSGSKEVPGELIKYLKCLHAMEIQVMIQFLPVILMQLFRVL--TNMTHED--DVPINCTMVLLHIVSKCHEEGLDS--------YLRSFIKYSFRPEKPSAPQAQ-LIHETLATTMIAILKQS-ADFLSINKLLKYSWFFFEIIAKSMATYLLEENKIKLPRG--QRFPETYHHVLHSLLLAIIPHVTIRYAEIPDES----------------RNVNYSLASFLKRCLTLMDRGFIFNLINDYISGFSPK------DPKVLAEYKFEFLQTICNHEHYIPLNLPMAFAKP--KLQRVQDFFSFAVDRLTSVDSNLEYSLSDEYCKHHFLVGLLLRETSIALQDNYE---IRYTAISVIKNLLIKHAFDTRYQHKNQQAKIAQLYLPFVGLLLENIQRLAGRDTLYSCAAMPNSASRDEFPCGFTSPANR--GSLSTDKDTAYGSFQNGHGIKREDSRGSLIPEGATGFPDQGNTGENTRQSSTRSSV 1097          

HSP 3 Score: 123.635 bits (309), Expect = 3.808e-27
Identity = 65/153 (42.48%), Postives = 93/153 (60.78%), Query Frame = 2
Query: 2411 LYIYPRTLNFSNQNVFHRARNLSCFVELRDVDKSDAPPLKVFYSRPSRKQPAFDYWSNTSVIYHDSSPTFNEEIKIALPLNLHSKHHLLFRFYHVSCDTAAIPNVREKGSNKK--SLETPVGVTWLTLMDQNLNLKSGSFSLPVATQLVPDYL 2863
            LY+YP  L + +Q  F +ARN++  VE RD D+SDA  LK  Y +P+     F   +   V +H+ +P F +EIKI LP++LH KHHLLF FYHVSC+      +  KG+ KK  ++ETPVG  W+ L+ ++  + +    LPV+  L P YL
Sbjct:  459 LYVYPLQLKYDSQKTFAKARNIAVCVEFRDSDESDASALKCIYGKPAGS--VFTTNAYAVVSHHNQNPEFYDEIKIELPIHLHQKHHLLFTFYHVSCE------INTKGTTKKQDTVETPVGFAWVPLL-KDGRIITFEQQLPVSANLPPGYL 602          

HSP 4 Score: 71.2478 bits (173), Expect = 3.460e-11
Identity = 104/450 (23.11%), Postives = 176/450 (39.11%), Query Frame = 2
Query:  662 FSLNELSDGSTVL------KESMPRDGHEQIIVYLD---NVDSLRELGGYWILLSFKGKQSESYLFTGGNDNQKLWANKLKDAIESETKTKQIERPVSSESIERSE---------------ETVHGMLSKFLQENEQSAVILRKKDHQKILVIYSEIRNQIKMKSQQTPIYDIGIIEKSQLDDCHIRPQV---EQSIPKTFIKLTANRFITSVG-ISDENSNPKGVIPAEPFFISFSLFHIADGRRISEEFYWNPNRPQIEDLLPSDLFAYKFGGHPVHATINGNCDNRTPLN-LPTMSDRVLQSTNSFILKVPCLPDKICLFIKSEKVFSGAIGPTVDKYIKSGGSLLKKKDREEELFVENPDVKTGASINKTMSVYCANIGHYRMPFGWTA--------CRLNIKGKNCLRFHKYENNKTSEDDIIKLVQNMSSQHVDNNASKYTTIP 1900
            F L +L DGS +L      K S    G     +YLD   +V    ++  +   L    K S  YL        + W   LK  I+  T +   E+  + E+ +  E                ++H  L K+ +E EQ   + R    Q +    SE++                     +LD   I P +   E+   K F+    +     +G I D    P   +  EPFFI+ +LF + +  +IS +F+ + N P + ++L          G       +G+    +P + +  +++  L+     I  V     +I L  + EKV  G I    + YIK+                 +P VKT   +++T    C+ +G YRMPF W A          L++ G+     +K +++K S +DI+KL+    S++     +K   IP
Sbjct:    9 FYLTQLPDGSYILNSYKDEKNSKESKG----CIYLDACIDVVQCPKMRRHAFELKMLDKYSH-YLAAETEQEMEEWLITLKKIIQINTDSLVQEKKETVETAQDDETSSQGKAENIMASLERSMHPELMKYGRETEQLNKLSRGDGRQNLFSFDSEVQ---------------------RLDFSGIEPDIKPFEEKCNKRFLVNCHDLTFNILGQIGDNAKGPPTNV--EPFFINLALFDVKNNCKISADFHVDLNPPSVREML---------WGSSTQLASDGSPKGSSPESYIHGIAESQLRYIQQGIFSVTNPHPEIFLVARIEKVLQGNITHCAEPYIKNS----------------DP-VKTAQKVHRTAKQVCSRLGQYRMPFAWAARPIFKDTQGSLDLDGRFS-PLYKQDSSKLSSEDILKLL----SEYKKPEKTKLQIIP 399          
BLAST of Dedicator of cytokinesis vs. Ensembl Human
Match: DOCK11 (dedicator of cytokinesis 11 [Source:HGNC Symbol;Acc:HGNC:23483])

HSP 1 Score: 426.402 bits (1095), Expect = 7.123e-120
Identity = 268/838 (31.98%), Postives = 425/838 (50.72%), Query Frame = 2
Query: 5138 KDIFVCLLHIFHTISSDDLKATICNLTVQERLEFLQLLILSIHHLKYQGRKVINNFESI--------------------STGCAKSKIQLRPHGPRSSVTAILDDVDHGD--HKAYLEGNVSTEVGLIVLDVLSAYCSAFKQEILTYTPDHVIFKKIVDIYLTLLSVNQSEIVLKHVFVSMRVFVSTFAKVLFANCHNVISDLSLHTLRFLDTRFTSVRIEACGFLYRMMRSSYDTFNKPGINRVHLQMIVAVSKLDRTV----GIRFKESLNYLKRLAEIEMXXXXXXXXXXXXXGTPTGTSKSITIGVHSTTKLSMQTFFEEVTDLTQRIRTVLMATVQMNEHVDDPEMQVDLQYSLAKSYSSNPALRRTWLEKIYAIHNKNNSRAEMAMCKAHIVAMIVEYLRRKEQYSMSCANFKAISPNIPLEESGMRDDSVQLEVHYTKEEVVKLLRELAHEFDAGCLWEVLRHVYKLVIPIYERKRDYEQLAEIYKHMSDGYNKIKTAESTNQRIIGSYYRVVLYGKP-FDSLAGKVFIYRLDSGKQFCVVREELQKLFSKKYGAGKVQMLVE-NHIDRSKLDPELASIQVTHVEPFFNEDEELERHSMFERQYNISKFMLETPFVKMNHVEHESRWKKYKEHDIDGVLKSKQTDDLSIQWKRRTILTVEASFPHLKRRLEVISIKEIDFSPIERAIDEIQLKNRQLAMHLAYXXXXXXXXXXXXXXXXXXXXXVGSSQTRANNIPLLMDMHMSGALLPQVNQGPMAYARVFLHKETQANYSQEKVKQLKIQFMEFLTLCYLLLRDFNELMSHIQQQKYIAMREALDSYRVELSNLINEEI 7567
            + + +C L+I   IS D L      ++ QE +  L LL + + H +Y G++ I                           +G  ++++Q       S            D  H+A LEGN +TEV L VLD +S +   FK ++L     + + KK+ DI+L  L   QSE+ LKHVF S+R F+S F    F    N+ +      L+   ++ +S R EA   LY +MR++++   +    R HLQ+I+AVS+L   V    G RF+ESL  +   A                               +S   +    F  EV DLT+RIRTVLMAT QM EH  DPEM +DLQYSLAKSY+S P LR+TWL+ +  IH KN   +E AMC  H+ A++ E+L RK+ +   C+ FK I+PNI  EE  M++D+  ++VHY++E +++LL +          +E++  + KL++PIYE++R++E+L ++Y+ +   Y KI     T +R++G+++RV  YG+  F+   GK +IY+         +   L KL+ +K+G   V+++ + + ++  +LDP+ A IQVT+V+P+F++ E  ER + FER +NIS+F+ E P+                       L  K+   +  Q KRRTILT   SFP++K+R+ +   ++I+  PI+ A DEI+ K  +L                              S T  + I L   + + G +  QVN GP+AYAR FL+    + Y  +KV +LK  F +F+  C + L     L+   Q + +  ++        ELS++I+E+I
Sbjct: 1280 RSLLMCYLYIVKMISEDTLLTYWNKVSPQELINILILLEVCLFHFRYMGKRNIARVHDAWLSKHFGIDRKSQTMPALRNRSGVMQARLQHLSSLESSFTLNHSSTTTEADIFHQALLEGNTATEVSLTVLDTISFFTQCFKTQLLNNDGHNPLMKKVFDIHLAFLKNGQSEVSLKHVFASLRAFISKFPSAFFKGRVNMCAAFCYEVLKCCTSKISSTRNEASALLYLLMRNNFEYTKRKTFLRTHLQIIIAVSQLIADVALSGGSRFQESLFIINNFA-------------------------------NSDRPMKATAFPAEVKDLTKRIRTVLMATAQMKEHEKDPEMLIDLQYSLAKSYASTPELRKTWLDSMAKIHVKNGDFSEAAMCYVHVAALVAEFLHRKKLFPNGCSAFKKITPNID-EEGAMKEDAGMMDVHYSEEVLLELLEQCVDGLWKAERYEIISEISKLIVPIYEKRREFEKLTQVYRTLHGAYTKILEVMHTKKRLLGTFFRVAFYGQSFFEEEDGKEYIYKEPKLTGLSEISLRLVKLYGEKFGTENVKIIQDSDKVNAKELDPKYAHIQVTYVKPYFDDKELTERKTEFERNHNISRFVFEAPY----------------------TLSGKKQGCIEEQCKRRTILTTSNSFPYVKKRIPINCEQQINLKPIDVATDEIKDKTAELQKL--------------------------CSSTDVDMIQL--QLKLQGCVSVQVNAGPLAYARAFLNDSQASKYPPKKVSELKDMFRKFIQACSIALELNERLIKEDQVEYHEGLKSNFRDMVKELSDIIHEQI 2035          

HSP 2 Score: 165.236 bits (417), Expect = 1.157e-39
Identity = 148/556 (26.62%), Postives = 247/556 (44.42%), Query Frame = 2
Query: 3098 VQWVDGQKSIFTVVIRPETTIFTQSTHLHKFFQVCSEKLDELTNPTVVEKKESIFTKPRSGSDPTTPKPVSDDTLLLQTSNKDV--EIKNAIKALATVNVTNLIKFFAPTFNQLLHVVVCTAISHSE-ISKTAVTSMITLASSLRTPSMESLSSKATKRNTKIIKSYIKFAFDAEKIVPTKVKRTVHESLIQAISELIRPPFRDTXXXXXXXXXXXXXYSIITKSMIQSLTKQSKITIDKGGDKFFSTSYMDSLQNMIHLIINCILEITSTVGNQSGMNGQLRPNNSFQSLATSANKDLARFISRLFNVMDRGFIFQIIHQYMKIFIARINAYSGHREHLCRMKFDFLEIVTNHEHYLPLNLLKIINPSDKGQSVRKRQAPPSLELILSETYCRQHYLAGLLLQEVHRQMSDVYSHNAVRRLPFVMLRNLLAKHLFDDRYSSINMQARIAALYLPLVSIILENQKSFSLPGNLHTKVNLLN----DIYDHSDRSLSARPLSTLSGDTLSTHSSINGSSG------------DGAGGSVYGLGFGTNSSKSARSSQV 4708
            ++WVDG K +  +    E+TI+TQ  H+HKFF  C                                        L+Q+ +K+V  E+   +K L  + +  +I+F      QL  V+  T ++H + +       ++ + S      ++S            ++S+IK++F  EK    + +  +HE+L   +  +++    D   +N  L  S+ F+ II KSM   L +++KI + +G  + F  +Y   L +++  II  +    + + ++S                 + N  LA F+ R   +MDRGFIF +I+ Y+  F  +        + L   KF+FL+ + NHEHY+PLNL     P    +   +R    +LE  LS+ YC+ H+L GLLL+E    + D Y    +R     +++NLL KH FD RY   N QA+IA LYLP V ++LEN +  +    L++   + N    D +     S + R   +LS D  + + S     G            +GA G       G N+ +S+  S V
Sbjct:  801 IKWVDGAKPLLKIKSHLESTIYTQDLHVHKFFHHCQ---------------------------------------LIQSGSKEVPGELIKYLKCLHAMEIQVMIQFLPVILMQLFRVL--TNMTHEDDVPINCTMVLLHIVSKCHEEGLDSY-----------LRSFIKYSFRPEKPSAPQAQ-LIHETLATTMIAILKQS-ADFLSINKLLKYSWFFFEIIAKSMATYLLEENKIKLPRG--QRFPETYHHVLHSLLLAIIPHVTIRYAEIPDES----------------RNVNYSLASFLKRCLTLMDRGFIFNLINDYISGFSPK------DPKVLAEYKFEFLQTICNHEHYIPLNL-----PMAFAKPKLQRVQDSNLEYSLSDEYCKHHFLVGLLLRETSIALQDNYE---IRYTAISVIKNLLIKHAFDTRYQHKNQQAKIAQLYLPFVGLLLENIQRLAGRDTLYSCAAMPNSASRDEFPCGFTSPANR--GSLSTDKDTAYGSFQNGHGIKREDSRGSLIPEGATGFPDQGNTGENTRQSSTRSSV 1268          

HSP 3 Score: 123.635 bits (309), Expect = 3.971e-27
Identity = 65/153 (42.48%), Postives = 93/153 (60.78%), Query Frame = 2
Query: 2411 LYIYPRTLNFSNQNVFHRARNLSCFVELRDVDKSDAPPLKVFYSRPSRKQPAFDYWSNTSVIYHDSSPTFNEEIKIALPLNLHSKHHLLFRFYHVSCDTAAIPNVREKGSNKK--SLETPVGVTWLTLMDQNLNLKSGSFSLPVATQLVPDYL 2863
            LY+YP  L + +Q  F +ARN++  VE RD D+SDA  LK  Y +P+     F   +   V +H+ +P F +EIKI LP++LH KHHLLF FYHVSC+      +  KG+ KK  ++ETPVG  W+ L+ ++  + +    LPV+  L P YL
Sbjct:  643 LYVYPLQLKYDSQKTFAKARNIAVCVEFRDSDESDASALKCIYGKPAGS--VFTTNAYAVVSHHNQNPEFYDEIKIELPIHLHQKHHLLFTFYHVSCE------INTKGTTKKQDTVETPVGFAWVPLL-KDGRIITFEQQLPVSANLPPGYL 786          

HSP 4 Score: 100.138 bits (248), Expect = 6.530e-20
Identity = 148/626 (23.64%), Postives = 253/626 (40.42%), Query Frame = 2
Query:  134 SELVKPIDFESVYLQNKNNISNDPNRVLVKIPDNDVKINKVSRKETVYNNGVPTNIHEIFDCNLLAKLCVDFYTSEWTATCYKDFTYNSSFWTLPNVHNQLTMAKEQKFIIXXXXXXXXXXLLTFKTKGSYFESNLAICDRNAYQKHLKHREDELANTSSNAGINYSKAAVPELLSFSLNELSDGSTVL------KESMPRDGHEQIIVYLD---NVDSLRELGGYWILLSFKGKQSESYLFTGGNDNQKLWANKLKDAIESETKTKQIERPVSSESIERSE---------------ETVHGMLSKFLQENEQSAVILRKKDHQKILVIYSEIRNQIKMKSQQTPIYDIGIIEKSQLDDCHIRPQV---EQSIPKTFIKLTANRFITSVG-ISDENSNPKGVIPAEPFFISFSLFHIADGRRISEEFYWNPNRPQIEDLLPSDLFAYKFGGHPVHATINGNCDNRTPLN-LPTMSDRVLQSTNSFILKVPCLPDKICLFIKSEKVFSGAIGPTVDKYIKSGGSLLKKKDREEELFVENPDVKTGASINKTMSVYCANIGHYRMPFGWTA--------CRLNIKGKNCLRFHKYENNKTSEDDIIKLVQNMSSQHVDNNASKYTTIP 1900
            +++V+P+D+E+V  Q K  I +DP R L+  P  D+ I+ + R+     + VP +  +    +L  K C+  Y+++W    YK   ++  F  LP    +        F IDED EKD              E + ++C     QK    ++  L   + N+ I  +   V +   F L +L DGS +L      K S    G     +YLD   +V    ++  +   L    K S  YL        + W   LK  I+  T +   E+  + E+ +  E                ++H  L K+ +E EQ   + R    Q +    SE++                     +LD   I P +   E+   K F+    +     +G I D    P   +  EPFFI+ +LF + +  +IS +F+ + N P + ++L          G       +G+    +P + +  +++  L+     I  V     +I L  + EKV  G I    + YIK+                 +P VKT   +++T    C+ +G YRMPF W A          L++ G+     +K +++K S +DI+KL+    S++     +K   IP
Sbjct:   37 AKVVEPLDYENVIAQRKTQIYSDPLRDLLMFPMEDISISVIGRQRRTVQSTVPEDAEKRAQ-SLFVKECIKTYSTDWHVVNYKYEDFSGDFRMLPCKSLRPEKIPNHVFEIDEDCEKD--------------EDSSSLCS----QKGGVIKQGWLHKANVNSTITVT-MKVFKRRYFYLTQLPDGSYILNSYKDEKNSKESKG----CIYLDACIDVVQCPKMRRHAFELKMLDKYSH-YLAAETEQEMEEWLITLKKIIQINTDSLVQEKKETVETAQDDETSSQGKAENIMASLERSMHPELMKYGRETEQLNKLSRGDGRQNLFSFDSEVQ---------------------RLDFSGIEPDIKPFEEKCNKRFLVNCHDLTFNILGQIGDNAKGPPTNV--EPFFINLALFDVKNNCKISADFHVDLNPPSVREML---------WGSSTQLASDGSPKGSSPESYIHGIAESQLRYIQQGIFSVTNPHPEIFLVARIEKVLQGNITHCAEPYIKNS----------------DP-VKTAQKVHRTAKQVCSRLGQYRMPFAWAARPIFKDTQGSLDLDGRFS-PLYKQDSSKLSSEDILKLL----SEYKKPEKTKLQIIP 583          
BLAST of Dedicator of cytokinesis vs. Ensembl Human
Match: DOCK11 (dedicator of cytokinesis 11 [Source:HGNC Symbol;Acc:HGNC:23483])

HSP 1 Score: 424.861 bits (1091), Expect = 2.323e-119
Identity = 267/840 (31.79%), Postives = 425/840 (50.60%), Query Frame = 2
Query: 5138 KDIFVCLLHIFHTISSDDLKATICNLTVQERLEFLQLLILSIHHLKYQGRKVINNFESI--------------------STGCAKSKIQLRPHGPRSSVTAILDDVDHGD--HKAYLEGNVSTEVGLIVLDVLSAYCSAFKQEILTYTPDHVIFKKIVDIYLTLLSVNQSEIVLKHVFVSMRVFVSTFAKVLFANCHNVISDLSLHTLRFLDTRFTSVRIEACGFLYRMMRSSYDTFNKPGINRVHLQMIVAVSKLDRTV----GIRFKESLNYLKRLAEIEMXXXXXXXXXXXXXGTPTGTSKSITIGVHSTTKLSMQTFFEEVTDLTQRIRTVLMATVQMNEHVDDPEMQVDLQYSLAKSYSSNPALRRTWLEKIYAIHNKNNSRAEMAMCKAHIVAMIVEYLRRKEQYSMSCANFKAISPNIPLEESGMRDDSVQLEVHYTKEEVVKLLRELAHEFDAGCLWEVLRHVYKLVIPIYERKRDYEQLAEIYKHMSDGYNKIKTAESTNQRIIGSYYRVVLYGKP-FDSLAGKVFIYRLDSGKQFCVVREELQKLFSKKYGAGKVQMLVE-NHIDRSKLDPELASIQVTHVEPFFNEDEELERHSMFERQYNISKFMLETPFVKMNHVEHESRWKKYKEHDIDGVLKSKQTDDLSIQWKRRTILTVEASFPHLKRRLEVISIKEIDFSPIERAIDEIQLKNRQLAMHLAYXXXXXXXXXXXXXXXXXXXXXVGSSQTRANNIPLLMDMHMSGALLPQVNQGPMAYARVFLHKETQANYSQEKVKQLKIQFMEFLTLCYLLLRDFNELMSHIQQQKYIAMREALDSYRVELSNLINEEICV 7573
            + + +C L+I   IS D L      ++ QE +  L LL + + H +Y G++ I                           +G  ++++Q       S            D  H+A LEGN +TEV L VLD +S +   FK ++L     + + KK+ DI+L  L   QSE+ LKHVF S+R F+S F    F    N+ +      L+   ++ +S R EA   LY +MR++++   +    R HLQ+I+AVS+L   V    G RF+ESL  +   A                               +S   +    F  EV DLT+RIRTVLMAT QM EH  DPEM +DLQYSLAKSY+S P LR+TWL+ +  IH KN   +E AMC  H+ A++ E+L RK+ +   C+ FK I+PNI  EE  M++D+  ++VHY++E +++LL +          +E++  + KL++PIYE++R++E+L ++Y+ +   Y KI     T +R++G+++RV  YG+  F+   GK +IY+         +   L KL+ +K+G   V+++ + + ++  +LDP+ A IQVT+V+P+F++ E  ER + FER +NIS+F+ E P+                       L  K+   +  Q KRRTILT   SFP++K+R+ +   ++I+  PI+ A DEI+ K  +L                              S T  + I L   + + G +  QVN GP+AYAR FL+    + Y  +KV +LK  F +F+  C + L     L+   Q + +  ++        ELS++I+E+  +
Sbjct: 1280 RSLLMCYLYIVKMISEDTLLTYWNKVSPQELINILILLEVCLFHFRYMGKRNIARVHDAWLSKHFGIDRKSQTMPALRNRSGVMQARLQHLSSLESSFTLNHSSTTTEADIFHQALLEGNTATEVSLTVLDTISFFTQCFKTQLLNNDGHNPLMKKVFDIHLAFLKNGQSEVSLKHVFASLRAFISKFPSAFFKGRVNMCAAFCYEVLKCCTSKISSTRNEASALLYLLMRNNFEYTKRKTFLRTHLQIIIAVSQLIADVALSGGSRFQESLFIINNFA-------------------------------NSDRPMKATAFPAEVKDLTKRIRTVLMATAQMKEHEKDPEMLIDLQYSLAKSYASTPELRKTWLDSMAKIHVKNGDFSEAAMCYVHVAALVAEFLHRKKLFPNGCSAFKKITPNID-EEGAMKEDAGMMDVHYSEEVLLELLEQCVDGLWKAERYEIISEISKLIVPIYEKRREFEKLTQVYRTLHGAYTKILEVMHTKKRLLGTFFRVAFYGQSFFEEEDGKEYIYKEPKLTGLSEISLRLVKLYGEKFGTENVKIIQDSDKVNAKELDPKYAHIQVTYVKPYFDDKELTERKTEFERNHNISRFVFEAPY----------------------TLSGKKQGCIEEQCKRRTILTTSNSFPYVKKRIPINCEQQINLKPIDVATDEIKDKTAELQKL--------------------------CSSTDVDMIQL--QLKLQGCVSVQVNAGPLAYARAFLNDSQASKYPPKKVSELKDMFRKFIQACSIALELNERLIKEDQVEYHEGLKSNFRDMVKELSDIIHEQASI 2037          

HSP 2 Score: 164.851 bits (416), Expect = 1.178e-39
Identity = 150/555 (27.03%), Postives = 246/555 (44.32%), Query Frame = 2
Query: 3098 VQWVDGQKSIFTVVIRPETTIFTQSTHLHKFFQVCSEKLDELTNPTVVEKKESIFTKPRSGSDPTTPKPVSDDTLLLQTSNKDV--EIKNAIKALATVNVTNLIKFFAPTFNQLLHVVVCTAISHSEISKTAVTSMITLASSLRTPSMESLSSKATKRNTKIIKSYIKFAFDAEKIVPTKVKRTVHESLIQAISELIRPPFRDTXXXXXXXXXXXXXYSIITKSMIQSLTKQSKITIDKGGDKFFSTSYMDSLQNMIHLIINCILEITSTVGNQSGMNGQLRPNNSFQSLATSANKDLARFISRLFNVMDRGFIFQIIHQYMKIFIARINAYSGHREHLCRMKFDFLEIVTNHEHYLPLNLLKIINPSDKGQSVRKRQAPPSLELILSETYCRQHYLAGLLLQEVHRQMSDVYSHNAVRRLPFVMLRNLLAKHLFDDRYSSINMQARIAALYLPLVSIILENQKSFSLPGNLHTKVNLLN----DIYDHSDRSLSARPLSTLSGDTLSTHSSINGSSG------------DGAGGSVYGLGFGTNSSKSARSSQV 4708
            ++WVDG K +  +    E+TI+TQ  H+HKFF  C                                        L+Q+ +K+V  E+   +K L  + +  +I+F      QL  V+  T ++H +     +   + L   +     E L S         ++S+IK++F  EK    + +  +HE+L   +  +++    D   +N  L  S+ F+ II KSM   L +++KI + +G  + F  +Y   L +++  II  +    + + ++S                 + N  LA F+ R   +MDRGFIF +I+ Y+  F  +        + L   KF+FL+ + NHEHY+PLNL     P    +   +R    +LE  LS+ YC+ H+L GLLL+E    + D Y    +R     +++NLL KH FD RY   N QA+IA LYLP V ++LEN +  +    L++   + N    D +     S + R   +LS D  + + S     G            +GA G       G N+ +S+  S V
Sbjct:  801 IKWVDGAKPLLKIKSHLESTIYTQDLHVHKFFHHCQ---------------------------------------LIQSGSKEVPGELIKYLKCLHAMEIQVMIQFLPVILMQLFRVL--TNMTHED--DVPINCTMVLLHIVSKCHEEGLDS--------YLRSFIKYSFRPEKPSAPQAQ-LIHETLATTMIAILKQS-ADFLSINKLLKYSWFFFEIIAKSMATYLLEENKIKLPRG--QRFPETYHHVLHSLLLAIIPHVTIRYAEIPDES----------------RNVNYSLASFLKRCLTLMDRGFIFNLINDYISGFSPK------DPKVLAEYKFEFLQTICNHEHYIPLNL-----PMAFAKPKLQRVQDSNLEYSLSDEYCKHHFLVGLLLRETSIALQDNYE---IRYTAISVIKNLLIKHAFDTRYQHKNQQAKIAQLYLPFVGLLLENIQRLAGRDTLYSCAAMPNSASRDEFPCGFTSPANR--GSLSTDKDTAYGSFQNGHGIKREDSRGSLIPEGATGFPDQGNTGENTRQSSTRSSV 1268          

HSP 3 Score: 123.635 bits (309), Expect = 3.940e-27
Identity = 65/153 (42.48%), Postives = 93/153 (60.78%), Query Frame = 2
Query: 2411 LYIYPRTLNFSNQNVFHRARNLSCFVELRDVDKSDAPPLKVFYSRPSRKQPAFDYWSNTSVIYHDSSPTFNEEIKIALPLNLHSKHHLLFRFYHVSCDTAAIPNVREKGSNKK--SLETPVGVTWLTLMDQNLNLKSGSFSLPVATQLVPDYL 2863
            LY+YP  L + +Q  F +ARN++  VE RD D+SDA  LK  Y +P+     F   +   V +H+ +P F +EIKI LP++LH KHHLLF FYHVSC+      +  KG+ KK  ++ETPVG  W+ L+ ++  + +    LPV+  L P YL
Sbjct:  643 LYVYPLQLKYDSQKTFAKARNIAVCVEFRDSDESDASALKCIYGKPAGS--VFTTNAYAVVSHHNQNPEFYDEIKIELPIHLHQKHHLLFTFYHVSCE------INTKGTTKKQDTVETPVGFAWVPLL-KDGRIITFEQQLPVSANLPPGYL 786          

HSP 4 Score: 99.7525 bits (247), Expect = 6.701e-20
Identity = 148/626 (23.64%), Postives = 253/626 (40.42%), Query Frame = 2
Query:  134 SELVKPIDFESVYLQNKNNISNDPNRVLVKIPDNDVKINKVSRKETVYNNGVPTNIHEIFDCNLLAKLCVDFYTSEWTATCYKDFTYNSSFWTLPNVHNQLTMAKEQKFIIXXXXXXXXXXLLTFKTKGSYFESNLAICDRNAYQKHLKHREDELANTSSNAGINYSKAAVPELLSFSLNELSDGSTVL------KESMPRDGHEQIIVYLD---NVDSLRELGGYWILLSFKGKQSESYLFTGGNDNQKLWANKLKDAIESETKTKQIERPVSSESIERSE---------------ETVHGMLSKFLQENEQSAVILRKKDHQKILVIYSEIRNQIKMKSQQTPIYDIGIIEKSQLDDCHIRPQV---EQSIPKTFIKLTANRFITSVG-ISDENSNPKGVIPAEPFFISFSLFHIADGRRISEEFYWNPNRPQIEDLLPSDLFAYKFGGHPVHATINGNCDNRTPLN-LPTMSDRVLQSTNSFILKVPCLPDKICLFIKSEKVFSGAIGPTVDKYIKSGGSLLKKKDREEELFVENPDVKTGASINKTMSVYCANIGHYRMPFGWTA--------CRLNIKGKNCLRFHKYENNKTSEDDIIKLVQNMSSQHVDNNASKYTTIP 1900
            +++V+P+D+E+V  Q K  I +DP R L+  P  D+ I+ + R+     + VP +  +    +L  K C+  Y+++W    YK   ++  F  LP    +        F IDED EKD              E + ++C     QK    ++  L   + N+ I  +   V +   F L +L DGS +L      K S    G     +YLD   +V    ++  +   L    K S  YL        + W   LK  I+  T +   E+  + E+ +  E                ++H  L K+ +E EQ   + R    Q +    SE++                     +LD   I P +   E+   K F+    +     +G I D    P   +  EPFFI+ +LF + +  +IS +F+ + N P + ++L          G       +G+    +P + +  +++  L+     I  V     +I L  + EKV  G I    + YIK+                 +P VKT   +++T    C+ +G YRMPF W A          L++ G+     +K +++K S +DI+KL+    S++     +K   IP
Sbjct:   37 AKVVEPLDYENVIAQRKTQIYSDPLRDLLMFPMEDISISVIGRQRRTVQSTVPEDAEKRAQ-SLFVKECIKTYSTDWHVVNYKYEDFSGDFRMLPCKSLRPEKIPNHVFEIDEDCEKD--------------EDSSSLCS----QKGGVIKQGWLHKANVNSTITVT-MKVFKRRYFYLTQLPDGSYILNSYKDEKNSKESKG----CIYLDACIDVVQCPKMRRHAFELKMLDKYSH-YLAAETEQEMEEWLITLKKIIQINTDSLVQEKKETVETAQDDETSSQGKAENIMASLERSMHPELMKYGRETEQLNKLSRGDGRQNLFSFDSEVQ---------------------RLDFSGIEPDIKPFEEKCNKRFLVNCHDLTFNILGQIGDNAKGPPTNV--EPFFINLALFDVKNNCKISADFHVDLNPPSVREML---------WGSSTQLASDGSPKGSSPESYIHGIAESQLRYIQQGIFSVTNPHPEIFLVARIEKVLQGNITHCAEPYIKNS----------------DP-VKTAQKVHRTAKQVCSRLGQYRMPFAWAARPIFKDTQGSLDLDGRFS-PLYKQDSSKLSSEDILKLL----SEYKKPEKTKLQIIP 583          
BLAST of Dedicator of cytokinesis vs. Ensembl Human
Match: DOCK9 (dedicator of cytokinesis 9 [Source:HGNC Symbol;Acc:HGNC:14132])

HSP 1 Score: 412.535 bits (1059), Expect = 1.757e-115
Identity = 269/863 (31.17%), Postives = 419/863 (48.55%), Query Frame = 2
Query: 5120 LNDKTQKDIFVCLLHIFHTISSDDLKATICNLTVQERLEFLQLLILSIHHLKYQGRKVINNFESISTGCAKSKIQLRPHGPRSSVTAILDDVDHGD----HKAYLEGNVSTEVGLIVLDVLSAYCSAFKQEILTYTPDHVIFKKIVDIYLTLLSVNQSEIVLKHVFVSMRVFVSTFAKVLFANCHNVISDLSLHTLRFLDTRFTSVRIEACGFLYRMMRSSYDTFNKPGINRVHLQMIVAVSKLDRTV----GIRFKESLNYLKRLAEIEMXXXXXXXXXXXXXGTPTGTSKSITIGVHSTTKLSMQTFFEEVTDLTQRIRTVLMATVQMNEHVDDPEMQVDLQYSLAKSYSSNPALRRTWLEKIYAIHNKNNSRAEMAMCKAHIVAMIVEYLRRKEQ-----------------------YSMSCANFKAISPNIPLEESGMRDDSVQLEVHYTKEEVVKLLRELAHEFDAGCLWEVLRHVYKLVIPIYERKRDYEQLAEIYKHMSDGYNKIKTAESTNQRIIGSYYRVVLYGKP---------------FDSLAGKVFIYRLDSGKQFCVVREELQKLFSKKYGAGKVQMLVEN-HIDRSKLDPELASIQVTHVEPFFNEDEELERHSMFERQYNISKFMLETPFVKMNHVEHESRWKKYKEHDIDGVLKSKQTDDLSIQWKRRTILTVEASFPHLKRRLEVISIKEIDFSPIERAIDEIQLKNRQLAMHLAYXXXXXXXXXXXXXXXXXXXXXVGSSQTRANNIPLLMDMHMSGALLPQVNQGPMAYARVFLHKETQANYSQEKVKQLKIQFMEFLTLCYLLLRDFNELMSHIQQQKYIAMREALDSYRVELSNLINEEI 7567
            L+    K + +C L+I  ++S D L       +  E ++F  +  + +H  +Y G++ I       TG   +++Q    G   +         H D    H++ LE N++TEV L  LD LS +  AFK ++L     + + KK+ D+YL  L  +QSE  LK+VF ++R  +  F    +    ++ + L    L+  +++ +S+R EA   LY +MR+++D   K    R HLQ+I++VS+L   V    G RF++SL+ +   A                               +S   +   +F  +V DLT+RIRTVLMAT QM EH +DPEM VDLQYSLAKSY+S P LR+TWL+ +  IH KN   +E AMC  H+ A++ EYL RKE                        +   C  F+ I+PNI  E S M D  +Q +VH+ ++ +++LL + A        +E++  +YKL+IPIYE++RD+E+LA +Y  +   Y+K+     + +R++G+Y+RV  +G+                F+   GK +IY+         + + L KL+S K+G+  V+M+ ++  ++   LD + A IQVTHV PFF+E E  ER + FER +NI +FM E PF +                        K+   +  Q KRRTILT    FP++K+R+ V+     D +PIE AIDE+  K  +L                              S    + I L   + + G++  QVN GP+AYAR FL       Y   KVK LK  F +F+  C   L     L+   Q +    M+        ELS +++E++
Sbjct: 1294 LDQSEIKSLLMCFLYILKSMSDDALFTYWNKASTSELMDFFTISEVCLHQFQYMGKRYIAR-----TGMMHARLQQL--GSLDNSLTFNHSYGHSDADVLHQSLLEANIATEVCLTALDTLSLFTLAFKNQLLADHGHNPLMKKVFDVYLCFLQKHQSETALKNVFTALRSLIYKFPSTFYEGRADMCAALCYEILKCCNSKLSSIRTEASQLLYFLMRNNFDYTGKKSFVRTHLQVIISVSQLIADVVGIGGTRFQQSLSIINNCA-------------------------------NSDRLIKHTSFSSDVKDLTKRIRTVLMATAQMKEHENDPEMLVDLQYSLAKSYASTPELRKTWLDSMARIHVKNGDLSEAAMCYVHVTALVAEYLTRKEAVQWEPPLLPHSHSACLRRSRGGVFRQGCTAFRVITPNIDEEASMMEDVGMQ-DVHFNEDVLMELLEQCADGLWKAERYELIADIYKLIIPIYEKRRDFERLAHLYDTLHRAYSKVTEVMHSGRRLLGTYFRVAFFGQAAQYQFTDSETDVEGFFEDEDGKEYIYKEPKLTPLSEISQRLLKLYSDKFGSENVKMIQDSGKVNPKDLDSKYAYIQVTHVIPFFDEKELQERKTEFERSHNIRRFMFEMPFTQTG----------------------KRQGGVEEQCKRRTILTAIHCFPYVKKRIPVMYQHHTDLNPIEVAIDEMSKKVAELRQL--------------------------CSSAEVDMIKL--QLKLQGSVSVQVNAGPLAYARAFLDDTNTKRYPDNKVKLLKEVFRQFVEACGQALAVNERLIKEDQLEYQEEMKANYREMAKELSEIMHEQV 2067          

HSP 2 Score: 281.952 bits (720), Expect = 2.915e-75
Identity = 220/752 (29.26%), Postives = 340/752 (45.21%), Query Frame = 2
Query: 2387 PNLDFIHTLYIYPRTLNFSNQNVFHRARNLSCFVELRDVDKSDAPPLKVFYSRPSRKQPAFDYWSNTSVIYHDSSPTFNEEIKIALPLNLHSKHHLLFRFYHVSCDTAAIPNVREKGSNKKS--LETPVGVTWLTLMDQNLNLKSGSFSLPVATQLVPDYLEEKQQSIYYKKDSLWKLSTSFGQPKPRNSSTDKVIDESVNKRHSGPTFKSYINPRSSRDLEDIFSIKSDDVEQSHDTTVQWVDGQKSIFTVVIRPETTIFTQSTHLHKFFQVCSEKLDELTNPTVVEKKESIFTKPRSGSDPTTPKPVSDDTLLLQTSNKDVEIKNAIKALATVNVTNLIKFFAPTFNQLLHVVVCTAISHSEISKTAVTSMITLASSLRTPSMESLSSKATKRNTKIIKSYIKFAFDAEKIVPTKVKRTVHESLIQAISELIRPPFRDTXXXXXXXXXXXXXYSIITKSMIQSLTKQSKITIDKGGDKFFSTSYMDSLQNMIHLIINCILEITSTVGNQSGMNGQLRPNNSFQSLATSANKDLARFISRLFNVMDRGFIFQIIHQYMKIFIARINAYSGHREHLCRMKFDFLEIVTNHEHYLPLNLLKIINPSDKGQSVRKRQAPPSLELILSETYCRQHYLAGLLLQEVHRQMSDVYSHNAVRRLPFVMLRNLLAKHLFDDRYSSINMQARIAALYLPLVSIILENQKSFSLPGNLHTKVNLLNDIYDHSDRSLSARPLST-LSGDTL--STHSSINGS 4627
            P   + + LY+YP+ L + +Q  F +ARN++  +E +D D+ D+ PLK  Y RP    P F   +  +V++H  +P F +EIKI LP  LH KHHLL  F+HVSCD ++      KGS KK   +ET VG +WL L+     + S    +PV+  L   YL  ++  +                                  RH GP  K                               WVDG K +  +     +T++TQ  HLH FFQ C                     K  SG+                      E+   +K+L  +    +I F     NQL  V+  T  +  E++      +I + +      +ES            ++SY+K+A+ AE  V ++ K TVHE L ++++ +++P   D    N  L  S+ F+ ++ KSM Q L + SK+ + +  ++ F  SY  +++ ++++++  I +             + R N      + +AN  LA FI R F  MDRGF+F+ I+ Y+  F        G  + L   KF+FL +V NHEHY+PLNL     P   G+   +R     L+  L++ +CR H+L GLLL+EV   + +      VR +   +L+NLL KH FDDRY+S + QARIA LYLPL  +++EN +  ++       VN    + D S    +  PL T   G TL  S H  + G+
Sbjct:  634 PYTIYTNHLYVYPKYLKYDSQKSFAKARNIAICIEFKDSDEEDSQPLKCIYGRPG--GPVFTRSAFAAVLHHHQNPEFYDEIKIELPTQLHEKHHLLLTFFHVSCDNSS------KGSTKKRDVVETQVGYSWLPLLKDGRVVTSEQ-HIPVSANLPSGYLGYQELGM---------------------------------GRHYGPEIK-------------------------------WVDGGKPLLKISTHLVSTVYTQDQHLHNFFQYCQ--------------------KTESGAQALGN-----------------ELVKYLKSLHAMEGHVMIAFLPTILNQLFRVL--TRATQEEVAVNVTRVIIHVVAQCHEEGLESH-----------LRSYVKYAYKAEPYVASEYK-TVHEELTKSMTTILKPS-ADFLTSNKLLKYSWFFFDVLIKSMAQHLIENSKVKLLR--NQRFPASYHHAVETVVNMLMPHITQ-------------KFRDN---PEASKNANHSLAVFIKRCFTFMDRGFVFKQINNYISCFAP------GDPKTLFEYKFEFLRVVCNHEHYIPLNL-----PMPFGKGRIQRYQDLQLDYSLTDEFCRNHFLVGLLLREVGTALQEF---REVRLIAISVLKNLLIKHSFDDRYASRSHQARIATLYLPLFGLLIENVQRINVRDVSPFPVNAGMTVKDESLALPAVNPLVTPQKGSTLDNSLHKDLLGA 1228          

HSP 3 Score: 68.9366 bits (167), Expect = 1.680e-10
Identity = 54/203 (26.60%), Postives = 82/203 (40.39%), Query Frame = 2
Query: 1265 EPFFISFSLFHIADGRRISEEFYWNPNRPQIEDLLPSDLFAYKFGGHPVHATINGNCDNRTPLNLPTMSDRVLQSTNSFILKVPCLPDKICLFIKSEKVFSGAIGPTVDKYIKSGGSLLKKKDREEELFVENPDVKTGASINKTMSVYCANIGHYRMPFGWTACRLNIKGKNCL----RF---HKYENNKTSEDDIIKLVQNM 1852
            EPFF++ SLF I   R+IS +F+ + N   +  +L +   A   G     + + G            + +  +Q     I  V C    I L  + EKV  G+I    + Y+KS  S                  K    + K     C  +G YRMPF W A  L       L    RF   ++ ++NK S DD++KL+ + 
Sbjct:  394 EPFFVTLSLFDIKYNRKISADFHVDLNHFSVRQMLATTSPALMNGSGQSPSVLKG-----------ILHEAAMQYPKQGIFSVTCPHPDIFLVARIEKVLQGSITHCAEPYMKSSDS-----------------SKVAQKVLKNAKQACQRLGQYRMPFAWAARTLFKDASGNLDKNARFSAIYRQDSNKLSNDDMLKLLADF 568          
BLAST of Dedicator of cytokinesis vs. Ensembl Celegans
Match: F46H5.4 (pep chromosome:WBcel235:X:7245057:7254612:-1 gene:WBGene00018520.1 transcript:F46H5.4.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F46H5.4)

HSP 1 Score: 239.195 bits (609), Expect = 1.276e-62
Identity = 221/903 (24.47%), Postives = 400/903 (44.30%), Query Frame = 2
Query: 5063 ASILNKASNKNHETKSSIYLNDKTQKDIFVCLLHIFHTISSDDLKATICNLTVQERLEFLQLLILSIHHLKYQGRKVINNFESISTGCAK-------SKIQLRPHGPRSSVTAILDDVDHGDHKAYLEG-----NVSTEVGLIVLDVLSAYCSAFKQEILTYTPDHV---IFKKIVDIYLTLLSVNQSEIVLKHVFVSMRVFVSTFAKVLFANCHNVISDLSLHTLRFLD-TRFTSVRIEACGFLYRMMRSSYDTFNKPGINRVHLQMIVAVSKLDRTVGIRFKESLNYLKRLAEIEMXXXXXXXXXXXXXGTPTGTSKSITIGVHSTTKLSMQTFFEEVTDLTQRIRTVLMATVQMNEHVDDPEMQVDLQYSLAKSYSSNPALRRTWLEKIYAIHNKNNSRAEMAMCKAHIVAMIVEYLRRKEQ----YSMSCANFKAISPNIPLEESGMRDDSVQ--------LEVHYTKEEVVKLLRELAHEFDAGCLWEVLRHVYKLVIPIYERKRDYEQLAEIYKHMSDGYNKIK-TAE--------------STNQRIIGSYYRVVLYGKPFDSLAGKVFIYRLDSGKQFCVVREELQKLFSKKYGAGKVQMLVENH-IDRSKLDPELASIQVTHVEPFFNEDEELERHSMFERQYNISKFMLETPFVKMNHVEHESRWKKYKEHDIDGVLKSKQTDDLSIQWKRRTILTVEASFPHLKRRLEVISIKEIDFSPIERAIDEIQLKNRQLAMHLAYXXXXXXXXXXXXXXXXXXXXXVGSSQTRANNIPLLMDMHMSGALLPQVNQGPMAYARVFL------HKETQANYSQEKV----KQLKIQFMEFLTLCYLLLRDFNELMSHIQQQKYIAMREALDSYRVELSNLINEE-----ICVFEDISVI 7594
            A+I  K  N    T     ++    K I  C+  +   I  +DLK  I +L  +  L+ L +L  ++   + +            T   K        +++ R     +  T +       D  + LE       VS EV + V++V+    +      +   P +    I   I  I +  LS N S+ VL+ +F + + F++ F  ++      + ++LS   LR    TR  +VR  A   LY  +R ++  +      R  L   ++ + L  + GI    +  ++ R  EI  Q                  ++  T  + +  KL+     E++ +LT  ++ ++++TV+M EHV+D EM +DL Y L + YS+NP LR TWL  +   H K  +  E A       A++ EY+ +K+Q     S   A F  I+PN  ++ES    +S++           H+T+  V+K+L +     +   L+E+L    K+++  Y   + Y +++  +K +    ++IK T E                ++R  GS++RV  YGK F +L    F+Y+  +  +   +   L+  ++  YG G V +L ++  +   KL+PE A IQ+T V+ + +++E++ER + F R+ N+++F  E P+                       ++ +   +L+ Q+K+RTILTVE SFP++K RL+V++    DFSPIE AI++I+ K R+L                             S+  +  N P ++ M + G++   VNQGP+  A VFL       +    +  Q K+    + L+ + ME + LC        +L+   Q++    + E  +S+   L  +++ +     I  F D +V+
Sbjct: 1211 AAIAGKLRNSPDPTFGKQQMDLPMTKTILCCVFWVLRNIDREDLKHWIRSLDNENMLKMLHILFHTMTSFEIKDDPASARRSPDKTSLTKLDEEPEPGQVKWRAQSSETCETKV-------DQISTLEALSSDAIVSCEVFMCVIEVVDNIIA------VATDPKNAQFHILPMIFPIIMHGLSCNASDQVLEVIFAAQQNFLAKFPDMILEQNPELCAELSQQILRHCSSTRLENVRTMATVSLYHFLRENFKLYRNLTRARTFLSTALS-TLLSGSCGIDIFVNDEFMIRSLEIANQL----------------AAEDDTFDIAAKKKLT-----EQMQELTANLQKIMLSTVRMREHVNDYEMTIDLMYQLVEGYSNNPDLRITWLLNMAERHEKQRNLCEAAHSYLQASALVFEYIAQKDQNLSFESKGAATFSEITPN-AIKESKTNFNSLKNADSENHIQSYHFTEAGVIKILEKAFALLEKAQLYELLFPFSKIILKYYHATKSYSRVSHTHKRLGIAADQIKETGEYYENQSDAWISPLPGIDKRCFGSFFRVAFYGKLFGALNNAEFVYKESAFSKLNEISNRLETFYTNMYGEGNVVVLKDSKPVQLEKLNPEKAYIQITFVDVYLSDNEKMERTTYFTRRNNVNRFYFEAPY----------------------TMEGRAQGELAAQYKKRTILTVENSFPYIKTRLQVVNRSVKDFSPIEVAIEDIEKKTREL-----------------------------SAAAQHKN-PKMLSMFIQGSIGTTVNQGPLEIANVFLANAMLDDRGRPVDRLQNKLRLSFRHLQCKAMEAIELC-------RQLIGEDQKEYQRNVEENFESFVTHLKPMLSRQRNEITISEFSDPTVV 2018          

HSP 2 Score: 99.3673 bits (246), Expect = 3.854e-20
Identity = 64/192 (33.33%), Postives = 102/192 (53.12%), Query Frame = 2
Query: 2306 SSQHKSFDYSDHDINYY---ENINQEELVAP------NLDFIHTLYIYPRTLNFSNQNVFHRARNLSCFVELRDVDKSDAPPLKVFYSRPSRKQPAFDYWSNTSVIYHDSSPTFNEEIKIALPLNLHSKHHLLFRFYHVSCDTAAIPNVREKGSNKKSLETPVGVTWLTLMDQNLNLKSGSFSLPVATQLVP 2854
            +  +KS +Y  H  N     E +  E +  P      N  + + +++YP+ +N SN+     ARN+   +EL D +++     +V +   S +  +F   + TSVIYH+ +P F +EIK++LP +L+  HHLLF  YH+SC          K  +  S E+P+G TWL L  +N  L+SG+F LPV  +  P
Sbjct:  549 AGSNKSKEYQSHGSNLTLNSERVIHEAMEIPIYQASLNKSYKNVIFVYPKHINLSNRT--GNARNIMIKIELMDANETAQ---EVVFENGSTRM-SFLTSAKTSVIYHNRTPHFTDEIKLSLPCDLNDGHHLLFTVYHISC----------KEGDSSSTESPIGYTWLPLY-RNGKLRSGNFHLPVCGEKPP 723          

HSP 3 Score: 73.1738 bits (178), Expect = 3.085e-12
Identity = 51/180 (28.33%), Postives = 88/180 (48.89%), Query Frame = 2
Query: 3983 LARFISRLFNVMDRGFIFQIIHQYMKIFIARINAYSGHREHLCRMKFDFLEIVTNHEHYLPLNLLKIINPSD--KGQSVRKRQAPPSLEL-------------ILSETYCRQHYLAGLLLQEVHRQMSDVYSHNAVRRLPFVMLRNLLAKHLFDDRYSSINMQARIAALYLPLVSIILEN 4477
            L  F+   F++MDR F+ +++H+Y+  F   +     H   L  +K DF+ +V ++EHYL +N+L  + PS    G +V     PP+  L              L++     HYL+G +L ++   +    +    + +  V  + LL  H  DDR       A++A +Y PLV+I+L+N
Sbjct: 1008 LGYFLRDCFSIMDRTFVMKLVHKYLIAFAESMRKLV-HSNELLSIKIDFVRVVCSYEHYLIVNILSDLKPSGNTNGGAV-----PPASFLSGNRTKSSSLTSWTLNDISRSTHYLSGQVLSDMKDSIISGKTTLCAKAIETV--KELLQSHDLDDRIVEGESLAQVANIYKPLVTIVLDN 1179          
BLAST of Dedicator of cytokinesis vs. Ensembl Celegans
Match: F46H5.4 (pep chromosome:WBcel235:X:7245079:7254792:-1 gene:WBGene00018520.1 transcript:F46H5.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F46H5.4)

HSP 1 Score: 239.195 bits (609), Expect = 1.276e-62
Identity = 221/903 (24.47%), Postives = 400/903 (44.30%), Query Frame = 2
Query: 5063 ASILNKASNKNHETKSSIYLNDKTQKDIFVCLLHIFHTISSDDLKATICNLTVQERLEFLQLLILSIHHLKYQGRKVINNFESISTGCAK-------SKIQLRPHGPRSSVTAILDDVDHGDHKAYLEG-----NVSTEVGLIVLDVLSAYCSAFKQEILTYTPDHV---IFKKIVDIYLTLLSVNQSEIVLKHVFVSMRVFVSTFAKVLFANCHNVISDLSLHTLRFLD-TRFTSVRIEACGFLYRMMRSSYDTFNKPGINRVHLQMIVAVSKLDRTVGIRFKESLNYLKRLAEIEMXXXXXXXXXXXXXGTPTGTSKSITIGVHSTTKLSMQTFFEEVTDLTQRIRTVLMATVQMNEHVDDPEMQVDLQYSLAKSYSSNPALRRTWLEKIYAIHNKNNSRAEMAMCKAHIVAMIVEYLRRKEQ----YSMSCANFKAISPNIPLEESGMRDDSVQ--------LEVHYTKEEVVKLLRELAHEFDAGCLWEVLRHVYKLVIPIYERKRDYEQLAEIYKHMSDGYNKIK-TAE--------------STNQRIIGSYYRVVLYGKPFDSLAGKVFIYRLDSGKQFCVVREELQKLFSKKYGAGKVQMLVENH-IDRSKLDPELASIQVTHVEPFFNEDEELERHSMFERQYNISKFMLETPFVKMNHVEHESRWKKYKEHDIDGVLKSKQTDDLSIQWKRRTILTVEASFPHLKRRLEVISIKEIDFSPIERAIDEIQLKNRQLAMHLAYXXXXXXXXXXXXXXXXXXXXXVGSSQTRANNIPLLMDMHMSGALLPQVNQGPMAYARVFL------HKETQANYSQEKV----KQLKIQFMEFLTLCYLLLRDFNELMSHIQQQKYIAMREALDSYRVELSNLINEE-----ICVFEDISVI 7594
            A+I  K  N    T     ++    K I  C+  +   I  +DLK  I +L  +  L+ L +L  ++   + +            T   K        +++ R     +  T +       D  + LE       VS EV + V++V+    +      +   P +    I   I  I +  LS N S+ VL+ +F + + F++ F  ++      + ++LS   LR    TR  +VR  A   LY  +R ++  +      R  L   ++ + L  + GI    +  ++ R  EI  Q                  ++  T  + +  KL+     E++ +LT  ++ ++++TV+M EHV+D EM +DL Y L + YS+NP LR TWL  +   H K  +  E A       A++ EY+ +K+Q     S   A F  I+PN  ++ES    +S++           H+T+  V+K+L +     +   L+E+L    K+++  Y   + Y +++  +K +    ++IK T E                ++R  GS++RV  YGK F +L    F+Y+  +  +   +   L+  ++  YG G V +L ++  +   KL+PE A IQ+T V+ + +++E++ER + F R+ N+++F  E P+                       ++ +   +L+ Q+K+RTILTVE SFP++K RL+V++    DFSPIE AI++I+ K R+L                             S+  +  N P ++ M + G++   VNQGP+  A VFL       +    +  Q K+    + L+ + ME + LC        +L+   Q++    + E  +S+   L  +++ +     I  F D +V+
Sbjct: 1211 AAIAGKLRNSPDPTFGKQQMDLPMTKTILCCVFWVLRNIDREDLKHWIRSLDNENMLKMLHILFHTMTSFEIKDDPASARRSPDKTSLTKLDEEPEPGQVKWRAQSSETCETKV-------DQISTLEALSSDAIVSCEVFMCVIEVVDNIIA------VATDPKNAQFHILPMIFPIIMHGLSCNASDQVLEVIFAAQQNFLAKFPDMILEQNPELCAELSQQILRHCSSTRLENVRTMATVSLYHFLRENFKLYRNLTRARTFLSTALS-TLLSGSCGIDIFVNDEFMIRSLEIANQL----------------AAEDDTFDIAAKKKLT-----EQMQELTANLQKIMLSTVRMREHVNDYEMTIDLMYQLVEGYSNNPDLRITWLLNMAERHEKQRNLCEAAHSYLQASALVFEYIAQKDQNLSFESKGAATFSEITPN-AIKESKTNFNSLKNADSENHIQSYHFTEAGVIKILEKAFALLEKAQLYELLFPFSKIILKYYHATKSYSRVSHTHKRLGIAADQIKETGEYYENQSDAWISPLPGIDKRCFGSFFRVAFYGKLFGALNNAEFVYKESAFSKLNEISNRLETFYTNMYGEGNVVVLKDSKPVQLEKLNPEKAYIQITFVDVYLSDNEKMERTTYFTRRNNVNRFYFEAPY----------------------TMEGRAQGELAAQYKKRTILTVENSFPYIKTRLQVVNRSVKDFSPIEVAIEDIEKKTREL-----------------------------SAAAQHKN-PKMLSMFIQGSIGTTVNQGPLEIANVFLANAMLDDRGRPVDRLQNKLRLSFRHLQCKAMEAIELC-------RQLIGEDQKEYQRNVEENFESFVTHLKPMLSRQRNEITISEFSDPTVV 2018          

HSP 2 Score: 99.3673 bits (246), Expect = 3.854e-20
Identity = 64/192 (33.33%), Postives = 102/192 (53.12%), Query Frame = 2
Query: 2306 SSQHKSFDYSDHDINYY---ENINQEELVAP------NLDFIHTLYIYPRTLNFSNQNVFHRARNLSCFVELRDVDKSDAPPLKVFYSRPSRKQPAFDYWSNTSVIYHDSSPTFNEEIKIALPLNLHSKHHLLFRFYHVSCDTAAIPNVREKGSNKKSLETPVGVTWLTLMDQNLNLKSGSFSLPVATQLVP 2854
            +  +KS +Y  H  N     E +  E +  P      N  + + +++YP+ +N SN+     ARN+   +EL D +++     +V +   S +  +F   + TSVIYH+ +P F +EIK++LP +L+  HHLLF  YH+SC          K  +  S E+P+G TWL L  +N  L+SG+F LPV  +  P
Sbjct:  549 AGSNKSKEYQSHGSNLTLNSERVIHEAMEIPIYQASLNKSYKNVIFVYPKHINLSNRT--GNARNIMIKIELMDANETAQ---EVVFENGSTRM-SFLTSAKTSVIYHNRTPHFTDEIKLSLPCDLNDGHHLLFTVYHISC----------KEGDSSSTESPIGYTWLPLY-RNGKLRSGNFHLPVCGEKPP 723          

HSP 3 Score: 73.1738 bits (178), Expect = 3.085e-12
Identity = 51/180 (28.33%), Postives = 88/180 (48.89%), Query Frame = 2
Query: 3983 LARFISRLFNVMDRGFIFQIIHQYMKIFIARINAYSGHREHLCRMKFDFLEIVTNHEHYLPLNLLKIINPSD--KGQSVRKRQAPPSLEL-------------ILSETYCRQHYLAGLLLQEVHRQMSDVYSHNAVRRLPFVMLRNLLAKHLFDDRYSSINMQARIAALYLPLVSIILEN 4477
            L  F+   F++MDR F+ +++H+Y+  F   +     H   L  +K DF+ +V ++EHYL +N+L  + PS    G +V     PP+  L              L++     HYL+G +L ++   +    +    + +  V  + LL  H  DDR       A++A +Y PLV+I+L+N
Sbjct: 1008 LGYFLRDCFSIMDRTFVMKLVHKYLIAFAESMRKLV-HSNELLSIKIDFVRVVCSYEHYLIVNILSDLKPSGNTNGGAV-----PPASFLSGNRTKSSSLTSWTLNDISRSTHYLSGQVLSDMKDSIISGKTTLCAKAIETV--KELLQSHDLDDRIVEGESLAQVANIYKPLVTIVLDN 1179          
BLAST of Dedicator of cytokinesis vs. Ensembl Celegans
Match: F22G12.5 (pep chromosome:WBcel235:I:13162492:13182725:1 gene:WBGene00009065.1 transcript:F22G12.5c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F22G12.5)

HSP 1 Score: 172.555 bits (436), Expect = 2.303e-42
Identity = 183/747 (24.50%), Postives = 310/747 (41.50%), Query Frame = 2
Query: 5429 NVSTEVGLIVLDVLSAYCS--AFKQEILTYTPDHVIFKKIVDIYLTLLSVNQSEIVLKHVFVSMRVFVSTFAKVLF-ANCHNVISDLSLHTLRFLDTRFTSVRIEACGFLYRMMRSSYDTFNKPGINRVHLQMIV-AVSKLDRTVGIRFKESLNYLKRLAEIEMXXXXXXXXXXXXXGTPTGTSKSITIGVHSTTKLSMQTFFEE--------------------VTDLTQRIRTVLMATVQMNEHVDDPEMQVDLQYSLAKSYSSNPALRRTWLEKIYAIHNKNNSRAEMAMCKAHIVAMIVEYLRRKEQYSMSCANFKAISPNIPLEESGMRDDSVQLE-VHYTKEEVVKLLRELAHEFDAGCLWEVLRHVYKLVIPIYERKRDYEQLAEIYKHMSDGYNKIKTAESTNQRIIGSYYRVVLYG-KPFDSLAGKVFIYRLDSGKQFCVVREELQKLFSKKYGAGKVQMLVENHIDRSKLDPELASIQVTHVEPFFNEDEEL--ERHSMFERQYNISKFMLETPFVKMNHVEHESRWKKYKEHDIDGVLKSKQTDDLSIQWKRRTILTVEAS-----------FPHLKRRLEVISIKEIDFSPIERAIDEIQLKNRQLAMHLAYXXXXXXXXXXXXXXXXXXXXXVGSSQTRANNIPLLMDMHMSGALLPQVNQGPMAYARVFLHKETQANYSQEKVKQLKIQFMEFLTLCYLLLRDFNELMSHIQQ-------QKYIAMREALDSY 7531
            N+S EV LIVLDV   +    A  Q          +F  ++ ++L L   + SE V  HV   + +FV+ F   LF       +  L    L  + +R  +V+  A   L  ++R+ Y+       ++V  Q +  + SK+++    R   S   L R                   G+ TG + +  +G  S   LS    FE                     V DL +++R V+ ATV + +  +DP    DL   LA SY  + ALR  W + +  I+ ++   AE ++C AH VA+I   L  +++  +    F  I+  I   E     D+  ++   +T + +   + + A        +E +  +Y+L++P+ E+  ++  L  +Y  +   Y++     S+ +R +G+Y+RV   G + F S     +IYR            E+++   ++ G  +VQ+     +D SK+DP +A +Q+THVEP       +  +  + F    N+S+F  E   +       E+  K  KE  I              Q  +RT+L V  S           FP  +RRL VIS+    FSP+E A  ++  K  Q+   L                         +S  R  ++  L  + + GA+LP VN GP+AYA VF  +E +  Y  + + +L+  F   +  C L +      +   QQ         + AM E L ++
Sbjct: 1621 NLSQEVALIVLDVAQTFAHQLASSQRHRHCPQSDALFHSLLALHLRLADEHWSETVRLHVIAGLALFVNLFRARLFEGGPLEPLYMLIEKVLIQMASRLPAVQAAAAALLQLILRNGYEVAQGYFASQVLAQSVSPSSSKINQQAATRKGVSSERLGR------------------PGSQTGVALARLLGFQSV--LSNSAAFERGLAAVEALVDTRKATSFDLAVLDLLRQLRGVMTATVALKDAANDPIRLADLHLQLADSYRGSAALRSAWFDTLAEIYEQDRWFAEASVCHAHSVAIIARELEERKELEVDWRVFDWINNRIAETEQSQGGDAGSVQPAGFTTDNLGAKIDKTAAALMLAERFEAVGPLYRLIVPVLEKNMNFTSLVSVYAELQQTYSRAAEVRSSGKRHLGAYFRVRFNGERHFGSEHNTDWIYREAGLTSLAAFALEIKEKCQRQVGHDRVQIEANEQLDLSKIDPTVAYVQITHVEPSIPAAAGIADQHRNDFLVHTNLSEFSYECATI-------ENERKVSKEPAIHE------------QCLKRTVLRVSPSPVSEDSRAATGFPATRRRLPVISVHFEQFSPLEFACQKLNTKAEQIRKTLN-----------------------AASNGRQLDVKGL-QLLLQGAVLPTVNAGPLAYAEVFTKEEQRERYGDDGLVKLRESFRNLMNSCQLAIEANASAIGSDQQTYHEVLVSSFDAMHERLQTF 2304          

HSP 2 Score: 151.754 bits (382), Expect = 5.551e-36
Identity = 184/765 (24.05%), Postives = 303/765 (39.61%), Query Frame = 2
Query: 2387 PNLDFIHTLYIYPRTLNFSNQNVFHRARNLSCFVELRDVDKSDAPPLKVFYSRPSRKQPAFDYWSNTSVIYHDSSPTFNEEIKIALPLNLHSKHHLLFRFYHVSCDTAAIPNVREKGSNKKSLETPVGVTWLTLMDQNLNLK-SGSFSLPVATQLVPDYLEEKQQSIYYKKDSLWKLS--TSFGQPKPRNSSTDKVIDESVNKRHSGPTFKSYINPRSSRDLEDIFSIKSDDVEQSHDTTVQWVDGQKSIFTVVIRPETTIFTQSTHLHKFFQVC------------SEKLDELTNPTVVEKKESIFTKPRSGSDPTTPKPVSDD---TLLLQTSNKDVEIKN---AIKALATVNVTNLIKFFAPTFNQLLHVVVCTAISHSEISKTAVTSMITLASSLRTPSMESLSSKATKRNT--KIIKSYIKFAFDAEKIVPTKVKRTVHESLIQAISELIRPPFRDTXXXXXXXXXXXXXYSIITKSMIQSLTKQSKITIDKGGDKFFSTSYMDSLQNMIHLIINCILEITSTVGNQSGMNGQLRPNNSFQSLATSANKDLARFISRLFNVMDRGFIFQIIHQYMKIFIARINA--YSGHREHLCRMKFDFLEIVTNHEHYLPLNLLKIINPSDKGQSVR---------------------------------------KRQAPPSLELILSETYCRQHYLAGLLLQEVHRQMSDVYSHNAVRRLPFVMLRNLLAKHLFDDRYSSINMQARIAALYLPLVSIILENQKSF 4489
            P+    + LYIYP  L + +Q  F +ARN+SC V  R V   +A P K    R S   P +   S  +V +H  +P F EE+K  LPLNL +  HLLF F H+S                              +  N NLK S S   P+    +P         + +KKD L   +    F  P          ID   N   S PT                   K D+      + V+WVD QK +F V +R  +++FT    L  FFQ C            ++ L  +           +   PRS S      P++D    +  L+  +++  +K+   +I+ L+ V    L+ +      +L  ++             A T  + +A+     S+  +  +  K     + +KS+   +   E+ V  +   T++ ++ + +  L+R    +   +       ++    + KSM Q++  +          +   TS  D     I   +  +LE+        G+   +  +   +  +  AN  LA F     + +DRG +F+ IH Y    I+R++   Y   R++    K D LEI+  HEH++PLNL  +IN + + Q +                                         R A  S E  LS  + + H++ GLL+QE+   ++ +      R+ P  +LRNLLAKH FD RY  + +Q RIA LY P+++  L++   F
Sbjct:  754 PHTSLTNLLYIYPLALKYDSQKAFSKARNISCTV--RFVRGEEAIPEKAMVDRMSAAGP-YCISSTCAVQHHQQNPVFGEEMKAQLPLNLTTSDHLLFSFSHIS------------------------------VAGNSNLKASESTETPIGYSWLP---------LVWKKDRLVMENDEQEFALPV--------AIDLPPNYYRSKPTGMG----------------KGDETL----SEVRWVD-QKPLFRVRLRLVSSVFTTDAKLQTFFQACDRLSAKGIIGDAADSLKRMVKSKSSSPPSDLLHHPRSCS------PIADSLQRSHSLEDPDQNPHMKHLLQSIRLLSDVPFDRLLVYLPIVLGRLFAIL-----------PQAPTEQLAIATLRSIISICDMCCQNGKPQVVRRFVKSHFSDSVAREQFVSHET--TIYSAICRHLPTLMRELQSEPEQLAQLYLQLWVLTDAVIKSMAQTMCSE----------QLNKTSQRDRFPQEILEQMGQVLEV--------GVPQIVLKHKEMREESRCANLALAYFTRFAMSFVDRGVVFRWIHFY----ISRLDDTDYRALRDY----KTDLLEILCLHEHHVPLNLPVLINAAAQIQRLNYSGGVVDTQMQTTNASGSGFLSRFFNQIFNTPTLETNETDRYASCSGEWHLSPAFAQNHFIVGLLMQEL---VACIRETKDYRKRPISLLRNLLAKHSFDKRYGDMTIQRRIAMLYAPVLTFALDHLHEF 1399          
BLAST of Dedicator of cytokinesis vs. Ensembl Celegans
Match: F22G12.5 (pep chromosome:WBcel235:I:13162499:13182659:1 gene:WBGene00009065.1 transcript:F22G12.5a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F22G12.5)

HSP 1 Score: 172.555 bits (436), Expect = 2.421e-42
Identity = 183/747 (24.50%), Postives = 310/747 (41.50%), Query Frame = 2
Query: 5429 NVSTEVGLIVLDVLSAYCS--AFKQEILTYTPDHVIFKKIVDIYLTLLSVNQSEIVLKHVFVSMRVFVSTFAKVLF-ANCHNVISDLSLHTLRFLDTRFTSVRIEACGFLYRMMRSSYDTFNKPGINRVHLQMIV-AVSKLDRTVGIRFKESLNYLKRLAEIEMXXXXXXXXXXXXXGTPTGTSKSITIGVHSTTKLSMQTFFEE--------------------VTDLTQRIRTVLMATVQMNEHVDDPEMQVDLQYSLAKSYSSNPALRRTWLEKIYAIHNKNNSRAEMAMCKAHIVAMIVEYLRRKEQYSMSCANFKAISPNIPLEESGMRDDSVQLE-VHYTKEEVVKLLRELAHEFDAGCLWEVLRHVYKLVIPIYERKRDYEQLAEIYKHMSDGYNKIKTAESTNQRIIGSYYRVVLYG-KPFDSLAGKVFIYRLDSGKQFCVVREELQKLFSKKYGAGKVQMLVENHIDRSKLDPELASIQVTHVEPFFNEDEEL--ERHSMFERQYNISKFMLETPFVKMNHVEHESRWKKYKEHDIDGVLKSKQTDDLSIQWKRRTILTVEAS-----------FPHLKRRLEVISIKEIDFSPIERAIDEIQLKNRQLAMHLAYXXXXXXXXXXXXXXXXXXXXXVGSSQTRANNIPLLMDMHMSGALLPQVNQGPMAYARVFLHKETQANYSQEKVKQLKIQFMEFLTLCYLLLRDFNELMSHIQQ-------QKYIAMREALDSY 7531
            N+S EV LIVLDV   +    A  Q          +F  ++ ++L L   + SE V  HV   + +FV+ F   LF       +  L    L  + +R  +V+  A   L  ++R+ Y+       ++V  Q +  + SK+++    R   S   L R                   G+ TG + +  +G  S   LS    FE                     V DL +++R V+ ATV + +  +DP    DL   LA SY  + ALR  W + +  I+ ++   AE ++C AH VA+I   L  +++  +    F  I+  I   E     D+  ++   +T + +   + + A        +E +  +Y+L++P+ E+  ++  L  +Y  +   Y++     S+ +R +G+Y+RV   G + F S     +IYR            E+++   ++ G  +VQ+     +D SK+DP +A +Q+THVEP       +  +  + F    N+S+F  E   +       E+  K  KE  I              Q  +RT+L V  S           FP  +RRL VIS+    FSP+E A  ++  K  Q+   L                         +S  R  ++  L  + + GA+LP VN GP+AYA VF  +E +  Y  + + +L+  F   +  C L +      +   QQ         + AM E L ++
Sbjct: 1619 NLSQEVALIVLDVAQTFAHQLASSQRHRHCPQSDALFHSLLALHLRLADEHWSETVRLHVIAGLALFVNLFRARLFEGGPLEPLYMLIEKVLIQMASRLPAVQAAAAALLQLILRNGYEVAQGYFASQVLAQSVSPSSSKINQQAATRKGVSSERLGR------------------PGSQTGVALARLLGFQSV--LSNSAAFERGLAAVEALVDTRKATSFDLAVLDLLRQLRGVMTATVALKDAANDPIRLADLHLQLADSYRGSAALRSAWFDTLAEIYEQDRWFAEASVCHAHSVAIIARELEERKELEVDWRVFDWINNRIAETEQSQGGDAGSVQPAGFTTDNLGAKIDKTAAALMLAERFEAVGPLYRLIVPVLEKNMNFTSLVSVYAELQQTYSRAAEVRSSGKRHLGAYFRVRFNGERHFGSEHNTDWIYREAGLTSLAAFALEIKEKCQRQVGHDRVQIEANEQLDLSKIDPTVAYVQITHVEPSIPAAAGIADQHRNDFLVHTNLSEFSYECATI-------ENERKVSKEPAIHE------------QCLKRTVLRVSPSPVSEDSRAATGFPATRRRLPVISVHFEQFSPLEFACQKLNTKAEQIRKTLN-----------------------AASNGRQLDVKGL-QLLLQGAVLPTVNAGPLAYAEVFTKEEQRERYGDDGLVKLRESFRNLMNSCQLAIEANASAIGSDQQTYHEVLVSSFDAMHERLQTF 2302          

HSP 2 Score: 151.369 bits (381), Expect = 5.836e-36
Identity = 184/765 (24.05%), Postives = 303/765 (39.61%), Query Frame = 2
Query: 2387 PNLDFIHTLYIYPRTLNFSNQNVFHRARNLSCFVELRDVDKSDAPPLKVFYSRPSRKQPAFDYWSNTSVIYHDSSPTFNEEIKIALPLNLHSKHHLLFRFYHVSCDTAAIPNVREKGSNKKSLETPVGVTWLTLMDQNLNLK-SGSFSLPVATQLVPDYLEEKQQSIYYKKDSLWKLS--TSFGQPKPRNSSTDKVIDESVNKRHSGPTFKSYINPRSSRDLEDIFSIKSDDVEQSHDTTVQWVDGQKSIFTVVIRPETTIFTQSTHLHKFFQVC------------SEKLDELTNPTVVEKKESIFTKPRSGSDPTTPKPVSDD---TLLLQTSNKDVEIKN---AIKALATVNVTNLIKFFAPTFNQLLHVVVCTAISHSEISKTAVTSMITLASSLRTPSMESLSSKATKRNT--KIIKSYIKFAFDAEKIVPTKVKRTVHESLIQAISELIRPPFRDTXXXXXXXXXXXXXYSIITKSMIQSLTKQSKITIDKGGDKFFSTSYMDSLQNMIHLIINCILEITSTVGNQSGMNGQLRPNNSFQSLATSANKDLARFISRLFNVMDRGFIFQIIHQYMKIFIARINA--YSGHREHLCRMKFDFLEIVTNHEHYLPLNLLKIINPSDKGQSVR---------------------------------------KRQAPPSLELILSETYCRQHYLAGLLLQEVHRQMSDVYSHNAVRRLPFVMLRNLLAKHLFDDRYSSINMQARIAALYLPLVSIILENQKSF 4489
            P+    + LYIYP  L + +Q  F +ARN+SC V  R V   +A P K    R S   P +   S  +V +H  +P F EE+K  LPLNL +  HLLF F H+S                              +  N NLK S S   P+    +P         + +KKD L   +    F  P          ID   N   S PT                   K D+      + V+WVD QK +F V +R  +++FT    L  FFQ C            ++ L  +           +   PRS S      P++D    +  L+  +++  +K+   +I+ L+ V    L+ +      +L  ++             A T  + +A+     S+  +  +  K     + +KS+   +   E+ V  +   T++ ++ + +  L+R    +   +       ++    + KSM Q++  +          +   TS  D     I   +  +LE+        G+   +  +   +  +  AN  LA F     + +DRG +F+ IH Y    I+R++   Y   R++    K D LEI+  HEH++PLNL  +IN + + Q +                                         R A  S E  LS  + + H++ GLL+QE+   ++ +      R+ P  +LRNLLAKH FD RY  + +Q RIA LY P+++  L++   F
Sbjct:  752 PHTSLTNLLYIYPLALKYDSQKAFSKARNISCTV--RFVRGEEAIPEKAMVDRMSAAGP-YCISSTCAVQHHQQNPVFGEEMKAQLPLNLTTSDHLLFSFSHIS------------------------------VAGNSNLKASESTETPIGYSWLP---------LVWKKDRLVMENDEQEFALPV--------AIDLPPNYYRSKPTGMG----------------KGDETL----SEVRWVD-QKPLFRVRLRLVSSVFTTDAKLQTFFQACDRLSAKGIIGDAADSLKRMVKSKSSSPPSDLLHHPRSCS------PIADSLQRSHSLEDPDQNPHMKHLLQSIRLLSDVPFDRLLVYLPIVLGRLFAIL-----------PQAPTEQLAIATLRSIISICDMCCQNGKPQVVRRFVKSHFSDSVAREQFVSHET--TIYSAICRHLPTLMRELQSEPEQLAQLYLQLWVLTDAVIKSMAQTMCSE----------QLNKTSQRDRFPQEILEQMGQVLEV--------GVPQIVLKHKEMREESRCANLALAYFTRFAMSFVDRGVVFRWIHFY----ISRLDDTDYRALRDY----KTDLLEILCLHEHHVPLNLPVLINAAAQIQRLNYSGGVVDTQMQTTNASGSGFLSRFFNQIFNTPTLETNETDRYASCSGEWHLSPAFAQNHFIVGLLMQEL---VACIRETKDYRKRPISLLRNLLAKHSFDKRYGDMTIQRRIAMLYAPVLTFALDHLHEF 1397          
BLAST of Dedicator of cytokinesis vs. Ensembl Celegans
Match: F22G12.5 (pep chromosome:WBcel235:I:13171598:13182659:1 gene:WBGene00009065.1 transcript:F22G12.5b.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F22G12.5)

HSP 1 Score: 169.474 bits (428), Expect = 1.168e-41
Identity = 183/747 (24.50%), Postives = 310/747 (41.50%), Query Frame = 2
Query: 5429 NVSTEVGLIVLDVLSAYCS--AFKQEILTYTPDHVIFKKIVDIYLTLLSVNQSEIVLKHVFVSMRVFVSTFAKVLF-ANCHNVISDLSLHTLRFLDTRFTSVRIEACGFLYRMMRSSYDTFNKPGINRVHLQMIV-AVSKLDRTVGIRFKESLNYLKRLAEIEMXXXXXXXXXXXXXGTPTGTSKSITIGVHSTTKLSMQTFFEE--------------------VTDLTQRIRTVLMATVQMNEHVDDPEMQVDLQYSLAKSYSSNPALRRTWLEKIYAIHNKNNSRAEMAMCKAHIVAMIVEYLRRKEQYSMSCANFKAISPNIPLEESGMRDDSVQLE-VHYTKEEVVKLLRELAHEFDAGCLWEVLRHVYKLVIPIYERKRDYEQLAEIYKHMSDGYNKIKTAESTNQRIIGSYYRVVLYG-KPFDSLAGKVFIYRLDSGKQFCVVREELQKLFSKKYGAGKVQMLVENHIDRSKLDPELASIQVTHVEPFFNEDEEL--ERHSMFERQYNISKFMLETPFVKMNHVEHESRWKKYKEHDIDGVLKSKQTDDLSIQWKRRTILTVEAS-----------FPHLKRRLEVISIKEIDFSPIERAIDEIQLKNRQLAMHLAYXXXXXXXXXXXXXXXXXXXXXVGSSQTRANNIPLLMDMHMSGALLPQVNQGPMAYARVFLHKETQANYSQEKVKQLKIQFMEFLTLCYLLLRDFNELMSHIQQ-------QKYIAMREALDSY 7531
            N+S EV LIVLDV   +    A  Q          +F  ++ ++L L   + SE V  HV   + +FV+ F   LF       +  L    L  + +R  +V+  A   L  ++R+ Y+       ++V  Q +  + SK+++    R   S   L R                   G+ TG + +  +G  S   LS    FE                     V DL +++R V+ ATV + +  +DP    DL   LA SY  + ALR  W + +  I+ ++   AE ++C AH VA+I   L  +++  +    F  I+  I   E     D+  ++   +T + +   + + A        +E +  +Y+L++P+ E+  ++  L  +Y  +   Y++     S+ +R +G+Y+RV   G + F S     +IYR            E+++   ++ G  +VQ+     +D SK+DP +A +Q+THVEP       +  +  + F    N+S+F  E   +       E+  K  KE  I              Q  +RT+L V  S           FP  +RRL VIS+    FSP+E A  ++  K  Q+   L                         +S  R  ++  L  + + GA+LP VN GP+AYA VF  +E +  Y  + + +L+  F   +  C L +      +   QQ         + AM E L ++
Sbjct:  550 NLSQEVALIVLDVAQTFAHQLASSQRHRHCPQSDALFHSLLALHLRLADEHWSETVRLHVIAGLALFVNLFRARLFEGGPLEPLYMLIEKVLIQMASRLPAVQAAAAALLQLILRNGYEVAQGYFASQVLAQSVSPSSSKINQQAATRKGVSSERLGR------------------PGSQTGVALARLLGFQSV--LSNSAAFERGLAAVEALVDTRKATSFDLAVLDLLRQLRGVMTATVALKDAANDPIRLADLHLQLADSYRGSAALRSAWFDTLAEIYEQDRWFAEASVCHAHSVAIIARELEERKELEVDWRVFDWINNRIAETEQSQGGDAGSVQPAGFTTDNLGAKIDKTAAALMLAERFEAVGPLYRLIVPVLEKNMNFTSLVSVYAELQQTYSRAAEVRSSGKRHLGAYFRVRFNGERHFGSEHNTDWIYREAGLTSLAAFALEIKEKCQRQVGHDRVQIEANEQLDLSKIDPTVAYVQITHVEPSIPAAAGIADQHRNDFLVHTNLSEFSYECATI-------ENERKVSKEPAIHE------------QCLKRTVLRVSPSPVSEDSRAATGFPATRRRLPVISVHFEQFSPLEFACQKLNTKAEQIRKTLN-----------------------AASNGRQLDVKGL-QLLLQGAVLPTVNAGPLAYAEVFTKEEQRERYGDDGLVKLRESFRNLMNSCQLAIEANASAIGSDQQTYHEVLVSSFDAMHERLQTF 1233          

HSP 2 Score: 88.9669 bits (219), Expect = 4.133e-17
Identity = 66/214 (30.84%), Postives = 100/214 (46.73%), Query Frame = 2
Query: 3971 ANKDLARFISRLFNVMDRGFIFQIIHQYMKIFIARINA--YSGHREHLCRMKFDFLEIVTNHEHYLPLNLLKIINPSDKGQSVR---------------------------------------KRQAPPSLELILSETYCRQHYLAGLLLQEVHRQMSDVYSHNAVRRLPFVMLRNLLAKHLFDDRYSSINMQARIAALYLPLVSIILENQKSF 4489
            AN  LA F     + +DRG +F+ IH Y    I+R++   Y   R++    K D LEI+  HEH++PLNL  +IN + + Q +                                         R A  S E  LS  + + H++ GLL+QE+   ++ +      R+ P  +LRNLLAKH FD RY  + +Q RIA LY P+++  L++   F
Sbjct:  126 ANLALAYFTRFAMSFVDRGVVFRWIHFY----ISRLDDTDYRALRDY----KTDLLEILCLHEHHVPLNLPVLINAAAQIQRLNYSGGVVDTQMQTTNASGSGFLSRFFNQIFNTPTLETNETDRYASCSGEWHLSPAFAQNHFIVGLLMQEL---VACIRETKDYRKRPISLLRNLLAKHSFDKRYGDMTIQRRIAMLYAPVLTFALDHLHEF 328          
BLAST of Dedicator of cytokinesis vs. Ensembl Fly
Match: Ziz (gene:FBgn0260486 transcript:FBtr0330721)

HSP 1 Score: 395.586 bits (1015), Expect = 2.489e-110
Identity = 262/838 (31.26%), Postives = 425/838 (50.72%), Query Frame = 2
Query: 5138 KDIFVCLLHIFHTISSDDLKATICNLTVQERLEFLQLLILSIHHLKYQGRK-VINNFESISTGCAKSK-IQLRPHGPR-----------SSVTA------ILDDVD--HGDHKAYLEGNVSTEVGLIVLDVLSAYCSAFKQEILTYTPDHVIFKKIVDIYLTLLSVNQSEIVLKHVFVSMRVFVSTFAKVLFANCHNVISDLSLHTLRFLDTRFTSVRIEACGFLYRMMRSSYDTFNKPGINRVHLQMIVAVSKL-DRTVGI---RFKESLNYLKRLAEIEMXXXXXXXXXXXXXGTPTGTSKSITIGVHSTTKLSMQTFFEEVTDLTQRIRTVLMATVQMNEHVDDPEMQVDLQYSLAKSYSSNPALRRTWLEKIYAIHNKNNSRAEMAMCKAHIVAMIVEYLRRKEQYSMSCAN--FKAISPNIPLEESGMRDDSVQLEVHYTKEEVVKLLRELAHEFDAGCLWEVLRHVYKLVIPIYERKRDYEQLAEIYKHMSDGYNKIKTAESTNQRIIGSYYRVVLYG-KPFDSLAGKVFIYRLDSGKQFCVVREELQKLFSKKYGAGKVQMLVENH-IDRSKLDPELASIQVTHVEPFFNEDEELERHSMFERQYNISKFMLETPFVKMNHVEHESRWKKYKEHDIDGVLKSKQTDDLSIQWKRRTILTVEASFPHLKRRLEVISIKEIDFSPIERAIDEIQLKNRQLAMHLAYXXXXXXXXXXXXXXXXXXXXXVGSSQTRANNIPLLMDMHMSGALLPQVNQGPMAYARVFLHKETQANYSQEKVKQLKIQFMEFLTLCYLLLRDFNELMSHIQQQKYIAMREALDSYRVELSNLINEE 7564
            KD+ +  L I   +S + +     N    E L+FL +L L +   +Y G+K V+   E+     AK+  +  R   P            SS T       +L+D+D    +  A  E N++TEVG+I+LD L  Y   F+Q +     D ++  K+  +YL  L + QSE + KHVF ++R F++ +A  LF     +   +    L+  D+R   +R E+C  LY +MRS+++   +  + RVHLQ+I++VS++    +G+   RF+ESL+ +   A                               +S   +    F  EV DLT+R+RTVLMAT QM  H  DPE  ++LQYSLA SY+S P LR TWL  +   H +N + +E A C  HI A++ EYLR K   ++S ++  F  IS NIPL+E G++ D+   +  YT++ +++ L+  A   D    +E L  +YKL++P+YER R Y+ LA  Y+H++  YNKI     + +R++G +YRVV YG   F+      F+Y+         + E L K + +K+GA  V+M++++  +   +LD +LA IQVTHV PFF++DE  +R + FE+ +++  FM ETPF K                   G  +    +    QWKR+T++  + SFP++ +R+ V S + I+ SPIE AIDE+Q K  +L                           +  +  +       + + + G++   VN GP+AYA  FL  +   N+S ++V  LK  F +F+ +C   L     ++S  Q++ +  ++E  +     LS L+++E
Sbjct: 1499 KDLLLGFLFIIKHLSQEQMIGWWQNCNESETLQFLSILDLCLLQFRYVGKKSVVITTETRQGRLAKANTLPARTQPPTGLENGSQEQQPSSGTLNQTREHLLEDIDTLARNQLALYESNLATEVGMIILDCLGLYVLQFRQLL----ADSLVLPKVARVYLRFLQLGQSERLSKHVFAALRAFINNYAVALFKGNAMLCGQMVYELLKACDSRLVEIRHESCAVLYLLMRSNFEFSGRKALTRVHLQVIISVSQMIGNVIGLNNARFQESLSIINSYA-------------------------------NSDKAMKGTGFPMEVKDLTRRVRTVLMATAQMQAHHMDPERLLELQYSLANSYASTPELRHTWLVTMARNHEQNGNLSEAACCHLHIAALMCEYLRLKGGCTLSWSSTAFGKISTNIPLDEQGLKLDAGAQDSQYTEQMLLEQLKLCADFLDRAERFECLGELYKLILPMYERDRSYQDLAHCYEHLTQAYNKIVEVNRSGKRMLGRFYRVVFYGLMYFEEDHAIEFVYKEPKLTSLSEISERLAKQYKEKFGADVVKMIMDSSPVKVDELDAKLAYIQVTHVIPFFSKDELDQRLNEFEQNHDVDTFMYETPFTK------------------SGAARGSVEE----QWKRKTVIKTQYSFPYVLKRIPVKSREIIELSPIEVAIDEMQSKVSEL-----------------------EEIILPPADVKK------LQLRLQGSVAVTVNAGPLAYAHAFLDAKVVNNFSMDRVGDLKDVFRDFIVVCQKALFLNERIISADQKEYHHVLKENYEKLCQALSELLDDE 2250          

HSP 2 Score: 255.758 bits (652), Expect = 1.714e-67
Identity = 204/703 (29.02%), Postives = 315/703 (44.81%), Query Frame = 2
Query: 2387 PNLDFIHTLYIYPRTLNFSNQNVFHRARNLSCFVELRDVDKSDAPPLKVFYSRPSRKQPAFDYWSNTSVIYHDSSPTFNEEIKIALPLNLHSKHHLLFRFYHVSCDTAAIPNVREKGSNKKSLETPVGVTWLTLMDQNLNLKSGSFSLPVATQLVPDYLEEKQQSIYYKKDSLWKLSTSFGQPKPRNSSTDKVIDESVNKRHSGPTFKSYINPRSSRDLEDIFSIKSDDVEQSHDTTVQWVDGQKSIFTVVIRPETTIFTQSTHLHKFFQVCSEKLDELTNPTVVEKKESIFTKPRSGSDPTTPKPVSDDTLLLQTSNKDVEIKNAIKALATVNVTNLIKFFAPTFNQLLHVVVCTAISHSEISKTAVTSMITLASSLRTPSMESLSSKATKRNTKIIKSYIKFAFDAEKIV-PTKVKRTVHESLIQAISELIRPPFRDTXXXXXXXXXXXXXYSIITKSMIQSLTKQSKITIDKGGDKFFSTSYMDSLQNMIHLIINCILEITSTVGNQSGMNGQLRPNNSFQSLATSA---NKDLARFISRLFNVMDRGFIFQIIHQYMKIFIARINAYSGHREHLCRMKFDFLEIVTNHEHYLPLNLLKIINPSDKGQSVRKRQAPPSL--ELILSETYCRQHYLAGLLLQEVHRQMSDVYSHNAVRRLPFVMLRNLLAKHLFDDRYSSINMQARIAALYLPLVSIILEN 4477
            P   F + LY+YP +L F +Q +F RARN++  VELRD D   + PLK  Y RP   Q          V++H+ +PT+ EEIK+ LPL L  +HHLLF FYHVSC      N+ +K     + ETP+G  WL L+ +N  +      LPVA  L   YL            S+  L    GQ                   + GP  +   N R                               +++TV +R ++T+ T   HLH FF  C                E +    ++G+ P                  + E    +KA   +++ +LI +     N+L  ++V T    SE     V  +IT        ++  L S   KR + ++ +Y+K+ F A      T  +RTVH  L + +  L+ P   D   VN F+  S +F+ +I KSM Q L    +I + +  ++ F   Y D ++ +I  ++  I                      F+ L+      N+ LA+F+ +  + MDRGF+F++I  YM  F        G+   L   KF+FL+ +  HEHY+PLNL  ++NP ++         PP +     LSE +CRQH+L+GLLLQE+   +++V     VRR    + ++LLAKH  D+RY      +RIA LY+P + ++++N
Sbjct:  803 PYTSFCNHLYVYPLSLQFDSQKLFSRARNITVVVELRDGDGEYSKPLKCIYGRPG--QDLLVSQIACPVLHHNVTPTWYEEIKLRLPLGLFPEHHLLFSFYHVSC------NLSKKRDANAAFETPIGYAWLPLLQKN-RICLEEQQLPVAATLPVGYL------------SIQPLGWGKGQ-------------------NCGPDIQWIDNQR-------------------------------NLYTVGLRLDSTVLTADQHLHNFFGHC----------------ERLLEGGKTGAVPA-----------------ETETCKILKAAHAIDMKSLINYLPTVLNELFTLLVHT---QSEEIGLNVIRLIT--------NIIHLISDQAKR-SDLLGAYVKYVFHAPYYSQQTARQRTVHGELCRHLPYLLNPSNPDFLIVNKFMRYSSIFFDLIIKSMAQHLLATGRIRMLR--NERFPKEYGDRVEQLIKALMPYI-------------------TTRFEDLSEETHLLNRSLAKFVRQCLSYMDRGFVFRLIRCYMGEF------SPGNPRILHEYKFNFLQEICQHEHYVPLNLPFVLNPKNR---------PPEMMQHFTLSEQFCRQHFLSGLLLQELKSSLNEV---GHVRRHALGIFKDLLAKHELDNRYQQKGQLSRIALLYVPWLGVVMDN 1350          

HSP 3 Score: 68.1662 bits (165), Expect = 1.294e-10
Identity = 67/292 (22.95%), Postives = 108/292 (36.99%), Query Frame = 2
Query:  920 PVSSESIERSEETVHGMLSKFLQENEQSAVILRKKDHQKILVIYSEIRNQIKMKSQQTPIYDIGIIEKSQLDDCHIRPQVEQSIPKTFIKLTAN--RFITSVGISDENSNPKGVIPAEPFFISFSLFHIADGRRISEEFYWNPNRPQIEDLLPSDLFAYKFGGHPVHATINGNCDNRTPLNLP-TMSDRV-----------LQSTNSFILKVPCLPDKICLFIKSEKVFSGAIGPTVDKYIKSGGSLLKKKDREEELFVENPDVKTGASINKTMSVYCANIGHYRMPFGWTA 1753
            P +  +++  ++++H  L K+ +E + S  + R++  +++   Y            Q+P+   G     Q  + H           T + LT +  RF       DE+S        EP+  S +LF     R++SE FY+N N      LLP+        G  V        +  T    P ++ D V            Q     +L V      I L ++ EK+    I    + Y+K+G                  D K G  + K    Y  +IGHYR PF W A
Sbjct:  441 PPTFGTLKGLDQSLHPQLMKYGRETDHSIALARREQRRRLFACY------------QSPVKGSGSDNVEQYRE-HF---------GTRLLLTCHNLRFRLQCIPQDESSAGGVEQQVEPYITSLALFDAKANRKLSENFYFNVNEQWAAQLLPNTPVPSSVAGCGVPRKSAEGDERSTACQAPHSLFDGVSAELLRSNRQQFQQLRQCLLSVTAPHADIYLVVRIEKILQSGIAQVTEPYLKAG-----------------KDPKLGQKVYKAAKSYAQHIGHYRQPFAWAA 693          
BLAST of Dedicator of cytokinesis vs. Ensembl Fly
Match: Ziz (gene:FBgn0260486 transcript:FBtr0330722)

HSP 1 Score: 395.586 bits (1015), Expect = 2.520e-110
Identity = 262/838 (31.26%), Postives = 425/838 (50.72%), Query Frame = 2
Query: 5138 KDIFVCLLHIFHTISSDDLKATICNLTVQERLEFLQLLILSIHHLKYQGRK-VINNFESISTGCAKSK-IQLRPHGPR-----------SSVTA------ILDDVD--HGDHKAYLEGNVSTEVGLIVLDVLSAYCSAFKQEILTYTPDHVIFKKIVDIYLTLLSVNQSEIVLKHVFVSMRVFVSTFAKVLFANCHNVISDLSLHTLRFLDTRFTSVRIEACGFLYRMMRSSYDTFNKPGINRVHLQMIVAVSKL-DRTVGI---RFKESLNYLKRLAEIEMXXXXXXXXXXXXXGTPTGTSKSITIGVHSTTKLSMQTFFEEVTDLTQRIRTVLMATVQMNEHVDDPEMQVDLQYSLAKSYSSNPALRRTWLEKIYAIHNKNNSRAEMAMCKAHIVAMIVEYLRRKEQYSMSCAN--FKAISPNIPLEESGMRDDSVQLEVHYTKEEVVKLLRELAHEFDAGCLWEVLRHVYKLVIPIYERKRDYEQLAEIYKHMSDGYNKIKTAESTNQRIIGSYYRVVLYG-KPFDSLAGKVFIYRLDSGKQFCVVREELQKLFSKKYGAGKVQMLVENH-IDRSKLDPELASIQVTHVEPFFNEDEELERHSMFERQYNISKFMLETPFVKMNHVEHESRWKKYKEHDIDGVLKSKQTDDLSIQWKRRTILTVEASFPHLKRRLEVISIKEIDFSPIERAIDEIQLKNRQLAMHLAYXXXXXXXXXXXXXXXXXXXXXVGSSQTRANNIPLLMDMHMSGALLPQVNQGPMAYARVFLHKETQANYSQEKVKQLKIQFMEFLTLCYLLLRDFNELMSHIQQQKYIAMREALDSYRVELSNLINEE 7564
            KD+ +  L I   +S + +     N    E L+FL +L L +   +Y G+K V+   E+     AK+  +  R   P            SS T       +L+D+D    +  A  E N++TEVG+I+LD L  Y   F+Q +     D ++  K+  +YL  L + QSE + KHVF ++R F++ +A  LF     +   +    L+  D+R   +R E+C  LY +MRS+++   +  + RVHLQ+I++VS++    +G+   RF+ESL+ +   A                               +S   +    F  EV DLT+R+RTVLMAT QM  H  DPE  ++LQYSLA SY+S P LR TWL  +   H +N + +E A C  HI A++ EYLR K   ++S ++  F  IS NIPL+E G++ D+   +  YT++ +++ L+  A   D    +E L  +YKL++P+YER R Y+ LA  Y+H++  YNKI     + +R++G +YRVV YG   F+      F+Y+         + E L K + +K+GA  V+M++++  +   +LD +LA IQVTHV PFF++DE  +R + FE+ +++  FM ETPF K                   G  +    +    QWKR+T++  + SFP++ +R+ V S + I+ SPIE AIDE+Q K  +L                           +  +  +       + + + G++   VN GP+AYA  FL  +   N+S ++V  LK  F +F+ +C   L     ++S  Q++ +  ++E  +     LS L+++E
Sbjct: 1487 KDLLLGFLFIIKHLSQEQMIGWWQNCNESETLQFLSILDLCLLQFRYVGKKSVVITTETRQGRLAKANTLPARTQPPTGLENGSQEQQPSSGTLNQTREHLLEDIDTLARNQLALYESNLATEVGMIILDCLGLYVLQFRQLL----ADSLVLPKVARVYLRFLQLGQSERLSKHVFAALRAFINNYAVALFKGNAMLCGQMVYELLKACDSRLVEIRHESCAVLYLLMRSNFEFSGRKALTRVHLQVIISVSQMIGNVIGLNNARFQESLSIINSYA-------------------------------NSDKAMKGTGFPMEVKDLTRRVRTVLMATAQMQAHHMDPERLLELQYSLANSYASTPELRHTWLVTMARNHEQNGNLSEAACCHLHIAALMCEYLRLKGGCTLSWSSTAFGKISTNIPLDEQGLKLDAGAQDSQYTEQMLLEQLKLCADFLDRAERFECLGELYKLILPMYERDRSYQDLAHCYEHLTQAYNKIVEVNRSGKRMLGRFYRVVFYGLMYFEEDHAIEFVYKEPKLTSLSEISERLAKQYKEKFGADVVKMIMDSSPVKVDELDAKLAYIQVTHVIPFFSKDELDQRLNEFEQNHDVDTFMYETPFTK------------------SGAARGSVEE----QWKRKTVIKTQYSFPYVLKRIPVKSREIIELSPIEVAIDEMQSKVSEL-----------------------EEIILPPADVKK------LQLRLQGSVAVTVNAGPLAYAHAFLDAKVVNNFSMDRVGDLKDVFRDFIVVCQKALFLNERIISADQKEYHHVLKENYEKLCQALSELLDDE 2238          

HSP 2 Score: 176.022 bits (445), Expect = 3.043e-43
Identity = 133/466 (28.54%), Postives = 222/466 (47.64%), Query Frame = 2
Query: 3098 VQWVDGQKSIFTVVIRPETTIFTQSTHLHKFFQVCSEKLDELTNPTVVEKKESIFTKPRSGSDPTTPKPVSDDTLLLQTSNKDVEIKNAIKALATVNVTNLIKFFAPTFNQLLHVVVCTAISHSEISKTAVTSMITLASSLRTPSMESLSSKATKRNTKIIKSYIKFAFDAEKIV-PTKVKRTVHESLIQAISELIRPPFRDTXXXXXXXXXXXXXYSIITKSMIQSLTKQSKITIDKGGDKFFSTSYMDSLQNMIHLIINCILEITSTVGNQSGMNGQLRPNNSFQSLATSA---NKDLARFISRLFNVMDRGFIFQIIHQYMKIFIARINAYSGHREHLCRMKFDFLEIVTNHEHYLPLNLLKIINPSDKGQSVRKRQAPPSL--ELILSETYCRQHYLAGLLLQEVHRQMSDVYSHNAVRRLPFVMLRNLLAKHLFDDRYSSINMQARIAALYLPLVSIILEN 4477
            +QW+D Q++++TV +R ++T+ T   HLH FF  C                E +    ++G+ P                  + E    +KA   +++ +LI +     N+L  ++V T    SE     V  +IT        ++  L S   KR + ++ +Y+K+ F A      T  +RTVH  L + +  L+ P   D   VN F+  S +F+ +I KSM Q L    +I + +  ++ F   Y D ++ +I  ++  I                      F+ L+      N+ LA+F+ +  + MDRGF+F++I  YM  F        G+   L   KF+FL+ +  HEHY+PLNL  ++NP ++         PP +     LSE +CRQH+L+GLLLQE+   +++V     VRR    + ++LLAKH  D+RY      +RIA LY+P + ++++N
Sbjct:  954 IQWIDNQRNLYTVGLRLDSTVLTADQHLHNFFGHC----------------ERLLEGGKTGAVPA-----------------ETETCKILKAAHAIDMKSLINYLPTVLNELFTLLVHT---QSEEIGLNVIRLIT--------NIIHLISDQAKR-SDLLGAYVKYVFHAPYYSQQTARQRTVHGELCRHLPYLLNPSNPDFLIVNKFMRYSSIFFDLIIKSMAQHLLATGRIRMLR--NERFPKEYGDRVEQLIKALMPYI-------------------TTRFEDLSEETHLLNRSLAKFVRQCLSYMDRGFVFRLIRCYMGEF------SPGNPRILHEYKFNFLQEICQHEHYVPLNLPFVLNPKNR---------PPEMMQHFTLSEQFCRQHFLSGLLLQELKSSLNEV---GHVRRHALGIFKDLLAKHELDNRYQQKGQLSRIALLYVPWLGVVMDN 1335          

HSP 3 Score: 123.25 bits (308), Expect = 2.866e-27
Identity = 67/159 (42.14%), Postives = 89/159 (55.97%), Query Frame = 2
Query: 2387 PNLDFIHTLYIYPRTLNFSNQNVFHRARNLSCFVELRDVDKSDAPPLKVFYSRPSRKQPAFDYWSNTSVIYHDSSPTFNEEIKIALPLNLHSKHHLLFRFYHVSCDTAAIPNVREKGSNKKSLETPVGVTWLTLMDQNLNLKSGSFSLPVATQLVPDYL 2863
            P   F + LY+YP +L F +Q +F RARN++  VELRD D   + PLK  Y RP   Q          V++H+ +PT+ EEIK+ LPL L  +HHLLF FYHVSC      N+ +K     + ETP+G  WL L+ +N  +      LPVA  L   YL
Sbjct:  789 PYTSFCNHLYVYPLSLQFDSQKLFSRARNITVVVELRDGDGEYSKPLKCIYGRPG--QDLLVSQIACPVLHHNVTPTWYEEIKLRLPLGLFPEHHLLFSFYHVSC------NLSKKRDANAAFETPIGYAWLPLLQKN-RICLEEQQLPVAATLPVGYL 938          

HSP 4 Score: 68.1662 bits (165), Expect = 1.348e-10
Identity = 67/292 (22.95%), Postives = 108/292 (36.99%), Query Frame = 2
Query:  920 PVSSESIERSEETVHGMLSKFLQENEQSAVILRKKDHQKILVIYSEIRNQIKMKSQQTPIYDIGIIEKSQLDDCHIRPQVEQSIPKTFIKLTAN--RFITSVGISDENSNPKGVIPAEPFFISFSLFHIADGRRISEEFYWNPNRPQIEDLLPSDLFAYKFGGHPVHATINGNCDNRTPLNLP-TMSDRV-----------LQSTNSFILKVPCLPDKICLFIKSEKVFSGAIGPTVDKYIKSGGSLLKKKDREEELFVENPDVKTGASINKTMSVYCANIGHYRMPFGWTA 1753
            P +  +++  ++++H  L K+ +E + S  + R++  +++   Y            Q+P+   G     Q  + H           T + LT +  RF       DE+S        EP+  S +LF     R++SE FY+N N      LLP+        G  V        +  T    P ++ D V            Q     +L V      I L ++ EK+    I    + Y+K+G                  D K G  + K    Y  +IGHYR PF W A
Sbjct:  427 PPTFGTLKGLDQSLHPQLMKYGRETDHSIALARREQRRRLFACY------------QSPVKGSGSDNVEQYRE-HF---------GTRLLLTCHNLRFRLQCIPQDESSAGGVEQQVEPYITSLALFDAKANRKLSENFYFNVNEQWAAQLLPNTPVPSSVAGCGVPRKSAEGDERSTACQAPHSLFDGVSAELLRSNRQQFQQLRQCLLSVTAPHADIYLVVRIEKILQSGIAQVTEPYLKAG-----------------KDPKLGQKVYKAAKSYAQHIGHYRQPFAWAA 679          
BLAST of Dedicator of cytokinesis vs. Ensembl Fly
Match: Ziz (gene:FBgn0260486 transcript:FBtr0330726)

HSP 1 Score: 395.586 bits (1015), Expect = 2.546e-110
Identity = 262/838 (31.26%), Postives = 425/838 (50.72%), Query Frame = 2
Query: 5138 KDIFVCLLHIFHTISSDDLKATICNLTVQERLEFLQLLILSIHHLKYQGRK-VINNFESISTGCAKSK-IQLRPHGPR-----------SSVTA------ILDDVD--HGDHKAYLEGNVSTEVGLIVLDVLSAYCSAFKQEILTYTPDHVIFKKIVDIYLTLLSVNQSEIVLKHVFVSMRVFVSTFAKVLFANCHNVISDLSLHTLRFLDTRFTSVRIEACGFLYRMMRSSYDTFNKPGINRVHLQMIVAVSKL-DRTVGI---RFKESLNYLKRLAEIEMXXXXXXXXXXXXXGTPTGTSKSITIGVHSTTKLSMQTFFEEVTDLTQRIRTVLMATVQMNEHVDDPEMQVDLQYSLAKSYSSNPALRRTWLEKIYAIHNKNNSRAEMAMCKAHIVAMIVEYLRRKEQYSMSCAN--FKAISPNIPLEESGMRDDSVQLEVHYTKEEVVKLLRELAHEFDAGCLWEVLRHVYKLVIPIYERKRDYEQLAEIYKHMSDGYNKIKTAESTNQRIIGSYYRVVLYG-KPFDSLAGKVFIYRLDSGKQFCVVREELQKLFSKKYGAGKVQMLVENH-IDRSKLDPELASIQVTHVEPFFNEDEELERHSMFERQYNISKFMLETPFVKMNHVEHESRWKKYKEHDIDGVLKSKQTDDLSIQWKRRTILTVEASFPHLKRRLEVISIKEIDFSPIERAIDEIQLKNRQLAMHLAYXXXXXXXXXXXXXXXXXXXXXVGSSQTRANNIPLLMDMHMSGALLPQVNQGPMAYARVFLHKETQANYSQEKVKQLKIQFMEFLTLCYLLLRDFNELMSHIQQQKYIAMREALDSYRVELSNLINEE 7564
            KD+ +  L I   +S + +     N    E L+FL +L L +   +Y G+K V+   E+     AK+  +  R   P            SS T       +L+D+D    +  A  E N++TEVG+I+LD L  Y   F+Q +     D ++  K+  +YL  L + QSE + KHVF ++R F++ +A  LF     +   +    L+  D+R   +R E+C  LY +MRS+++   +  + RVHLQ+I++VS++    +G+   RF+ESL+ +   A                               +S   +    F  EV DLT+R+RTVLMAT QM  H  DPE  ++LQYSLA SY+S P LR TWL  +   H +N + +E A C  HI A++ EYLR K   ++S ++  F  IS NIPL+E G++ D+   +  YT++ +++ L+  A   D    +E L  +YKL++P+YER R Y+ LA  Y+H++  YNKI     + +R++G +YRVV YG   F+      F+Y+         + E L K + +K+GA  V+M++++  +   +LD +LA IQVTHV PFF++DE  +R + FE+ +++  FM ETPF K                   G  +    +    QWKR+T++  + SFP++ +R+ V S + I+ SPIE AIDE+Q K  +L                           +  +  +       + + + G++   VN GP+AYA  FL  +   N+S ++V  LK  F +F+ +C   L     ++S  Q++ +  ++E  +     LS L+++E
Sbjct: 1502 KDLLLGFLFIIKHLSQEQMIGWWQNCNESETLQFLSILDLCLLQFRYVGKKSVVITTETRQGRLAKANTLPARTQPPTGLENGSQEQQPSSGTLNQTREHLLEDIDTLARNQLALYESNLATEVGMIILDCLGLYVLQFRQLL----ADSLVLPKVARVYLRFLQLGQSERLSKHVFAALRAFINNYAVALFKGNAMLCGQMVYELLKACDSRLVEIRHESCAVLYLLMRSNFEFSGRKALTRVHLQVIISVSQMIGNVIGLNNARFQESLSIINSYA-------------------------------NSDKAMKGTGFPMEVKDLTRRVRTVLMATAQMQAHHMDPERLLELQYSLANSYASTPELRHTWLVTMARNHEQNGNLSEAACCHLHIAALMCEYLRLKGGCTLSWSSTAFGKISTNIPLDEQGLKLDAGAQDSQYTEQMLLEQLKLCADFLDRAERFECLGELYKLILPMYERDRSYQDLAHCYEHLTQAYNKIVEVNRSGKRMLGRFYRVVFYGLMYFEEDHAIEFVYKEPKLTSLSEISERLAKQYKEKFGADVVKMIMDSSPVKVDELDAKLAYIQVTHVIPFFSKDELDQRLNEFEQNHDVDTFMYETPFTK------------------SGAARGSVEE----QWKRKTVIKTQYSFPYVLKRIPVKSREIIELSPIEVAIDEMQSKVSEL-----------------------EEIILPPADVKK------LQLRLQGSVAVTVNAGPLAYAHAFLDAKVVNNFSMDRVGDLKDVFRDFIVVCQKALFLNERIISADQKEYHHVLKENYEKLCQALSELLDDE 2253          

HSP 2 Score: 255.758 bits (652), Expect = 1.604e-67
Identity = 204/703 (29.02%), Postives = 315/703 (44.81%), Query Frame = 2
Query: 2387 PNLDFIHTLYIYPRTLNFSNQNVFHRARNLSCFVELRDVDKSDAPPLKVFYSRPSRKQPAFDYWSNTSVIYHDSSPTFNEEIKIALPLNLHSKHHLLFRFYHVSCDTAAIPNVREKGSNKKSLETPVGVTWLTLMDQNLNLKSGSFSLPVATQLVPDYLEEKQQSIYYKKDSLWKLSTSFGQPKPRNSSTDKVIDESVNKRHSGPTFKSYINPRSSRDLEDIFSIKSDDVEQSHDTTVQWVDGQKSIFTVVIRPETTIFTQSTHLHKFFQVCSEKLDELTNPTVVEKKESIFTKPRSGSDPTTPKPVSDDTLLLQTSNKDVEIKNAIKALATVNVTNLIKFFAPTFNQLLHVVVCTAISHSEISKTAVTSMITLASSLRTPSMESLSSKATKRNTKIIKSYIKFAFDAEKIV-PTKVKRTVHESLIQAISELIRPPFRDTXXXXXXXXXXXXXYSIITKSMIQSLTKQSKITIDKGGDKFFSTSYMDSLQNMIHLIINCILEITSTVGNQSGMNGQLRPNNSFQSLATSA---NKDLARFISRLFNVMDRGFIFQIIHQYMKIFIARINAYSGHREHLCRMKFDFLEIVTNHEHYLPLNLLKIINPSDKGQSVRKRQAPPSL--ELILSETYCRQHYLAGLLLQEVHRQMSDVYSHNAVRRLPFVMLRNLLAKHLFDDRYSSINMQARIAALYLPLVSIILEN 4477
            P   F + LY+YP +L F +Q +F RARN++  VELRD D   + PLK  Y RP   Q          V++H+ +PT+ EEIK+ LPL L  +HHLLF FYHVSC      N+ +K     + ETP+G  WL L+ +N  +      LPVA  L   YL            S+  L    GQ                   + GP  +   N R                               +++TV +R ++T+ T   HLH FF  C                E +    ++G+ P                  + E    +KA   +++ +LI +     N+L  ++V T    SE     V  +IT        ++  L S   KR + ++ +Y+K+ F A      T  +RTVH  L + +  L+ P   D   VN F+  S +F+ +I KSM Q L    +I + +  ++ F   Y D ++ +I  ++  I                      F+ L+      N+ LA+F+ +  + MDRGF+F++I  YM  F        G+   L   KF+FL+ +  HEHY+PLNL  ++NP ++         PP +     LSE +CRQH+L+GLLLQE+   +++V     VRR    + ++LLAKH  D+RY      +RIA LY+P + ++++N
Sbjct:  803 PYTSFCNHLYVYPLSLQFDSQKLFSRARNITVVVELRDGDGEYSKPLKCIYGRPG--QDLLVSQIACPVLHHNVTPTWYEEIKLRLPLGLFPEHHLLFSFYHVSC------NLSKKRDANAAFETPIGYAWLPLLQKN-RICLEEQQLPVAATLPVGYL------------SIQPLGWGKGQ-------------------NCGPDIQWIDNQR-------------------------------NLYTVGLRLDSTVLTADQHLHNFFGHC----------------ERLLEGGKTGAVPA-----------------ETETCKILKAAHAIDMKSLINYLPTVLNELFTLLVHT---QSEEIGLNVIRLIT--------NIIHLISDQAKR-SDLLGAYVKYVFHAPYYSQQTARQRTVHGELCRHLPYLLNPSNPDFLIVNKFMRYSSIFFDLIIKSMAQHLLATGRIRMLR--NERFPKEYGDRVEQLIKALMPYI-------------------TTRFEDLSEETHLLNRSLAKFVRQCLSYMDRGFVFRLIRCYMGEF------SPGNPRILHEYKFNFLQEICQHEHYVPLNLPFVLNPKNR---------PPEMMQHFTLSEQFCRQHFLSGLLLQELKSSLNEV---GHVRRHALGIFKDLLAKHELDNRYQQKGQLSRIALLYVPWLGVVMDN 1350          

HSP 3 Score: 68.1662 bits (165), Expect = 1.316e-10
Identity = 67/292 (22.95%), Postives = 108/292 (36.99%), Query Frame = 2
Query:  920 PVSSESIERSEETVHGMLSKFLQENEQSAVILRKKDHQKILVIYSEIRNQIKMKSQQTPIYDIGIIEKSQLDDCHIRPQVEQSIPKTFIKLTAN--RFITSVGISDENSNPKGVIPAEPFFISFSLFHIADGRRISEEFYWNPNRPQIEDLLPSDLFAYKFGGHPVHATINGNCDNRTPLNLP-TMSDRV-----------LQSTNSFILKVPCLPDKICLFIKSEKVFSGAIGPTVDKYIKSGGSLLKKKDREEELFVENPDVKTGASINKTMSVYCANIGHYRMPFGWTA 1753
            P +  +++  ++++H  L K+ +E + S  + R++  +++   Y            Q+P+   G     Q  + H           T + LT +  RF       DE+S        EP+  S +LF     R++SE FY+N N      LLP+        G  V        +  T    P ++ D V            Q     +L V      I L ++ EK+    I    + Y+K+G                  D K G  + K    Y  +IGHYR PF W A
Sbjct:  441 PPTFGTLKGLDQSLHPQLMKYGRETDHSIALARREQRRRLFACY------------QSPVKGSGSDNVEQYRE-HF---------GTRLLLTCHNLRFRLQCIPQDESSAGGVEQQVEPYITSLALFDAKANRKLSENFYFNVNEQWAAQLLPNTPVPSSVAGCGVPRKSAEGDERSTACQAPHSLFDGVSAELLRSNRQQFQQLRQCLLSVTAPHADIYLVVRIEKILQSGIAQVTEPYLKAG-----------------KDPKLGQKVYKAAKSYAQHIGHYRQPFAWAA 693          
BLAST of Dedicator of cytokinesis vs. Ensembl Fly
Match: Ziz (gene:FBgn0260486 transcript:FBtr0330723)

HSP 1 Score: 395.586 bits (1015), Expect = 2.568e-110
Identity = 262/838 (31.26%), Postives = 425/838 (50.72%), Query Frame = 2
Query: 5138 KDIFVCLLHIFHTISSDDLKATICNLTVQERLEFLQLLILSIHHLKYQGRK-VINNFESISTGCAKSK-IQLRPHGPR-----------SSVTA------ILDDVD--HGDHKAYLEGNVSTEVGLIVLDVLSAYCSAFKQEILTYTPDHVIFKKIVDIYLTLLSVNQSEIVLKHVFVSMRVFVSTFAKVLFANCHNVISDLSLHTLRFLDTRFTSVRIEACGFLYRMMRSSYDTFNKPGINRVHLQMIVAVSKL-DRTVGI---RFKESLNYLKRLAEIEMXXXXXXXXXXXXXGTPTGTSKSITIGVHSTTKLSMQTFFEEVTDLTQRIRTVLMATVQMNEHVDDPEMQVDLQYSLAKSYSSNPALRRTWLEKIYAIHNKNNSRAEMAMCKAHIVAMIVEYLRRKEQYSMSCAN--FKAISPNIPLEESGMRDDSVQLEVHYTKEEVVKLLRELAHEFDAGCLWEVLRHVYKLVIPIYERKRDYEQLAEIYKHMSDGYNKIKTAESTNQRIIGSYYRVVLYG-KPFDSLAGKVFIYRLDSGKQFCVVREELQKLFSKKYGAGKVQMLVENH-IDRSKLDPELASIQVTHVEPFFNEDEELERHSMFERQYNISKFMLETPFVKMNHVEHESRWKKYKEHDIDGVLKSKQTDDLSIQWKRRTILTVEASFPHLKRRLEVISIKEIDFSPIERAIDEIQLKNRQLAMHLAYXXXXXXXXXXXXXXXXXXXXXVGSSQTRANNIPLLMDMHMSGALLPQVNQGPMAYARVFLHKETQANYSQEKVKQLKIQFMEFLTLCYLLLRDFNELMSHIQQQKYIAMREALDSYRVELSNLINEE 7564
            KD+ +  L I   +S + +     N    E L+FL +L L +   +Y G+K V+   E+     AK+  +  R   P            SS T       +L+D+D    +  A  E N++TEVG+I+LD L  Y   F+Q +     D ++  K+  +YL  L + QSE + KHVF ++R F++ +A  LF     +   +    L+  D+R   +R E+C  LY +MRS+++   +  + RVHLQ+I++VS++    +G+   RF+ESL+ +   A                               +S   +    F  EV DLT+R+RTVLMAT QM  H  DPE  ++LQYSLA SY+S P LR TWL  +   H +N + +E A C  HI A++ EYLR K   ++S ++  F  IS NIPL+E G++ D+   +  YT++ +++ L+  A   D    +E L  +YKL++P+YER R Y+ LA  Y+H++  YNKI     + +R++G +YRVV YG   F+      F+Y+         + E L K + +K+GA  V+M++++  +   +LD +LA IQVTHV PFF++DE  +R + FE+ +++  FM ETPF K                   G  +    +    QWKR+T++  + SFP++ +R+ V S + I+ SPIE AIDE+Q K  +L                           +  +  +       + + + G++   VN GP+AYA  FL  +   N+S ++V  LK  F +F+ +C   L     ++S  Q++ +  ++E  +     LS L+++E
Sbjct: 1488 KDLLLGFLFIIKHLSQEQMIGWWQNCNESETLQFLSILDLCLLQFRYVGKKSVVITTETRQGRLAKANTLPARTQPPTGLENGSQEQQPSSGTLNQTREHLLEDIDTLARNQLALYESNLATEVGMIILDCLGLYVLQFRQLL----ADSLVLPKVARVYLRFLQLGQSERLSKHVFAALRAFINNYAVALFKGNAMLCGQMVYELLKACDSRLVEIRHESCAVLYLLMRSNFEFSGRKALTRVHLQVIISVSQMIGNVIGLNNARFQESLSIINSYA-------------------------------NSDKAMKGTGFPMEVKDLTRRVRTVLMATAQMQAHHMDPERLLELQYSLANSYASTPELRHTWLVTMARNHEQNGNLSEAACCHLHIAALMCEYLRLKGGCTLSWSSTAFGKISTNIPLDEQGLKLDAGAQDSQYTEQMLLEQLKLCADFLDRAERFECLGELYKLILPMYERDRSYQDLAHCYEHLTQAYNKIVEVNRSGKRMLGRFYRVVFYGLMYFEEDHAIEFVYKEPKLTSLSEISERLAKQYKEKFGADVVKMIMDSSPVKVDELDAKLAYIQVTHVIPFFSKDELDQRLNEFEQNHDVDTFMYETPFTK------------------SGAARGSVEE----QWKRKTVIKTQYSFPYVLKRIPVKSREIIELSPIEVAIDEMQSKVSEL-----------------------EEIILPPADVKK------LQLRLQGSVAVTVNAGPLAYAHAFLDAKVVNNFSMDRVGDLKDVFRDFIVVCQKALFLNERIISADQKEYHHVLKENYEKLCQALSELLDDE 2239          

HSP 2 Score: 255.758 bits (652), Expect = 1.607e-67
Identity = 204/703 (29.02%), Postives = 315/703 (44.81%), Query Frame = 2
Query: 2387 PNLDFIHTLYIYPRTLNFSNQNVFHRARNLSCFVELRDVDKSDAPPLKVFYSRPSRKQPAFDYWSNTSVIYHDSSPTFNEEIKIALPLNLHSKHHLLFRFYHVSCDTAAIPNVREKGSNKKSLETPVGVTWLTLMDQNLNLKSGSFSLPVATQLVPDYLEEKQQSIYYKKDSLWKLSTSFGQPKPRNSSTDKVIDESVNKRHSGPTFKSYINPRSSRDLEDIFSIKSDDVEQSHDTTVQWVDGQKSIFTVVIRPETTIFTQSTHLHKFFQVCSEKLDELTNPTVVEKKESIFTKPRSGSDPTTPKPVSDDTLLLQTSNKDVEIKNAIKALATVNVTNLIKFFAPTFNQLLHVVVCTAISHSEISKTAVTSMITLASSLRTPSMESLSSKATKRNTKIIKSYIKFAFDAEKIV-PTKVKRTVHESLIQAISELIRPPFRDTXXXXXXXXXXXXXYSIITKSMIQSLTKQSKITIDKGGDKFFSTSYMDSLQNMIHLIINCILEITSTVGNQSGMNGQLRPNNSFQSLATSA---NKDLARFISRLFNVMDRGFIFQIIHQYMKIFIARINAYSGHREHLCRMKFDFLEIVTNHEHYLPLNLLKIINPSDKGQSVRKRQAPPSL--ELILSETYCRQHYLAGLLLQEVHRQMSDVYSHNAVRRLPFVMLRNLLAKHLFDDRYSSINMQARIAALYLPLVSIILEN 4477
            P   F + LY+YP +L F +Q +F RARN++  VELRD D   + PLK  Y RP   Q          V++H+ +PT+ EEIK+ LPL L  +HHLLF FYHVSC      N+ +K     + ETP+G  WL L+ +N  +      LPVA  L   YL            S+  L    GQ                   + GP  +   N R                               +++TV +R ++T+ T   HLH FF  C                E +    ++G+ P                  + E    +KA   +++ +LI +     N+L  ++V T    SE     V  +IT        ++  L S   KR + ++ +Y+K+ F A      T  +RTVH  L + +  L+ P   D   VN F+  S +F+ +I KSM Q L    +I + +  ++ F   Y D ++ +I  ++  I                      F+ L+      N+ LA+F+ +  + MDRGF+F++I  YM  F        G+   L   KF+FL+ +  HEHY+PLNL  ++NP ++         PP +     LSE +CRQH+L+GLLLQE+   +++V     VRR    + ++LLAKH  D+RY      +RIA LY+P + ++++N
Sbjct:  789 PYTSFCNHLYVYPLSLQFDSQKLFSRARNITVVVELRDGDGEYSKPLKCIYGRPG--QDLLVSQIACPVLHHNVTPTWYEEIKLRLPLGLFPEHHLLFSFYHVSC------NLSKKRDANAAFETPIGYAWLPLLQKN-RICLEEQQLPVAATLPVGYL------------SIQPLGWGKGQ-------------------NCGPDIQWIDNQR-------------------------------NLYTVGLRLDSTVLTADQHLHNFFGHC----------------ERLLEGGKTGAVPA-----------------ETETCKILKAAHAIDMKSLINYLPTVLNELFTLLVHT---QSEEIGLNVIRLIT--------NIIHLISDQAKR-SDLLGAYVKYVFHAPYYSQQTARQRTVHGELCRHLPYLLNPSNPDFLIVNKFMRYSSIFFDLIIKSMAQHLLATGRIRMLR--NERFPKEYGDRVEQLIKALMPYI-------------------TTRFEDLSEETHLLNRSLAKFVRQCLSYMDRGFVFRLIRCYMGEF------SPGNPRILHEYKFNFLQEICQHEHYVPLNLPFVLNPKNR---------PPEMMQHFTLSEQFCRQHFLSGLLLQELKSSLNEV---GHVRRHALGIFKDLLAKHELDNRYQQKGQLSRIALLYVPWLGVVMDN 1336          

HSP 3 Score: 68.1662 bits (165), Expect = 1.337e-10
Identity = 67/292 (22.95%), Postives = 108/292 (36.99%), Query Frame = 2
Query:  920 PVSSESIERSEETVHGMLSKFLQENEQSAVILRKKDHQKILVIYSEIRNQIKMKSQQTPIYDIGIIEKSQLDDCHIRPQVEQSIPKTFIKLTAN--RFITSVGISDENSNPKGVIPAEPFFISFSLFHIADGRRISEEFYWNPNRPQIEDLLPSDLFAYKFGGHPVHATINGNCDNRTPLNLP-TMSDRV-----------LQSTNSFILKVPCLPDKICLFIKSEKVFSGAIGPTVDKYIKSGGSLLKKKDREEELFVENPDVKTGASINKTMSVYCANIGHYRMPFGWTA 1753
            P +  +++  ++++H  L K+ +E + S  + R++  +++   Y            Q+P+   G     Q  + H           T + LT +  RF       DE+S        EP+  S +LF     R++SE FY+N N      LLP+        G  V        +  T    P ++ D V            Q     +L V      I L ++ EK+    I    + Y+K+G                  D K G  + K    Y  +IGHYR PF W A
Sbjct:  427 PPTFGTLKGLDQSLHPQLMKYGRETDHSIALARREQRRRLFACY------------QSPVKGSGSDNVEQYRE-HF---------GTRLLLTCHNLRFRLQCIPQDESSAGGVEQQVEPYITSLALFDAKANRKLSENFYFNVNEQWAAQLLPNTPVPSSVAGCGVPRKSAEGDERSTACQAPHSLFDGVSAELLRSNRQQFQQLRQCLLSVTAPHADIYLVVRIEKILQSGIAQVTEPYLKAG-----------------KDPKLGQKVYKAAKSYAQHIGHYRQPFAWAA 679          
BLAST of Dedicator of cytokinesis vs. Ensembl Fly
Match: Ziz (gene:FBgn0260486 transcript:FBtr0332201)

HSP 1 Score: 395.586 bits (1015), Expect = 2.573e-110
Identity = 262/838 (31.26%), Postives = 425/838 (50.72%), Query Frame = 2
Query: 5138 KDIFVCLLHIFHTISSDDLKATICNLTVQERLEFLQLLILSIHHLKYQGRK-VINNFESISTGCAKSK-IQLRPHGPR-----------SSVTA------ILDDVD--HGDHKAYLEGNVSTEVGLIVLDVLSAYCSAFKQEILTYTPDHVIFKKIVDIYLTLLSVNQSEIVLKHVFVSMRVFVSTFAKVLFANCHNVISDLSLHTLRFLDTRFTSVRIEACGFLYRMMRSSYDTFNKPGINRVHLQMIVAVSKL-DRTVGI---RFKESLNYLKRLAEIEMXXXXXXXXXXXXXGTPTGTSKSITIGVHSTTKLSMQTFFEEVTDLTQRIRTVLMATVQMNEHVDDPEMQVDLQYSLAKSYSSNPALRRTWLEKIYAIHNKNNSRAEMAMCKAHIVAMIVEYLRRKEQYSMSCAN--FKAISPNIPLEESGMRDDSVQLEVHYTKEEVVKLLRELAHEFDAGCLWEVLRHVYKLVIPIYERKRDYEQLAEIYKHMSDGYNKIKTAESTNQRIIGSYYRVVLYG-KPFDSLAGKVFIYRLDSGKQFCVVREELQKLFSKKYGAGKVQMLVENH-IDRSKLDPELASIQVTHVEPFFNEDEELERHSMFERQYNISKFMLETPFVKMNHVEHESRWKKYKEHDIDGVLKSKQTDDLSIQWKRRTILTVEASFPHLKRRLEVISIKEIDFSPIERAIDEIQLKNRQLAMHLAYXXXXXXXXXXXXXXXXXXXXXVGSSQTRANNIPLLMDMHMSGALLPQVNQGPMAYARVFLHKETQANYSQEKVKQLKIQFMEFLTLCYLLLRDFNELMSHIQQQKYIAMREALDSYRVELSNLINEE 7564
            KD+ +  L I   +S + +     N    E L+FL +L L +   +Y G+K V+   E+     AK+  +  R   P            SS T       +L+D+D    +  A  E N++TEVG+I+LD L  Y   F+Q +     D ++  K+  +YL  L + QSE + KHVF ++R F++ +A  LF     +   +    L+  D+R   +R E+C  LY +MRS+++   +  + RVHLQ+I++VS++    +G+   RF+ESL+ +   A                               +S   +    F  EV DLT+R+RTVLMAT QM  H  DPE  ++LQYSLA SY+S P LR TWL  +   H +N + +E A C  HI A++ EYLR K   ++S ++  F  IS NIPL+E G++ D+   +  YT++ +++ L+  A   D    +E L  +YKL++P+YER R Y+ LA  Y+H++  YNKI     + +R++G +YRVV YG   F+      F+Y+         + E L K + +K+GA  V+M++++  +   +LD +LA IQVTHV PFF++DE  +R + FE+ +++  FM ETPF K                   G  +    +    QWKR+T++  + SFP++ +R+ V S + I+ SPIE AIDE+Q K  +L                           +  +  +       + + + G++   VN GP+AYA  FL  +   N+S ++V  LK  F +F+ +C   L     ++S  Q++ +  ++E  +     LS L+++E
Sbjct: 1487 KDLLLGFLFIIKHLSQEQMIGWWQNCNESETLQFLSILDLCLLQFRYVGKKSVVITTETRQGRLAKANTLPARTQPPTGLENGSQEQQPSSGTLNQTREHLLEDIDTLARNQLALYESNLATEVGMIILDCLGLYVLQFRQLL----ADSLVLPKVARVYLRFLQLGQSERLSKHVFAALRAFINNYAVALFKGNAMLCGQMVYELLKACDSRLVEIRHESCAVLYLLMRSNFEFSGRKALTRVHLQVIISVSQMIGNVIGLNNARFQESLSIINSYA-------------------------------NSDKAMKGTGFPMEVKDLTRRVRTVLMATAQMQAHHMDPERLLELQYSLANSYASTPELRHTWLVTMARNHEQNGNLSEAACCHLHIAALMCEYLRLKGGCTLSWSSTAFGKISTNIPLDEQGLKLDAGAQDSQYTEQMLLEQLKLCADFLDRAERFECLGELYKLILPMYERDRSYQDLAHCYEHLTQAYNKIVEVNRSGKRMLGRFYRVVFYGLMYFEEDHAIEFVYKEPKLTSLSEISERLAKQYKEKFGADVVKMIMDSSPVKVDELDAKLAYIQVTHVIPFFSKDELDQRLNEFEQNHDVDTFMYETPFTK------------------SGAARGSVEE----QWKRKTVIKTQYSFPYVLKRIPVKSREIIELSPIEVAIDEMQSKVSEL-----------------------EEIILPPADVKK------LQLRLQGSVAVTVNAGPLAYAHAFLDAKVVNNFSMDRVGDLKDVFRDFIVVCQKALFLNERIISADQKEYHHVLKENYEKLCQALSELLDDE 2238          

HSP 2 Score: 176.022 bits (445), Expect = 2.791e-43
Identity = 133/466 (28.54%), Postives = 222/466 (47.64%), Query Frame = 2
Query: 3098 VQWVDGQKSIFTVVIRPETTIFTQSTHLHKFFQVCSEKLDELTNPTVVEKKESIFTKPRSGSDPTTPKPVSDDTLLLQTSNKDVEIKNAIKALATVNVTNLIKFFAPTFNQLLHVVVCTAISHSEISKTAVTSMITLASSLRTPSMESLSSKATKRNTKIIKSYIKFAFDAEKIV-PTKVKRTVHESLIQAISELIRPPFRDTXXXXXXXXXXXXXYSIITKSMIQSLTKQSKITIDKGGDKFFSTSYMDSLQNMIHLIINCILEITSTVGNQSGMNGQLRPNNSFQSLATSA---NKDLARFISRLFNVMDRGFIFQIIHQYMKIFIARINAYSGHREHLCRMKFDFLEIVTNHEHYLPLNLLKIINPSDKGQSVRKRQAPPSL--ELILSETYCRQHYLAGLLLQEVHRQMSDVYSHNAVRRLPFVMLRNLLAKHLFDDRYSSINMQARIAALYLPLVSIILEN 4477
            +QW+D Q++++TV +R ++T+ T   HLH FF  C                E +    ++G+ P                  + E    +KA   +++ +LI +     N+L  ++V T    SE     V  +IT        ++  L S   KR + ++ +Y+K+ F A      T  +RTVH  L + +  L+ P   D   VN F+  S +F+ +I KSM Q L    +I + +  ++ F   Y D ++ +I  ++  I                      F+ L+      N+ LA+F+ +  + MDRGF+F++I  YM  F        G+   L   KF+FL+ +  HEHY+PLNL  ++NP ++         PP +     LSE +CRQH+L+GLLLQE+   +++V     VRR    + ++LLAKH  D+RY      +RIA LY+P + ++++N
Sbjct:  954 IQWIDNQRNLYTVGLRLDSTVLTADQHLHNFFGHC----------------ERLLEGGKTGAVPA-----------------ETETCKILKAAHAIDMKSLINYLPTVLNELFTLLVHT---QSEEIGLNVIRLIT--------NIIHLISDQAKR-SDLLGAYVKYVFHAPYYSQQTARQRTVHGELCRHLPYLLNPSNPDFLIVNKFMRYSSIFFDLIIKSMAQHLLATGRIRMLR--NERFPKEYGDRVEQLIKALMPYI-------------------TTRFEDLSEETHLLNRSLAKFVRQCLSYMDRGFVFRLIRCYMGEF------SPGNPRILHEYKFNFLQEICQHEHYVPLNLPFVLNPKNR---------PPEMMQHFTLSEQFCRQHFLSGLLLQELKSSLNEV---GHVRRHALGIFKDLLAKHELDNRYQQKGQLSRIALLYVPWLGVVMDN 1335          

HSP 3 Score: 123.25 bits (308), Expect = 3.076e-27
Identity = 67/159 (42.14%), Postives = 89/159 (55.97%), Query Frame = 2
Query: 2387 PNLDFIHTLYIYPRTLNFSNQNVFHRARNLSCFVELRDVDKSDAPPLKVFYSRPSRKQPAFDYWSNTSVIYHDSSPTFNEEIKIALPLNLHSKHHLLFRFYHVSCDTAAIPNVREKGSNKKSLETPVGVTWLTLMDQNLNLKSGSFSLPVATQLVPDYL 2863
            P   F + LY+YP +L F +Q +F RARN++  VELRD D   + PLK  Y RP   Q          V++H+ +PT+ EEIK+ LPL L  +HHLLF FYHVSC      N+ +K     + ETP+G  WL L+ +N  +      LPVA  L   YL
Sbjct:  789 PYTSFCNHLYVYPLSLQFDSQKLFSRARNITVVVELRDGDGEYSKPLKCIYGRPG--QDLLVSQIACPVLHHNVTPTWYEEIKLRLPLGLFPEHHLLFSFYHVSC------NLSKKRDANAAFETPIGYAWLPLLQKN-RICLEEQQLPVAATLPVGYL 938          

HSP 4 Score: 68.1662 bits (165), Expect = 1.306e-10
Identity = 67/292 (22.95%), Postives = 108/292 (36.99%), Query Frame = 2
Query:  920 PVSSESIERSEETVHGMLSKFLQENEQSAVILRKKDHQKILVIYSEIRNQIKMKSQQTPIYDIGIIEKSQLDDCHIRPQVEQSIPKTFIKLTAN--RFITSVGISDENSNPKGVIPAEPFFISFSLFHIADGRRISEEFYWNPNRPQIEDLLPSDLFAYKFGGHPVHATINGNCDNRTPLNLP-TMSDRV-----------LQSTNSFILKVPCLPDKICLFIKSEKVFSGAIGPTVDKYIKSGGSLLKKKDREEELFVENPDVKTGASINKTMSVYCANIGHYRMPFGWTA 1753
            P +  +++  ++++H  L K+ +E + S  + R++  +++   Y            Q+P+   G     Q  + H           T + LT +  RF       DE+S        EP+  S +LF     R++SE FY+N N      LLP+        G  V        +  T    P ++ D V            Q     +L V      I L ++ EK+    I    + Y+K+G                  D K G  + K    Y  +IGHYR PF W A
Sbjct:  427 PPTFGTLKGLDQSLHPQLMKYGRETDHSIALARREQRRRLFACY------------QSPVKGSGSDNVEQYRE-HF---------GTRLLLTCHNLRFRLQCIPQDESSAGGVEQQVEPYITSLALFDAKANRKLSENFYFNVNEQWAAQLLPNTPVPSSVAGCGVPRKSAEGDERSTACQAPHSLFDGVSAELLRSNRQQFQQLRQCLLSVTAPHADIYLVVRIEKILQSGIAQVTEPYLKAG-----------------KDPKLGQKVYKAAKSYAQHIGHYRQPFAWAA 679          
BLAST of Dedicator of cytokinesis vs. Ensembl Zebrafish
Match: dock11 (dedicator of cytokinesis 11 [Source:ZFIN;Acc:ZDB-GENE-060503-196])

HSP 1 Score: 435.647 bits (1119), Expect = 6.389e-123
Identity = 283/839 (33.73%), Postives = 428/839 (51.01%), Query Frame = 2
Query: 5138 KDIFVCLLHIFHTISSDDLKATICNLTVQERLEFLQLLILSIHHLKYQGRKVINNFESISTG---CAKSKIQLRP--HGPRSSVTAILDDVDHGD-----------------HKAYLEGNVSTEVGLIVLDVLSAYCSAFKQEILTYTPDHVIFKKIVDIYLTLLSVNQSEIVLKHVFVSMRVFVSTFAKVLFANCHNVISDLSLHTLRFLDTRFTSVRIEACGFLYRMMRSSYDTFNKPGINRVHLQMIVAVSKLDRTVGI----RFKESLNYLKRLAEIEMXXXXXXXXXXXXXGTPTGTSKSITIGVHSTTKLSMQTFFEEVTDLTQRIRTVLMATVQMNEHVDDPEMQVDLQYSLAKSYSSNPALRRTWLEKIYAIHNKNNSRAEMAMCKAHIVAMIVEYLRRKEQYSMSCANFKAISPNIPLEESGMRDDSVQLEVHYTKEEVVKLLRELAHEFDAGCLWEVLRHVYKLVIPIYERKRDYEQLAEIYKHMSDGYNKIKTAESTNQRIIGSYYRVVLYGKP-FDSLAGKVFIYRLDSGKQFCVVREELQKLFSKKYGAGKVQMLVE-NHIDRSKLDPELASIQVTHVEPFFNEDEELERHSMFERQYNISKFMLETPFVKMNHVEHESRWKKYKEHDIDGVLKSKQTDDLSIQWKRRTILTVEASFPHLKRRLEVISIKEIDFSPIERAIDEIQLKNRQLAMHLAYXXXXXXXXXXXXXXXXXXXXXVGSSQTRANNIPLLMDMHMSGALLPQVNQGPMAYARVFLHKETQANYSQEKVKQLKIQFMEFLTLCYLLLRDFNE-LMSHIQQQKYIAMREALDSYRVELSNLINEEI 7567
            + + +C LHI  T+S D L A    +  Q+ + FL LL + I   +Y GR+ I+  +          + K Q  P   G  S + A L      D                 H++ LEGN STEV L VLDVLS +  +FK ++L     + +  KI D YLTLL V QSE  +KH+F S+R F+  F   LF     +   L    L+   ++ + +R EA   LY +MR ++D   +    RVHLQ+I+AVS+L   V +    RF+ESL+ +   A                               +S   +   TF  EV  LT RIRTVLMAT QM EH  DPEM +DLQYSLA+SY+S P LRRTWL+ +   H+KN   +E AMC  H+ A++ EYL RK+ +    A FK  + NI  EE  M++D    +V+YT++ +V+ L            +E++ H+ +L+IP+YE++ ++E+L  +Y  +   Y KI     + +R++G+Y+RV  +G+  F+   GK +IY+         +   L KL+ +K+G+  V+++ + N +++  LD + A IQVT+V+PFF+E E  ER + FE+ +NI +F+ ETPF                       L  K+   +  Q KRRT+LT   +FP++K+R+EV+  K  +  PI+ AIDE++ K+ +LA                             S    N I L   + + G +  QVN GPMAYAR FL  E+++  S +KVK LK  F +F+  C + L D NE L+   Q + +  ++    S   ELS +I+E+I
Sbjct: 1275 RGLLLCYLHIVRTLSDDTLTAYWSKVNPQDIMNFLSLLEICIIQFRYVGRRNISRSQEPWVSKLFSPERKSQTMPVLRGRASLMQAKLQQFSTMDTSLTLNMAGGPTEAEINHQSLLEGNTSTEVCLTVLDVLSLFTQSFKNQLLDSDGHNALMTKIFDTYLTLLKVGQSETAIKHIFASLRAFIVKFQVPLFKGRVVLCGSLCYEVLKCCMSKLSVLRGEASALLYLLMRHNFDYTKRKSFLRVHLQIIIAVSQLIADVALTGSSRFQESLSIINNFA-------------------------------NSDKIMKTTTFPSEVKGLTMRIRTVLMATAQMREHEKDPEMLLDLQYSLARSYASTPELRRTWLDSMARAHSKNGDFSEAAMCNVHVAALMAEYLHRKKLFPSGLAAFKRTTQNID-EEGAMKEDIGMQDVYYTEDVLVEQLEVCVESLWKAERFELITHIARLIIPVYEKRHEFEKLRRLYDTLQRAYAKILEVMQSGRRLLGTYFRVAFFGQGFFEEEDGKEYIYKEPKLTTLPEISHRLLKLYGEKFGSENVKIIQDSNKVNQKDLDSKFAYIQVTYVKPFFDEKEMAERKTDFEKCHNIQRFVFETPF----------------------TLTGKKQGGVEEQCKRRTVLTTANTFPYVKKRIEVVGEKHTELKPIDVAIDEMKEKSSELAKL--------------------------CSNQEVNMITL--QLKLQGCVSVQVNAGPMAYARAFL-DESKSGQSNKKVKDLKEIFRQFVNACSMAL-DINERLIKEDQYEYHEGLKANFKSMVKELSEIIHEQI 2029          

HSP 2 Score: 147.132 bits (370), Expect = 1.903e-34
Identity = 153/548 (27.92%), Postives = 239/548 (43.61%), Query Frame = 2
Query: 3023 PRSSRDLEDIFSIKSDDVEQSHDTTVQWVDGQKSIFTVVIRPETTIFTQSTHLHKFFQVCSEKLDELTNPTVVEKKESIFTKPRSGSDPTTPKPVSDDTLLLQTSNKDVEIKNAIKALATVNVTNLIKFFAPTFNQLLHVVVCTAISHSEISKTAVTSMITLASSLRTPSMESLSSKATKRNTKIIKSYIKFAFDAEKIVPTKVKRTVHESLIQAISELIRPPFRDTXXXXXXXXXXXXXYSIITKSMIQSLTKQSKITIDKGGDKFFSTSYMDSLQNMIHLIINCILEITSTVGNQSGMNGQLRPNNSFQSLATSANKDLARFISRLFNVMDRGFIFQIIHQYMKIFIARINAYSGHREHLCRMKFDFLEIVTNHEHYLPLNLLKIINPSDKGQSVRKRQAPPSLELILSETYCRQHYLAGLLLQEVHRQMSDVYSHNAVRRLPFVMLRNLLAKHLFDDRYSSI-NMQARIAALYLPLVSIILENQKSFSLPGNLHTKVNLLNDIYDHSDRSLSARPLSTLSGDTLSTHSSINGSSGDG-AGGSVYG 4660
            P S+  L      KS D+++     ++WVD  K +F V     +TI+TQ  HLH FFQ C                     +  S  +P                    E+   +K L  V    +IKF      QL  V+   +    +++  +   +I + S      +E             ++S++K+ F       ++   T HE L  A++ +++    D N  N  L  S+ F+  + +SM Q L   +++ + +   + F  S+  +LQ ++  I+  I      +  +                A   N  LA FI R    M+RGF F +I+ YM  F  +        + L  MKFDFL  V NHEHY+PLNL     P   G++  +R    SLE  L+E YC+ H+L GLLL+EV      + +   +R+L   +L+NL+ KH  DDRY++  N QARI  LYLPL  ++ +N    + P  +    N L  +Y   D S+ +R  ST+     S   + NG S  G + GS+YG
Sbjct:  782 PVSANLLAGYLCDKSQDIKKVF-PYIKWVDNAKPLFKVRAYVASTIYTQDLHLHNFFQHCQ------------------LMRSTSQGNPA-------------------ELIKYLKCLHAVETQVVIKFLPTVLVQLFEVLSMASKEGQDVAVNSTRVIIHIVSQCHEEGLEHY-----------LRSFLKYVFRINNAT-SENSVTTHEVLATAVTVILKQT-ADINTCNKLLKYSWFFFETMARSMAQYLMDGNRMKMPRA--QRFPESFQQALQCLLLSIMPHITIRYVEIPEE----------------ARCVNFSLACFIKRCLTFMNRGFAFSLINDYMCGFSLK------DPKVLTEMKFDFLMTVCNHEHYIPLNL-----PMAFGRTKLQRVQDQSLEYSLTEDYCKNHFLVGLLLREV---ADGLQACPEIRQLAVAVLKNLMIKHAMDDRYNAFKNQQARICLLYLPLFELLYQNLSQMNSPRQMCR--NGLGLMY-RDDLSVDSRRSSTIVDKEPSGSVTQNGLSRRGESRGSMYG 1243          

HSP 3 Score: 128.257 bits (321), Expect = 1.121e-28
Identity = 61/158 (38.61%), Postives = 95/158 (60.13%), Query Frame = 2
Query: 2411 LYIYPRTLNFSNQNVFHRARNLSCFVELRDVDKSDAPPLKVFYSRPSRKQPAFDYWSNTSVIYHDSSPTFNEEIKIALPLNLHSKHHLLFRFYHVSCDTAAIPNVREKGSNKKSLETPVGVTWLTLMDQNLNLKSGSFSLPVATQLVPDYLEEKQQSI 2884
            LYIYP+ L + +Q  F +ARN++  V+ +D D+  + PLK  Y +P    P F   +  +V++H+ SP F +EIKI LP+++H KHH+LF FYH+SCD       +     ++ +ET VG +W  L+ ++  +KS    LPV+  L+  YL +K Q I
Sbjct:  649 LYIYPQQLKYDSQKAFDKARNIAVCVQFKDSDEEGSSPLKCIYGKPG--DPLFTTSAFAAVLHHNQSPEFYDEIKIELPVHIHEKHHILFTFYHISCDLG----TKTTSKKREGVETLVGYSWTPLL-KDGRIKSSDLQLPVSANLLAGYLCDKSQDI 799          

HSP 4 Score: 105.916 bits (263), Expect = 5.742e-22
Identity = 148/617 (23.99%), Postives = 245/617 (39.71%), Query Frame = 2
Query:  137 ELVKPIDFESVYLQNKNNISNDPNRVLVKIPDNDVKINKVSRKETVYNNGVPTNIHEIFDCNLLAKLCVDFYTSEWTATCYKDFTYNSSFWTLPNVHNQLTMAKEQKFIIXXXXXXXXXXLLTFKTKGSYFESNLAICDRNAYQKHLKHREDELANTSSNAGINYSKAAVPELLSFSLNELSDGSTVLKESMPRDGHEQI--IVYLDNV------DSLRELGGYWILLSFKGKQSESY---LFTGGNDNQKLWANKLKDAI---------ESETKTKQIERPVSS----ESIERS-EETVHGMLSKFLQENEQSAVILRKKDHQKILVIYSEIRNQIKMKSQQTPIYDIGIIEKSQLDDCHIRPQV---EQSIPKTFIKLTANRFITSVGISDENSNPKGVIP-AEPFFISFSLFHIADGRRISEEFYWNPNRPQIEDLLPSDLFAYKFGGHPVHA--------TINGNCDNRTPLNLPTMSDRVLQSTNSFILKVPCLPDKICLFIKSEKVFSGAIGPTVDKYIKSGGSLLKKKDREEELFVENPDV-KTGASINKTMSVYCANIGHYRMPFGWTACRLNIKGKNCLR-------FHKYENNKTSEDDIIKLVQNM 1852
            ++++P+D+E+V  Q K  I +DP R L+  P +DV    + R     N  VP N       +L AK C+  Y + W    Y    Y+  F  LP    +      Q F +DE  E                + + ++C     Q+    ++  L   + N+ ++ S   V +   F L++L DGS +L        +++    +YLD+         +R  G       F+ K  E Y   L        + W N +K A+          SET    ++   SS    ESI  S   ++H  L K+ +E +Q + + R +  QKI  +  E++                     +LD   I P V   E+   +  +    N      G   E ++  GV+   EPFFIS +LF ++ G +IS +F+ + N P + +++ +        G P  A         +NG   +  PL L  +++ +L      I  V      I L  + EKV    I    D YIK                    D+ KT   + KT    C  +G YRMPF W A ++    +  L         ++ +++K S +D+IKL+ ++
Sbjct:   38 KIIEPLDYENVVFQRKAQIHSDPQRDLLLWPADDVSEAHIDRHRRTINPSVPQNAENEAK-SLFAKECIKMYNTNWHVINYNYEAYSGDFRMLPCKGMKTEKLPSQVFEVDEGEEVR--------------DDSSSLCS----QRGGVMKQGWLQKANINSSLSVS-MKVFKRRYFYLSQLPDGSYILNSYKDEKNYKESKGSIYLDSCIDVVPCPKMRRNG-------FELKMQERYSHYLAADSEAEMEDWVNTIKQALLSTMEDRRNGSETSEGSLDDDSSSQGKPESITESFGRSLHPELMKYARETDQLSKMSRNEGRQKIFSLDPEVQ---------------------RLDFSGIEPDVKPFEERFGRRIMVSCHNLTFNLQGCVSEKND--GVLTNVEPFFISLALFDLSKGCKISADFHVDLNPPCVREMIQTG-----SAGTPTEAGEDENDPVKMNG---HGLPL-LQRVAESLLHFPTQGIFSVTNPHADIFLLARVEKVLQNGITHCADPYIKPS------------------DISKTVQKVLKTAKQTCQRLGQYRMPFAWAAKQVFKDSQGTLDTDGKFSPLYRQDSSKISTEDLIKLLTDL 577          
BLAST of Dedicator of cytokinesis vs. Ensembl Zebrafish
Match: dock11 (dedicator of cytokinesis 11 [Source:ZFIN;Acc:ZDB-GENE-060503-196])

HSP 1 Score: 435.261 bits (1118), Expect = 7.526e-123
Identity = 283/839 (33.73%), Postives = 428/839 (51.01%), Query Frame = 2
Query: 5138 KDIFVCLLHIFHTISSDDLKATICNLTVQERLEFLQLLILSIHHLKYQGRKVINNFESISTG---CAKSKIQLRP--HGPRSSVTAILDDVDHGD-----------------HKAYLEGNVSTEVGLIVLDVLSAYCSAFKQEILTYTPDHVIFKKIVDIYLTLLSVNQSEIVLKHVFVSMRVFVSTFAKVLFANCHNVISDLSLHTLRFLDTRFTSVRIEACGFLYRMMRSSYDTFNKPGINRVHLQMIVAVSKLDRTVGI----RFKESLNYLKRLAEIEMXXXXXXXXXXXXXGTPTGTSKSITIGVHSTTKLSMQTFFEEVTDLTQRIRTVLMATVQMNEHVDDPEMQVDLQYSLAKSYSSNPALRRTWLEKIYAIHNKNNSRAEMAMCKAHIVAMIVEYLRRKEQYSMSCANFKAISPNIPLEESGMRDDSVQLEVHYTKEEVVKLLRELAHEFDAGCLWEVLRHVYKLVIPIYERKRDYEQLAEIYKHMSDGYNKIKTAESTNQRIIGSYYRVVLYGKP-FDSLAGKVFIYRLDSGKQFCVVREELQKLFSKKYGAGKVQMLVE-NHIDRSKLDPELASIQVTHVEPFFNEDEELERHSMFERQYNISKFMLETPFVKMNHVEHESRWKKYKEHDIDGVLKSKQTDDLSIQWKRRTILTVEASFPHLKRRLEVISIKEIDFSPIERAIDEIQLKNRQLAMHLAYXXXXXXXXXXXXXXXXXXXXXVGSSQTRANNIPLLMDMHMSGALLPQVNQGPMAYARVFLHKETQANYSQEKVKQLKIQFMEFLTLCYLLLRDFNE-LMSHIQQQKYIAMREALDSYRVELSNLINEEI 7567
            + + +C LHI  T+S D L A    +  Q+ + FL LL + I   +Y GR+ I+  +          + K Q  P   G  S + A L      D                 H++ LEGN STEV L VLDVLS +  +FK ++L     + +  KI D YLTLL V QSE  +KH+F S+R F+  F   LF     +   L    L+   ++ + +R EA   LY +MR ++D   +    RVHLQ+I+AVS+L   V +    RF+ESL+ +   A                               +S   +   TF  EV  LT RIRTVLMAT QM EH  DPEM +DLQYSLA+SY+S P LRRTWL+ +   H+KN   +E AMC  H+ A++ EYL RK+ +    A FK  + NI  EE  M++D    +V+YT++ +V+ L            +E++ H+ +L+IP+YE++ ++E+L  +Y  +   Y KI     + +R++G+Y+RV  +G+  F+   GK +IY+         +   L KL+ +K+G+  V+++ + N +++  LD + A IQVT+V+PFF+E E  ER + FE+ +NI +F+ ETPF                       L  K+   +  Q KRRT+LT   +FP++K+R+EV+  K  +  PI+ AIDE++ K+ +LA                             S    N I L   + + G +  QVN GPMAYAR FL  E+++  S +KVK LK  F +F+  C + L D NE L+   Q + +  ++    S   ELS +I+E+I
Sbjct: 1285 RGLLLCYLHIVRTLSDDTLTAYWSKVNPQDIMNFLSLLEICIIQFRYVGRRNISRSQEPWVSKLFSPERKSQTMPVLRGRASLMQAKLQQFSTMDTSLTLNMAGGPTEAEINHQSLLEGNTSTEVCLTVLDVLSLFTQSFKNQLLDSDGHNALMTKIFDTYLTLLKVGQSETAIKHIFASLRAFIVKFQVPLFKGRVVLCGSLCYEVLKCCMSKLSVLRGEASALLYLLMRHNFDYTKRKSFLRVHLQIIIAVSQLIADVALTGSSRFQESLSIINNFA-------------------------------NSDKIMKTTTFPSEVKGLTMRIRTVLMATAQMREHEKDPEMLLDLQYSLARSYASTPELRRTWLDSMARAHSKNGDFSEAAMCNVHVAALMAEYLHRKKLFPSGLAAFKRTTQNID-EEGAMKEDIGMQDVYYTEDVLVEQLEVCVESLWKAERFELITHIARLIIPVYEKRHEFEKLRRLYDTLQRAYAKILEVMQSGRRLLGTYFRVAFFGQGFFEEEDGKEYIYKEPKLTTLPEISHRLLKLYGEKFGSENVKIIQDSNKVNQKDLDSKFAYIQVTYVKPFFDEKEMAERKTDFEKCHNIQRFVFETPF----------------------TLTGKKQGGVEEQCKRRTVLTTANTFPYVKKRIEVVGEKHTELKPIDVAIDEMKEKSSELAKL--------------------------CSNQEVNMITL--QLKLQGCVSVQVNAGPMAYARAFL-DESKSGQSNKKVKDLKEIFRQFVNACSMAL-DINERLIKEDQYEYHEGLKANFKSMVKELSEIIHEQI 2039          

HSP 2 Score: 138.272 bits (347), Expect = 1.059e-31
Identity = 153/561 (27.27%), Postives = 239/561 (42.60%), Query Frame = 2
Query: 3023 PRSSRDLEDIFSIKSDDVEQSHDTTVQWVDGQKSIFTVVIRPETTIFTQSTHLHKFFQVCSEKLDELTNPTVVEKKESIFTKPRSGSDPTTPKPVSDDTLLLQTSNKDVEIKNAIKALATVNVTNLIKFFAPTFNQLLHVVVCTAISHSEISKTAVTSMITLASSLRTPSMESLSSKATKRNTKIIKSYIKFAFDAEKIVPTKVKRTVHESLIQAISELIRPPFRDTXXXXXXXXXXXXXYSIITKSMIQSLTKQSKITIDKGGDKFFSTSYMDSLQNMIHLIINCILEITSTVGNQSGMNGQLRPNNSFQSLATSANKDLARFISRLFNVMDRGFIFQIIHQYMKIFIARINAYSGHREHLCRMKFDFLEIVTNHEHYLPLNLLKIINPSDKGQSVRKR-------------QAPPSLELILSETYCRQHYLAGLLLQEVHRQMSDVYSHNAVRRLPFVMLRNLLAKHLFDDRYSSI-NMQARIAALYLPLVSIILENQKSFSLPGNLHTKVNLLNDIYDHSDRSLSARPLSTLSGDTLSTHSSINGSSGDG-AGGSVYG 4660
            P S+  L      KS D+++     ++WVD  K +F V     +TI+TQ  HLH FFQ C                     +  S  +P                    E+   +K L  V    +IKF      QL  V+   +    +++  +   +I + S      +E             ++S++K+ F       ++   T HE L  A++ +++    D N  N  L  S+ F+  + +SM Q L   +++ + +   + F  S+  +LQ ++  I+  I      +  +                A   N  LA FI R    M+RGF F +I+ YM  F  +        + L  MKFDFL  V NHEHY+PLNL     P   G++  +R                 SLE  L+E YC+ H+L GLLL+EV      + +   +R+L   +L+NL+ KH  DDRY++  N QARI  LYLPL  ++ +N    + P  +    N L  +Y   D S+ +R  ST+     S   + NG S  G + GS+YG
Sbjct:  779 PVSANLLAGYLCDKSQDIKKVF-PYIKWVDNAKPLFKVRAYVASTIYTQDLHLHNFFQHCQ------------------LMRSTSQGNPA-------------------ELIKYLKCLHAVETQVVIKFLPTVLVQLFEVLSMASKEGQDVAVNSTRVIIHIVSQCHEEGLEHY-----------LRSFLKYVFRINNAT-SENSVTTHEVLATAVTVILKQT-ADINTCNKLLKYSWFFFETMARSMAQYLMDGNRMKMPRA--QRFPESFQQALQCLLLSIMPHITIRYVEIPEE----------------ARCVNFSLACFIKRCLTFMNRGFAFSLINDYMCGFSLK------DPKVLTEMKFDFLMTVCNHEHYIPLNL-----PMAFGRTKLQRVQDFISYAAECFGVVDQSLEYSLTEDYCKNHFLVGLLLREV---ADGLQACPEIRQLAVAVLKNLMIKHAMDDRYNAFKNQQARICLLYLPLFELLYQNLSQMNSPRQMCR--NGLGLMY-RDDLSVDSRRSSTIVDKEPSGSVTQNGLSRRGESRGSMYG 1253          

HSP 3 Score: 128.257 bits (321), Expect = 1.161e-28
Identity = 61/158 (38.61%), Postives = 95/158 (60.13%), Query Frame = 2
Query: 2411 LYIYPRTLNFSNQNVFHRARNLSCFVELRDVDKSDAPPLKVFYSRPSRKQPAFDYWSNTSVIYHDSSPTFNEEIKIALPLNLHSKHHLLFRFYHVSCDTAAIPNVREKGSNKKSLETPVGVTWLTLMDQNLNLKSGSFSLPVATQLVPDYLEEKQQSI 2884
            LYIYP+ L + +Q  F +ARN++  V+ +D D+  + PLK  Y +P    P F   +  +V++H+ SP F +EIKI LP+++H KHH+LF FYH+SCD       +     ++ +ET VG +W  L+ ++  +KS    LPV+  L+  YL +K Q I
Sbjct:  646 LYIYPQQLKYDSQKAFDKARNIAVCVQFKDSDEEGSSPLKCIYGKPG--DPLFTTSAFAAVLHHNQSPEFYDEIKIELPVHIHEKHHILFTFYHISCDLG----TKTTSKKREGVETLVGYSWTPLL-KDGRIKSSDLQLPVSANLLAGYLCDKSQDI 796          

HSP 4 Score: 107.457 bits (267), Expect = 2.358e-22
Identity = 148/617 (23.99%), Postives = 244/617 (39.55%), Query Frame = 2
Query:  137 ELVKPIDFESVYLQNKNNISNDPNRVLVKIPDNDVKINKVSRKETVYNNGVPTNIHEIFDCNLLAKLCVDFYTSEWTATCYKDFTYNSSFWTLPNVHNQLTMAKEQKFIIXXXXXXXXXXLLTFKTKGSYFESNLAICDRNAYQKHLKHREDELANTSSNAGINYSKAAVPELLSFSLNELSDGSTVLKESMPRDGHEQI--IVYLDNV------DSLRELGGYWILLSFKGKQSESY---LFTGGNDNQKLWANKLKDAI---------ESETKTKQIERPVSS----ESIERS-EETVHGMLSKFLQENEQSAVILRKKDHQKILVIYSEIRNQIKMKSQQTPIYDIGIIEKSQLDDCHIRPQV---EQSIPKTFIKLTANRFITSVGISDENSNPKGVIP-AEPFFISFSLFHIADGRRISEEFYWNPNRPQIEDLLPSDLFAYKFGGHPVHA--------TINGNCDNRTPLNLPTMSDRVLQSTNSFILKVPCLPDKICLFIKSEKVFSGAIGPTVDKYIKSGGSLLKKKDREEELFVENPDV-KTGASINKTMSVYCANIGHYRMPFGWTACRLNIKGKNCLR-------FHKYENNKTSEDDIIKLVQNM 1852
            ++++P+D+E+V  Q K  I +DP R L+  P +DV    + R     N  VP N       +L AK C+  Y + W    Y    Y+  F  LP    +      Q F +DE                   E + ++C     Q+    ++  L   + N+ ++ S   V +   F L++L DGS +L        +++    +YLD+         +R  G       F+ K  E Y   L        + W N +K A+          SET    ++   SS    ESI  S   ++H  L K+ +E +Q + + R +  QKI  +  E++                     +LD   I P V   E+   +  +    N      G   E ++  GV+   EPFFIS +LF ++ G +IS +F+ + N P + +++ +        G P  A         +NG   +  PL L  +++ +L      I  V      I L  + EKV    I    D YIK                    D+ KT   + KT    C  +G YRMPF W A ++    +  L         ++ +++K S +D+IKL+ ++
Sbjct:   38 KIIEPLDYENVVFQRKAQIHSDPQRDLLLWPADDVSEAHIDRHRRTINPSVPQNAENEAK-SLFAKECIKMYNTNWHVINYNYEAYSGDFRMLPCKGMKTEKLPSQVFEVDEGE-----------------EDSSSLCS----QRGGVMKQGWLQKANINSSLSVS-MKVFKRRYFYLSQLPDGSYILNSYKDEKNYKESKGSIYLDSCIDVVPCPKMRRNG-------FELKMQERYSHYLAADSEAEMEDWVNTIKQALLSTMEDRRNGSETSEGSLDDDSSSQGKPESITESFGRSLHPELMKYARETDQLSKMSRNEGRQKIFSLDPEVQ---------------------RLDFSGIEPDVKPFEERFGRRIMVSCHNLTFNLQGCVSEKND--GVLTNVEPFFISLALFDLSKGCKISADFHVDLNPPCVREMIQTG-----SAGTPTEAGEDENDPVKMNG---HGLPL-LQRVAESLLHFPTQGIFSVTNPHADIFLLARVEKVLQNGITHCADPYIKPS------------------DISKTVQKVLKTAKQTCQRLGQYRMPFAWAAKQVFKDSQGTLDTDGKFSPLYRQDSSKISTEDLIKLLTDL 574          
BLAST of Dedicator of cytokinesis vs. Ensembl Zebrafish
Match: dock11 (dedicator of cytokinesis 11 [Source:ZFIN;Acc:ZDB-GENE-060503-196])

HSP 1 Score: 434.876 bits (1117), Expect = 9.569e-123
Identity = 283/839 (33.73%), Postives = 428/839 (51.01%), Query Frame = 2
Query: 5138 KDIFVCLLHIFHTISSDDLKATICNLTVQERLEFLQLLILSIHHLKYQGRKVINNFESISTG---CAKSKIQLRP--HGPRSSVTAILDDVDHGD-----------------HKAYLEGNVSTEVGLIVLDVLSAYCSAFKQEILTYTPDHVIFKKIVDIYLTLLSVNQSEIVLKHVFVSMRVFVSTFAKVLFANCHNVISDLSLHTLRFLDTRFTSVRIEACGFLYRMMRSSYDTFNKPGINRVHLQMIVAVSKLDRTVGI----RFKESLNYLKRLAEIEMXXXXXXXXXXXXXGTPTGTSKSITIGVHSTTKLSMQTFFEEVTDLTQRIRTVLMATVQMNEHVDDPEMQVDLQYSLAKSYSSNPALRRTWLEKIYAIHNKNNSRAEMAMCKAHIVAMIVEYLRRKEQYSMSCANFKAISPNIPLEESGMRDDSVQLEVHYTKEEVVKLLRELAHEFDAGCLWEVLRHVYKLVIPIYERKRDYEQLAEIYKHMSDGYNKIKTAESTNQRIIGSYYRVVLYGKP-FDSLAGKVFIYRLDSGKQFCVVREELQKLFSKKYGAGKVQMLVE-NHIDRSKLDPELASIQVTHVEPFFNEDEELERHSMFERQYNISKFMLETPFVKMNHVEHESRWKKYKEHDIDGVLKSKQTDDLSIQWKRRTILTVEASFPHLKRRLEVISIKEIDFSPIERAIDEIQLKNRQLAMHLAYXXXXXXXXXXXXXXXXXXXXXVGSSQTRANNIPLLMDMHMSGALLPQVNQGPMAYARVFLHKETQANYSQEKVKQLKIQFMEFLTLCYLLLRDFNE-LMSHIQQQKYIAMREALDSYRVELSNLINEEI 7567
            + + +C LHI  T+S D L A    +  Q+ + FL LL + I   +Y GR+ I+  +          + K Q  P   G  S + A L      D                 H++ LEGN STEV L VLDVLS +  +FK ++L     + +  KI D YLTLL V QSE  +KH+F S+R F+  F   LF     +   L    L+   ++ + +R EA   LY +MR ++D   +    RVHLQ+I+AVS+L   V +    RF+ESL+ +   A                               +S   +   TF  EV  LT RIRTVLMAT QM EH  DPEM +DLQYSLA+SY+S P LRRTWL+ +   H+KN   +E AMC  H+ A++ EYL RK+ +    A FK  + NI  EE  M++D    +V+YT++ +V+ L            +E++ H+ +L+IP+YE++ ++E+L  +Y  +   Y KI     + +R++G+Y+RV  +G+  F+   GK +IY+         +   L KL+ +K+G+  V+++ + N +++  LD + A IQVT+V+PFF+E E  ER + FE+ +NI +F+ ETPF                       L  K+   +  Q KRRT+LT   +FP++K+R+EV+  K  +  PI+ AIDE++ K+ +LA                             S    N I L   + + G +  QVN GPMAYAR FL  E+++  S +KVK LK  F +F+  C + L D NE L+   Q + +  ++    S   ELS +I+E+I
Sbjct: 1244 RGLLLCYLHIVRTLSDDTLTAYWSKVNPQDIMNFLSLLEICIIQFRYVGRRNISRSQEPWVSKLFSPERKSQTMPVLRGRASLMQAKLQQFSTMDTSLTLNMAGGPTEAEINHQSLLEGNTSTEVCLTVLDVLSLFTQSFKNQLLDSDGHNALMTKIFDTYLTLLKVGQSETAIKHIFASLRAFIVKFQVPLFKGRVVLCGSLCYEVLKCCMSKLSVLRGEASALLYLLMRHNFDYTKRKSFLRVHLQIIIAVSQLIADVALTGSSRFQESLSIINNFA-------------------------------NSDKIMKTTTFPSEVKGLTMRIRTVLMATAQMREHEKDPEMLLDLQYSLARSYASTPELRRTWLDSMARAHSKNGDFSEAAMCNVHVAALMAEYLHRKKLFPSGLAAFKRTTQNID-EEGAMKEDIGMQDVYYTEDVLVEQLEVCVESLWKAERFELITHIARLIIPVYEKRHEFEKLRRLYDTLQRAYAKILEVMQSGRRLLGTYFRVAFFGQGFFEEEDGKEYIYKEPKLTTLPEISHRLLKLYGEKFGSENVKIIQDSNKVNQKDLDSKFAYIQVTYVKPFFDEKEMAERKTDFEKCHNIQRFVFETPF----------------------TLTGKKQGGVEEQCKRRTVLTTANTFPYVKKRIEVVGEKHTELKPIDVAIDEMKEKSSELAKL--------------------------CSNQEVNMITL--QLKLQGCVSVQVNAGPMAYARAFL-DESKSGQSNKKVKDLKEIFRQFVNACSMAL-DINERLIKEDQYEYHEGLKANFKSMVKELSEIIHEQI 1998          

HSP 2 Score: 127.102 bits (318), Expect = 2.297e-28
Identity = 61/158 (38.61%), Postives = 95/158 (60.13%), Query Frame = 2
Query: 2411 LYIYPRTLNFSNQNVFHRARNLSCFVELRDVDKSDAPPLKVFYSRPSRKQPAFDYWSNTSVIYHDSSPTFNEEIKIALPLNLHSKHHLLFRFYHVSCDTAAIPNVREKGSNKKSLETPVGVTWLTLMDQNLNLKSGSFSLPVATQLVPDYLEEKQQSI 2884
            LYIYP+ L + +Q  F +ARN++  V+ +D D+  + PLK  Y +P    P F   +  +V++H+ SP F +EIKI LP+++H KHH+LF FYH+SCD       +     ++ +ET VG +W  L+ ++  +KS    LPV+  L+  YL +K Q I
Sbjct:  646 LYIYPQQLKYDSQKAFDKARNIAVCVQFKDSDEEGSSPLKCIYGKPG--DPLFTTSAFAAVLHHNQSPEFYDEIKIELPVHIHEKHHILFTFYHISCDLGT----KTTSKKREGVETLVGYSWTPLL-KDGRIKSSDLQLPVSANLLAGYLCDKSQDI 796          

HSP 3 Score: 105.145 bits (261), Expect = 1.149e-21
Identity = 150/617 (24.31%), Postives = 247/617 (40.03%), Query Frame = 2
Query:  137 ELVKPIDFESVYLQNKNNISNDPNRVLVKIPDNDVKINKVSRKETVYNNGVPTNIHEIFDCNLLAKLCVDFYTSEWTATCYKDFTYNSSFWTLPNVHNQLTMAKEQKFIIXXXXXXXXXXLLTFKTKGSYFESNLAICDRNAYQKHLKHREDELANTSSNAGINYSKAAVPELLSFSLNELSDGSTVLKESMPRDGHEQI--IVYLDN-VD-----SLRELGGYWILLSFKGKQSESY---LFTGGNDNQKLWANKLKDAI---------ESETKTKQIERPVSS----ESIERS-EETVHGMLSKFLQENEQSAVILRKKDHQKILVIYSEIRNQIKMKSQQTPIYDIGIIEKSQLDDCHIRPQV---EQSIPKTFIKLTANRFITSVGISDENSNPKGVIP-AEPFFISFSLFHIADGRRISEEFYWNPNRPQIEDLLPSDLFAYKFGGHPVHA--------TINGNCDNRTPLNLPTMSDRVLQSTNSFILKVPCLPDKICLFIKSEKVFSGAIGPTVDKYIKSGGSLLKKKDREEELFVENPDV-KTGASINKTMSVYCANIGHYRMPFGWTACRLNIKGKNCLR-------FHKYENNKTSEDDIIKLVQNM 1852
            ++++P+D+E+V  Q K  I +DP R L+  P +DV    + R     N  VP N  E    +L AK C+  Y + W    Y    Y+  F  LP    +      Q F +DE                   E + ++C     Q+    ++  L   + N+ ++ S   V +   F L++L DGS +L        +++    +YLD+ +D      +R  G       F+ K  E Y   L        + W N +K A+          SET    ++   SS    ESI  S   ++H  L K+ +E +Q + + R +  QKI  +  E++                     +LD   I P V   E+   +  +    N      G   E ++  GV+   EPFFIS +LF ++ G +IS +F+ + N P + +++ +        G P  A         +NG   +  PL L  +++ +L      I  V      I L  + EKV    I    D YIK                    D+ KT   + KT    C  +G YRMPF W A ++    +  L         ++ +++K S +D+IKL+ ++
Sbjct:   38 KIIEPLDYENVVFQRKAQIHSDPQRDLLLWPADDVSEAHIDRHRRTINPSVPQNA-ENEAKSLFAKECIKMYNTNWHVINYNYEAYSGDFRMLPCKGMKTEKLPSQVFEVDEGE-----------------EDSSSLCS----QRGGVMKQGWLQKANINSSLSVS-MKVFKRRYFYLSQLPDGSYILNSYKDEKNYKESKGSIYLDSCIDVVPCPKMRRNG-------FELKMQERYSHYLAADSEAEMEDWVNTIKQALLSTMEDRRNGSETSEGSLDDDSSSQGKPESITESFGRSLHPELMKYARETDQLSKMSRNEGRQKIFSLDPEVQ---------------------RLDFSGIEPDVKPFEERFGRRIMVSCHNLTFNLQGCVSEKND--GVLTNVEPFFISLALFDLSKGCKISADFHVDLNPPCVREMIQTG-----SAGTPTEAGEDENDPVKMNG---HGLPL-LQRVAESLLHFPTQGIFSVTNPHADIFLLARVEKVLQNGITHCADPYIKPS------------------DISKTVQKVLKTAKQTCQRLGQYRMPFAWAAKQVFKDSQGTLDTDGKFSPLYRQDSSKISTEDLIKLLTDL 574          

HSP 4 Score: 98.9821 bits (245), Expect = 8.226e-20
Identity = 75/187 (40.11%), Postives = 103/187 (55.08%), Query Frame = 2
Query: 4106 LCRMKFDFLEIVTNHEHYLPLNLLKIINPSDKGQSVRKRQAPPSLELILSETYCRQHYLAGLLLQEVHRQMSDVYSHNAVRRLPFVMLRNLLAKHLFDDRYSSI-NMQARIAALYLPLVSIILENQKSFSLPGNLHTKVNLLNDIYDHSDRSLSARPLSTLSGDTLSTHSSINGSSGDGAG-GSVYG 4660
            L  MKFDFL  V NHEHY+PLNL     P   G++  +R    SLE  L+E YC+ H+L GLLL+EV      + +   +R+L   +L+NL+ KH  DDRY++  N QARI  LYLPL  ++ +N    + P  +    N L  +Y   D S+ +R  ST+     S   + NG S  G   GS+YG
Sbjct: 1037 LTEMKFDFLMTVCNHEHYIPLNL-----PMAFGRTKLQRVQDQSLEYSLTEDYCKNHFLVGLLLREV---ADGLQACPEIRQLAVAVLKNLMIKHAMDDRYNAFKNQQARICLLYLPLFELLYQNLSQMNSPRQMCR--NGLGLMY-RDDLSVDSRRSSTIVDKEPSGSVTQNGLSRRGESRGSMYG 1212          
BLAST of Dedicator of cytokinesis vs. Ensembl Zebrafish
Match: dock9b (dedicator of cytokinesis 9b [Source:ZFIN;Acc:ZDB-GENE-090916-2])

HSP 1 Score: 421.394 bits (1082), Expect = 1.709e-118
Identity = 271/857 (31.62%), Postives = 432/857 (50.41%), Query Frame = 2
Query: 5120 LNDKTQKDIFVCLLHIFHTISSDDLKATICNLTVQERLEFLQLLILSIHHLKYQGRKVIN-----------NFESISTGCAKSK---IQLRPH--GPRSSVTAILDDVDHGDHKA-YLEGNVSTEVGLIVLDVLSAYCSAFKQEILTYTPDHVIFKKIVDIYLTLLSVNQSEIVLKHVFVSMRVFVSTFAKVLFANCHNVISDLSLHTLRFLDTRFTSVRIEACGFLYRMMRSSYDTFNKPGINRVHLQMIVAVSKLDRTV----GIRFKESLNYLKRLAEIEMXXXXXXXXXXXXXGTPTGTSKSITIGVHSTTKLSMQTFFEEVTDLTQRIRTVLMATVQMNEHVDDPEMQVDLQYSLAKSYSSNPALRRTWLEKIYAIHNKNNSRAEMAMCKAHIVAMIVEYLRRKEQYSMSCANFKAISPNIPLEESGMRDDSVQLEVHYTKEEVVKLLRELAHEFDAGCLWEVLRHVYKLVIPIYERKRDYEQLAEIYKHMSDGYNKIKTAESTNQRIIGSYYRVVLYGKP-FDSLAGKVFIYRLDSGKQFCVVREELQKLFSKKYGAGKVQMLVEN-HIDRSKLDPELASIQVTHVEPFFNEDEELERHSMFERQYNISKFMLETPFVKMNHVEHESRWKKYKEHDIDGVLKSKQTDDLSIQWKRRTILTVEASFPHLKRRLEVISIKEIDFSPIERAIDEIQLKNRQLAMHLAYXXXXXXXXXXXXXXXXXXXXXVGSSQTRANNIPLLMDMHMSGALLPQVNQGPMAYARVFLHKETQANYSQEKVKQLKIQFMEFLTLCYLLLRDFNELMSHIQQQKYIAMREALDSYRVELSNLINEEICVFEDISVISTSALSDDV 7621
            L+ +  K++ +C LH+  ++S D L       T  E ++F  L+ + +H  +Y G++ I            + +S++   ++++   +  R H  G   +         H D  A  LE N+STEV L VLD LS +   FK ++      + + KK+  ++L  L + QSE  LK VF S+R F+  F    F    ++ + L    L+  +++ +S+R +A   LY +M+S+++   +    R HLQ+++AVS+L   V    G RF++SL+ +   A                               +S   +    F  +V DLT+RIRTVLMAT QM EH  DPEM VDLQYSLAKSY+S P LR+TWL+ +  IH KN   +E AMC  H+ A++ EYL+RK  +   C  F+ I+PNI  EE+ M +D    +VH+ +E +++LL   A        +E++  +YKL+IPIYE++RD+E+LA +Y  +   Y K+     + +R++G+++RV  +G+  F+   GK +IY+         + + L KL+S K+G   V+M+ ++  ++   L+ + A IQVTHV P+  E E  ER + FER +NI +F+ ETPF +                        K+   +  Q KRRT+LT    FP++K+R+ V+     D SPIE AIDE+  K  +L    A ++                               + + + + G++  QVN GP+AYAR FL       Y   KVKQLK  F +F+  C   L     L+   QQ+ +  M+ +      ELSN+++E+I     +   + SALSD +
Sbjct: 1279 LDREEIKNLLMCFLHVLKSMSEDALFTYWNKATTSELMDFFTLVEVCLHQFRYMGKRFIARSQDGVGFMVPDRKSLTLPVSRNRGSVMHTRLHQLGSLENSHTFNHTYCHADADACLLEANISTEVCLTVLDTLSVFIMGFKTQLCADLGHNPLMKKVFQVHLCFLQIPQSETALKQVFTSLRTFIYKFPCTFFDGRADMCACLCYEILKCCNSKLSSIRSDAAHLLYFLMKSNFEYNGRKSFVRTHLQVVIAVSQLIADVIGIGGTRFQQSLSIINNCA-------------------------------NSDKTVKHTAFPSDVKDLTKRIRTVLMATEQMKEHEKDPEMLVDLQYSLAKSYTSTPELRKTWLDSMAKIHVKNGDLSEAAMCYVHVAALVAEYLKRKGMFRQGCCAFRVITPNID-EEAAMMEDVGMQDVHFNEEVLMELLEACADGLWKAERYELISDIYKLIIPIYEQRRDFEKLAHLYDTLHRAYTKVMEVMHSGKRLLGTFFRVAFFGQGFFEDEDGKEYIYKEPKFTPLSEISQRLLKLYSDKFGQENVKMIQDSGRVNPKDLEAKFAYIQVTHVTPYLEEKELEERKTDFERSHNIRRFVFETPFTE----------------------SGKRHGGVEEQCKRRTVLTTTHCFPYVKKRIAVMYQHHTDLSPIEVAIDEMSGKVAELRALCATSEVDM----------------------------IRLQLKLQGSISVQVNAGPLAYARAFLDDACAKKYPDNKVKQLKEVFRQFVEACGQALAVNERLIKEDQQEYHDEMKASYRDLARELSNIMHEQISA---VDGGTKSALSDSL 2050          

HSP 2 Score: 251.906 bits (642), Expect = 2.491e-66
Identity = 195/689 (28.30%), Postives = 309/689 (44.85%), Query Frame = 2
Query: 2411 LYIYPRTLNFSNQNVFHRARNLSCFVELRDVDKSDAPPLKVFYSRPSRKQPAFDYWSNTSVIYHDSSPTFNEEIKIALPLNLHSKHHLLFRFYHVSCDTAAIPNVREKGSNKKSLETPVGVTWLTLMDQNLNLKSGSFSLPVATQLVPDYLEEKQQSIYYKKDSLWKLSTSFGQPKPRNSSTDKVIDESVNKRHSGPTFKSYINPRSSRDLEDIFSIKSDDVEQSHDTTVQWVDGQKSIFTVVIRPETTIFTQSTHLHKFFQVCSEKLDELTNPTVVEKKESIFTKPRSGSDPTTPKPVSDDTLLLQTSNKDVEIKNAIKALATVNVTNLIKFFAPTFNQLLHVVVCTAISHSEISKTAVTSMITLASSLRTPSMESLSSKATKRNTKIIKSYIKFAFDAEKIVPTKVKRTVHESLIQAISELIRPPFRDTXXXXXXXXXXXXXYSIITKSMIQSLTKQSKITIDKGGDKFFSTSYMDSLQNMIHLIINCILEITSTVGNQSGMNGQLRPNNSFQSLATSANKDLARFISRLFNVMDRGFIFQIIHQYMKIFIARINAYSGHREHLCRMKFDFLEIVTNHEHYLPLNLLKIINPSDKGQSVRKRQAPPSLELILSETYCRQHYLAGLLLQEVHRQMSDVYSHNAVRRLPFVMLRNLLAKHLFDDRYSSINMQARIAALYLPLVSIILEN 4477
            LY+YP+ L + NQ  F +ARN++  VE R+ D+ DA  LK  Y RP    P F   +  +V++H  +P F +EIKI LP  LH KHHLLF FYH+SCD++           +  +ETPVG  WL L+     + S    + VA+ L   YL                                    E V+K HS P  K                               WVDG + +F V     +TI+TQ                       +      F   +SG+    P+P             + E+   +K+L  +    +I F     NQ++HV+  T+ ++ +++      M+ + +      +E             ++SY+K+ F  E       K TVHE L +A++ +++P   D    N  L  S+ F+  + KSM Q L +  K+ + +  ++ F+ S+  +++ ++++++  I     T   +  ++            A +AN  LA FI R F  MDRGF+F+ I+ Y+  F+       G  + L   KF+FL +  NHEHY+PLNL     P   G+   +R     L+  L++ +CR H+L GLLL+EV   + +      VR++   +L++L+ KH FDDRY S + QAR+A LYLPL  ++ EN
Sbjct:  636 LYVYPKHLKYDNQKSFAKARNIAVCVEFRESDEEDAQALKCIYGRPG--GPVFTKHAYAAVLHHQQNPEFYDEIKIELPTQLHEKHHLLFTFYHISCDSST--------KKRDIVETPVGSAWLPLLKDGRVVMSEQ-HISVASNLPNGYLS---------------------------------CQEGVSK-HSSPEIK-------------------------------WVDGGRPLFRVSTHLVSTIYTQD--------------------QHLHNFFHHFHSMQSGA----PRPT------------EGELVKYLKSLHAMEGHVMINFLPTILNQMIHVL--TSATNEDVAVNTTRVMVHIVAQCHEEGLE-----------HYLRSYVKYVFKTESYSNGNSK-TVHEELAKAMTSILKPS-TDFLTSNKLLKYSWYFFEALVKSMAQYLMESGKVKLSR--NQRFTASFHHAVETLVNMLMPHI-----TQKYKDNLDA-----------ARNANHSLAVFIKRCFTFMDRGFVFKQINNYITCFVP------GDPKTLYEFKFEFLRVACNHEHYVPLNL-----PMPFGKGRIQRFQDLQLDYSLTDDFCRNHFLVGLLLREVCGALQEF---GEVRQIAIQVLKSLMIKHTFDDRYVSKSQQARLATLYLPLFGLLQEN 1165          

HSP 3 Score: 77.7962 bits (190), Expect = 2.144e-13
Identity = 56/203 (27.59%), Postives = 84/203 (41.38%), Query Frame = 2
Query: 1265 EPFFISFSLFHIADGRRISEEFYWNPNRPQIEDLLPSDLFAYKFGGHPVHATINGNCDNRTPLNLPTMSDRVLQSTNSFILKVPCLPDKICLFIKSEKVFSGAIGPTVDKYIKSGGSLLKKKDREEELFVENPDVKTGASINKTMSVYCANIGHYRMPFGWTACRLNIKGKNCL----RF---HKYENNKTSEDDIIKLVQNM 1852
            EPFF+  SLF + + R+IS +F+ + N P +  L+PS               ING  D      L +    +L      +  V C    I L  + EKV  G I    + Y+KS  S                  K    + K   + C+ +G YRMPF W A  +       L    RF   ++ ++NK SE+D+ KL+ + 
Sbjct:  387 EPFFVVLSLFDVQNSRKISADFHVDLNHPLVRSLIPSP-----------SMQINGGVDTPHGETLLSELQGMLHYPKKGVFSVTCPHPDIFLVARIEKVLQGGITHCAEPYMKSSDS-----------------SKVAQKVLKNAKMACSRLGQYRMPFAWAARPVFKDASGTLDKSARFSALYRQDSNKLSEEDLFKLLADF 561          

HSP 4 Score: 54.6842 bits (130), Expect = 2.014e-6
Identity = 29/95 (30.53%), Postives = 52/95 (54.74%), Query Frame = 2
Query:  137 ELVKPIDFESVYLQNKNNISNDPNRVLVKIPDNDVKINKVSRKETVYNNGVPTNIHEIFDCNLLAKLCVDFYTSEWTATCYKDFTYNSSFWTLPN 421
            ++++P+D+E+V +Q K  I +D  R +++ P +D +I+ + R+     + VP    E    +LL + C+  Y S+W    YK   Y+  F  LPN
Sbjct:   43 KVIEPLDYENVLVQRKTQILSDVLRDMLQFPIDDFQISTLKRQGRTLYSSVPDGA-EKRASSLLVQECIKTYNSDWHVVNYKYEDYSGDFRQLPN 136          
BLAST of Dedicator of cytokinesis vs. Ensembl Zebrafish
Match: dock9b (dedicator of cytokinesis 9b [Source:ZFIN;Acc:ZDB-GENE-090916-2])

HSP 1 Score: 418.313 bits (1074), Expect = 1.703e-117
Identity = 265/839 (31.59%), Postives = 424/839 (50.54%), Query Frame = 2
Query: 5120 LNDKTQKDIFVCLLHIFHTISSDDLKATICNLTVQERLEFLQLLILSIHHLKYQGRKVIN-----------NFESISTGCAKSK---IQLRPH--GPRSSVTAILDDVDHGDHKA-YLEGNVSTEVGLIVLDVLSAYCSAFKQEILTYTPDHVIFKKIVDIYLTLLSVNQSEIVLKHVFVSMRVFVSTFAKVLFANCHNVISDLSLHTLRFLDTRFTSVRIEACGFLYRMMRSSYDTFNKPGINRVHLQMIVAVSKLDRTV----GIRFKESLNYLKRLAEIEMXXXXXXXXXXXXXGTPTGTSKSITIGVHSTTKLSMQTFFEEVTDLTQRIRTVLMATVQMNEHVDDPEMQVDLQYSLAKSYSSNPALRRTWLEKIYAIHNKNNSRAEMAMCKAHIVAMIVEYLRRKEQYSMSCANFKAISPNIPLEESGMRDDSVQLEVHYTKEEVVKLLRELAHEFDAGCLWEVLRHVYKLVIPIYERKRDYEQLAEIYKHMSDGYNKIKTAESTNQRIIGSYYRVVLYGKP-FDSLAGKVFIYRLDSGKQFCVVREELQKLFSKKYGAGKVQMLVEN-HIDRSKLDPELASIQVTHVEPFFNEDEELERHSMFERQYNISKFMLETPFVKMNHVEHESRWKKYKEHDIDGVLKSKQTDDLSIQWKRRTILTVEASFPHLKRRLEVISIKEIDFSPIERAIDEIQLKNRQLAMHLAYXXXXXXXXXXXXXXXXXXXXXVGSSQTRANNIPLLMDMHMSGALLPQVNQGPMAYARVFLHKETQANYSQEKVKQLKIQFMEFLTLCYLLLRDFNELMSHIQQQKYIAMREALDSYRVELSNLINEEI 7567
            L+ +  K++ +C LH+  ++S D L       T  E ++F  L+ + +H  +Y G++ I            + +S++   ++++   +  R H  G   +         H D  A  LE N+STEV L VLD LS +   FK ++      + + KK+  ++L  L + QSE  LK VF S+R F+  F    F    ++ + L    L+  +++ +S+R +A   LY +M+S+++   +    R HLQ+++AVS+L   V    G RF++SL+ +   A                               +S   +    F  +V DLT+RIRTVLMAT QM EH  DPEM VDLQYSLAKSY+S P LR+TWL+ +  IH KN   +E AMC  H+ A++ EYL+RK  +   C  F+ I+PNI  EE+ M +D    +VH+ +E +++LL   A        +E++  +YKL+IPIYE++RD+E+LA +Y  +   Y K+     + +R++G+++RV  +G+  F+   GK +IY+         + + L KL+S K+G   V+M+ ++  ++   L+ + A IQVTHV P+  E E  ER + FER +NI +F+ ETPF +                        K+   +  Q KRRT+LT    FP++K+R+ V+     D SPIE AIDE+  K  +L    A ++                               + + + + G++  QVN GP+AYAR FL       Y   KVKQLK  F +F+  C   L     L+   QQ+ +  M+ +      ELSN+++E++
Sbjct: 1336 LDREEIKNLLMCFLHVLKSMSEDALFTYWNKATTSELMDFFTLVEVCLHQFRYMGKRFIARSQDGVGFMVPDRKSLTLPVSRNRGSVMHTRLHQLGSLENSHTFNHTYCHADADACLLEANISTEVCLTVLDTLSVFIMGFKTQLCADLGHNPLMKKVFQVHLCFLQIPQSETALKQVFTSLRTFIYKFPCTFFDGRADMCACLCYEILKCCNSKLSSIRSDAAHLLYFLMKSNFEYNGRKSFVRTHLQVVIAVSQLIADVIGIGGTRFQQSLSIINNCA-------------------------------NSDKTVKHTAFPSDVKDLTKRIRTVLMATEQMKEHEKDPEMLVDLQYSLAKSYTSTPELRKTWLDSMAKIHVKNGDLSEAAMCYVHVAALVAEYLKRKGMFRQGCCAFRVITPNID-EEAAMMEDVGMQDVHFNEEVLMELLEACADGLWKAERYELISDIYKLIIPIYEQRRDFEKLAHLYDTLHRAYTKVMEVMHSGKRLLGTFFRVAFFGQGFFEDEDGKEYIYKEPKFTPLSEISQRLLKLYSDKFGQENVKMIQDSGRVNPKDLEAKFAYIQVTHVTPYLEEKELEERKTDFERSHNIRRFVFETPFTE----------------------SGKRHGGVEEQCKRRTVLTTTHCFPYVKKRIAVMYQHHTDLSPIEVAIDEMSGKVAELRALCATSEVDM----------------------------IRLQLKLQGSISVQVNAGPLAYARAFLDDACAKKYPDNKVKQLKEVFRQFVEACGQALAVNERLIKEDQQEYHDEMKASYRDLARELSNIMHEQV 2092          

HSP 2 Score: 251.521 bits (641), Expect = 3.694e-66
Identity = 195/689 (28.30%), Postives = 309/689 (44.85%), Query Frame = 2
Query: 2411 LYIYPRTLNFSNQNVFHRARNLSCFVELRDVDKSDAPPLKVFYSRPSRKQPAFDYWSNTSVIYHDSSPTFNEEIKIALPLNLHSKHHLLFRFYHVSCDTAAIPNVREKGSNKKSLETPVGVTWLTLMDQNLNLKSGSFSLPVATQLVPDYLEEKQQSIYYKKDSLWKLSTSFGQPKPRNSSTDKVIDESVNKRHSGPTFKSYINPRSSRDLEDIFSIKSDDVEQSHDTTVQWVDGQKSIFTVVIRPETTIFTQSTHLHKFFQVCSEKLDELTNPTVVEKKESIFTKPRSGSDPTTPKPVSDDTLLLQTSNKDVEIKNAIKALATVNVTNLIKFFAPTFNQLLHVVVCTAISHSEISKTAVTSMITLASSLRTPSMESLSSKATKRNTKIIKSYIKFAFDAEKIVPTKVKRTVHESLIQAISELIRPPFRDTXXXXXXXXXXXXXYSIITKSMIQSLTKQSKITIDKGGDKFFSTSYMDSLQNMIHLIINCILEITSTVGNQSGMNGQLRPNNSFQSLATSANKDLARFISRLFNVMDRGFIFQIIHQYMKIFIARINAYSGHREHLCRMKFDFLEIVTNHEHYLPLNLLKIINPSDKGQSVRKRQAPPSLELILSETYCRQHYLAGLLLQEVHRQMSDVYSHNAVRRLPFVMLRNLLAKHLFDDRYSSINMQARIAALYLPLVSIILEN 4477
            LY+YP+ L + NQ  F +ARN++  VE R+ D+ DA  LK  Y RP    P F   +  +V++H  +P F +EIKI LP  LH KHHLLF FYH+SCD++           +  +ETPVG  WL L+     + S    + VA+ L   YL                                    E V+K HS P  K                               WVDG + +F V     +TI+TQ                       +      F   +SG+    P+P             + E+   +K+L  +    +I F     NQ++HV+  T+ ++ +++      M+ + +      +E             ++SY+K+ F  E       K TVHE L +A++ +++P   D    N  L  S+ F+  + KSM Q L +  K+ + +  ++ F+ S+  +++ ++++++  I     T   +  ++            A +AN  LA FI R F  MDRGF+F+ I+ Y+  F+       G  + L   KF+FL +  NHEHY+PLNL     P   G+   +R     L+  L++ +CR H+L GLLL+EV   + +      VR++   +L++L+ KH FDDRY S + QAR+A LYLPL  ++ EN
Sbjct:  635 LYVYPKHLKYDNQKSFAKARNIAVCVEFRESDEEDAQALKCIYGRPG--GPVFTKHAYAAVLHHQQNPEFYDEIKIELPTQLHEKHHLLFTFYHISCDSST--------KKRDIVETPVGSAWLPLLKDGRVVMSEQ-HISVASNLPNGYLS---------------------------------CQEGVSK-HSSPEIK-------------------------------WVDGGRPLFRVSTHLVSTIYTQD--------------------QHLHNFFHHFHSMQSGA----PRPT------------EGELVKYLKSLHAMEGHVMINFLPTILNQMIHVL--TSATNEDVAVNTTRVMVHIVAQCHEEGLE-----------HYLRSYVKYVFKTESYSNGNSK-TVHEELAKAMTSILKPS-TDFLTSNKLLKYSWYFFEALVKSMAQYLMESGKVKLSR--NQRFTASFHHAVETLVNMLMPHI-----TQKYKDNLDA-----------ARNANHSLAVFIKRCFTFMDRGFVFKQINNYITCFVP------GDPKTLYEFKFEFLRVACNHEHYVPLNL-----PMPFGKGRIQRFQDLQLDYSLTDDFCRNHFLVGLLLREVCGALQEF---GEVRQIAIQVLKSLMIKHTFDDRYVSKSQQARLATLYLPLFGLLQEN 1164          

HSP 3 Score: 77.7962 bits (190), Expect = 2.298e-13
Identity = 56/203 (27.59%), Postives = 84/203 (41.38%), Query Frame = 2
Query: 1265 EPFFISFSLFHIADGRRISEEFYWNPNRPQIEDLLPSDLFAYKFGGHPVHATINGNCDNRTPLNLPTMSDRVLQSTNSFILKVPCLPDKICLFIKSEKVFSGAIGPTVDKYIKSGGSLLKKKDREEELFVENPDVKTGASINKTMSVYCANIGHYRMPFGWTACRLNIKGKNCL----RF---HKYENNKTSEDDIIKLVQNM 1852
            EPFF+  SLF + + R+IS +F+ + N P +  L+PS               ING  D      L +    +L      +  V C    I L  + EKV  G I    + Y+KS  S                  K    + K   + C+ +G YRMPF W A  +       L    RF   ++ ++NK SE+D+ KL+ + 
Sbjct:  386 EPFFVVLSLFDVQNSRKISADFHVDLNHPLVRSLIPSP-----------SMQINGGVDTPHGETLLSELQGMLHYPKKGVFSVTCPHPDIFLVARIEKVLQGGITHCAEPYMKSSDS-----------------SKVAQKVLKNAKMACSRLGQYRMPFAWAARPVFKDASGTLDKSARFSALYRQDSNKLSEEDLFKLLADF 560          

HSP 4 Score: 54.6842 bits (130), Expect = 2.068e-6
Identity = 29/95 (30.53%), Postives = 52/95 (54.74%), Query Frame = 2
Query:  137 ELVKPIDFESVYLQNKNNISNDPNRVLVKIPDNDVKINKVSRKETVYNNGVPTNIHEIFDCNLLAKLCVDFYTSEWTATCYKDFTYNSSFWTLPN 421
            ++++P+D+E+V +Q K  I +D  R +++ P +D +I+ + R+     + VP    E    +LL + C+  Y S+W    YK   Y+  F  LPN
Sbjct:   42 KVIEPLDYENVLVQRKTQILSDVLRDMLQFPIDDFQISTLKRQGRTLYSSVPDGA-EKRASSLLVQECIKTYNSDWHVVNYKYEDYSGDFRQLPN 135          
BLAST of Dedicator of cytokinesis vs. Ensembl Xenopus
Match: DOCK9 (dedicator of cytokinesis 9 [Source:NCBI gene;Acc:100144990])

HSP 1 Score: 438.728 bits (1127), Expect = 8.803e-124
Identity = 278/839 (33.13%), Postives = 437/839 (52.09%), Query Frame = 2
Query: 5138 KDIFVCLLHIFHTISSDDLKATICNLTVQERLEFLQLLILSIHHLKYQGRKVINNFESISTGCAKSKIQLRPHGPRSSVTAILD---DVDHGD----HKAYLEGNVSTEVGLIVLDVLSAYCSAFKQEILTYTPDHVIFKKIVDIYLTLLSVNQSEIVLKHVFVSMRVFVSTFAKVLFANCHNVISDLSLHTLRFLDTRFTSVRIEACGFLYRMMRSSYDTFNKPGINRVHLQMIVAVSKLDRTV----GIRFKESLNYLKRLAEIEMXXXXXXXXXXXXXGTPTGTSKSITIGVHSTTKLSMQTFFEEVTDLTQRIRTVLMATVQMNEHVDDPEMQVDLQYSLAKSYSSNPALRRTWLEKIYAIHNKNNSRAEMAMCKAHIVAMIVEYLRRKEQYSMSCANFKAISPNIPLEESGMRDDSVQLEVHYTKEEVVKLLRELAHEFDAGCLWEVLRHVYKLVIPIYERKRDYEQLAEIYKHMSDGYNKIKTAESTNQRIIGSYYRVVLYGKP-FDSLAGKVFIYRLDSGKQFCVVREELQKLFSKKYGAGKVQMLVEN-HIDRSKLDPELASIQVTHVEPFFNEDEELERHSMFERQYNISKFMLETPFVKMNHVEHESRWKKYKEHDIDGVLKSKQTDDLSIQWKRRTILTVEASFPHLKRRLEVISIKEIDFSPIERAIDEIQLKNRQLAMHLAYXXXXXXXXXXXXXXXXXXXXXVGSSQTRANNIPLLMDMHMSGALLPQVNQGPMAYARVFLHKETQANYSQEKVKQLKIQFMEFLTLCYLLLRDFNELMSHIQQQKYIAMREALDSYR---VELSNLINEEI-CVFEDISVISTS 7603
            K + +  LHI  ++S D L       +  E ++F  +  + +H  +Y G++ I       TG   +++Q       SS+   L       H D    H++ LE N++TEV L +LD LS +  AFK ++L     + + KK+ D+YL  L  NQSE  LK+VF ++R  +  F    +    ++ + L    L+  +++ +S+R +A   LY +MR++++   K    R HLQ+I++VS+L   V    G RF++SL+ +   A                               +S   +   +F  +V DLT+RIRTVLMAT QM EH +DPEM VDLQYSLAKSY+S P LR+TWL+ +  IH K+   +E AMC  H+ A++ EYL RK  +   C+ F+ I+PNI  E S M D  +Q +VH+ ++ +++LL + A        +E++  +YK++IPIYE++RD+E+LA +Y  +   Y+K+     T +R++G+Y+RV  +G+  F+   GK +IY+         + + LQKL+S K+G+  V+M+ ++  ++   LD + A IQVTHV P+F E E  ER + FE+ +NI +F+ E PF                       L  K+   +  QWKRRTILT    FP++K+R+ V+     D +PIE AIDE+  K  +L                              S +  + I L   + + G++  QVN GP+AYARVFL       Y+  K+KQLK  F +F+  C   L   NE +  I++ ++    E   +YR    ELS +++E+I C  E ISV+  S
Sbjct: 1297 KSLLMSFLHILKSMSDDALFTYWNKASTSELMDFFTISEVCLHQFQYMGKRYIAR-----TGMMHARLQ-----QLSSLDNSLTFNHSYGHSDADILHQSSLEANIATEVCLTILDTLSLFTMAFKNQLLADHGHNPLMKKVFDVYLCFLQKNQSETALKNVFTALRCLIYKFPSTFYEGRADMCAALCYEILKCCNSKLSSIRTDASQLLYFLMRNNFEYTGKKSFVRTHLQVIISVSQLIADVVGIGGTRFQQSLSIINNCA-------------------------------NSDRLIKHTSFSSDVKDLTKRIRTVLMATAQMKEHENDPEMLVDLQYSLAKSYASTPELRKTWLDSMARIHVKHGDLSEAAMCYVHVAALVSEYLTRKGMFRQGCSTFRVITPNIDEEASMMEDVGMQ-DVHFNEDVLMELLEQCADGLWKAERYELIADIYKIIIPIYEKRRDFERLAHLYDTLHRAYSKVTEVMHTGKRLLGTYFRVAFFGQGFFEDEDGKEYIYKEPKLTPLSEISQRLQKLYSDKFGSENVKMIQDSGKVNPKDLDSKYAYIQVTHVTPYFEEKELQERKTEFEKSHNIRRFVFEMPF----------------------TLSGKRQGGVEEQWKRRTILTAIHCFPYVKKRIPVMYQHHTDLNPIEVAIDEMSKKVAELRQL--------------------------CSSSEVDMIKL--QLKLQGSVSVQVNAGPLAYARVFLDDTNTKKYADNKIKQLKEVFRQFVEACGQALC-VNERL--IKENQFEYQEEMKANYREMVKELSEIMHEQIWCGEEKISVMPNS 2040          

HSP 2 Score: 273.863 bits (699), Expect = 8.315e-73
Identity = 197/691 (28.51%), Postives = 313/691 (45.30%), Query Frame = 2
Query: 2411 LYIYPRTLNFSNQNVFHRARNLSCFVELRDVDKSDAPPLKVFYSRPSRKQPAFDYWSNTSVIYHDSSPTFNEEIKIALPLNLHSKHHLLFRFYHVSCDTAAIPNVREKGSNKKS--LETPVGVTWLTLMDQNLNLKSGSFSLPVATQLVPDYLEEKQQSIYYKKDSLWKLSTSFGQPKPRNSSTDKVIDESVNKRHSGPTFKSYINPRSSRDLEDIFSIKSDDVEQSHDTTVQWVDGQKSIFTVVIRPETTIFTQSTHLHKFFQVCSEKLDELTNPTVVEKKESIFTKPRSGSDPTTPKPVSDDTLLLQTSNKDVEIKNAIKALATVNVTNLIKFFAPTFNQLLHVVVCTAISHSEISKTAVTSMITLASSLRTPSMESLSSKATKRNTKIIKSYIKFAFDAEKIVPTKVKRTVHESLIQAISELIRPPFRDTXXXXXXXXXXXXXYSIITKSMIQSLTKQSKITIDKGGDKFFSTSYMDSLQNMIHLIINCILEITSTVGNQSGMNGQLRPNNSFQSLATSANKDLARFISRLFNVMDRGFIFQIIHQYMKIFIARINAYSGHREHLCRMKFDFLEIVTNHEHYLPLNLLKIINPSDKGQSVRKRQAPPSLELILSETYCRQHYLAGLLLQEVHRQMSDVYSHNAVRRLPFVMLRNLLAKHLFDDRYSSINMQARIAALYLPLVSIILEN 4477
            LY+YP+ L +  Q  F +ARN++  +E RD D  ++ PLK  Y RP    P F   +  SV++H  +P F +EIKI LP  LH KHHLLF F+HVSCDT++      KG  KK   +E+ VG  WL L+ ++  + +   ++PV+  L   YL  ++  +                                  +HSGP  K                               WVDG K +  V     +T++ Q  HLH FFQ C                     K  SG               +Q    D  +   +K L  +    +I F     NQ+  V+  T  +  E++      +I + +      +ES            ++SY+K+ + AE  + ++ K T+HE L ++++ +++P   D    N  L  S+ F+ ++ KSM Q L + SK+ + +  ++ F  S+  +++ ++++++  I +    +   S                 +AN  LA FI R F  MDRGF+F+ I+ YM  F        G  + L   KF+F  +V NHEHY+PLNL     P   G+    R     L+  L++ +C+ H+L GLLL+EV   + +      +R++   +L+ L+ KH FDDRYSS + QAR+A LYLPL  +++EN
Sbjct:  643 LYVYPKHLKYDGQKAFAKARNIALSIEFRDADDEESQPLKCIYGRPG--GPLFVKNALASVLHHQQNPEFYDEIKIELPTQLHEKHHLLFTFFHVSCDTSS------KGGTKKRDVIESQVGYAWLPLL-KDGRVVTNEQNIPVSANLPAGYLGYQELGM---------------------------------GKHSGPEIK-------------------------------WVDGAKPLLKVATHLVSTVYAQDLHLHNFFQYCQ--------------------KTESG---------------VQAVGSD--LVKYLKGLHAMEGHVMIAFLPTVLNQMCRVL--TRATQEEVAVNVTRVIIHVVALCHEEGLESY-----------LRSYVKYVYKAEPYITSECK-TMHEELAKSMTTILKPS-ADFLTSNKLLKYSWFFFEVLIKSMAQHLVENSKVKLLR--NQRFPASFHHAVETLVNMLMPHITQKYKEIPEAS----------------RNANHSLAFFIKRCFTFMDRGFVFKQINNYMSFFAP------GDPKTLFEYKFEFFRVVCNHEHYIPLNL-----PMPFGKGRIHRYQDLQLDYTLTDDFCKNHFLVGLLLREVGSALQEF---RDIRQIAISVLKGLMIKHSFDDRYSSRSQQARLATLYLPLFGLLIEN 1176          

HSP 3 Score: 73.9442 bits (180), Expect = 4.608e-12
Identity = 64/253 (25.30%), Postives = 103/253 (40.71%), Query Frame = 2
Query: 1127 QLDDCHIRPQV----EQSIPKTFIKLTANRFITSVGISDENSNPKGVIPAEPFFISFSLFHIADGRRISEEFYWNPNRPQIEDLLPSDLFAYKFGGHPVHATINGNCDNRTPLNLPTMSDRVLQSTNSFILKVPCLPDKICLFIKSEKVFSGAIGPTVDKYIKSGGSLLKKKDREEELFVENPDVKTGASINKTMSVYCANIGHYRMPFGWTACRLNIKGKNCL----RF---HKYENNKTSEDDIIKLVQNM 1852
            +LD   I P+V    E+   +  +K     F     +++    P   +  EPFF++ SLF I   R+IS +F  + N   +  ++ +       GG  V  +I G           ++ + +LQ     I  V C    I L  + EKV  G+I    + Y+KS  S                  K    + K     C+ +G YRMPF W A  L       L    RF   ++ ++NK S +D++KL+ + 
Sbjct:  347 KLDFSGIEPEVKPFEEKFGKRILVKCNDLAFNLQSCVAENEEGPTTNV--EPFFVTLSLFDIKTNRKISADFPVDLNHASVRQMICAHSQQLLNGGGDVSQSILG-----------SIQESMLQYPKQGIFSVTCPHTDIFLVARIEKVLQGSIAHCAEPYMKSSDS-----------------AKVAQKVLKNAKQACSRLGQYRMPFAWAARSLFKDSNGTLDKNARFSAIYRQDSNKISNEDMLKLLADF 569          

HSP 4 Score: 54.6842 bits (130), Expect = 3.146e-6
Identity = 30/95 (31.58%), Postives = 47/95 (49.47%), Query Frame = 2
Query:  137 ELVKPIDFESVYLQNKNNISNDPNRVLVKIPDNDVKINKVSRKETVYNNGVPTNIHEIFDCNLLAKLCVDFYTSEWTATCYKDFTYNSSFWTLPN 421
            +L++PID+E+V +Q K  I ND  R ++  P +D +I  + R+       VP N  +    +L    C+  Y S+W    YK   Y+  F  LP 
Sbjct:   57 KLIEPIDYENVIVQKKTQILNDALREMLLFPYDDFQIATLRRQGRYICTTVPENAEKEAQ-SLFVTECIRTYNSDWHVVTYKHEDYSGDFRQLPG 150          
BLAST of Dedicator of cytokinesis vs. Ensembl Xenopus
Match: DOCK9 (dedicator of cytokinesis 9 [Source:NCBI gene;Acc:100144990])

HSP 1 Score: 437.958 bits (1125), Expect = 1.974e-123
Identity = 278/852 (32.63%), Postives = 440/852 (51.64%), Query Frame = 2
Query: 5138 KDIFVCLLHIFHTISSDDLKATICNLTVQERLEFLQLLILSIHHLKYQGRKVI-NNFESISTGCAKSKIQLRP---------HGPRSSVTAILDDV------DHGD----HKAYLEGNVSTEVGLIVLDVLSAYCSAFKQEILTYTPDHVIFKKIVDIYLTLLSVNQSEIVLKHVFVSMRVFVSTFAKVLFANCHNVISDLSLHTLRFLDTRFTSVRIEACGFLYRMMRSSYDTFNKPGINRVHLQMIVAVSKLDRTV----GIRFKESLNYLKRLAEIEMXXXXXXXXXXXXXGTPTGTSKSITIGVHSTTKLSMQTFFEEVTDLTQRIRTVLMATVQMNEHVDDPEMQVDLQYSLAKSYSSNPALRRTWLEKIYAIHNKNNSRAEMAMCKAHIVAMIVEYLRRKEQYSMSCANFKAISPNIPLEESGMRDDSVQLEVHYTKEEVVKLLRELAHEFDAGCLWEVLRHVYKLVIPIYERKRDYEQLAEIYKHMSDGYNKIKTAESTNQRIIGSYYRVVLYGKP-FDSLAGKVFIYRLDSGKQFCVVREELQKLFSKKYGAGKVQMLVEN-HIDRSKLDPELASIQVTHVEPFFNEDEELERHSMFERQYNISKFMLETPFVKMNHVEHESRWKKYKEHDIDGVLKSKQTDDLSIQWKRRTILTVEASFPHLKRRLEVISIKEIDFSPIERAIDEIQLKNRQLAMHLAYXXXXXXXXXXXXXXXXXXXXXVGSSQTRANNIPLLMDMHMSGALLPQVNQGPMAYARVFLHKETQANYSQEKVKQLKIQFMEFLTLCYLLLRDFNELMSHIQQQKYIAMREALDSYR---VELSNLINEEI-CVFEDISVISTS 7603
            K + +  LHI  ++S D L       +  E ++F  +  + +H  +Y G++ I  N E +       K Q  P         H     ++++ + +       H D    H++ LE N++TEV L +LD LS +  AFK ++L     + + KK+ D+YL  L  NQSE  LK+VF ++R  +  F    +    ++ + L    L+  +++ +S+R +A   LY +MR++++   K    R HLQ+I++VS+L   V    G RF++SL+ +   A                               +S   +   +F  +V DLT+RIRTVLMAT QM EH +DPEM VDLQYSLAKSY+S P LR+TWL+ +  IH K+   +E AMC  H+ A++ EYL RK  +   C+ F+ I+PNI  E S M D  +Q +VH+ ++ +++LL + A        +E++  +YK++IPIYE++RD+E+LA +Y  +   Y+K+     T +R++G+Y+RV  +G+  F+   GK +IY+         + + LQKL+S K+G+  V+M+ ++  ++   LD + A IQVTHV P+F E E  ER + FE+ +NI +F+ E PF                       L  K+   +  QWKRRTILT    FP++K+R+ V+     D +PIE AIDE+  K  +L                              S +  + I L   + + G++  QVN GP+AYARVFL       Y+  K+KQLK  F +F+  C   L   NE +  I++ ++    E   +YR    ELS +++E+I C  E ISV+  S
Sbjct: 1296 KSLLMSFLHILKSMSDDALFTYWNKASTSELMDFFTISEVCLHQFQYMGKRYIARNQEGLGPIVHDRKSQTLPVSRNRTGMMHARLQQLSSLDNSLTFNHSYGHSDADILHQSSLEANIATEVCLTILDTLSLFTMAFKNQLLADHGHNPLMKKVFDVYLCFLQKNQSETALKNVFTALRCLIYKFPSTFYEGRADMCAALCYEILKCCNSKLSSIRTDASQLLYFLMRNNFEYTGKKSFVRTHLQVIISVSQLIADVVGIGGTRFQQSLSIINNCA-------------------------------NSDRLIKHTSFSSDVKDLTKRIRTVLMATAQMKEHENDPEMLVDLQYSLAKSYASTPELRKTWLDSMARIHVKHGDLSEAAMCYVHVAALVSEYLTRKGMFRQGCSTFRVITPNIDEEASMMEDVGMQ-DVHFNEDVLMELLEQCADGLWKAERYELIADIYKIIIPIYEKRRDFERLAHLYDTLHRAYSKVTEVMHTGKRLLGTYFRVAFFGQGFFEDEDGKEYIYKEPKLTPLSEISQRLQKLYSDKFGSENVKMIQDSGKVNPKDLDSKYAYIQVTHVTPYFEEKELQERKTEFEKSHNIRRFVFEMPF----------------------TLSGKRQGGVEEQWKRRTILTAIHCFPYVKKRIPVMYQHHTDLNPIEVAIDEMSKKVAELRQL--------------------------CSSSEVDMIKL--QLKLQGSVSVQVNAGPLAYARVFLDDTNTKKYADNKIKQLKEVFRQFVEACGQALC-VNERL--IKENQFEYQEEMKANYREMVKELSEIMHEQIWCGEEKISVMPNS 2062          

HSP 2 Score: 273.478 bits (698), Expect = 9.360e-73
Identity = 197/691 (28.51%), Postives = 313/691 (45.30%), Query Frame = 2
Query: 2411 LYIYPRTLNFSNQNVFHRARNLSCFVELRDVDKSDAPPLKVFYSRPSRKQPAFDYWSNTSVIYHDSSPTFNEEIKIALPLNLHSKHHLLFRFYHVSCDTAAIPNVREKGSNKKS--LETPVGVTWLTLMDQNLNLKSGSFSLPVATQLVPDYLEEKQQSIYYKKDSLWKLSTSFGQPKPRNSSTDKVIDESVNKRHSGPTFKSYINPRSSRDLEDIFSIKSDDVEQSHDTTVQWVDGQKSIFTVVIRPETTIFTQSTHLHKFFQVCSEKLDELTNPTVVEKKESIFTKPRSGSDPTTPKPVSDDTLLLQTSNKDVEIKNAIKALATVNVTNLIKFFAPTFNQLLHVVVCTAISHSEISKTAVTSMITLASSLRTPSMESLSSKATKRNTKIIKSYIKFAFDAEKIVPTKVKRTVHESLIQAISELIRPPFRDTXXXXXXXXXXXXXYSIITKSMIQSLTKQSKITIDKGGDKFFSTSYMDSLQNMIHLIINCILEITSTVGNQSGMNGQLRPNNSFQSLATSANKDLARFISRLFNVMDRGFIFQIIHQYMKIFIARINAYSGHREHLCRMKFDFLEIVTNHEHYLPLNLLKIINPSDKGQSVRKRQAPPSLELILSETYCRQHYLAGLLLQEVHRQMSDVYSHNAVRRLPFVMLRNLLAKHLFDDRYSSINMQARIAALYLPLVSIILEN 4477
            LY+YP+ L +  Q  F +ARN++  +E RD D  ++ PLK  Y RP    P F   +  SV++H  +P F +EIKI LP  LH KHHLLF F+HVSCDT++      KG  KK   +E+ VG  WL L+ ++  + +   ++PV+  L   YL  ++  +                                  +HSGP  K                               WVDG K +  V     +T++ Q  HLH FFQ C                     K  SG               +Q    D  +   +K L  +    +I F     NQ+  V+  T  +  E++      +I + +      +ES            ++SY+K+ + AE  + ++ K T+HE L ++++ +++P   D    N  L  S+ F+ ++ KSM Q L + SK+ + +  ++ F  S+  +++ ++++++  I +    +   S                 +AN  LA FI R F  MDRGF+F+ I+ YM  F        G  + L   KF+F  +V NHEHY+PLNL     P   G+    R     L+  L++ +C+ H+L GLLL+EV   + +      +R++   +L+ L+ KH FDDRYSS + QAR+A LYLPL  +++EN
Sbjct:  639 LYVYPKHLKYDGQKAFAKARNIALSIEFRDADDEESQPLKCIYGRPG--GPLFVKNALASVLHHQQNPEFYDEIKIELPTQLHEKHHLLFTFFHVSCDTSS------KGGTKKRDVIESQVGYAWLPLL-KDGRVVTNEQNIPVSANLPAGYLGYQELGM---------------------------------GKHSGPEIK-------------------------------WVDGAKPLLKVATHLVSTVYAQDLHLHNFFQYCQ--------------------KTESG---------------VQAVGSD--LVKYLKGLHAMEGHVMIAFLPTVLNQMCRVL--TRATQEEVAVNVTRVIIHVVALCHEEGLESY-----------LRSYVKYVYKAEPYITSECK-TMHEELAKSMTTILKPS-ADFLTSNKLLKYSWFFFEVLIKSMAQHLVENSKVKLLR--NQRFPASFHHAVETLVNMLMPHITQKYKEIPEAS----------------RNANHSLAFFIKRCFTFMDRGFVFKQINNYMSFFAP------GDPKTLFEYKFEFFRVVCNHEHYIPLNL-----PMPFGKGRIHRYQDLQLDYTLTDDFCKNHFLVGLLLREVGSALQEF---RDIRQIAISVLKGLMIKHSFDDRYSSRSQQARLATLYLPLFGLLIEN 1172          

HSP 3 Score: 74.3294 bits (181), Expect = 3.805e-12
Identity = 64/253 (25.30%), Postives = 103/253 (40.71%), Query Frame = 2
Query: 1127 QLDDCHIRPQV----EQSIPKTFIKLTANRFITSVGISDENSNPKGVIPAEPFFISFSLFHIADGRRISEEFYWNPNRPQIEDLLPSDLFAYKFGGHPVHATINGNCDNRTPLNLPTMSDRVLQSTNSFILKVPCLPDKICLFIKSEKVFSGAIGPTVDKYIKSGGSLLKKKDREEELFVENPDVKTGASINKTMSVYCANIGHYRMPFGWTACRLNIKGKNCL----RF---HKYENNKTSEDDIIKLVQNM 1852
            +LD   I P+V    E+   +  +K     F     +++    P   +  EPFF++ SLF I   R+IS +F  + N   +  ++ +       GG  V  +I G           ++ + +LQ     I  V C    I L  + EKV  G+I    + Y+KS  S                  K    + K     C+ +G YRMPF W A  L       L    RF   ++ ++NK S +D++KL+ + 
Sbjct:  343 KLDFSGIEPEVKPFEEKFGKRILVKCNDLAFNLQSCVAENEEGPTTNV--EPFFVTLSLFDIKTNRKISADFPVDLNHASVRQMICAHSQQLLNGGGDVSQSILG-----------SIQESMLQYPKQGIFSVTCPHTDIFLVARIEKVLQGSIAHCAEPYMKSSDS-----------------AKVAQKVLKNAKQACSRLGQYRMPFAWAARSLFKDSNGTLDKNARFSAIYRQDSNKISNEDMLKLLADF 565          

HSP 4 Score: 55.0694 bits (131), Expect = 2.641e-6
Identity = 30/95 (31.58%), Postives = 47/95 (49.47%), Query Frame = 2
Query:  137 ELVKPIDFESVYLQNKNNISNDPNRVLVKIPDNDVKINKVSRKETVYNNGVPTNIHEIFDCNLLAKLCVDFYTSEWTATCYKDFTYNSSFWTLPN 421
            +L++PID+E+V +Q K  I ND  R ++  P +D +I  + R+       VP N  +    +L    C+  Y S+W    YK   Y+  F  LP 
Sbjct:   45 KLIEPIDYENVIVQKKTQILNDALREMLLFPYDDFQIATLRRQGRYICTTVPENAEKEAQ-SLFVTECIRTYNSDWHVVTYKHEDYSGDFRQLPG 138          
BLAST of Dedicator of cytokinesis vs. Ensembl Xenopus
Match: DOCK9 (dedicator of cytokinesis 9 [Source:NCBI gene;Acc:100144990])

HSP 1 Score: 437.573 bits (1124), Expect = 2.552e-123
Identity = 278/852 (32.63%), Postives = 440/852 (51.64%), Query Frame = 2
Query: 5138 KDIFVCLLHIFHTISSDDLKATICNLTVQERLEFLQLLILSIHHLKYQGRKVI-NNFESISTGCAKSKIQLRP---------HGPRSSVTAILDDV------DHGD----HKAYLEGNVSTEVGLIVLDVLSAYCSAFKQEILTYTPDHVIFKKIVDIYLTLLSVNQSEIVLKHVFVSMRVFVSTFAKVLFANCHNVISDLSLHTLRFLDTRFTSVRIEACGFLYRMMRSSYDTFNKPGINRVHLQMIVAVSKLDRTV----GIRFKESLNYLKRLAEIEMXXXXXXXXXXXXXGTPTGTSKSITIGVHSTTKLSMQTFFEEVTDLTQRIRTVLMATVQMNEHVDDPEMQVDLQYSLAKSYSSNPALRRTWLEKIYAIHNKNNSRAEMAMCKAHIVAMIVEYLRRKEQYSMSCANFKAISPNIPLEESGMRDDSVQLEVHYTKEEVVKLLRELAHEFDAGCLWEVLRHVYKLVIPIYERKRDYEQLAEIYKHMSDGYNKIKTAESTNQRIIGSYYRVVLYGKP-FDSLAGKVFIYRLDSGKQFCVVREELQKLFSKKYGAGKVQMLVEN-HIDRSKLDPELASIQVTHVEPFFNEDEELERHSMFERQYNISKFMLETPFVKMNHVEHESRWKKYKEHDIDGVLKSKQTDDLSIQWKRRTILTVEASFPHLKRRLEVISIKEIDFSPIERAIDEIQLKNRQLAMHLAYXXXXXXXXXXXXXXXXXXXXXVGSSQTRANNIPLLMDMHMSGALLPQVNQGPMAYARVFLHKETQANYSQEKVKQLKIQFMEFLTLCYLLLRDFNELMSHIQQQKYIAMREALDSYR---VELSNLINEEI-CVFEDISVISTS 7603
            K + +  LHI  ++S D L       +  E ++F  +  + +H  +Y G++ I  N E +       K Q  P         H     ++++ + +       H D    H++ LE N++TEV L +LD LS +  AFK ++L     + + KK+ D+YL  L  NQSE  LK+VF ++R  +  F    +    ++ + L    L+  +++ +S+R +A   LY +MR++++   K    R HLQ+I++VS+L   V    G RF++SL+ +   A                               +S   +   +F  +V DLT+RIRTVLMAT QM EH +DPEM VDLQYSLAKSY+S P LR+TWL+ +  IH K+   +E AMC  H+ A++ EYL RK  +   C+ F+ I+PNI  E S M D  +Q +VH+ ++ +++LL + A        +E++  +YK++IPIYE++RD+E+LA +Y  +   Y+K+     T +R++G+Y+RV  +G+  F+   GK +IY+         + + LQKL+S K+G+  V+M+ ++  ++   LD + A IQVTHV P+F E E  ER + FE+ +NI +F+ E PF                       L  K+   +  QWKRRTILT    FP++K+R+ V+     D +PIE AIDE+  K  +L                              S +  + I L   + + G++  QVN GP+AYARVFL       Y+  K+KQLK  F +F+  C   L   NE +  I++ ++    E   +YR    ELS +++E+I C  E ISV+  S
Sbjct: 1295 KSLLMSFLHILKSMSDDALFTYWNKASTSELMDFFTISEVCLHQFQYMGKRYIARNQEGLGPIVHDRKSQTLPVSRNRTGMMHARLQQLSSLDNSLTFNHSYGHSDADILHQSSLEANIATEVCLTILDTLSLFTMAFKNQLLADHGHNPLMKKVFDVYLCFLQKNQSETALKNVFTALRCLIYKFPSTFYEGRADMCAALCYEILKCCNSKLSSIRTDASQLLYFLMRNNFEYTGKKSFVRTHLQVIISVSQLIADVVGIGGTRFQQSLSIINNCA-------------------------------NSDRLIKHTSFSSDVKDLTKRIRTVLMATAQMKEHENDPEMLVDLQYSLAKSYASTPELRKTWLDSMARIHVKHGDLSEAAMCYVHVAALVSEYLTRKGMFRQGCSTFRVITPNIDEEASMMEDVGMQ-DVHFNEDVLMELLEQCADGLWKAERYELIADIYKIIIPIYEKRRDFERLAHLYDTLHRAYSKVTEVMHTGKRLLGTYFRVAFFGQGFFEDEDGKEYIYKEPKLTPLSEISQRLQKLYSDKFGSENVKMIQDSGKVNPKDLDSKYAYIQVTHVTPYFEEKELQERKTEFEKSHNIRRFVFEMPF----------------------TLSGKRQGGVEEQWKRRTILTAIHCFPYVKKRIPVMYQHHTDLNPIEVAIDEMSKKVAELRQL--------------------------CSSSEVDMIKL--QLKLQGSVSVQVNAGPLAYARVFLDDTNTKKYADNKIKQLKEVFRQFVEACGQALC-VNERL--IKENQFEYQEEMKANYREMVKELSEIMHEQIWCGEEKISVMPNS 2061          

HSP 2 Score: 273.478 bits (698), Expect = 1.175e-72
Identity = 197/691 (28.51%), Postives = 313/691 (45.30%), Query Frame = 2
Query: 2411 LYIYPRTLNFSNQNVFHRARNLSCFVELRDVDKSDAPPLKVFYSRPSRKQPAFDYWSNTSVIYHDSSPTFNEEIKIALPLNLHSKHHLLFRFYHVSCDTAAIPNVREKGSNKKS--LETPVGVTWLTLMDQNLNLKSGSFSLPVATQLVPDYLEEKQQSIYYKKDSLWKLSTSFGQPKPRNSSTDKVIDESVNKRHSGPTFKSYINPRSSRDLEDIFSIKSDDVEQSHDTTVQWVDGQKSIFTVVIRPETTIFTQSTHLHKFFQVCSEKLDELTNPTVVEKKESIFTKPRSGSDPTTPKPVSDDTLLLQTSNKDVEIKNAIKALATVNVTNLIKFFAPTFNQLLHVVVCTAISHSEISKTAVTSMITLASSLRTPSMESLSSKATKRNTKIIKSYIKFAFDAEKIVPTKVKRTVHESLIQAISELIRPPFRDTXXXXXXXXXXXXXYSIITKSMIQSLTKQSKITIDKGGDKFFSTSYMDSLQNMIHLIINCILEITSTVGNQSGMNGQLRPNNSFQSLATSANKDLARFISRLFNVMDRGFIFQIIHQYMKIFIARINAYSGHREHLCRMKFDFLEIVTNHEHYLPLNLLKIINPSDKGQSVRKRQAPPSLELILSETYCRQHYLAGLLLQEVHRQMSDVYSHNAVRRLPFVMLRNLLAKHLFDDRYSSINMQARIAALYLPLVSIILEN 4477
            LY+YP+ L +  Q  F +ARN++  +E RD D  ++ PLK  Y RP    P F   +  SV++H  +P F +EIKI LP  LH KHHLLF F+HVSCDT++      KG  KK   +E+ VG  WL L+ ++  + +   ++PV+  L   YL  ++  +                                  +HSGP  K                               WVDG K +  V     +T++ Q  HLH FFQ C                     K  SG               +Q    D  +   +K L  +    +I F     NQ+  V+  T  +  E++      +I + +      +ES            ++SY+K+ + AE  + ++ K T+HE L ++++ +++P   D    N  L  S+ F+ ++ KSM Q L + SK+ + +  ++ F  S+  +++ ++++++  I +    +   S                 +AN  LA FI R F  MDRGF+F+ I+ YM  F        G  + L   KF+F  +V NHEHY+PLNL     P   G+    R     L+  L++ +C+ H+L GLLL+EV   + +      +R++   +L+ L+ KH FDDRYSS + QAR+A LYLPL  +++EN
Sbjct:  638 LYVYPKHLKYDGQKAFAKARNIALSIEFRDADDEESQPLKCIYGRPG--GPLFVKNALASVLHHQQNPEFYDEIKIELPTQLHEKHHLLFTFFHVSCDTSS------KGGTKKRDVIESQVGYAWLPLL-KDGRVVTNEQNIPVSANLPAGYLGYQELGM---------------------------------GKHSGPEIK-------------------------------WVDGAKPLLKVATHLVSTVYAQDLHLHNFFQYCQ--------------------KTESG---------------VQAVGSD--LVKYLKGLHAMEGHVMIAFLPTVLNQMCRVL--TRATQEEVAVNVTRVIIHVVALCHEEGLESY-----------LRSYVKYVYKAEPYITSECK-TMHEELAKSMTTILKPS-ADFLTSNKLLKYSWFFFEVLIKSMAQHLVENSKVKLLR--NQRFPASFHHAVETLVNMLMPHITQKYKEIPEAS----------------RNANHSLAFFIKRCFTFMDRGFVFKQINNYMSFFAP------GDPKTLFEYKFEFFRVVCNHEHYIPLNL-----PMPFGKGRIHRYQDLQLDYTLTDDFCKNHFLVGLLLREVGSALQEF---RDIRQIAISVLKGLMIKHSFDDRYSSRSQQARLATLYLPLFGLLIEN 1171          

HSP 3 Score: 73.9442 bits (180), Expect = 4.139e-12
Identity = 64/253 (25.30%), Postives = 103/253 (40.71%), Query Frame = 2
Query: 1127 QLDDCHIRPQV----EQSIPKTFIKLTANRFITSVGISDENSNPKGVIPAEPFFISFSLFHIADGRRISEEFYWNPNRPQIEDLLPSDLFAYKFGGHPVHATINGNCDNRTPLNLPTMSDRVLQSTNSFILKVPCLPDKICLFIKSEKVFSGAIGPTVDKYIKSGGSLLKKKDREEELFVENPDVKTGASINKTMSVYCANIGHYRMPFGWTACRLNIKGKNCL----RF---HKYENNKTSEDDIIKLVQNM 1852
            +LD   I P+V    E+   +  +K     F     +++    P   +  EPFF++ SLF I   R+IS +F  + N   +  ++ +       GG  V  +I G           ++ + +LQ     I  V C    I L  + EKV  G+I    + Y+KS  S                  K    + K     C+ +G YRMPF W A  L       L    RF   ++ ++NK S +D++KL+ + 
Sbjct:  342 KLDFSGIEPEVKPFEEKFGKRILVKCNDLAFNLQSCVAENEEGPTTNV--EPFFVTLSLFDIKTNRKISADFPVDLNHASVRQMICAHSQQLLNGGGDVSQSILG-----------SIQESMLQYPKQGIFSVTCPHTDIFLVARIEKVLQGSIAHCAEPYMKSSDS-----------------AKVAQKVLKNAKQACSRLGQYRMPFAWAARSLFKDSNGTLDKNARFSAIYRQDSNKISNEDMLKLLADF 564          

HSP 4 Score: 54.6842 bits (130), Expect = 3.046e-6
Identity = 30/95 (31.58%), Postives = 47/95 (49.47%), Query Frame = 2
Query:  137 ELVKPIDFESVYLQNKNNISNDPNRVLVKIPDNDVKINKVSRKETVYNNGVPTNIHEIFDCNLLAKLCVDFYTSEWTATCYKDFTYNSSFWTLPN 421
            +L++PID+E+V +Q K  I ND  R ++  P +D +I  + R+       VP N  +    +L    C+  Y S+W    YK   Y+  F  LP 
Sbjct:   44 KLIEPIDYENVIVQKKTQILNDALREMLLFPYDDFQIATLRRQGRYICTTVPENAEKEAQ-SLFVTECIRTYNSDWHVVTYKHEDYSGDFRQLPG 137          
BLAST of Dedicator of cytokinesis vs. Ensembl Xenopus
Match: DOCK9 (dedicator of cytokinesis 9 [Source:NCBI gene;Acc:100144990])

HSP 1 Score: 436.802 bits (1122), Expect = 3.039e-123
Identity = 272/832 (32.69%), Postives = 429/832 (51.56%), Query Frame = 2
Query: 5138 KDIFVCLLHIFHTISSDDLKATICNLTVQERLEFLQLLILSIHHLKYQGRKVINNFESISTGCAKSKIQLRPHGPRSSVTAILDDVDHGDHKAYLEGNVSTEVGLIVLDVLSAYCSAFKQEILTYTPDHVIFKKIVDIYLTLLSVNQSEIVLKHVFVSMRVFVSTFAKVLFANCHNVISDLSLHTLRFLDTRFTSVRIEACGFLYRMMRSSYDTFNKPGINRVHLQMIVAVSKLDRTV----GIRFKESLNYLKRLAEIEMXXXXXXXXXXXXXGTPTGTSKSITIGVHSTTKLSMQTFFEEVTDLTQRIRTVLMATVQMNEHVDDPEMQVDLQYSLAKSYSSNPALRRTWLEKIYAIHNKNNSRAEMAMCKAHIVAMIVEYLRRKEQYSMSCANFKAISPNIPLEESGMRDDSVQLEVHYTKEEVVKLLRELAHEFDAGCLWEVLRHVYKLVIPIYERKRDYEQLAEIYKHMSDGYNKIKTAESTNQRIIGSYYRVVLYGKP-FDSLAGKVFIYRLDSGKQFCVVREELQKLFSKKYGAGKVQMLVEN-HIDRSKLDPELASIQVTHVEPFFNEDEELERHSMFERQYNISKFMLETPFVKMNHVEHESRWKKYKEHDIDGVLKSKQTDDLSIQWKRRTILTVEASFPHLKRRLEVISIKEIDFSPIERAIDEIQLKNRQLAMHLAYXXXXXXXXXXXXXXXXXXXXXVGSSQTRANNIPLLMDMHMSGALLPQVNQGPMAYARVFLHKETQANYSQEKVKQLKIQFMEFLTLCYLLLRDFNELMSHIQQQKYIAMREALDSYR---VELSNLINEEI-CVFEDISVISTS 7603
            K + +  LHI  ++S D L       +  E ++F  +  + +H  +Y G++ I  +  I      S   +                    H++ LE N++TEV L +LD LS +  AFK ++L     + + KK+ D+YL  L  NQSE  LK+VF ++R  +  F    +    ++ + L    L+  +++ +S+R +A   LY +MR++++   K    R HLQ+I++VS+L   V    G RF++SL+ +   A                               +S   +   +F  +V DLT+RIRTVLMAT QM EH +DPEM VDLQYSLAKSY+S P LR+TWL+ +  IH K+   +E AMC  H+ A++ EYL RK  +   C+ F+ I+PNI  E S M D  +Q +VH+ ++ +++LL + A        +E++  +YK++IPIYE++RD+E+LA +Y  +   Y+K+     T +R++G+Y+RV  +G+  F+   GK +IY+         + + LQKL+S K+G+  V+M+ ++  ++   LD + A IQVTHV P+F E E  ER + FE+ +NI +F+ E PF                       L  K+   +  QWKRRTILT    FP++K+R+ V+     D +PIE AIDE+  K  +L                              S +  + I L   + + G++  QVN GP+AYARVFL       Y+  K+KQLK  F +F+  C   L   NE +  I++ ++    E   +YR    ELS +++E+I C  E ISV+  S
Sbjct: 1249 KSLLMSFLHILKSMSDDALFTYWNKASTSELMDFFTISEVCLHQFQYMGKRYIARYSVIYNCYGHSDADIL-------------------HQSSLEANIATEVCLTILDTLSLFTMAFKNQLLADHGHNPLMKKVFDVYLCFLQKNQSETALKNVFTALRCLIYKFPSTFYEGRADMCAALCYEILKCCNSKLSSIRTDASQLLYFLMRNNFEYTGKKSFVRTHLQVIISVSQLIADVVGIGGTRFQQSLSIINNCA-------------------------------NSDRLIKHTSFSSDVKDLTKRIRTVLMATAQMKEHENDPEMLVDLQYSLAKSYASTPELRKTWLDSMARIHVKHGDLSEAAMCYVHVAALVSEYLTRKGMFRQGCSTFRVITPNIDEEASMMEDVGMQ-DVHFNEDVLMELLEQCADGLWKAERYELIADIYKIIIPIYEKRRDFERLAHLYDTLHRAYSKVTEVMHTGKRLLGTYFRVAFFGQGFFEDEDGKEYIYKEPKLTPLSEISQRLQKLYSDKFGSENVKMIQDSGKVNPKDLDSKYAYIQVTHVTPYFEEKELQERKTEFEKSHNIRRFVFEMPF----------------------TLSGKRQGGVEEQWKRRTILTAIHCFPYVKKRIPVMYQHHTDLNPIEVAIDEMSKKVAELRQL--------------------------CSSSEVDMIKL--QLKLQGSVSVQVNAGPLAYARVFLDDTNTKKYADNKIKQLKEVFRQFVEACGQALC-VNERL--IKENQFEYQEEMKANYREMVKELSEIMHEQIWCGEEKISVMPNS 1976          

HSP 2 Score: 275.789 bits (704), Expect = 2.033e-73
Identity = 200/693 (28.86%), Postives = 317/693 (45.74%), Query Frame = 2
Query: 2411 LYIYPRTLNFSNQNVFHRARNLSCFVELRDVDKSDAPPLKVFYSRPSRKQPAFDYWSNTSVIYHDSSPTFNEEIKIALPLNLHSKHHLLFRFYHVSCDTAAIPNVREKGSNKKS--LETPVGVTWLTLMDQNLNLKSGSFSLPVATQLVPDYLEEKQQSIYYKKDSLWKLSTSFGQPKPRNSSTDKVIDESVNKRHSGPTFKSYINPRSSRDLEDIFSIKSDDVEQSHDTTVQWVDGQKSIFTVVIRPETTIFTQSTHLHKFFQVCSEKLDELTNPTVVEKKESIFTKPRSGSDPTTPKPVSDDTLLLQTSNKDVEIKNAIKALATVNVTNLIKFFAPTFNQLLHVVVCTAISHSEISKTAVTSMITLASSLRTPSMESLSSKATKRNTKIIKSYIKFAFDAEKIVPTKVKRTVHESLIQAISELIRPPFRDTXXXXXXXXXXXXXYSIITKSMIQSLTKQSKITIDKGGDKFFSTSYMDSLQNMIHLIINCILEITSTVGNQSGMNGQLRPNNSFQSLATSANKDLARFISRLFNVMDRGFIFQIIHQYMKIFIARINAYSGHREHLCRMKFDFLEIVTNHEHYLPLNLLKIINPSDKGQSVRKRQAPPSLEL--ILSETYCRQHYLAGLLLQEVHRQMSDVYSHNAVRRLPFVMLRNLLAKHLFDDRYSSINMQARIAALYLPLVSIILEN 4477
            LY+YP+ L +  Q  F +ARN++  +E RD D  ++ PLK  Y RP    P F   +  SV++H  +P F +EIKI LP  LH KHHLLF F+HVSCDT++      KG  KK   +E+ VG  WL L+ ++  + +   ++PV+  L   YL  ++  +                                  +HSGP  K                               WVDG K +  V     +T++ Q  HLH FFQ C                     K  SG               +Q    D  +   +K L  +    +I F     NQ+  V+  T  +  E++      +I + +      +ES            ++SY+K+ + AE  + ++ K T+HE L ++++ +++P   D    N  L  S+ F+ ++ KSM Q L + SK+ + +  ++ F  S+  +++ ++++++  I +    +   S                 +AN  LA FI R F  MDRGF+F+ I+ YM  F        G  + L   KF+F  +V NHEHY+PLNL     P  KG+  R +  P  L+L   L++ +C+ H+L GLLL+EV   + +      +R++   +L+ L+ KH FDDRYSS + QAR+A LYLPL  +++EN
Sbjct:  591 LYVYPKHLKYDGQKAFAKARNIALSIEFRDADDEESQPLKCIYGRPG--GPLFVKNALASVLHHQQNPEFYDEIKIELPTQLHEKHHLLFTFFHVSCDTSS------KGGTKKRDVIESQVGYAWLPLL-KDGRVVTNEQNIPVSANLPAGYLGYQELGM---------------------------------GKHSGPEIK-------------------------------WVDGAKPLLKVATHLVSTVYAQDLHLHNFFQYCQ--------------------KTESG---------------VQAVGSD--LVKYLKGLHAMEGHVMIAFLPTVLNQMCRVL--TRATQEEVAVNVTRVIIHVVALCHEEGLESY-----------LRSYVKYVYKAEPYITSECK-TMHEELAKSMTTILKPS-ADFLTSNKLLKYSWFFFEVLIKSMAQHLVENSKVKLLR--NQRFPASFHHAVETLVNMLMPHITQKYKEIPEAS----------------RNANHSLAFFIKRCFTFMDRGFVFKQINNYMSFFAP------GDPKTLFEYKFEFFRVVCNHEHYIPLNLPM---PFGKGRIHRYQDHPVDLQLDYTLTDDFCKNHFLVGLLLREVGSALQEF---RDIRQIAISVLKGLMIKHSFDDRYSSRSQQARLATLYLPLFGLLIEN 1128          

HSP 3 Score: 73.559 bits (179), Expect = 5.606e-12
Identity = 64/253 (25.30%), Postives = 103/253 (40.71%), Query Frame = 2
Query: 1127 QLDDCHIRPQV----EQSIPKTFIKLTANRFITSVGISDENSNPKGVIPAEPFFISFSLFHIADGRRISEEFYWNPNRPQIEDLLPSDLFAYKFGGHPVHATINGNCDNRTPLNLPTMSDRVLQSTNSFILKVPCLPDKICLFIKSEKVFSGAIGPTVDKYIKSGGSLLKKKDREEELFVENPDVKTGASINKTMSVYCANIGHYRMPFGWTACRLNIKGKNCL----RF---HKYENNKTSEDDIIKLVQNM 1852
            +LD   I P+V    E+   +  +K     F     +++    P   +  EPFF++ SLF I   R+IS +F  + N   +  ++ +       GG  V  +I G           ++ + +LQ     I  V C    I L  + EKV  G+I    + Y+KS  S                  K    + K     C+ +G YRMPF W A  L       L    RF   ++ ++NK S +D++KL+ + 
Sbjct:  295 KLDFSGIEPEVKPFEEKFGKRILVKCNDLAFNLQSCVAENEEGPTTNV--EPFFVTLSLFDIKTNRKISADFPVDLNHASVRQMICAHSQQLLNGGGDVSQSILG-----------SIQESMLQYPKQGIFSVTCPHTDIFLVARIEKVLQGSIAHCAEPYMKSSDS-----------------AKVAQKVLKNAKQACSRLGQYRMPFAWAARSLFKDSNGTLDKNARFSAIYRQDSNKISNEDMLKLLADF 517          

HSP 4 Score: 54.6842 bits (130), Expect = 3.467e-6
Identity = 30/95 (31.58%), Postives = 47/95 (49.47%), Query Frame = 2
Query:  137 ELVKPIDFESVYLQNKNNISNDPNRVLVKIPDNDVKINKVSRKETVYNNGVPTNIHEIFDCNLLAKLCVDFYTSEWTATCYKDFTYNSSFWTLPN 421
            +L++PID+E+V +Q K  I ND  R ++  P +D +I  + R+       VP N  +    +L    C+  Y S+W    YK   Y+  F  LP 
Sbjct:    5 KLIEPIDYENVIVQKKTQILNDALREMLLFPYDDFQIATLRRQGRYICTTVPENAEKEAQ-SLFVTECIRTYNSDWHVVTYKHEDYSGDFRQLPG 98          
BLAST of Dedicator of cytokinesis vs. Ensembl Xenopus
Match: DOCK9 (dedicator of cytokinesis 9 [Source:NCBI gene;Acc:100144990])

HSP 1 Score: 436.802 bits (1122), Expect = 3.433e-123
Identity = 272/832 (32.69%), Postives = 429/832 (51.56%), Query Frame = 2
Query: 5138 KDIFVCLLHIFHTISSDDLKATICNLTVQERLEFLQLLILSIHHLKYQGRKVINNFESISTGCAKSKIQLRPHGPRSSVTAILDDVDHGDHKAYLEGNVSTEVGLIVLDVLSAYCSAFKQEILTYTPDHVIFKKIVDIYLTLLSVNQSEIVLKHVFVSMRVFVSTFAKVLFANCHNVISDLSLHTLRFLDTRFTSVRIEACGFLYRMMRSSYDTFNKPGINRVHLQMIVAVSKLDRTV----GIRFKESLNYLKRLAEIEMXXXXXXXXXXXXXGTPTGTSKSITIGVHSTTKLSMQTFFEEVTDLTQRIRTVLMATVQMNEHVDDPEMQVDLQYSLAKSYSSNPALRRTWLEKIYAIHNKNNSRAEMAMCKAHIVAMIVEYLRRKEQYSMSCANFKAISPNIPLEESGMRDDSVQLEVHYTKEEVVKLLRELAHEFDAGCLWEVLRHVYKLVIPIYERKRDYEQLAEIYKHMSDGYNKIKTAESTNQRIIGSYYRVVLYGKP-FDSLAGKVFIYRLDSGKQFCVVREELQKLFSKKYGAGKVQMLVEN-HIDRSKLDPELASIQVTHVEPFFNEDEELERHSMFERQYNISKFMLETPFVKMNHVEHESRWKKYKEHDIDGVLKSKQTDDLSIQWKRRTILTVEASFPHLKRRLEVISIKEIDFSPIERAIDEIQLKNRQLAMHLAYXXXXXXXXXXXXXXXXXXXXXVGSSQTRANNIPLLMDMHMSGALLPQVNQGPMAYARVFLHKETQANYSQEKVKQLKIQFMEFLTLCYLLLRDFNELMSHIQQQKYIAMREALDSYR---VELSNLINEEI-CVFEDISVISTS 7603
            K + +  LHI  ++S D L       +  E ++F  +  + +H  +Y G++ I  +  I      S   +                    H++ LE N++TEV L +LD LS +  AFK ++L     + + KK+ D+YL  L  NQSE  LK+VF ++R  +  F    +    ++ + L    L+  +++ +S+R +A   LY +MR++++   K    R HLQ+I++VS+L   V    G RF++SL+ +   A                               +S   +   +F  +V DLT+RIRTVLMAT QM EH +DPEM VDLQYSLAKSY+S P LR+TWL+ +  IH K+   +E AMC  H+ A++ EYL RK  +   C+ F+ I+PNI  E S M D  +Q +VH+ ++ +++LL + A        +E++  +YK++IPIYE++RD+E+LA +Y  +   Y+K+     T +R++G+Y+RV  +G+  F+   GK +IY+         + + LQKL+S K+G+  V+M+ ++  ++   LD + A IQVTHV P+F E E  ER + FE+ +NI +F+ E PF                       L  K+   +  QWKRRTILT    FP++K+R+ V+     D +PIE AIDE+  K  +L                              S +  + I L   + + G++  QVN GP+AYARVFL       Y+  K+KQLK  F +F+  C   L   NE +  I++ ++    E   +YR    ELS +++E+I C  E ISV+  S
Sbjct: 1283 KSLLMSFLHILKSMSDDALFTYWNKASTSELMDFFTISEVCLHQFQYMGKRYIARYSVIYNCYGHSDADIL-------------------HQSSLEANIATEVCLTILDTLSLFTMAFKNQLLADHGHNPLMKKVFDVYLCFLQKNQSETALKNVFTALRCLIYKFPSTFYEGRADMCAALCYEILKCCNSKLSSIRTDASQLLYFLMRNNFEYTGKKSFVRTHLQVIISVSQLIADVVGIGGTRFQQSLSIINNCA-------------------------------NSDRLIKHTSFSSDVKDLTKRIRTVLMATAQMKEHENDPEMLVDLQYSLAKSYASTPELRKTWLDSMARIHVKHGDLSEAAMCYVHVAALVSEYLTRKGMFRQGCSTFRVITPNIDEEASMMEDVGMQ-DVHFNEDVLMELLEQCADGLWKAERYELIADIYKIIIPIYEKRRDFERLAHLYDTLHRAYSKVTEVMHTGKRLLGTYFRVAFFGQGFFEDEDGKEYIYKEPKLTPLSEISQRLQKLYSDKFGSENVKMIQDSGKVNPKDLDSKYAYIQVTHVTPYFEEKELQERKTEFEKSHNIRRFVFEMPF----------------------TLSGKRQGGVEEQWKRRTILTAIHCFPYVKKRIPVMYQHHTDLNPIEVAIDEMSKKVAELRQL--------------------------CSSSEVDMIKL--QLKLQGSVSVQVNAGPLAYARVFLDDTNTKKYADNKIKQLKEVFRQFVEACGQAL-CVNERL--IKENQFEYQEEMKANYREMVKELSEIMHEQIWCGEEKISVMPNS 2010          

HSP 2 Score: 273.092 bits (697), Expect = 1.395e-72
Identity = 197/691 (28.51%), Postives = 313/691 (45.30%), Query Frame = 2
Query: 2411 LYIYPRTLNFSNQNVFHRARNLSCFVELRDVDKSDAPPLKVFYSRPSRKQPAFDYWSNTSVIYHDSSPTFNEEIKIALPLNLHSKHHLLFRFYHVSCDTAAIPNVREKGSNKKS--LETPVGVTWLTLMDQNLNLKSGSFSLPVATQLVPDYLEEKQQSIYYKKDSLWKLSTSFGQPKPRNSSTDKVIDESVNKRHSGPTFKSYINPRSSRDLEDIFSIKSDDVEQSHDTTVQWVDGQKSIFTVVIRPETTIFTQSTHLHKFFQVCSEKLDELTNPTVVEKKESIFTKPRSGSDPTTPKPVSDDTLLLQTSNKDVEIKNAIKALATVNVTNLIKFFAPTFNQLLHVVVCTAISHSEISKTAVTSMITLASSLRTPSMESLSSKATKRNTKIIKSYIKFAFDAEKIVPTKVKRTVHESLIQAISELIRPPFRDTXXXXXXXXXXXXXYSIITKSMIQSLTKQSKITIDKGGDKFFSTSYMDSLQNMIHLIINCILEITSTVGNQSGMNGQLRPNNSFQSLATSANKDLARFISRLFNVMDRGFIFQIIHQYMKIFIARINAYSGHREHLCRMKFDFLEIVTNHEHYLPLNLLKIINPSDKGQSVRKRQAPPSLELILSETYCRQHYLAGLLLQEVHRQMSDVYSHNAVRRLPFVMLRNLLAKHLFDDRYSSINMQARIAALYLPLVSIILEN 4477
            LY+YP+ L +  Q  F +ARN++  +E RD D  ++ PLK  Y RP    P F   +  SV++H  +P F +EIKI LP  LH KHHLLF F+HVSCDT++      KG  KK   +E+ VG  WL L+ ++  + +   ++PV+  L   YL  ++  +                                  +HSGP  K                               WVDG K +  V     +T++ Q  HLH FFQ C                     K  SG               +Q    D  +   +K L  +    +I F     NQ+  V+  T  +  E++      +I + +      +ES            ++SY+K+ + AE  + ++ K T+HE L ++++ +++P   D    N  L  S+ F+ ++ KSM Q L + SK+ + +  ++ F  S+  +++ ++++++  I +    +   S                 +AN  LA FI R F  MDRGF+F+ I+ YM  F        G  + L   KF+F  +V NHEHY+PLNL     P   G+    R     L+  L++ +C+ H+L GLLL+EV   + +      +R++   +L+ L+ KH FDDRYSS + QAR+A LYLPL  +++EN
Sbjct:  629 LYVYPKHLKYDGQKAFAKARNIALSIEFRDADDEESQPLKCIYGRPG--GPLFVKNALASVLHHQQNPEFYDEIKIELPTQLHEKHHLLFTFFHVSCDTSS------KGGTKKRDVIESQVGYAWLPLL-KDGRVVTNEQNIPVSANLPAGYLGYQELGM---------------------------------GKHSGPEIK-------------------------------WVDGAKPLLKVATHLVSTVYAQDLHLHNFFQYCQ--------------------KTESG---------------VQAVGSD--LVKYLKGLHAMEGHVMIAFLPTVLNQMCRVL--TRATQEEVAVNVTRVIIHVVALCHEEGLESY-----------LRSYVKYVYKAEPYITSECK-TMHEELAKSMTTILKPS-ADFLTSNKLLKYSWFFFEVLIKSMAQHLVENSKVKLLR--NQRFPASFHHAVETLVNMLMPHITQKYKEIPEAS----------------RNANHSLAFFIKRCFTFMDRGFVFKQINNYMSFFAP------GDPKTLFEYKFEFFRVVCNHEHYIPLNL-----PMPFGKGRIHRYQDLQLDYTLTDDFCKNHFLVGLLLREVGSALQEF---RDIRQIAISVLKGLMIKHSFDDRYSSRSQQARLATLYLPLFGLLIEN 1162          

HSP 3 Score: 73.559 bits (179), Expect = 5.718e-12
Identity = 64/253 (25.30%), Postives = 103/253 (40.71%), Query Frame = 2
Query: 1127 QLDDCHIRPQV----EQSIPKTFIKLTANRFITSVGISDENSNPKGVIPAEPFFISFSLFHIADGRRISEEFYWNPNRPQIEDLLPSDLFAYKFGGHPVHATINGNCDNRTPLNLPTMSDRVLQSTNSFILKVPCLPDKICLFIKSEKVFSGAIGPTVDKYIKSGGSLLKKKDREEELFVENPDVKTGASINKTMSVYCANIGHYRMPFGWTACRLNIKGKNCL----RF---HKYENNKTSEDDIIKLVQNM 1852
            +LD   I P+V    E+   +  +K     F     +++    P   +  EPFF++ SLF I   R+IS +F  + N   +  ++ +       GG  V  +I G           ++ + +LQ     I  V C    I L  + EKV  G+I    + Y+KS  S                  K    + K     C+ +G YRMPF W A  L       L    RF   ++ ++NK S +D++KL+ + 
Sbjct:  333 KLDFSGIEPEVKPFEEKFGKRILVKCNDLAFNLQSCVAENEEGPTTNV--EPFFVTLSLFDIKTNRKISADFPVDLNHASVRQMICAHSQQLLNGGGDVSQSILG-----------SIQESMLQYPKQGIFSVTCPHTDIFLVARIEKVLQGSIAHCAEPYMKSSDS-----------------AKVAQKVLKNAKQACSRLGQYRMPFAWAARSLFKDSNGTLDKNARFSAIYRQDSNKISNEDMLKLLADF 555          

HSP 4 Score: 54.6842 bits (130), Expect = 3.416e-6
Identity = 30/95 (31.58%), Postives = 47/95 (49.47%), Query Frame = 2
Query:  137 ELVKPIDFESVYLQNKNNISNDPNRVLVKIPDNDVKINKVSRKETVYNNGVPTNIHEIFDCNLLAKLCVDFYTSEWTATCYKDFTYNSSFWTLPN 421
            +L++PID+E+V +Q K  I ND  R ++  P +D +I  + R+       VP N  +    +L    C+  Y S+W    YK   Y+  F  LP 
Sbjct:   43 KLIEPIDYENVIVQKKTQILNDALREMLLFPYDDFQIATLRRQGRYICTTVPENAEKEAQ-SLFVTECIRTYNSDWHVVTYKHEDYSGDFRQLPG 136          
BLAST of Dedicator of cytokinesis vs. Ensembl Mouse
Match: Dock9 (dedicator of cytokinesis 9 [Source:MGI Symbol;Acc:MGI:106321])

HSP 1 Score: 437.573 bits (1124), Expect = 1.440e-123
Identity = 272/842 (32.30%), Postives = 426/842 (50.59%), Query Frame = 2
Query: 5120 LNDKTQKDIFVCLLHIFHTISSDDLKATICNLTVQERLEFLQLLILSIHHLKYQGRKVINNFESISTGCAKSKIQLRPHGPRSSVTAILDDVDHGD------HKAYLEGNVSTEVGLIVLDVLSAYCSAFKQEILTYTPDHVIFKKIVDIYLTLLSVNQSEIVLKHVFVSMRVFVSTFAKVLFANCHNVISDLSLHTLRFLDTRFTSVRIEACGFLYRMMRSSYDTFNKPGINRVHLQMIVAVSKLDRTV----GIRFKESLNYLKRLAEIEMXXXXXXXXXXXXXGTPTGTSKSITIGVHSTTKLSMQTFFEEVTDLTQRIRTVLMATVQMNEHVDDPEMQVDLQYSLAKSYSSNPALRRTWLEKIYAIHNKNNSRAEMAMCKAHIVAMIVEYLRRKEQYSMSCANFKAISPNIPLEESGMRDDSVQLEVHYTKEEVVKLLRELAHEFDAGCLWEVLRHVYKLVIPIYERKRDYEQLAEIYKHMSDGYNKIKTAESTNQRIIGSYYRVVLYGKP-FDSLAGKVFIYRLDSGKQFCVVREELQKLFSKKYGAGKVQMLVEN-HIDRSKLDPELASIQVTHVEPFFNEDEELERHSMFERQYNISKFMLETPFVKMNHVEHESRWKKYKEHDIDGVLKSKQTDDLSIQWKRRTILTVEASFPHLKRRLEVISIKEIDFSPIERAIDEIQLKNRQLAMHLAYXXXXXXXXXXXXXXXXXXXXXVGSSQTRANNIPLLMDMHMSGALLPQVNQGPMAYARVFLHKETQANYSQEKVKQLKIQFMEFLTLCYLLLRDFNELMSHIQQQKYIAMREALDSYRVELSNLINEEICVFEDISVISTSAL 7609
            L+    K + +C L++  ++S D L       +  E ++F  +  + +H  +Y G++ I +   IS                 SV  I  D  +G       H++ LE N++TEV L  LD LS +  AFK ++L     + + KK+ D+YL  L  +QSE+ LK+VF ++R  +  F    +    ++ + L    L+  +++ +S+R EA   LY +MR+++D   K    R HLQ+I++VS+L   V    G RF++SL+ +   A                               +S   +   +F  +V DLT+RIRTVLMAT QM EH +DPEM VDLQYSLAKSY+S P LR+TWL+ +  IH KN   +E AMC  H+ A++ EYL RK  +   C  F+ I+PNI  E S M D  +Q +VH+ ++ +++LL + A        +E++  +YKL+IPIYE++RD+E+LA +Y  +   Y+K+     + +R++G+Y+RV  +G+  F+   GK +IY+         + + L KL+S K+G+  V+M+ ++  ++   LD + A IQVTHV PFF+E E  ER + FER +NI +FM E PF +                        K+   +  Q KRRTILT    FP++K+R+ V+     D +PIE AIDE+  K  +L                              S    + I L   + + G++  QVN GP+AYAR FL       Y   KVK LK  F +F+  C   L     L+   Q +    M+        ELS+++ E+IC  E+ + +  ++L
Sbjct: 1291 LDQSEIKSLLMCFLYVLKSMSDDALFTYWNKASTAELMDFFTISEVCLHQFQYMGKRYIASVRKIS-----------------SVLGISVDNGYGHSEADVVHQSLLEANIATEVCLTALDTLSLFTLAFKNQLLADHGHNPLMKKVFDVYLCFLQKHQSEMALKNVFTALRSLIYKFPSAFYEGRADMCASLCYEVLKCCNSKLSSIRTEASQLLYFLMRNNFDYTGKKSFVRTHLQVIISVSQLIADVVGIGGTRFQQSLSIINNCA-------------------------------NSDRIIKHTSFSSDVKDLTKRIRTVLMATAQMKEHENDPEMLVDLQYSLAKSYASTPELRKTWLDSMARIHVKNGDLSEAAMCYVHVTALVAEYLTRKGMFRQGCTAFRVITPNIDEEASMMEDVGMQ-DVHFNEDVLMELLEQCADGLWKAERYELIADIYKLIIPIYEKRRDFERLAHLYDTLHRAYSKVTEVMHSGRRLLGTYFRVAFFGQGFFEDEDGKEYIYKEPKLTPLSEISQRLLKLYSDKFGSENVKMIQDSGKVNPKDLDSKFAYIQVTHVTPFFDEKELQERRTEFERCHNIRRFMFEMPFTQTG----------------------KRQGGVEEQCKRRTILTAIHCFPYVKKRIPVMYQHHTDLNPIEVAIDEMSKKVAELRQL--------------------------CSSAEVDMIKL--QLKLQGSVSVQVNAGPLAYARAFLDDTNTKRYPDNKVKLLKEVFRQFVEACGQALAVNERLIKEDQLEYQEEMKANYREMAKELSDIMREQICPLEEKTSVLPNSL 2033          

HSP 2 Score: 286.189 bits (731), Expect = 9.079e-77
Identity = 222/744 (29.84%), Postives = 344/744 (46.24%), Query Frame = 2
Query: 2411 LYIYPRTLNFSNQNVFHRARNLSCFVELRDVDKSDAPPLKVFYSRPSRKQPAFDYWSNTSVIYHDSSPTFNEEIKIALPLNLHSKHHLLFRFYHVSCDTAAIPNVREKGSNKK--SLETPVGVTWLTLMDQNLNLKSGSFSLPVATQLVPDYLEEKQQSIYYKKDSLWKLSTSFGQPKPRNSSTDKVIDESVNKRHSGPTFKSYINPRSSRDLEDIFSIKSDDVEQSHDTTVQWVDGQKSIFTVVIRPETTIFTQSTHLHKFFQVCSEKLDELTNPTVVEKKESIFTKPRSGSDPTTPKPVSDDTLLLQTSNKDVEIKNAIKALATVNVTNLIKFFAPTFNQLLHVVVCTAISHSEISKTAVTSMITLASSLRTPSMESLSSKATKRNTKIIKSYIKFAFDAEKIVPTKVKRTVHESLIQAISELIRPPFRDTXXXXXXXXXXXXXYSIITKSMIQSLTKQSKITIDKGGDKFFSTSYMDSLQNMIHLIINCILEITSTVGNQSGMNGQLRPNNSFQSLATSANKDLARFISRLFNVMDRGFIFQIIHQYMKIFIARINAYSGHREHLCRMKFDFLEIVTNHEHYLPLNLLKIINPSDKGQSVRKRQAPPSLELILSETYCRQHYLAGLLLQEVHRQMSDVYSHNAVRRLPFVMLRNLLAKHLFDDRYSSINMQARIAALYLPLVSIILENQKSFSLPGNLHTKVNLLNDIYDHSDRSLSARPLST-LSGDTL--STHSSINGS 4627
            LY+YP+ L + +Q  F +ARN++  +E +D D+ D+ PLK  Y RP    P F   +  +V++H  +P F +EIKI LP  LH +HHLLF F+HVSCD +       KGS KK  ++ET VG +WL L+     L S    +PV+  L   YL  ++  +                                  RH GP                                V+WV+G K +  +     +T++TQ  HLH FFQ C             +K ES      SGS                      E+   +K+L  +    +I F     NQL  V+  T  +  E++      +I + +      +ES            ++SY+KFA+ AE  V ++ K TVHE L ++++ +++P   D    N  L  S+ F+ ++ KSM Q L + +K+ + +  ++ F  SY  +++ ++++++  I +             + R N      + +AN  LA FI R F  MDRGF+F+ I+ Y+  F        G  + L   KF+FL +V NHEHY+PLNL     P   G+   +R     L+  L++ +CR H+L GLLL+EV   + +      VR +   ML+NLL KH FDDRY+S + QARIA LYLPL  +++EN +  ++       VN  + + D +    +  PL T   G+TL  S H  + G+
Sbjct:  640 LYVYPKYLKYDSQKSFAKARNIAICIEFKDSDEEDSQPLKCIYGRPG--GPVFTRSALAAVLHHQQNPEFYDEIKIELPAQLHERHHLLFTFFHVSCDNST------KGSTKKKDAVETQVGFSWLPLLKDGRVLTSEQ-HIPVSANLPSGYLGYQELGM---------------------------------GRHYGPE-------------------------------VKWVEGGKPLLKISTHLVSTVYTQDQHLHNFFQYC-------------QKTES--GAQASGS----------------------ELVKYLKSLHAMEGHVMIAFLPTILNQLFRVL--TRATQEEVAVNVTRVIIHVVAQCHEEGLESH-----------LRSYVKFAYKAEPYVASEYK-TVHEELTKSMTTILKPS-ADFLTSNKLLKYSWFFFDVLIKSMAQHLIENNKVKLLR--NQRFPASYHHAVETVVNMLMPHITQ-------------KFRDN---PEASKNANHSLAVFIKRCFTFMDRGFVFKQINNYISCFAP------GDPKTLFEYKFEFLRVVCNHEHYIPLNL-----PMPFGKGRIQRYQDLQLDYSLTDEFCRNHFLVGLLLREVGTALQEF---REVRVIAISMLKNLLIKHSFDDRYNSRSHQARIATLYLPLFGLLIENVQRINVRDVSPFPVNPGSIVKDEALAVPAGNPLMTPQKGNTLDHSLHKDLLGA 1226          

HSP 3 Score: 67.781 bits (164), Expect = 2.849e-10
Identity = 61/244 (25.00%), Postives = 97/244 (39.75%), Query Frame = 2
Query: 1145 IRPQVEQSIPKTFIKLTANRFITSVGISDENSNPKGVIPAEPFFISFSLFHIADGRRISEEFYWNPNRPQIEDLLPSDLFAYKFGGHPVHATINGNCDNRTPLNLPTMSDRVLQSTNSFILKVPCLPDKICLFIKSEKVFSGAIGPTVDKYIKSGGSLLKKKDREEELFVENPDVKTGASINKTMSVYCANIGHYRMPFGWTACRL--NIKG---KNCLRF---HKYENNKTSEDDIIKLVQNM 1852
            ++P  E+   +  +K     F     +++    P   +  EPFF++ SLF I   R+IS +F+ + N   +  +L     A   GG             ++P          +Q     I  V C    I L  + EKV  G+I    + Y++S  S                  K    + K     C  +G YRMPF W A  L  +  G   KN  RF   ++ ++NK S DD++KL+ + 
Sbjct:  356 VKPFEEKFGKRILVKCNDLSFNLQCCVAENEEGPTTNV--EPFFVTLSLFDIKYNRKISADFHVDLNHFSVRQMLTPTSPALMNGG-------------QSPPAFQDALHTAMQYPKQGIFSVTCPHPDIFLVARIEKVLQGSITHCAEPYMRSSDS-----------------SKVAQKVLKNAKQACQRLGQYRMPFAWAARTLFKDTSGNLDKNA-RFSAIYRQDSNKLSNDDMLKLLADF 566          

HSP 4 Score: 55.0694 bits (131), Expect = 2.047e-6
Identity = 30/95 (31.58%), Postives = 48/95 (50.53%), Query Frame = 2
Query:  137 ELVKPIDFESVYLQNKNNISNDPNRVLVKIPDNDVKINKVSRKETVYNNGVPTNIHEIFDCNLLAKLCVDFYTSEWTATCYKDFTYNSSFWTLPN 421
            +L++P+D+E+V +Q K  I ND  R ++  P +D +   + R+     + VP N  E    +L    C+  Y S+W    YK   Y+  F  LPN
Sbjct:   46 KLIEPLDYENVIVQKKTQILNDCLREMLLFPYDDFQTAILRRQGRYLRSTVPANAEEEAQ-SLFVTECIKTYNSDWHLVTYKYEDYSGEFRQLPN 139          
BLAST of Dedicator of cytokinesis vs. Ensembl Mouse
Match: Dock9 (dedicator of cytokinesis 9 [Source:MGI Symbol;Acc:MGI:106321])

HSP 1 Score: 431.795 bits (1109), Expect = 1.370e-121
Identity = 273/856 (31.89%), Postives = 431/856 (50.35%), Query Frame = 2
Query: 5120 LNDKTQKDIFVCLLHIFHTISSDDLKATICNLTVQERLEFLQLLILSIHHLKYQGRKVI-NNFESISTGCAKSKIQLRP---------HGPRSSVTAILDDV------DHGD----HKAYLEGNVSTEVGLIVLDVLSAYCSAFKQEILTYTPDHVIFKKIVDIYLTLLSVNQSEIVLKHVFVSMRVFVSTFAKVLFANCHNVISDLSLHTLRFLDTRFTSVRIEACGFLYRMMRSSYDTFNKPGINRVHLQMIVAVSKLDRTV----GIRFKESLNYLKRLAEIEMXXXXXXXXXXXXXGTPTGTSKSITIGVHSTTKLSMQTFFEEVTDLTQRIRTVLMATVQMNEHVDDPEMQVDLQYSLAKSYSSNPALRRTWLEKIYAIHNKNNSRAEMAMCKAHIVAMIVEYLRRKEQYSMSCANFKAISPNIPLEESGMRDDSVQLEVHYTKEEVVKLLRELAHEFDAGCLWEVLRHVYKLVIPIYERKRDYEQLAEIYKHMSDGYNKIKTAESTNQRIIGSYYRVVLYGKP-FDSLAGKVFIYRLDSGKQFCVVREELQKLFSKKYGAGKVQMLVEN-HIDRSKLDPELASIQVTHVEPFFNEDEELERHSMFERQYNISKFMLETPFVKMNHVEHESRWKKYKEHDIDGVLKSKQTDDLSIQWKRRTILTVEASFPHLKRRLEVISIKEIDFSPIERAIDEIQLKNRQLAMHLAYXXXXXXXXXXXXXXXXXXXXXVGSSQTRANNIPLLMDMHMSGALLPQVNQGPMAYARVFLHKETQANYSQEKVKQLKIQFMEFLTLCYLLLRDFNELMSHIQQQKYIAMREALDSYRVELSNLINEEICVFEDISVISTSAL 7609
            L+    K + +C L++  ++S D L       +  E ++F  +  + +H  +Y G++ I  N E +       K Q  P         H     + ++ + V       H +    H++ LE N++TEV L  LD LS +  AFK ++L     + + KK+ D+YL  L  +QSE+ LK+VF ++R  +  F    +    ++ + L    L+  +++ +S+R EA   LY +MR+++D   K    R HLQ+I++VS+L   V    G RF++SL+ +   A                               +S   +   +F  +V DLT+RIRTVLMAT QM EH +DPEM VDLQYSLAKSY+S P LR+TWL+ +  IH KN   +E AMC  H+ A++ EYL RK  +   C  F+ I+PNI  E S M D  +Q +VH+ ++ +++LL + A        +E++  +YKL+IPIYE++RD+E+LA +Y  +   Y+K+     + +R++G+Y+RV  +G+  F+   GK +IY+         + + L KL+S K+G+  V+M+ ++  ++   LD + A IQVTHV PFF+E E  ER + FER +NI +FM E PF +                        K+   +  Q KRRTILT    FP++K+R+ V+     D +PIE AIDE+  K  +L                              S    + I L   + + G++  QVN GP+AYAR FL       Y   KVK LK  F +F+  C   L     L+   Q +    M+        ELS+++ E+IC  E+ + +  ++L
Sbjct: 1290 LDQSEIKSLLMCFLYVLKSMSDDALFTYWNKASTAELMDFFTISEVCLHQFQYMGKRYIARNQEGLGPIGHDRKSQTLPVSRNRTGMMHARLQQLGSLDNSVTFNHSYGHSEADVVHQSLLEANIATEVCLTALDTLSLFTLAFKNQLLADHGHNPLMKKVFDVYLCFLQKHQSEMALKNVFTALRSLIYKFPSAFYEGRADMCASLCYEVLKCCNSKLSSIRTEASQLLYFLMRNNFDYTGKKSFVRTHLQVIISVSQLIADVVGIGGTRFQQSLSIINNCA-------------------------------NSDRIIKHTSFSSDVKDLTKRIRTVLMATAQMKEHENDPEMLVDLQYSLAKSYASTPELRKTWLDSMARIHVKNGDLSEAAMCYVHVTALVAEYLTRKGMFRQGCTAFRVITPNIDEEASMMEDVGMQ-DVHFNEDVLMELLEQCADGLWKAERYELIADIYKLIIPIYEKRRDFERLAHLYDTLHRAYSKVTEVMHSGRRLLGTYFRVAFFGQGFFEDEDGKEYIYKEPKLTPLSEISQRLLKLYSDKFGSENVKMIQDSGKVNPKDLDSKFAYIQVTHVTPFFDEKELQERRTEFERCHNIRRFMFEMPFTQTG----------------------KRQGGVEEQCKRRTILTAIHCFPYVKKRIPVMYQHHTDLNPIEVAIDEMSKKVAELRQL--------------------------CSSAEVDMIKL--QLKLQGSVSVQVNAGPLAYARAFLDDTNTKRYPDNKVKLLKEVFRQFVEACGQALAVNERLIKEDQLEYQEEMKANYREMAKELSDIMREQICPLEEKTSVLPNSL 2063          

HSP 2 Score: 286.574 bits (732), Expect = 9.011e-77
Identity = 222/744 (29.84%), Postives = 344/744 (46.24%), Query Frame = 2
Query: 2411 LYIYPRTLNFSNQNVFHRARNLSCFVELRDVDKSDAPPLKVFYSRPSRKQPAFDYWSNTSVIYHDSSPTFNEEIKIALPLNLHSKHHLLFRFYHVSCDTAAIPNVREKGSNKK--SLETPVGVTWLTLMDQNLNLKSGSFSLPVATQLVPDYLEEKQQSIYYKKDSLWKLSTSFGQPKPRNSSTDKVIDESVNKRHSGPTFKSYINPRSSRDLEDIFSIKSDDVEQSHDTTVQWVDGQKSIFTVVIRPETTIFTQSTHLHKFFQVCSEKLDELTNPTVVEKKESIFTKPRSGSDPTTPKPVSDDTLLLQTSNKDVEIKNAIKALATVNVTNLIKFFAPTFNQLLHVVVCTAISHSEISKTAVTSMITLASSLRTPSMESLSSKATKRNTKIIKSYIKFAFDAEKIVPTKVKRTVHESLIQAISELIRPPFRDTXXXXXXXXXXXXXYSIITKSMIQSLTKQSKITIDKGGDKFFSTSYMDSLQNMIHLIINCILEITSTVGNQSGMNGQLRPNNSFQSLATSANKDLARFISRLFNVMDRGFIFQIIHQYMKIFIARINAYSGHREHLCRMKFDFLEIVTNHEHYLPLNLLKIINPSDKGQSVRKRQAPPSLELILSETYCRQHYLAGLLLQEVHRQMSDVYSHNAVRRLPFVMLRNLLAKHLFDDRYSSINMQARIAALYLPLVSIILENQKSFSLPGNLHTKVNLLNDIYDHSDRSLSARPLST-LSGDTL--STHSSINGS 4627
            LY+YP+ L + +Q  F +ARN++  +E +D D+ D+ PLK  Y RP    P F   +  +V++H  +P F +EIKI LP  LH +HHLLF F+HVSCD +       KGS KK  ++ET VG +WL L+     L S    +PV+  L   YL  ++  +                                  RH GP                                V+WV+G K +  +     +T++TQ  HLH FFQ C             +K ES      SGS                      E+   +K+L  +    +I F     NQL  V+  T  +  E++      +I + +      +ES            ++SY+KFA+ AE  V ++ K TVHE L ++++ +++P   D    N  L  S+ F+ ++ KSM Q L + +K+ + +  ++ F  SY  +++ ++++++  I +             + R N      + +AN  LA FI R F  MDRGF+F+ I+ Y+  F        G  + L   KF+FL +V NHEHY+PLNL     P   G+   +R     L+  L++ +CR H+L GLLL+EV   + +      VR +   ML+NLL KH FDDRY+S + QARIA LYLPL  +++EN +  ++       VN  + + D +    +  PL T   G+TL  S H  + G+
Sbjct:  638 LYVYPKYLKYDSQKSFAKARNIAICIEFKDSDEEDSQPLKCIYGRPG--GPVFTRSALAAVLHHQQNPEFYDEIKIELPAQLHERHHLLFTFFHVSCDNST------KGSTKKKDAVETQVGFSWLPLLKDGRVLTSEQ-HIPVSANLPSGYLGYQELGM---------------------------------GRHYGPE-------------------------------VKWVEGGKPLLKISTHLVSTVYTQDQHLHNFFQYC-------------QKTES--GAQASGS----------------------ELVKYLKSLHAMEGHVMIAFLPTILNQLFRVL--TRATQEEVAVNVTRVIIHVVAQCHEEGLESH-----------LRSYVKFAYKAEPYVASEYK-TVHEELTKSMTTILKPS-ADFLTSNKLLKYSWFFFDVLIKSMAQHLIENNKVKLLR--NQRFPASYHHAVETVVNMLMPHITQ-------------KFRDN---PEASKNANHSLAVFIKRCFTFMDRGFVFKQINNYISCFAP------GDPKTLFEYKFEFLRVVCNHEHYIPLNL-----PMPFGKGRIQRYQDLQLDYSLTDEFCRNHFLVGLLLREVGTALQEF---REVRVIAISMLKNLLIKHSFDDRYNSRSHQARIATLYLPLFGLLIENVQRINVRDVSPFPVNPGSIVKDEALAVPAGNPLMTPQKGNTLDHSLHKDLLGA 1224          

HSP 3 Score: 67.3958 bits (163), Expect = 3.003e-10
Identity = 61/244 (25.00%), Postives = 97/244 (39.75%), Query Frame = 2
Query: 1145 IRPQVEQSIPKTFIKLTANRFITSVGISDENSNPKGVIPAEPFFISFSLFHIADGRRISEEFYWNPNRPQIEDLLPSDLFAYKFGGHPVHATINGNCDNRTPLNLPTMSDRVLQSTNSFILKVPCLPDKICLFIKSEKVFSGAIGPTVDKYIKSGGSLLKKKDREEELFVENPDVKTGASINKTMSVYCANIGHYRMPFGWTACRL--NIKG---KNCLRF---HKYENNKTSEDDIIKLVQNM 1852
            ++P  E+   +  +K     F     +++    P   +  EPFF++ SLF I   R+IS +F+ + N   +  +L     A   GG             ++P          +Q     I  V C    I L  + EKV  G+I    + Y++S  S                  K    + K     C  +G YRMPF W A  L  +  G   KN  RF   ++ ++NK S DD++KL+ + 
Sbjct:  354 VKPFEEKFGKRILVKCNDLSFNLQCCVAENEEGPTTNV--EPFFVTLSLFDIKYNRKISADFHVDLNHFSVRQMLTPTSPALMNGG-------------QSPPAFQDALHTAMQYPKQGIFSVTCPHPDIFLVARIEKVLQGSITHCAEPYMRSSDS-----------------SKVAQKVLKNAKQACQRLGQYRMPFAWAARTLFKDTSGNLDKNA-RFSAIYRQDSNKLSNDDMLKLLADF 564          

HSP 4 Score: 58.151 bits (139), Expect = 2.388e-7
Identity = 31/112 (27.68%), Postives = 57/112 (50.89%), Query Frame = 2
Query:   86 NSSQIQIKCDNQQINISELVKPIDFESVYLQNKNNISNDPNRVLVKIPDNDVKINKVSRKETVYNNGVPTNIHEIFDCNLLAKLCVDFYTSEWTATCYKDFTYNSSFWTLPN 421
            +++Q  ++ ++  +   +L++P+D+E+V +Q K  I ND  R ++  P +D +   + R+     + VP N  E    +L    C+  Y S+W    YK   Y+  F  LPN
Sbjct:   27 DAAQADVEAESSTLAKPKLIEPLDYENVIVQKKTQILNDCLREMLLFPYDDFQTAILRRQGRYLRSTVPANAEEEAQ-SLFVTECIKTYNSDWHLVTYKYEDYSGEFRQLPN 137          
BLAST of Dedicator of cytokinesis vs. Ensembl Mouse
Match: Dock9 (dedicator of cytokinesis 9 [Source:MGI Symbol;Acc:MGI:106321])

HSP 1 Score: 427.943 bits (1099), Expect = 1.541e-120
Identity = 266/828 (32.13%), Postives = 419/828 (50.60%), Query Frame = 2
Query: 5120 LNDKTQKDIFVCLLHIFHTISSDDLKATICNLTVQERLEFLQLLILSIHHLKYQGRKVINNFESISTGCAKSKIQLRPHGPRSSVTAILDDVDHGD----HKAYLEGNVSTEVGLIVLDVLSAYCSAFKQEILTYTPDHVIFKKIVDIYLTLLSVNQSEIVLKHVFVSMRVFVSTFAKVLFANCHNVISDLSLHTLRFLDTRFTSVRIEACGFLYRMMRSSYDTFNKPGINRVHLQMIVAVSKLDRTV----GIRFKESLNYLKRLAEIEMXXXXXXXXXXXXXGTPTGTSKSITIGVHSTTKLSMQTFFEEVTDLTQRIRTVLMATVQMNEHVDDPEMQVDLQYSLAKSYSSNPALRRTWLEKIYAIHNKNNSRAEMAMCKAHIVAMIVEYLRRKEQYSMSCANFKAISPNIPLEESGMRDDSVQLEVHYTKEEVVKLLRELAHEFDAGCLWEVLRHVYKLVIPIYERKRDYEQLAEIYKHMSDGYNKIKTAESTNQRIIGSYYRVVLYGKP---FDSLAGKVFIYRLDSGKQFCVVREELQKLFSKKYGAGKVQMLVEN-HIDRSKLDPELASIQVTHVEPFFNEDEELERHSMFERQYNISKFMLETPFVKMNHVEHESRWKKYKEHDIDGVLKSKQTDDLSIQWKRRTILTVEASFPHLKRRLEVISIKEIDFSPIERAIDEIQLKNRQLAMHLAYXXXXXXXXXXXXXXXXXXXXXVGSSQTRANNIPLLMDMHMSGALLPQVNQGPMAYARVFLHKETQANYSQEKVKQLKIQFMEFLTLCYLLLRDFNELMSHIQQQKYIAMREALDSYRVELSNLINEEI 7567
            L+    K + +C L++  ++S D L       +  E ++F  +  + +H  +Y G++ I       TG   +++Q    G   +         H +    H++ LE N++TEV L  LD LS +  AFK ++L     + + KK+ D+YL  L  +QSE+ LK+VF ++R  +  F    +    ++ + L    L+  +++ +S+R EA   LY +MR+++D   K    R HLQ+I++VS+L   V    G RF++SL+ +   A                               +S   +   +F  +V DLT+RIRTVLMAT QM EH +DPEM VDLQYSLAKSY+S P LR+TWL+ +  IH KN   +E AMC  H+ A++ EYL RK  +   C  F+ I+PNI  E S M D  +Q +VH+ ++ +++LL + A        +E++  +YKL+IPIYE++RD+E+LA +Y  +   Y+K+     + +R++G+Y+RV  +G+    F+   GK +IY+         + + L KL+S K+G+  V+M+ ++  ++   LD + A IQVTHV PFF+E E  ER + FER +NI +FM E PF +                        K+   +  Q KRRTILT    FP++K+R+ V+     D +PIE AIDE+  K  +L                              S    + I L   + + G++  QVN GP+AYAR FL       Y   KVK LK  F +F+  C   L     L+   Q +    M+        ELS+++ E++
Sbjct: 1303 LDQSEIKSLLMCFLYVLKSMSDDALFTYWNKASTAELMDFFTISEVCLHQFQYMGKRYIAR-----TGMMHARLQ--QLGSLDNSVTFNHSYGHSEADVVHQSLLEANIATEVCLTALDTLSLFTLAFKNQLLADHGHNPLMKKVFDVYLCFLQKHQSEMALKNVFTALRSLIYKFPSAFYEGRADMCASLCYEVLKCCNSKLSSIRTEASQLLYFLMRNNFDYTGKKSFVRTHLQVIISVSQLIADVVGIGGTRFQQSLSIINNCA-------------------------------NSDRIIKHTSFSSDVKDLTKRIRTVLMATAQMKEHENDPEMLVDLQYSLAKSYASTPELRKTWLDSMARIHVKNGDLSEAAMCYVHVTALVAEYLTRKGMFRQGCTAFRVITPNIDEEASMMEDVGMQ-DVHFNEDVLMELLEQCADGLWKAERYELIADIYKLIIPIYEKRRDFERLAHLYDTLHRAYSKVTEVMHSGRRLLGTYFRVAFFGQAAGFFEDEDGKEYIYKEPKLTPLSEISQRLLKLYSDKFGSENVKMIQDSGKVNPKDLDSKFAYIQVTHVTPFFDEKELQERRTEFERCHNIRRFMFEMPFTQT----------------------GKRQGGVEEQCKRRTILTAIHCFPYVKKRIPVMYQHHTDLNPIEVAIDEMSKKVAELRQL--------------------------CSSAEVDMIKL--QLKLQGSVSVQVNAGPLAYARAFLDDTNTKRYPDNKVKLLKEVFRQFVEACGQALAVNERLIKEDQLEYQEEMKANYREMAKELSDIMREQM 2041          

HSP 2 Score: 286.96 bits (733), Expect = 5.710e-77
Identity = 222/744 (29.84%), Postives = 344/744 (46.24%), Query Frame = 2
Query: 2411 LYIYPRTLNFSNQNVFHRARNLSCFVELRDVDKSDAPPLKVFYSRPSRKQPAFDYWSNTSVIYHDSSPTFNEEIKIALPLNLHSKHHLLFRFYHVSCDTAAIPNVREKGSNKK--SLETPVGVTWLTLMDQNLNLKSGSFSLPVATQLVPDYLEEKQQSIYYKKDSLWKLSTSFGQPKPRNSSTDKVIDESVNKRHSGPTFKSYINPRSSRDLEDIFSIKSDDVEQSHDTTVQWVDGQKSIFTVVIRPETTIFTQSTHLHKFFQVCSEKLDELTNPTVVEKKESIFTKPRSGSDPTTPKPVSDDTLLLQTSNKDVEIKNAIKALATVNVTNLIKFFAPTFNQLLHVVVCTAISHSEISKTAVTSMITLASSLRTPSMESLSSKATKRNTKIIKSYIKFAFDAEKIVPTKVKRTVHESLIQAISELIRPPFRDTXXXXXXXXXXXXXYSIITKSMIQSLTKQSKITIDKGGDKFFSTSYMDSLQNMIHLIINCILEITSTVGNQSGMNGQLRPNNSFQSLATSANKDLARFISRLFNVMDRGFIFQIIHQYMKIFIARINAYSGHREHLCRMKFDFLEIVTNHEHYLPLNLLKIINPSDKGQSVRKRQAPPSLELILSETYCRQHYLAGLLLQEVHRQMSDVYSHNAVRRLPFVMLRNLLAKHLFDDRYSSINMQARIAALYLPLVSIILENQKSFSLPGNLHTKVNLLNDIYDHSDRSLSARPLST-LSGDTL--STHSSINGS 4627
            LY+YP+ L + +Q  F +ARN++  +E +D D+ D+ PLK  Y RP    P F   +  +V++H  +P F +EIKI LP  LH +HHLLF F+HVSCD +       KGS KK  ++ET VG +WL L+     L S    +PV+  L   YL  ++  +                                  RH GP                                V+WV+G K +  +     +T++TQ  HLH FFQ C             +K ES      SGS                      E+   +K+L  +    +I F     NQL  V+  T  +  E++      +I + +      +ES            ++SY+KFA+ AE  V ++ K TVHE L ++++ +++P   D    N  L  S+ F+ ++ KSM Q L + +K+ + +  ++ F  SY  +++ ++++++  I +             + R N      + +AN  LA FI R F  MDRGF+F+ I+ Y+  F        G  + L   KF+FL +V NHEHY+PLNL     P   G+   +R     L+  L++ +CR H+L GLLL+EV   + +      VR +   ML+NLL KH FDDRY+S + QARIA LYLPL  +++EN +  ++       VN  + + D +    +  PL T   G+TL  S H  + G+
Sbjct:  652 LYVYPKYLKYDSQKSFAKARNIAICIEFKDSDEEDSQPLKCIYGRPG--GPVFTRSALAAVLHHQQNPEFYDEIKIELPAQLHERHHLLFTFFHVSCDNST------KGSTKKKDAVETQVGFSWLPLLKDGRVLTSEQ-HIPVSANLPSGYLGYQELGM---------------------------------GRHYGPE-------------------------------VKWVEGGKPLLKISTHLVSTVYTQDQHLHNFFQYC-------------QKTES--GAQASGS----------------------ELVKYLKSLHAMEGHVMIAFLPTILNQLFRVL--TRATQEEVAVNVTRVIIHVVAQCHEEGLESH-----------LRSYVKFAYKAEPYVASEYK-TVHEELTKSMTTILKPS-ADFLTSNKLLKYSWFFFDVLIKSMAQHLIENNKVKLLR--NQRFPASYHHAVETVVNMLMPHITQ-------------KFRDN---PEASKNANHSLAVFIKRCFTFMDRGFVFKQINNYISCFAP------GDPKTLFEYKFEFLRVVCNHEHYIPLNL-----PMPFGKGRIQRYQDLQLDYSLTDEFCRNHFLVGLLLREVGTALQEF---REVRVIAISMLKNLLIKHSFDDRYNSRSHQARIATLYLPLFGLLIENVQRINVRDVSPFPVNPGSIVKDEALAVPAGNPLMTPQKGNTLDHSLHKDLLGA 1238          

HSP 3 Score: 67.3958 bits (163), Expect = 3.095e-10
Identity = 61/244 (25.00%), Postives = 97/244 (39.75%), Query Frame = 2
Query: 1145 IRPQVEQSIPKTFIKLTANRFITSVGISDENSNPKGVIPAEPFFISFSLFHIADGRRISEEFYWNPNRPQIEDLLPSDLFAYKFGGHPVHATINGNCDNRTPLNLPTMSDRVLQSTNSFILKVPCLPDKICLFIKSEKVFSGAIGPTVDKYIKSGGSLLKKKDREEELFVENPDVKTGASINKTMSVYCANIGHYRMPFGWTACRL--NIKG---KNCLRF---HKYENNKTSEDDIIKLVQNM 1852
            ++P  E+   +  +K     F     +++    P   +  EPFF++ SLF I   R+IS +F+ + N   +  +L     A   GG             ++P          +Q     I  V C    I L  + EKV  G+I    + Y++S  S                  K    + K     C  +G YRMPF W A  L  +  G   KN  RF   ++ ++NK S DD++KL+ + 
Sbjct:  368 VKPFEEKFGKRILVKCNDLSFNLQCCVAENEEGPTTNV--EPFFVTLSLFDIKYNRKISADFHVDLNHFSVRQMLTPTSPALMNGG-------------QSPPAFQDALHTAMQYPKQGIFSVTCPHPDIFLVARIEKVLQGSITHCAEPYMRSSDS-----------------SKVAQKVLKNAKQACQRLGQYRMPFAWAARTLFKDTSGNLDKNA-RFSAIYRQDSNKLSNDDMLKLLADF 578          

HSP 4 Score: 54.6842 bits (130), Expect = 2.115e-6
Identity = 30/95 (31.58%), Postives = 48/95 (50.53%), Query Frame = 2
Query:  137 ELVKPIDFESVYLQNKNNISNDPNRVLVKIPDNDVKINKVSRKETVYNNGVPTNIHEIFDCNLLAKLCVDFYTSEWTATCYKDFTYNSSFWTLPN 421
            +L++P+D+E+V +Q K  I ND  R ++  P +D +   + R+     + VP N  E    +L    C+  Y S+W    YK   Y+  F  LPN
Sbjct:   58 KLIEPLDYENVIVQKKTQILNDCLREMLLFPYDDFQTAILRRQGRYLRSTVPANAEEEAQ-SLFVTECIKTYNSDWHLVTYKYEDYSGEFRQLPN 151          
BLAST of Dedicator of cytokinesis vs. Ensembl Mouse
Match: Dock11 (dedicator of cytokinesis 11 [Source:MGI Symbol;Acc:MGI:1923224])

HSP 1 Score: 423.32 bits (1087), Expect = 1.848e-119
Identity = 271/839 (32.30%), Postives = 429/839 (51.13%), Query Frame = 2
Query: 5138 KDIFVCLLHIFHTISSDDLKATICNLTVQERLEFLQLLILSIHHLKYQGRKVINNFESI--------------------STGCAKSKIQLRPHGPRSSVTAILDDVDHGD--HKAYLEGNVSTEVGLIVLDVLSAYCSAFKQEILTYTPDHVIFKKIVDIYLTLLSVNQSEIVLKHVFVSMRVFVSTFAKVLFANCHNVISDLSLHTLRFLDTRFTSVRIEACGFLYRMMRSSYDTFNKPGINRVHLQMIVAVSKLDRTV----GIRFKESLNYLKRLAEIEMXXXXXXXXXXXXXGTPTGTSKSITIGVHSTTKLSMQTFFEEVTDLTQRIRTVLMATVQMNEHVDDPEMQVDLQYSLAKSYSSNPALRRTWLEKIYAIHNKNNSRAEMAMCKAHIVAMIVEYLRRKEQYSMSCANFKAISPNIPLEESGMRDDSVQLEVHYTKEEVVKLLRELAHEFDAGCLWEVLRHVYKLVIPIYERKRDYEQLAEIYKHMSDGYNKIKTAESTNQRIIGSYYRVVLYGKP-FDSLAGKVFIYRLDSGKQFCVVREELQKLFSKKYGAGKVQMLVE-NHIDRSKLDPELASIQVTHVEPFFNEDEELERHSMFERQYNISKFMLETPFVKMNHVEHESRWKKYKEHDIDGVLKSKQTDDLSIQWKRRTILTVEASFPHLKRRLEVISIKEIDFSPIERAIDEIQLKNRQLAMHLAYXXXXXXXXXXXXXXXXXXXXXVGSSQTRANNIPLLMDMHMSGALLPQVNQGPMAYARVFLHKETQAN-YSQEKVKQLKIQFMEFLTLCYLLLRDFNELMSHIQQQKYIAMREALDSYRVELSNLINEEI 7567
            +++ +C L+I   IS D L      ++ QE +  L LL + + H +Y G++ I                           +G  ++++Q       S            D  H+A LEGN +TEV L VLD +S +   FK ++L     + + KK+ DI+L  L   QSE+ LKHVF S+R F+S F    F    N+ +      L+   ++ +S R EA   LY +MR++++   +    R HLQ+I+AVS+L   V    G RF+ESL  +   A                               +S   +    F  EV DLT+RIRTVLMAT QM EH  DPEM +DLQYSLAKSY+S P LR+TWL+ +  IH KN   +E AMC  H+ A++ E+L RK+ +   C+ FK I+PNI  EE  M++D+  ++VHY++E +++LL +          +EV+  + KL+IPIYE++R++E+L ++Y+ +   Y KI     T +R++G+++RV  YG+  F+   GK +IY+         +   L KL+ +K+G   V+++ + + ++  +LDP+ A IQVT+V+P+F++ E  ER + FER +NI++F+ E P+                       L  K+   +  Q KRRTILT   SFP++K+R+ +   ++++  PI+ A DEI+ K  +L                              S    + I L   + + G +  QVN GP+AYAR FL+ E+QAN Y  +KV +LK  F +F+  C + L     L+   Q + +  ++        ELS++I+E+I
Sbjct: 1109 RNLLMCYLYIVKMISEDTLLTYWNKVSPQELINILVLLEVCLFHFRYMGKRNIARVHDAWLSKHFGIDRKSQTMPALRNRSGVMQARLQHLSSLESSFTLNHSSATTEADIFHQALLEGNTATEVSLTVLDTISFFTQCFKNQLLNNDGHNPLMKKVFDIHLAFLKNGQSEVSLKHVFASLRSFISKFPSAFFKGRVNMCAAFCYEVLKCCTSKISSTRNEASALLYLLMRNNFEYTKRKTFLRTHLQIIIAVSQLIADVALSGGSRFQESLFIINNFA-------------------------------NSDRPMKATAFPTEVKDLTKRIRTVLMATAQMKEHEKDPEMLIDLQYSLAKSYASTPELRKTWLDSMAKIHIKNGDFSEAAMCYVHVAALVAEFLHRKKLFPSGCSAFKKITPNID-EEGAMKEDAGMMDVHYSEEVLLELLEQCVDGLWKAERYEVISEISKLIIPIYEKRREFEKLTQVYRTLHGAYTKILEVMHTKKRLLGTFFRVAFYGQSFFEEEDGKEYIYKEPKLTGLSEISLRLVKLYGEKFGTENVKIIQDSDKVNAKELDPKFAHIQVTYVKPYFDDKELTERKTEFERNHNINRFVFEAPY----------------------TLSGKKQGCIEEQCKRRTILTTSNSFPYVKKRIPINCEQQVNLKPIDVATDEIKDKTAELHKL--------------------------CSSVDVDMIQL--QLKLQGCVSVQVNAGPLAYARAFLN-ESQANKYPPKKVNELKDMFRKFIQACSIALELNERLIKEDQIEYHEGLKSNFRDMVKELSDIIHEQI 1864          

HSP 2 Score: 164.081 bits (414), Expect = 1.430e-39
Identity = 136/474 (28.69%), Postives = 221/474 (46.62%), Query Frame = 2
Query: 3098 VQWVDGQKSIFTVVIRPETTIFTQSTHLHKFFQVCSEKLDELTNPTVVEKKESIFTKPRSGSDPTTPKPVSDDTLLLQTSNKDV--EIKNAIKALATVNVTNLIKFFAPTFNQLLHVVVCTAISHSE-ISKTAVTSMITLASSLRTPSMESLSSKATKRNTKIIKSYIKFAFDAEKIVPTKVK-RTVHESLIQAISELIRPPFRDTXXXXXXXXXXXXXYSIITKSMIQSLTKQSKITIDKGGDKFFSTSYMDSLQNMIHLIINCILEITSTVGNQSGMNGQLRPNNSFQSLATSANKDLARFISRLFNVMDRGFIFQIIHQYMKIFIARINAYSGHREHLCRMKFDFLEIVTNHEHYLPLNL-LKIINPSDKGQSV---------RKRQAPPSLELILSETYCRQHYLAGLLLQEVHRQMSDVYSHNAVRRLPFVMLRNLLAKHLFDDRYSSINMQARIAALYLPLVSIILEN 4477
            ++WVDG K +  +    E+TI+TQ  H+HKFF  C                                        L+Q+ +K+V  E+   +K L  + +  +I+F      QL  V+  T ++H + +       ++ + S      +ES            ++S+IK++F  EK  P+ ++ + +HE+L   +  +++    D   +N  L  S+ F+ II KSM   L +++KI + +G  + F  +Y   L +++  II  +    + + ++S  NG               N  LA F+ R   +MDRGF+F +I+ Y+  F  +        + L   KF+FL+ + NHEHY+PLNL +    P  K Q V         R      +LE  LS+ YC+ H+L GLLL+E    + D Y    +R     +++NLL KH FD RY   N QA+IA LYLP V ++LEN
Sbjct:  617 IKWVDGAKPLLKIKTHLESTIYTQDLHVHKFFHHCQ---------------------------------------LIQSGSKEVPGELIKYLKCLHAMEIQVMIQFLPVILMQLFRVL--TNMTHEDDVPINCTMVLLHIVSKCHEEGLESY-----------LRSFIKYSFRPEK--PSTLQAQLIHETLATTMIAILKQS-ADFLAINKLLKYSWFFFEIIAKSMATYLLEENKIKLPRG--QRFPEAYHHVLHSLLLAIIPHVTIRYAEIPDES-RNG---------------NYSLASFLKRCLTLMDRGFVFNLINDYISGFSPK------DPKVLAEYKFEFLQTICNHEHYIPLNLPMAFAKP--KLQRVQDFFSFAVDRLTSVDSNLEYSLSDEYCKHHFLVGLLLRETSIALQDNYE---IRYTAISVIKNLLIKHAFDTRYQHKNQQAKIAQLYLPFVGLLLEN 1006          

HSP 3 Score: 122.479 bits (306), Expect = 6.998e-27
Identity = 68/164 (41.46%), Postives = 98/164 (59.76%), Query Frame = 2
Query: 2411 LYIYPRTLNFSNQNVFHRARNLSCFVELRDVDKSDAPPLKVFYSRPSRKQPAFDYWSNTSVIYHDSSPTFNEEIKIALPLNLHSKHHLLFRFYHVSCDTAAIPNVREKGSNKK--SLETPVGVTWLTLMDQNLNLKSGSFSLPVATQLVPDYL-----EEKQQS 2881
            LY+YP  L + +Q  F +ARN++  VE RD D+SDA  LK  Y +P+     F   +   V +H+ +P F +EIKI LP++LH KHHLLF FYHVSC+      +  KG+ KK  ++ETPVG  W+ L+ ++  + +    LPV+  L P YL     E ++QS
Sbjct:  459 LYVYPLQLKYDSQKSFAKARNIAVCVEFRDSDESDASALKCIYGKPAGS--VFTTNAYAVVSHHNQNPEFYDEIKIELPIHLHQKHHLLFTFYHVSCE------INTKGTTKKQDTVETPVGFAWVPLL-KDGRVITLEQQLPVSANLPPGYLNVNDAESRRQS 613          

HSP 4 Score: 77.0258 bits (188), Expect = 3.862e-13
Identity = 108/449 (24.05%), Postives = 179/449 (39.87%), Query Frame = 2
Query:  662 FSLNELSDGSTVL------KESMPRDGHEQIIVYLD---NVDSLRELGGYWILLSFKGKQSESYLFTGGNDNQKLWANKLKDAIESETKTKQIERPVSSESIERSE---------------ETVHGMLSKFLQENEQSAVILRKKDHQKILVIYSEIRNQIKMKSQQTPIYDIGIIEKSQLDDCHIRPQV---EQSIPKTFIKLTANRFITSVG-ISDENSNPKGVIPAEPFFISFSLFHIADGRRISEEFYWNPNRPQIEDLLPSDLFAYKFGGHPVHATINGNCDNRTPLNL-PTMSDRVLQSTNSFILKVPCLPDKICLFIKSEKVFSGAIGPTVDKYIKSGGSLLKKKDREEELFVENPDVKTGASINKTMSVYCANIGHYRMPFGWTACRL--NIKGKNCL--RF---HKYENNKTSEDDIIKLVQNMSSQHVDNNASKYTTIP 1900
            F L +L DGS +L      K S    G     +YLD   +V    ++  +   L    K S  YL        + W   LK  I+  T +   E+  + E+I+  E                ++H  L K+ +E EQ   + R    Q +    SE++                     +LD   I P V   E+   K F+    +     +G I D    P   +  EPFFI+ +LF + +  +IS +F+ + N P + ++L          G     + +GN    +P +L   +++  L      I  V     +I L ++ EKV  G I    + YIK+                    +KT   +++T    C+ +G YRMPF W A  +  +++G   L  RF   +K +++K S +DI+KL+    S++     +K   IP
Sbjct:    9 FYLTQLPDGSYILNSYKDEKNSKESKG----CIYLDACIDVVQCPKMRRHAFELKMLDKYSH-YLAAETEQEMEEWLIMLKKIIQINTDSLVQEKKDTVEAIQEEETSSQGKAENIMASLERSMHPELMKYGRETEQLNKLSRGDGRQNLFSFDSEVQ---------------------RLDFSGIEPDVKPFEEKCNKRFMVNCHDLTFNILGHIGDNAKGPPTNV--EPFFINLALFDVKNNCKISADFHVDLNPPSVREML---------WGTSTQLSNDGNAKGFSPESLIHGIAESQLCYIKQGIFSVTNPHPEIFLVVRIEKVLQGNITHCAEPYIKNSDP-----------------IKTAQKVHRTAKQVCSRLGQYRMPFAWAARPIFKDVQGSLDLDGRFSPLYKQDSSKLSNEDILKLL----SEYKKPEKTKLQIIP 399          
BLAST of Dedicator of cytokinesis vs. Ensembl Mouse
Match: Dock11 (dedicator of cytokinesis 11 [Source:MGI Symbol;Acc:MGI:1923224])

HSP 1 Score: 423.705 bits (1088), Expect = 3.576e-119
Identity = 271/839 (32.30%), Postives = 429/839 (51.13%), Query Frame = 2
Query: 5138 KDIFVCLLHIFHTISSDDLKATICNLTVQERLEFLQLLILSIHHLKYQGRKVINNFESI--------------------STGCAKSKIQLRPHGPRSSVTAILDDVDHGD--HKAYLEGNVSTEVGLIVLDVLSAYCSAFKQEILTYTPDHVIFKKIVDIYLTLLSVNQSEIVLKHVFVSMRVFVSTFAKVLFANCHNVISDLSLHTLRFLDTRFTSVRIEACGFLYRMMRSSYDTFNKPGINRVHLQMIVAVSKLDRTV----GIRFKESLNYLKRLAEIEMXXXXXXXXXXXXXGTPTGTSKSITIGVHSTTKLSMQTFFEEVTDLTQRIRTVLMATVQMNEHVDDPEMQVDLQYSLAKSYSSNPALRRTWLEKIYAIHNKNNSRAEMAMCKAHIVAMIVEYLRRKEQYSMSCANFKAISPNIPLEESGMRDDSVQLEVHYTKEEVVKLLRELAHEFDAGCLWEVLRHVYKLVIPIYERKRDYEQLAEIYKHMSDGYNKIKTAESTNQRIIGSYYRVVLYGKP-FDSLAGKVFIYRLDSGKQFCVVREELQKLFSKKYGAGKVQMLVE-NHIDRSKLDPELASIQVTHVEPFFNEDEELERHSMFERQYNISKFMLETPFVKMNHVEHESRWKKYKEHDIDGVLKSKQTDDLSIQWKRRTILTVEASFPHLKRRLEVISIKEIDFSPIERAIDEIQLKNRQLAMHLAYXXXXXXXXXXXXXXXXXXXXXVGSSQTRANNIPLLMDMHMSGALLPQVNQGPMAYARVFLHKETQAN-YSQEKVKQLKIQFMEFLTLCYLLLRDFNELMSHIQQQKYIAMREALDSYRVELSNLINEEI 7567
            +++ +C L+I   IS D L      ++ QE +  L LL + + H +Y G++ I                           +G  ++++Q       S            D  H+A LEGN +TEV L VLD +S +   FK ++L     + + KK+ DI+L  L   QSE+ LKHVF S+R F+S F    F    N+ +      L+   ++ +S R EA   LY +MR++++   +    R HLQ+I+AVS+L   V    G RF+ESL  +   A                               +S   +    F  EV DLT+RIRTVLMAT QM EH  DPEM +DLQYSLAKSY+S P LR+TWL+ +  IH KN   +E AMC  H+ A++ E+L RK+ +   C+ FK I+PNI  EE  M++D+  ++VHY++E +++LL +          +EV+  + KL+IPIYE++R++E+L ++Y+ +   Y KI     T +R++G+++RV  YG+  F+   GK +IY+         +   L KL+ +K+G   V+++ + + ++  +LDP+ A IQVT+V+P+F++ E  ER + FER +NI++F+ E P+                       L  K+   +  Q KRRTILT   SFP++K+R+ +   ++++  PI+ A DEI+ K  +L                              S    + I L   + + G +  QVN GP+AYAR FL+ E+QAN Y  +KV +LK  F +F+  C + L     L+   Q + +  ++        ELS++I+E+I
Sbjct: 1280 RNLLMCYLYIVKMISEDTLLTYWNKVSPQELINILVLLEVCLFHFRYMGKRNIARVHDAWLSKHFGIDRKSQTMPALRNRSGVMQARLQHLSSLESSFTLNHSSATTEADIFHQALLEGNTATEVSLTVLDTISFFTQCFKNQLLNNDGHNPLMKKVFDIHLAFLKNGQSEVSLKHVFASLRSFISKFPSAFFKGRVNMCAAFCYEVLKCCTSKISSTRNEASALLYLLMRNNFEYTKRKTFLRTHLQIIIAVSQLIADVALSGGSRFQESLFIINNFA-------------------------------NSDRPMKATAFPTEVKDLTKRIRTVLMATAQMKEHEKDPEMLIDLQYSLAKSYASTPELRKTWLDSMAKIHIKNGDFSEAAMCYVHVAALVAEFLHRKKLFPSGCSAFKKITPNID-EEGAMKEDAGMMDVHYSEEVLLELLEQCVDGLWKAERYEVISEISKLIIPIYEKRREFEKLTQVYRTLHGAYTKILEVMHTKKRLLGTFFRVAFYGQSFFEEEDGKEYIYKEPKLTGLSEISLRLVKLYGEKFGTENVKIIQDSDKVNAKELDPKFAHIQVTYVKPYFDDKELTERKTEFERNHNINRFVFEAPY----------------------TLSGKKQGCIEEQCKRRTILTTSNSFPYVKKRIPINCEQQVNLKPIDVATDEIKDKTAELHKL--------------------------CSSVDVDMIQL--QLKLQGCVSVQVNAGPLAYARAFLN-ESQANKYPPKKVNELKDMFRKFIQACSIALELNERLIKEDQIEYHEGLKSNFRDMVKELSDIIHEQI 2035          

HSP 2 Score: 168.318 bits (425), Expect = 7.457e-41
Identity = 133/464 (28.66%), Postives = 219/464 (47.20%), Query Frame = 2
Query: 3098 VQWVDGQKSIFTVVIRPETTIFTQSTHLHKFFQVCSEKLDELTNPTVVEKKESIFTKPRSGSDPTTPKPVSDDTLLLQTSNKDV--EIKNAIKALATVNVTNLIKFFAPTFNQLLHVVVCTAISHSE-ISKTAVTSMITLASSLRTPSMESLSSKATKRNTKIIKSYIKFAFDAEKIVPTKVK-RTVHESLIQAISELIRPPFRDTXXXXXXXXXXXXXYSIITKSMIQSLTKQSKITIDKGGDKFFSTSYMDSLQNMIHLIINCILEITSTVGNQSGMNGQLRPNNSFQSLATSANKDLARFISRLFNVMDRGFIFQIIHQYMKIFIARINAYSGHREHLCRMKFDFLEIVTNHEHYLPLNLLKIINPSDKGQSVRKRQAPPSLELILSETYCRQHYLAGLLLQEVHRQMSDVYSHNAVRRLPFVMLRNLLAKHLFDDRYSSINMQARIAALYLPLVSIILEN 4477
            ++WVDG K +  +    E+TI+TQ  H+HKFF  C                                        L+Q+ +K+V  E+   +K L  + +  +I+F      QL  V+  T ++H + +       ++ + S      +ES            ++S+IK++F  EK  P+ ++ + +HE+L   +  +++    D   +N  L  S+ F+ II KSM   L +++KI + +G  + F  +Y   L +++  II  +    + + ++S  NG               N  LA F+ R   +MDRGF+F +I+ Y+  F  +        + L   KF+FL+ + NHEHY+PLNL     P    +   +R    +LE  LS+ YC+ H+L GLLL+E    + D Y    +R     +++NLL KH FD RY   N QA+IA LYLP V ++LEN
Sbjct:  801 IKWVDGAKPLLKIKTHLESTIYTQDLHVHKFFHHCQ---------------------------------------LIQSGSKEVPGELIKYLKCLHAMEIQVMIQFLPVILMQLFRVL--TNMTHEDDVPINCTMVLLHIVSKCHEEGLESY-----------LRSFIKYSFRPEK--PSTLQAQLIHETLATTMIAILKQS-ADFLAINKLLKYSWFFFEIIAKSMATYLLEENKIKLPRG--QRFPEAYHHVLHSLLLAIIPHVTIRYAEIPDES-RNG---------------NYSLASFLKRCLTLMDRGFVFNLINDYISGFSPK------DPKVLAEYKFEFLQTICNHEHYIPLNL-----PMAFAKPKLQRVQDSNLEYSLSDEYCKHHFLVGLLLRETSIALQDNYE---IRYTAISVIKNLLIKHAFDTRYQHKNQQAKIAQLYLPFVGLLLEN 1177          

HSP 3 Score: 122.479 bits (306), Expect = 6.934e-27
Identity = 68/164 (41.46%), Postives = 98/164 (59.76%), Query Frame = 2
Query: 2411 LYIYPRTLNFSNQNVFHRARNLSCFVELRDVDKSDAPPLKVFYSRPSRKQPAFDYWSNTSVIYHDSSPTFNEEIKIALPLNLHSKHHLLFRFYHVSCDTAAIPNVREKGSNKK--SLETPVGVTWLTLMDQNLNLKSGSFSLPVATQLVPDYL-----EEKQQS 2881
            LY+YP  L + +Q  F +ARN++  VE RD D+SDA  LK  Y +P+     F   +   V +H+ +P F +EIKI LP++LH KHHLLF FYHVSC+      +  KG+ KK  ++ETPVG  W+ L+ ++  + +    LPV+  L P YL     E ++QS
Sbjct:  643 LYVYPLQLKYDSQKSFAKARNIAVCVEFRDSDESDASALKCIYGKPAGS--VFTTNAYAVVSHHNQNPEFYDEIKIELPIHLHQKHHLLFTFYHVSCE------INTKGTTKKQDTVETPVGFAWVPLL-KDGRVITLEQQLPVSANLPPGYLNVNDAESRRQS 797          

HSP 4 Score: 107.071 bits (266), Expect = 3.065e-22
Identity = 153/625 (24.48%), Postives = 256/625 (40.96%), Query Frame = 2
Query:  134 SELVKPIDFESVYLQNKNNISNDPNRVLVKIPDNDVKINKVSRKETVYNNGVPTNIHEIFDCNLLAKLCVDFYTSEWTATCYKDFTYNSSFWTLPNVHNQLTMAKEQKFIIXXXXXXXXXXLLTFKTKGSYFESNLAICDRNAYQKHLKHREDELANTSSNAGINYSKAAVPELLSFSLNELSDGSTVL------KESMPRDGHEQIIVYLD---NVDSLRELGGYWILLSFKGKQSESYLFTGGNDNQKLWANKLKDAIESETKTKQIERPVSSESIERSE---------------ETVHGMLSKFLQENEQSAVILRKKDHQKILVIYSEIRNQIKMKSQQTPIYDIGIIEKSQLDDCHIRPQV---EQSIPKTFIKLTANRFITSVG-ISDENSNPKGVIPAEPFFISFSLFHIADGRRISEEFYWNPNRPQIEDLLPSDLFAYKFGGHPVHATINGNCDNRTPLNL-PTMSDRVLQSTNSFILKVPCLPDKICLFIKSEKVFSGAIGPTVDKYIKSGGSLLKKKDREEELFVENPDVKTGASINKTMSVYCANIGHYRMPFGWTACRL--NIKGKNCL--RF---HKYENNKTSEDDIIKLVQNMSSQHVDNNASKYTTIP 1900
            ++LV+P+D+E+V  Q K  I +DP R L+  P  D+ I+ + R+     + VP +  +    +L  K C+  Y+++W    YK   ++  F  LP    +        F IDED EKD              E + ++C     QK    ++  L   + N+ I  +   V +   F L +L DGS +L      K S    G     +YLD   +V    ++  +   L    K S  YL        + W   LK  I+  T +   E+  + E+I+  E                ++H  L K+ +E EQ   + R    Q +    SE++                     +LD   I P V   E+   K F+    +     +G I D    P   +  EPFFI+ +LF + +  +IS +F+ + N P + ++L          G     + +GN    +P +L   +++  L      I  V     +I L ++ EKV  G I    + YIK+                    +KT   +++T    C+ +G YRMPF W A  +  +++G   L  RF   +K +++K S +DI+KL+    S++     +K   IP
Sbjct:   37 AKLVEPLDYENVITQRKTQIYSDPLRDLLMFPMEDISISVIGRQRRTVQSTVPEDAEKRAQ-SLFVKECIKTYSTDWHVVNYKYEDFSGDFRMLPCKSLRPEKIPNHVFEIDEDCEKD--------------EDSSSLCS----QKGGVIKQGWLHKANVNSTITVT-MKVFKRRYFYLTQLPDGSYILNSYKDEKNSKESKG----CIYLDACIDVVQCPKMRRHAFELKMLDKYSH-YLAAETEQEMEEWLIMLKKIIQINTDSLVQEKKDTVEAIQEEETSSQGKAENIMASLERSMHPELMKYGRETEQLNKLSRGDGRQNLFSFDSEVQ---------------------RLDFSGIEPDVKPFEEKCNKRFMVNCHDLTFNILGHIGDNAKGPPTNV--EPFFINLALFDVKNNCKISADFHVDLNPPSVREML---------WGTSTQLSNDGNAKGFSPESLIHGIAESQLCYIKQGIFSVTNPHPEIFLVVRIEKVLQGNITHCAEPYIKNSDP-----------------IKTAQKVHRTAKQVCSRLGQYRMPFAWAARPIFKDVQGSLDLDGRFSPLYKQDSSKLSNEDILKLL----SEYKKPEKTKLQIIP 583          
BLAST of Dedicator of cytokinesis vs. UniProt/SwissProt
Match: sp|Q5JSL3|DOC11_HUMAN (Dedicator of cytokinesis protein 11 OS=Homo sapiens OX=9606 GN=DOCK11 PE=1 SV=2)

HSP 1 Score: 426.402 bits (1095), Expect = 3.421e-119
Identity = 268/838 (31.98%), Postives = 425/838 (50.72%), Query Frame = 2
Query: 5138 KDIFVCLLHIFHTISSDDLKATICNLTVQERLEFLQLLILSIHHLKYQGRKVINNFESI--------------------STGCAKSKIQLRPHGPRSSVTAILDDVDHGD--HKAYLEGNVSTEVGLIVLDVLSAYCSAFKQEILTYTPDHVIFKKIVDIYLTLLSVNQSEIVLKHVFVSMRVFVSTFAKVLFANCHNVISDLSLHTLRFLDTRFTSVRIEACGFLYRMMRSSYDTFNKPGINRVHLQMIVAVSKLDRTV----GIRFKESLNYLKRLAEIEMXXXXXXXXXXXXXGTPTGTSKSITIGVHSTTKLSMQTFFEEVTDLTQRIRTVLMATVQMNEHVDDPEMQVDLQYSLAKSYSSNPALRRTWLEKIYAIHNKNNSRAEMAMCKAHIVAMIVEYLRRKEQYSMSCANFKAISPNIPLEESGMRDDSVQLEVHYTKEEVVKLLRELAHEFDAGCLWEVLRHVYKLVIPIYERKRDYEQLAEIYKHMSDGYNKIKTAESTNQRIIGSYYRVVLYGKP-FDSLAGKVFIYRLDSGKQFCVVREELQKLFSKKYGAGKVQMLVE-NHIDRSKLDPELASIQVTHVEPFFNEDEELERHSMFERQYNISKFMLETPFVKMNHVEHESRWKKYKEHDIDGVLKSKQTDDLSIQWKRRTILTVEASFPHLKRRLEVISIKEIDFSPIERAIDEIQLKNRQLAMHLAYXXXXXXXXXXXXXXXXXXXXXVGSSQTRANNIPLLMDMHMSGALLPQVNQGPMAYARVFLHKETQANYSQEKVKQLKIQFMEFLTLCYLLLRDFNELMSHIQQQKYIAMREALDSYRVELSNLINEEI 7567
            + + +C L+I   IS D L      ++ QE +  L LL + + H +Y G++ I                           +G  ++++Q       S            D  H+A LEGN +TEV L VLD +S +   FK ++L     + + KK+ DI+L  L   QSE+ LKHVF S+R F+S F    F    N+ +      L+   ++ +S R EA   LY +MR++++   +    R HLQ+I+AVS+L   V    G RF+ESL  +   A                               +S   +    F  EV DLT+RIRTVLMAT QM EH  DPEM +DLQYSLAKSY+S P LR+TWL+ +  IH KN   +E AMC  H+ A++ E+L RK+ +   C+ FK I+PNI  EE  M++D+  ++VHY++E +++LL +          +E++  + KL++PIYE++R++E+L ++Y+ +   Y KI     T +R++G+++RV  YG+  F+   GK +IY+         +   L KL+ +K+G   V+++ + + ++  +LDP+ A IQVT+V+P+F++ E  ER + FER +NIS+F+ E P+                       L  K+   +  Q KRRTILT   SFP++K+R+ +   ++I+  PI+ A DEI+ K  +L                              S T  + I L   + + G +  QVN GP+AYAR FL+    + Y  +KV +LK  F +F+  C + L     L+   Q + +  ++        ELS++I+E+I
Sbjct: 1280 RSLLMCYLYIVKMISEDTLLTYWNKVSPQELINILILLEVCLFHFRYMGKRNIARVHDAWLSKHFGIDRKSQTMPALRNRSGVMQARLQHLSSLESSFTLNHSSTTTEADIFHQALLEGNTATEVSLTVLDTISFFTQCFKTQLLNNDGHNPLMKKVFDIHLAFLKNGQSEVSLKHVFASLRAFISKFPSAFFKGRVNMCAAFCYEVLKCCTSKISSTRNEASALLYLLMRNNFEYTKRKTFLRTHLQIIIAVSQLIADVALSGGSRFQESLFIINNFA-------------------------------NSDRPMKATAFPAEVKDLTKRIRTVLMATAQMKEHEKDPEMLIDLQYSLAKSYASTPELRKTWLDSMAKIHVKNGDFSEAAMCYVHVAALVAEFLHRKKLFPNGCSAFKKITPNID-EEGAMKEDAGMMDVHYSEEVLLELLEQCVDGLWKAERYEIISEISKLIVPIYEKRREFEKLTQVYRTLHGAYTKILEVMHTKKRLLGTFFRVAFYGQSFFEEEDGKEYIYKEPKLTGLSEISLRLVKLYGEKFGTENVKIIQDSDKVNAKELDPKYAHIQVTYVKPYFDDKELTERKTEFERNHNISRFVFEAPY----------------------TLSGKKQGCIEEQCKRRTILTTSNSFPYVKKRIPINCEQQINLKPIDVATDEIKDKTAELQKL--------------------------CSSTDVDMIQL--QLKLQGCVSVQVNAGPLAYARAFLNDSQASKYPPKKVSELKDMFRKFIQACSIALELNERLIKEDQVEYHEGLKSNFRDMVKELSDIIHEQI 2035          

HSP 2 Score: 165.236 bits (417), Expect = 5.558e-39
Identity = 148/556 (26.62%), Postives = 247/556 (44.42%), Query Frame = 2
Query: 3098 VQWVDGQKSIFTVVIRPETTIFTQSTHLHKFFQVCSEKLDELTNPTVVEKKESIFTKPRSGSDPTTPKPVSDDTLLLQTSNKDV--EIKNAIKALATVNVTNLIKFFAPTFNQLLHVVVCTAISHSE-ISKTAVTSMITLASSLRTPSMESLSSKATKRNTKIIKSYIKFAFDAEKIVPTKVKRTVHESLIQAISELIRPPFRDTXXXXXXXXXXXXXYSIITKSMIQSLTKQSKITIDKGGDKFFSTSYMDSLQNMIHLIINCILEITSTVGNQSGMNGQLRPNNSFQSLATSANKDLARFISRLFNVMDRGFIFQIIHQYMKIFIARINAYSGHREHLCRMKFDFLEIVTNHEHYLPLNLLKIINPSDKGQSVRKRQAPPSLELILSETYCRQHYLAGLLLQEVHRQMSDVYSHNAVRRLPFVMLRNLLAKHLFDDRYSSINMQARIAALYLPLVSIILENQKSFSLPGNLHTKVNLLN----DIYDHSDRSLSARPLSTLSGDTLSTHSSINGSSG------------DGAGGSVYGLGFGTNSSKSARSSQV 4708
            ++WVDG K +  +    E+TI+TQ  H+HKFF  C                                        L+Q+ +K+V  E+   +K L  + +  +I+F      QL  V+  T ++H + +       ++ + S      ++S            ++S+IK++F  EK    + +  +HE+L   +  +++    D   +N  L  S+ F+ II KSM   L +++KI + +G  + F  +Y   L +++  II  +    + + ++S                 + N  LA F+ R   +MDRGFIF +I+ Y+  F  +        + L   KF+FL+ + NHEHY+PLNL     P    +   +R    +LE  LS+ YC+ H+L GLLL+E    + D Y    +R     +++NLL KH FD RY   N QA+IA LYLP V ++LEN +  +    L++   + N    D +     S + R   +LS D  + + S     G            +GA G       G N+ +S+  S V
Sbjct:  801 IKWVDGAKPLLKIKSHLESTIYTQDLHVHKFFHHCQ---------------------------------------LIQSGSKEVPGELIKYLKCLHAMEIQVMIQFLPVILMQLFRVL--TNMTHEDDVPINCTMVLLHIVSKCHEEGLDSY-----------LRSFIKYSFRPEKPSAPQAQ-LIHETLATTMIAILKQS-ADFLSINKLLKYSWFFFEIIAKSMATYLLEENKIKLPRG--QRFPETYHHVLHSLLLAIIPHVTIRYAEIPDES----------------RNVNYSLASFLKRCLTLMDRGFIFNLINDYISGFSPK------DPKVLAEYKFEFLQTICNHEHYIPLNL-----PMAFAKPKLQRVQDSNLEYSLSDEYCKHHFLVGLLLRETSIALQDNYE---IRYTAISVIKNLLIKHAFDTRYQHKNQQAKIAQLYLPFVGLLLENIQRLAGRDTLYSCAAMPNSASRDEFPCGFTSPANR--GSLSTDKDTAYGSFQNGHGIKREDSRGSLIPEGATGFPDQGNTGENTRQSSTRSSV 1268          

HSP 3 Score: 123.635 bits (309), Expect = 1.907e-26
Identity = 65/153 (42.48%), Postives = 93/153 (60.78%), Query Frame = 2
Query: 2411 LYIYPRTLNFSNQNVFHRARNLSCFVELRDVDKSDAPPLKVFYSRPSRKQPAFDYWSNTSVIYHDSSPTFNEEIKIALPLNLHSKHHLLFRFYHVSCDTAAIPNVREKGSNKK--SLETPVGVTWLTLMDQNLNLKSGSFSLPVATQLVPDYL 2863
            LY+YP  L + +Q  F +ARN++  VE RD D+SDA  LK  Y +P+     F   +   V +H+ +P F +EIKI LP++LH KHHLLF FYHVSC+      +  KG+ KK  ++ETPVG  W+ L+ ++  + +    LPV+  L P YL
Sbjct:  643 LYVYPLQLKYDSQKTFAKARNIAVCVEFRDSDESDASALKCIYGKPAGS--VFTTNAYAVVSHHNQNPEFYDEIKIELPIHLHQKHHLLFTFYHVSCE------INTKGTTKKQDTVETPVGFAWVPLL-KDGRIITFEQQLPVSANLPPGYL 786          

HSP 4 Score: 100.138 bits (248), Expect = 3.136e-19
Identity = 148/626 (23.64%), Postives = 253/626 (40.42%), Query Frame = 2
Query:  134 SELVKPIDFESVYLQNKNNISNDPNRVLVKIPDNDVKINKVSRKETVYNNGVPTNIHEIFDCNLLAKLCVDFYTSEWTATCYKDFTYNSSFWTLPNVHNQLTMAKEQKFIIXXXXXXXXXXLLTFKTKGSYFESNLAICDRNAYQKHLKHREDELANTSSNAGINYSKAAVPELLSFSLNELSDGSTVL------KESMPRDGHEQIIVYLD---NVDSLRELGGYWILLSFKGKQSESYLFTGGNDNQKLWANKLKDAIESETKTKQIERPVSSESIERSE---------------ETVHGMLSKFLQENEQSAVILRKKDHQKILVIYSEIRNQIKMKSQQTPIYDIGIIEKSQLDDCHIRPQV---EQSIPKTFIKLTANRFITSVG-ISDENSNPKGVIPAEPFFISFSLFHIADGRRISEEFYWNPNRPQIEDLLPSDLFAYKFGGHPVHATINGNCDNRTPLN-LPTMSDRVLQSTNSFILKVPCLPDKICLFIKSEKVFSGAIGPTVDKYIKSGGSLLKKKDREEELFVENPDVKTGASINKTMSVYCANIGHYRMPFGWTA--------CRLNIKGKNCLRFHKYENNKTSEDDIIKLVQNMSSQHVDNNASKYTTIP 1900
            +++V+P+D+E+V  Q K  I +DP R L+  P  D+ I+ + R+     + VP +  +    +L  K C+  Y+++W    YK   ++  F  LP    +        F IDED EKD              E + ++C     QK    ++  L   + N+ I  +   V +   F L +L DGS +L      K S    G     +YLD   +V    ++  +   L    K S  YL        + W   LK  I+  T +   E+  + E+ +  E                ++H  L K+ +E EQ   + R    Q +    SE++                     +LD   I P +   E+   K F+    +     +G I D    P   +  EPFFI+ +LF + +  +IS +F+ + N P + ++L          G       +G+    +P + +  +++  L+     I  V     +I L  + EKV  G I    + YIK+                 +P VKT   +++T    C+ +G YRMPF W A          L++ G+     +K +++K S +DI+KL+    S++     +K   IP
Sbjct:   37 AKVVEPLDYENVIAQRKTQIYSDPLRDLLMFPMEDISISVIGRQRRTVQSTVPEDAEKRAQ-SLFVKECIKTYSTDWHVVNYKYEDFSGDFRMLPCKSLRPEKIPNHVFEIDEDCEKD--------------EDSSSLCS----QKGGVIKQGWLHKANVNSTITVT-MKVFKRRYFYLTQLPDGSYILNSYKDEKNSKESKG----CIYLDACIDVVQCPKMRRHAFELKMLDKYSH-YLAAETEQEMEEWLITLKKIIQINTDSLVQEKKETVETAQDDETSSQGKAENIMASLERSMHPELMKYGRETEQLNKLSRGDGRQNLFSFDSEVQ---------------------RLDFSGIEPDIKPFEEKCNKRFLVNCHDLTFNILGQIGDNAKGPPTNV--EPFFINLALFDVKNNCKISADFHVDLNPPSVREML---------WGSSTQLASDGSPKGSSPESYIHGIAESQLRYIQQGIFSVTNPHPEIFLVARIEKVLQGNITHCAEPYIKNS----------------DP-VKTAQKVHRTAKQVCSRLGQYRMPFAWAARPIFKDTQGSLDLDGRFS-PLYKQDSSKLSSEDILKLL----SEYKKPEKTKLQIIP 583          
BLAST of Dedicator of cytokinesis vs. UniProt/SwissProt
Match: sp|A2AF47|DOC11_MOUSE (Dedicator of cytokinesis protein 11 OS=Mus musculus OX=10090 GN=Dock11 PE=1 SV=1)

HSP 1 Score: 423.705 bits (1088), Expect = 2.501e-118
Identity = 271/839 (32.30%), Postives = 429/839 (51.13%), Query Frame = 2
Query: 5138 KDIFVCLLHIFHTISSDDLKATICNLTVQERLEFLQLLILSIHHLKYQGRKVINNFESI--------------------STGCAKSKIQLRPHGPRSSVTAILDDVDHGD--HKAYLEGNVSTEVGLIVLDVLSAYCSAFKQEILTYTPDHVIFKKIVDIYLTLLSVNQSEIVLKHVFVSMRVFVSTFAKVLFANCHNVISDLSLHTLRFLDTRFTSVRIEACGFLYRMMRSSYDTFNKPGINRVHLQMIVAVSKLDRTV----GIRFKESLNYLKRLAEIEMXXXXXXXXXXXXXGTPTGTSKSITIGVHSTTKLSMQTFFEEVTDLTQRIRTVLMATVQMNEHVDDPEMQVDLQYSLAKSYSSNPALRRTWLEKIYAIHNKNNSRAEMAMCKAHIVAMIVEYLRRKEQYSMSCANFKAISPNIPLEESGMRDDSVQLEVHYTKEEVVKLLRELAHEFDAGCLWEVLRHVYKLVIPIYERKRDYEQLAEIYKHMSDGYNKIKTAESTNQRIIGSYYRVVLYGKP-FDSLAGKVFIYRLDSGKQFCVVREELQKLFSKKYGAGKVQMLVE-NHIDRSKLDPELASIQVTHVEPFFNEDEELERHSMFERQYNISKFMLETPFVKMNHVEHESRWKKYKEHDIDGVLKSKQTDDLSIQWKRRTILTVEASFPHLKRRLEVISIKEIDFSPIERAIDEIQLKNRQLAMHLAYXXXXXXXXXXXXXXXXXXXXXVGSSQTRANNIPLLMDMHMSGALLPQVNQGPMAYARVFLHKETQAN-YSQEKVKQLKIQFMEFLTLCYLLLRDFNELMSHIQQQKYIAMREALDSYRVELSNLINEEI 7567
            +++ +C L+I   IS D L      ++ QE +  L LL + + H +Y G++ I                           +G  ++++Q       S            D  H+A LEGN +TEV L VLD +S +   FK ++L     + + KK+ DI+L  L   QSE+ LKHVF S+R F+S F    F    N+ +      L+   ++ +S R EA   LY +MR++++   +    R HLQ+I+AVS+L   V    G RF+ESL  +   A                               +S   +    F  EV DLT+RIRTVLMAT QM EH  DPEM +DLQYSLAKSY+S P LR+TWL+ +  IH KN   +E AMC  H+ A++ E+L RK+ +   C+ FK I+PNI  EE  M++D+  ++VHY++E +++LL +          +EV+  + KL+IPIYE++R++E+L ++Y+ +   Y KI     T +R++G+++RV  YG+  F+   GK +IY+         +   L KL+ +K+G   V+++ + + ++  +LDP+ A IQVT+V+P+F++ E  ER + FER +NI++F+ E P+                       L  K+   +  Q KRRTILT   SFP++K+R+ +   ++++  PI+ A DEI+ K  +L                              S    + I L   + + G +  QVN GP+AYAR FL+ E+QAN Y  +KV +LK  F +F+  C + L     L+   Q + +  ++        ELS++I+E+I
Sbjct: 1280 RNLLMCYLYIVKMISEDTLLTYWNKVSPQELINILVLLEVCLFHFRYMGKRNIARVHDAWLSKHFGIDRKSQTMPALRNRSGVMQARLQHLSSLESSFTLNHSSATTEADIFHQALLEGNTATEVSLTVLDTISFFTQCFKNQLLNNDGHNPLMKKVFDIHLAFLKNGQSEVSLKHVFASLRSFISKFPSAFFKGRVNMCAAFCYEVLKCCTSKISSTRNEASALLYLLMRNNFEYTKRKTFLRTHLQIIIAVSQLIADVALSGGSRFQESLFIINNFA-------------------------------NSDRPMKATAFPTEVKDLTKRIRTVLMATAQMKEHEKDPEMLIDLQYSLAKSYASTPELRKTWLDSMAKIHIKNGDFSEAAMCYVHVAALVAEFLHRKKLFPSGCSAFKKITPNID-EEGAMKEDAGMMDVHYSEEVLLELLEQCVDGLWKAERYEVISEISKLIIPIYEKRREFEKLTQVYRTLHGAYTKILEVMHTKKRLLGTFFRVAFYGQSFFEEEDGKEYIYKEPKLTGLSEISLRLVKLYGEKFGTENVKIIQDSDKVNAKELDPKFAHIQVTYVKPYFDDKELTERKTEFERNHNINRFVFEAPY----------------------TLSGKKQGCIEEQCKRRTILTTSNSFPYVKKRIPINCEQQVNLKPIDVATDEIKDKTAELHKL--------------------------CSSVDVDMIQL--QLKLQGCVSVQVNAGPLAYARAFLN-ESQANKYPPKKVNELKDMFRKFIQACSIALELNERLIKEDQIEYHEGLKSNFRDMVKELSDIIHEQI 2035          

HSP 2 Score: 168.318 bits (425), Expect = 5.216e-40
Identity = 133/464 (28.66%), Postives = 219/464 (47.20%), Query Frame = 2
Query: 3098 VQWVDGQKSIFTVVIRPETTIFTQSTHLHKFFQVCSEKLDELTNPTVVEKKESIFTKPRSGSDPTTPKPVSDDTLLLQTSNKDV--EIKNAIKALATVNVTNLIKFFAPTFNQLLHVVVCTAISHSE-ISKTAVTSMITLASSLRTPSMESLSSKATKRNTKIIKSYIKFAFDAEKIVPTKVK-RTVHESLIQAISELIRPPFRDTXXXXXXXXXXXXXYSIITKSMIQSLTKQSKITIDKGGDKFFSTSYMDSLQNMIHLIINCILEITSTVGNQSGMNGQLRPNNSFQSLATSANKDLARFISRLFNVMDRGFIFQIIHQYMKIFIARINAYSGHREHLCRMKFDFLEIVTNHEHYLPLNLLKIINPSDKGQSVRKRQAPPSLELILSETYCRQHYLAGLLLQEVHRQMSDVYSHNAVRRLPFVMLRNLLAKHLFDDRYSSINMQARIAALYLPLVSIILEN 4477
            ++WVDG K +  +    E+TI+TQ  H+HKFF  C                                        L+Q+ +K+V  E+   +K L  + +  +I+F      QL  V+  T ++H + +       ++ + S      +ES            ++S+IK++F  EK  P+ ++ + +HE+L   +  +++    D   +N  L  S+ F+ II KSM   L +++KI + +G  + F  +Y   L +++  II  +    + + ++S  NG               N  LA F+ R   +MDRGF+F +I+ Y+  F  +        + L   KF+FL+ + NHEHY+PLNL     P    +   +R    +LE  LS+ YC+ H+L GLLL+E    + D Y    +R     +++NLL KH FD RY   N QA+IA LYLP V ++LEN
Sbjct:  801 IKWVDGAKPLLKIKTHLESTIYTQDLHVHKFFHHCQ---------------------------------------LIQSGSKEVPGELIKYLKCLHAMEIQVMIQFLPVILMQLFRVL--TNMTHEDDVPINCTMVLLHIVSKCHEEGLESY-----------LRSFIKYSFRPEK--PSTLQAQLIHETLATTMIAILKQS-ADFLAINKLLKYSWFFFEIIAKSMATYLLEENKIKLPRG--QRFPEAYHHVLHSLLLAIIPHVTIRYAEIPDES-RNG---------------NYSLASFLKRCLTLMDRGFVFNLINDYISGFSPK------DPKVLAEYKFEFLQTICNHEHYIPLNL-----PMAFAKPKLQRVQDSNLEYSLSDEYCKHHFLVGLLLRETSIALQDNYE---IRYTAISVIKNLLIKHAFDTRYQHKNQQAKIAQLYLPFVGLLLEN 1177          

HSP 3 Score: 122.479 bits (306), Expect = 4.850e-26
Identity = 68/164 (41.46%), Postives = 98/164 (59.76%), Query Frame = 2
Query: 2411 LYIYPRTLNFSNQNVFHRARNLSCFVELRDVDKSDAPPLKVFYSRPSRKQPAFDYWSNTSVIYHDSSPTFNEEIKIALPLNLHSKHHLLFRFYHVSCDTAAIPNVREKGSNKK--SLETPVGVTWLTLMDQNLNLKSGSFSLPVATQLVPDYL-----EEKQQS 2881
            LY+YP  L + +Q  F +ARN++  VE RD D+SDA  LK  Y +P+     F   +   V +H+ +P F +EIKI LP++LH KHHLLF FYHVSC+      +  KG+ KK  ++ETPVG  W+ L+ ++  + +    LPV+  L P YL     E ++QS
Sbjct:  643 LYVYPLQLKYDSQKSFAKARNIAVCVEFRDSDESDASALKCIYGKPAGS--VFTTNAYAVVSHHNQNPEFYDEIKIELPIHLHQKHHLLFTFYHVSCE------INTKGTTKKQDTVETPVGFAWVPLL-KDGRVITLEQQLPVSANLPPGYLNVNDAESRRQS 797          

HSP 4 Score: 107.071 bits (266), Expect = 2.144e-21
Identity = 153/625 (24.48%), Postives = 256/625 (40.96%), Query Frame = 2
Query:  134 SELVKPIDFESVYLQNKNNISNDPNRVLVKIPDNDVKINKVSRKETVYNNGVPTNIHEIFDCNLLAKLCVDFYTSEWTATCYKDFTYNSSFWTLPNVHNQLTMAKEQKFIIXXXXXXXXXXLLTFKTKGSYFESNLAICDRNAYQKHLKHREDELANTSSNAGINYSKAAVPELLSFSLNELSDGSTVL------KESMPRDGHEQIIVYLD---NVDSLRELGGYWILLSFKGKQSESYLFTGGNDNQKLWANKLKDAIESETKTKQIERPVSSESIERSE---------------ETVHGMLSKFLQENEQSAVILRKKDHQKILVIYSEIRNQIKMKSQQTPIYDIGIIEKSQLDDCHIRPQV---EQSIPKTFIKLTANRFITSVG-ISDENSNPKGVIPAEPFFISFSLFHIADGRRISEEFYWNPNRPQIEDLLPSDLFAYKFGGHPVHATINGNCDNRTPLNL-PTMSDRVLQSTNSFILKVPCLPDKICLFIKSEKVFSGAIGPTVDKYIKSGGSLLKKKDREEELFVENPDVKTGASINKTMSVYCANIGHYRMPFGWTACRL--NIKGKNCL--RF---HKYENNKTSEDDIIKLVQNMSSQHVDNNASKYTTIP 1900
            ++LV+P+D+E+V  Q K  I +DP R L+  P  D+ I+ + R+     + VP +  +    +L  K C+  Y+++W    YK   ++  F  LP    +        F IDED EKD              E + ++C     QK    ++  L   + N+ I  +   V +   F L +L DGS +L      K S    G     +YLD   +V    ++  +   L    K S  YL        + W   LK  I+  T +   E+  + E+I+  E                ++H  L K+ +E EQ   + R    Q +    SE++                     +LD   I P V   E+   K F+    +     +G I D    P   +  EPFFI+ +LF + +  +IS +F+ + N P + ++L          G     + +GN    +P +L   +++  L      I  V     +I L ++ EKV  G I    + YIK+                    +KT   +++T    C+ +G YRMPF W A  +  +++G   L  RF   +K +++K S +DI+KL+    S++     +K   IP
Sbjct:   37 AKLVEPLDYENVITQRKTQIYSDPLRDLLMFPMEDISISVIGRQRRTVQSTVPEDAEKRAQ-SLFVKECIKTYSTDWHVVNYKYEDFSGDFRMLPCKSLRPEKIPNHVFEIDEDCEKD--------------EDSSSLCS----QKGGVIKQGWLHKANVNSTITVT-MKVFKRRYFYLTQLPDGSYILNSYKDEKNSKESKG----CIYLDACIDVVQCPKMRRHAFELKMLDKYSH-YLAAETEQEMEEWLIMLKKIIQINTDSLVQEKKDTVEAIQEEETSSQGKAENIMASLERSMHPELMKYGRETEQLNKLSRGDGRQNLFSFDSEVQ---------------------RLDFSGIEPDVKPFEEKCNKRFMVNCHDLTFNILGHIGDNAKGPPTNV--EPFFINLALFDVKNNCKISADFHVDLNPPSVREML---------WGTSTQLSNDGNAKGFSPESLIHGIAESQLCYIKQGIFSVTNPHPEIFLVVRIEKVLQGNITHCAEPYIKNSDP-----------------IKTAQKVHRTAKQVCSRLGQYRMPFAWAARPIFKDVQGSLDLDGRFSPLYKQDSSKLSNEDILKLL----SEYKKPEKTKLQIIP 583          
BLAST of Dedicator of cytokinesis vs. UniProt/SwissProt
Match: sp|Q8BIK4|DOCK9_MOUSE (Dedicator of cytokinesis protein 9 OS=Mus musculus OX=10090 GN=Dock9 PE=1 SV=2)

HSP 1 Score: 423.32 bits (1087), Expect = 3.534e-118
Identity = 266/840 (31.67%), Postives = 419/840 (49.88%), Query Frame = 2
Query: 5120 LNDKTQKDIFVCLLHIFHTISSDDLKATICNLTVQERLEFLQLLILSIHHLKYQGRKVINNFESISTGCAKSKIQLRPHGPRSSVTAILDDVDHGD----HKAYLEGNVSTEVGLIVLDVLSAYCSAFKQEILTYTPDHVIFKKIVDIYLTLLSVNQSEIVLKHVFVSMRVFVSTFAKVLFANCHNVISDLSLHTLRFLDTRFTSVRIEACGFLYRMMRSSYDTFNKPGINRVHLQMIVAVSKLDRTV----GIRFKESLNYLKRLAEIEMXXXXXXXXXXXXXGTPTGTSKSITIGVHSTTKLSMQTFFEEVTDLTQRIRTVLMATVQMNEHVDDPEMQVDLQYSLAKSYSSNPALRRTWLEKIYAIHNKNNSRAEMAMCKAHIVAMIVEYLRRKEQYSMSCANFKAISPNIPLEESGMRDDSVQLEVHYTKEEVVKLLRELAHEFDAGCLWEVLRHVYKLVIPIYERKRDYEQLAEIYKHMSDGYNKIKTAESTNQRIIGSYYRVVLYGKP---------------FDSLAGKVFIYRLDSGKQFCVVREELQKLFSKKYGAGKVQMLVEN-HIDRSKLDPELASIQVTHVEPFFNEDEELERHSMFERQYNISKFMLETPFVKMNHVEHESRWKKYKEHDIDGVLKSKQTDDLSIQWKRRTILTVEASFPHLKRRLEVISIKEIDFSPIERAIDEIQLKNRQLAMHLAYXXXXXXXXXXXXXXXXXXXXXVGSSQTRANNIPLLMDMHMSGALLPQVNQGPMAYARVFLHKETQANYSQEKVKQLKIQFMEFLTLCYLLLRDFNELMSHIQQQKYIAMREALDSYRVELSNLINEEI 7567
            L+    K + +C L++  ++S D L       +  E ++F  +  + +H  +Y G++ I       TG   +++Q    G   +         H +    H++ LE N++TEV L  LD LS +  AFK ++L     + + KK+ D+YL  L  +QSE+ LK+VF ++R  +  F    +    ++ + L    L+  +++ +S+R EA   LY +MR+++D   K    R HLQ+I++VS+L   V    G RF++SL+ +   A                               +S   +   +F  +V DLT+RIRTVLMAT QM EH +DPEM VDLQYSLAKSY+S P LR+TWL+ +  IH KN   +E AMC  H+ A++ EYL RK  +   C  F+ I+PNI  E S M D  +Q +VH+ ++ +++LL + A        +E++  +YKL+IPIYE++RD+E+LA +Y  +   Y+K+     + +R++G+Y+RV  +G+                F+   GK +IY+         + + L KL+S K+G+  V+M+ ++  ++   LD + A IQVTHV PFF+E E  ER + FER +NI +FM E PF +                        K+   +  Q KRRTILT    FP++K+R+ V+     D +PIE AIDE+  K  +L                              S    + I L   + + G++  QVN GP+AYAR FL       Y   KVK LK  F +F+  C   L     L+   Q +    M+        ELS+++ E++
Sbjct: 1304 LDQSEIKSLLMCFLYVLKSMSDDALFTYWNKASTAELMDFFTISEVCLHQFQYMGKRYIAR-----TGMMHARLQ--QLGSLDNSVTFNHSYGHSEADVVHQSLLEANIATEVCLTALDTLSLFTLAFKNQLLADHGHNPLMKKVFDVYLCFLQKHQSEMALKNVFTALRSLIYKFPSAFYEGRADMCASLCYEVLKCCNSKLSSIRTEASQLLYFLMRNNFDYTGKKSFVRTHLQVIISVSQLIADVVGIGGTRFQQSLSIINNCA-------------------------------NSDRIIKHTSFSSDVKDLTKRIRTVLMATAQMKEHENDPEMLVDLQYSLAKSYASTPELRKTWLDSMARIHVKNGDLSEAAMCYVHVTALVAEYLTRKGMFRQGCTAFRVITPNIDEEASMMEDVGMQ-DVHFNEDVLMELLEQCADGLWKAERYELIADIYKLIIPIYEKRRDFERLAHLYDTLHRAYSKVTEVMHSGRRLLGTYFRVAFFGQAAQYQFTDSETDVEGFFEDEDGKEYIYKEPKLTPLSEISQRLLKLYSDKFGSENVKMIQDSGKVNPKDLDSKFAYIQVTHVTPFFDEKELQERRTEFERCHNIRRFMFEMPFTQT----------------------GKRQGGVEEQCKRRTILTAIHCFPYVKKRIPVMYQHHTDLNPIEVAIDEMSKKVAELRQL--------------------------CSSAEVDMIKL--QLKLQGSVSVQVNAGPLAYARAFLDDTNTKRYPDNKVKLLKEVFRQFVEACGQALAVNERLIKEDQLEYQEEMKANYREMAKELSDIMREQM 2054          

HSP 2 Score: 286.96 bits (733), Expect = 4.112e-76
Identity = 222/744 (29.84%), Postives = 344/744 (46.24%), Query Frame = 2
Query: 2411 LYIYPRTLNFSNQNVFHRARNLSCFVELRDVDKSDAPPLKVFYSRPSRKQPAFDYWSNTSVIYHDSSPTFNEEIKIALPLNLHSKHHLLFRFYHVSCDTAAIPNVREKGSNKK--SLETPVGVTWLTLMDQNLNLKSGSFSLPVATQLVPDYLEEKQQSIYYKKDSLWKLSTSFGQPKPRNSSTDKVIDESVNKRHSGPTFKSYINPRSSRDLEDIFSIKSDDVEQSHDTTVQWVDGQKSIFTVVIRPETTIFTQSTHLHKFFQVCSEKLDELTNPTVVEKKESIFTKPRSGSDPTTPKPVSDDTLLLQTSNKDVEIKNAIKALATVNVTNLIKFFAPTFNQLLHVVVCTAISHSEISKTAVTSMITLASSLRTPSMESLSSKATKRNTKIIKSYIKFAFDAEKIVPTKVKRTVHESLIQAISELIRPPFRDTXXXXXXXXXXXXXYSIITKSMIQSLTKQSKITIDKGGDKFFSTSYMDSLQNMIHLIINCILEITSTVGNQSGMNGQLRPNNSFQSLATSANKDLARFISRLFNVMDRGFIFQIIHQYMKIFIARINAYSGHREHLCRMKFDFLEIVTNHEHYLPLNLLKIINPSDKGQSVRKRQAPPSLELILSETYCRQHYLAGLLLQEVHRQMSDVYSHNAVRRLPFVMLRNLLAKHLFDDRYSSINMQARIAALYLPLVSIILENQKSFSLPGNLHTKVNLLNDIYDHSDRSLSARPLST-LSGDTL--STHSSINGS 4627
            LY+YP+ L + +Q  F +ARN++  +E +D D+ D+ PLK  Y RP    P F   +  +V++H  +P F +EIKI LP  LH +HHLLF F+HVSCD +       KGS KK  ++ET VG +WL L+     L S    +PV+  L   YL  ++  +                                  RH GP                                V+WV+G K +  +     +T++TQ  HLH FFQ C             +K ES      SGS                      E+   +K+L  +    +I F     NQL  V+  T  +  E++      +I + +      +ES            ++SY+KFA+ AE  V ++ K TVHE L ++++ +++P   D    N  L  S+ F+ ++ KSM Q L + +K+ + +  ++ F  SY  +++ ++++++  I +             + R N      + +AN  LA FI R F  MDRGF+F+ I+ Y+  F        G  + L   KF+FL +V NHEHY+PLNL     P   G+   +R     L+  L++ +CR H+L GLLL+EV   + +      VR +   ML+NLL KH FDDRY+S + QARIA LYLPL  +++EN +  ++       VN  + + D +    +  PL T   G+TL  S H  + G+
Sbjct:  652 LYVYPKYLKYDSQKSFAKARNIAICIEFKDSDEEDSQPLKCIYGRPG--GPVFTRSALAAVLHHQQNPEFYDEIKIELPAQLHERHHLLFTFFHVSCDNST------KGSTKKKDAVETQVGFSWLPLLKDGRVLTSEQ-HIPVSANLPSGYLGYQELGM---------------------------------GRHYGPE-------------------------------VKWVEGGKPLLKISTHLVSTVYTQDQHLHNFFQYC-------------QKTES--GAQASGS----------------------ELVKYLKSLHAMEGHVMIAFLPTILNQLFRVL--TRATQEEVAVNVTRVIIHVVAQCHEEGLESH-----------LRSYVKFAYKAEPYVASEYK-TVHEELTKSMTTILKPS-ADFLTSNKLLKYSWFFFDVLIKSMAQHLIENNKVKLLR--NQRFPASYHHAVETVVNMLMPHITQ-------------KFRDN---PEASKNANHSLAVFIKRCFTFMDRGFVFKQINNYISCFAP------GDPKTLFEYKFEFLRVVCNHEHYIPLNL-----PMPFGKGRIQRYQDLQLDYSLTDEFCRNHFLVGLLLREVGTALQEF---REVRVIAISMLKNLLIKHSFDDRYNSRSHQARIATLYLPLFGLLIENVQRINVRDVSPFPVNPGSIVKDEALAVPAGNPLMTPQKGNTLDHSLHKDLLGA 1238          

HSP 3 Score: 67.781 bits (164), Expect = 1.727e-9
Identity = 61/244 (25.00%), Postives = 97/244 (39.75%), Query Frame = 2
Query: 1145 IRPQVEQSIPKTFIKLTANRFITSVGISDENSNPKGVIPAEPFFISFSLFHIADGRRISEEFYWNPNRPQIEDLLPSDLFAYKFGGHPVHATINGNCDNRTPLNLPTMSDRVLQSTNSFILKVPCLPDKICLFIKSEKVFSGAIGPTVDKYIKSGGSLLKKKDREEELFVENPDVKTGASINKTMSVYCANIGHYRMPFGWTACRL--NIKG---KNCLRF---HKYENNKTSEDDIIKLVQNM 1852
            ++P  E+   +  +K     F     +++    P   +  EPFF++ SLF I   R+IS +F+ + N   +  +L     A   GG             ++P          +Q     I  V C    I L  + EKV  G+I    + Y++S  S                  K    + K     C  +G YRMPF W A  L  +  G   KN  RF   ++ ++NK S DD++KL+ + 
Sbjct:  368 VKPFEEKFGKRILVKCNDLSFNLQCCVAENEEGPTTNV--EPFFVTLSLFDIKYNRKISADFHVDLNHFSVRQMLAPTSPALMNGG-------------QSPPAFQDALHTAMQYPKQGIFSVTCPHPDIFLVARIEKVLQGSITHCAEPYMRSSDS-----------------SKVAQKVLKNAKQACQRLGQYRMPFAWAARTLFKDTSGNLDKNA-RFSAIYRQDSNKLSNDDMLKLLADF 578          
BLAST of Dedicator of cytokinesis vs. UniProt/SwissProt
Match: sp|Q9BZ29|DOCK9_HUMAN (Dedicator of cytokinesis protein 9 OS=Homo sapiens OX=9606 GN=DOCK9 PE=1 SV=2)

HSP 1 Score: 411.764 bits (1057), Expect = 1.326e-114
Identity = 269/863 (31.17%), Postives = 419/863 (48.55%), Query Frame = 2
Query: 5120 LNDKTQKDIFVCLLHIFHTISSDDLKATICNLTVQERLEFLQLLILSIHHLKYQGRKVINNFESISTGCAKSKIQLRPHGPRSSVTAILDDVDHGD----HKAYLEGNVSTEVGLIVLDVLSAYCSAFKQEILTYTPDHVIFKKIVDIYLTLLSVNQSEIVLKHVFVSMRVFVSTFAKVLFANCHNVISDLSLHTLRFLDTRFTSVRIEACGFLYRMMRSSYDTFNKPGINRVHLQMIVAVSKLDRTV----GIRFKESLNYLKRLAEIEMXXXXXXXXXXXXXGTPTGTSKSITIGVHSTTKLSMQTFFEEVTDLTQRIRTVLMATVQMNEHVDDPEMQVDLQYSLAKSYSSNPALRRTWLEKIYAIHNKNNSRAEMAMCKAHIVAMIVEYLRRKEQ-----------------------YSMSCANFKAISPNIPLEESGMRDDSVQLEVHYTKEEVVKLLRELAHEFDAGCLWEVLRHVYKLVIPIYERKRDYEQLAEIYKHMSDGYNKIKTAESTNQRIIGSYYRVVLYGKP---------------FDSLAGKVFIYRLDSGKQFCVVREELQKLFSKKYGAGKVQMLVEN-HIDRSKLDPELASIQVTHVEPFFNEDEELERHSMFERQYNISKFMLETPFVKMNHVEHESRWKKYKEHDIDGVLKSKQTDDLSIQWKRRTILTVEASFPHLKRRLEVISIKEIDFSPIERAIDEIQLKNRQLAMHLAYXXXXXXXXXXXXXXXXXXXXXVGSSQTRANNIPLLMDMHMSGALLPQVNQGPMAYARVFLHKETQANYSQEKVKQLKIQFMEFLTLCYLLLRDFNELMSHIQQQKYIAMREALDSYRVELSNLINEEI 7567
            L+    K + +C L+I  ++S D L       +  E ++F  +  + +H  +Y G++ I       TG   +++Q    G   +         H D    H++ LE N++TEV L  LD LS +  AFK ++L     + + KK+ D+YL  L  +QSE  LK+VF ++R  +  F    +    ++ + L    L+  +++ +S+R EA   LY +MR+++D   K    R HLQ+I++VS+L   V    G RF++SL+ +   A                               +S   +   +F  +V DLT+RIRTVLMAT QM EH +DPEM VDLQYSLAKSY+S P LR+TWL+ +  IH KN   +E AMC  H+ A++ EYL RKE                        +   C  F+ I+PNI  E S M D  +Q +VH+ ++ +++LL + A        +E++  +YKL+IPIYE++RD+E+LA +Y  +   Y+K+     + +R++G+Y+RV  +G+                F+   GK +IY+         + + L KL+S K+G+  V+M+ ++  ++   LD + A IQVTHV PFF+E E  ER + FER +NI +FM E PF +                        K+   +  Q KRRTILT    FP++K+R+ V+     D +PIE AIDE+  K  +L                              S    + I L   + + G++  QVN GP+AYAR FL       Y   KVK LK  F +F+  C   L     L+   Q +    M+        ELS +++E++
Sbjct: 1295 LDQSEIKSLLMCFLYILKSMSDDALFTYWNKASTSELMDFFTISEVCLHQFQYMGKRYIAR-----TGMMHARLQ--QLGSLDNSLTFNHSYGHSDADVLHQSLLEANIATEVCLTALDTLSLFTLAFKNQLLADHGHNPLMKKVFDVYLCFLQKHQSETALKNVFTALRSLIYKFPSTFYEGRADMCAALCYEILKCCNSKLSSIRTEASQLLYFLMRNNFDYTGKKSFVRTHLQVIISVSQLIADVVGIGGTRFQQSLSIINNCA-------------------------------NSDRLIKHTSFSSDVKDLTKRIRTVLMATAQMKEHENDPEMLVDLQYSLAKSYASTPELRKTWLDSMARIHVKNGDLSEAAMCYVHVTALVAEYLTRKEAVQWEPPLLPHSHSACLRRSRGGVFRQGCTAFRVITPNIDEEASMMEDVGMQ-DVHFNEDVLMELLEQCADGLWKAERYELIADIYKLIIPIYEKRRDFERLAHLYDTLHRAYSKVTEVMHSGRRLLGTYFRVAFFGQAAQYQFTDSETDVEGFFEDEDGKEYIYKEPKLTPLSEISQRLLKLYSDKFGSENVKMIQDSGKVNPKDLDSKYAYIQVTHVIPFFDEKELQERKTEFERSHNIRRFMFEMPFTQTG----------------------KRQGGVEEQCKRRTILTAIHCFPYVKKRIPVMYQHHTDLNPIEVAIDEMSKKVAELRQL--------------------------CSSAEVDMIKL--QLKLQGSVSVQVNAGPLAYARAFLDDTNTKRYPDNKVKLLKEVFRQFVEACGQALAVNERLIKEDQLEYQEEMKANYREMAKELSEIMHEQL 2068          

HSP 2 Score: 281.952 bits (720), Expect = 1.398e-74
Identity = 220/752 (29.26%), Postives = 340/752 (45.21%), Query Frame = 2
Query: 2387 PNLDFIHTLYIYPRTLNFSNQNVFHRARNLSCFVELRDVDKSDAPPLKVFYSRPSRKQPAFDYWSNTSVIYHDSSPTFNEEIKIALPLNLHSKHHLLFRFYHVSCDTAAIPNVREKGSNKKS--LETPVGVTWLTLMDQNLNLKSGSFSLPVATQLVPDYLEEKQQSIYYKKDSLWKLSTSFGQPKPRNSSTDKVIDESVNKRHSGPTFKSYINPRSSRDLEDIFSIKSDDVEQSHDTTVQWVDGQKSIFTVVIRPETTIFTQSTHLHKFFQVCSEKLDELTNPTVVEKKESIFTKPRSGSDPTTPKPVSDDTLLLQTSNKDVEIKNAIKALATVNVTNLIKFFAPTFNQLLHVVVCTAISHSEISKTAVTSMITLASSLRTPSMESLSSKATKRNTKIIKSYIKFAFDAEKIVPTKVKRTVHESLIQAISELIRPPFRDTXXXXXXXXXXXXXYSIITKSMIQSLTKQSKITIDKGGDKFFSTSYMDSLQNMIHLIINCILEITSTVGNQSGMNGQLRPNNSFQSLATSANKDLARFISRLFNVMDRGFIFQIIHQYMKIFIARINAYSGHREHLCRMKFDFLEIVTNHEHYLPLNLLKIINPSDKGQSVRKRQAPPSLELILSETYCRQHYLAGLLLQEVHRQMSDVYSHNAVRRLPFVMLRNLLAKHLFDDRYSSINMQARIAALYLPLVSIILENQKSFSLPGNLHTKVNLLNDIYDHSDRSLSARPLST-LSGDTL--STHSSINGS 4627
            P   + + LY+YP+ L + +Q  F +ARN++  +E +D D+ D+ PLK  Y RP    P F   +  +V++H  +P F +EIKI LP  LH KHHLL  F+HVSCD ++      KGS KK   +ET VG +WL L+     + S    +PV+  L   YL  ++  +                                  RH GP  K                               WVDG K +  +     +T++TQ  HLH FFQ C                     K  SG+                      E+   +K+L  +    +I F     NQL  V+  T  +  E++      +I + +      +ES            ++SY+K+A+ AE  V ++ K TVHE L ++++ +++P   D    N  L  S+ F+ ++ KSM Q L + SK+ + +  ++ F  SY  +++ ++++++  I +             + R N      + +AN  LA FI R F  MDRGF+F+ I+ Y+  F        G  + L   KF+FL +V NHEHY+PLNL     P   G+   +R     L+  L++ +CR H+L GLLL+EV   + +      VR +   +L+NLL KH FDDRY+S + QARIA LYLPL  +++EN +  ++       VN    + D S    +  PL T   G TL  S H  + G+
Sbjct:  635 PYTIYTNHLYVYPKYLKYDSQKSFAKARNIAICIEFKDSDEEDSQPLKCIYGRPG--GPVFTRSAFAAVLHHHQNPEFYDEIKIELPTQLHEKHHLLLTFFHVSCDNSS------KGSTKKRDVVETQVGYSWLPLLKDGRVVTSEQ-HIPVSANLPSGYLGYQELGM---------------------------------GRHYGPEIK-------------------------------WVDGGKPLLKISTHLVSTVYTQDQHLHNFFQYCQ--------------------KTESGAQALGN-----------------ELVKYLKSLHAMEGHVMIAFLPTILNQLFRVL--TRATQEEVAVNVTRVIIHVVAQCHEEGLESH-----------LRSYVKYAYKAEPYVASEYK-TVHEELTKSMTTILKPS-ADFLTSNKLLKYSWFFFDVLIKSMAQHLIENSKVKLLR--NQRFPASYHHAVETVVNMLMPHITQ-------------KFRDN---PEASKNANHSLAVFIKRCFTFMDRGFVFKQINNYISCFAP------GDPKTLFEYKFEFLRVVCNHEHYIPLNL-----PMPFGKGRIQRYQDLQLDYSLTDEFCRNHFLVGLLLREVGTALQEF---REVRLIAISVLKNLLIKHSFDDRYASRSHQARIATLYLPLFGLLIENVQRINVRDVSPFPVNAGMTVKDESLALPAVNPLVTPQKGSTLDNSLHKDLLGA 1229          

HSP 3 Score: 68.9366 bits (167), Expect = 7.589e-10
Identity = 54/203 (26.60%), Postives = 82/203 (40.39%), Query Frame = 2
Query: 1265 EPFFISFSLFHIADGRRISEEFYWNPNRPQIEDLLPSDLFAYKFGGHPVHATINGNCDNRTPLNLPTMSDRVLQSTNSFILKVPCLPDKICLFIKSEKVFSGAIGPTVDKYIKSGGSLLKKKDREEELFVENPDVKTGASINKTMSVYCANIGHYRMPFGWTACRLNIKGKNCL----RF---HKYENNKTSEDDIIKLVQNM 1852
            EPFF++ SLF I   R+IS +F+ + N   +  +L +   A   G     + + G            + +  +Q     I  V C    I L  + EKV  G+I    + Y+KS  S                  K    + K     C  +G YRMPF W A  L       L    RF   ++ ++NK S DD++KL+ + 
Sbjct:  395 EPFFVTLSLFDIKYNRKISADFHVDLNHFSVRQMLATTSPALMNGSGQSPSVLKG-----------ILHEAAMQYPKQGIFSVTCPHPDIFLVARIEKVLQGSITHCAEPYMKSSDS-----------------SKVAQKVLKNAKQACQRLGQYRMPFAWAARTLFKDASGNLDKNARFSAIYRQDSNKLSNDDMLKLLADF 569          
BLAST of Dedicator of cytokinesis vs. UniProt/SwissProt
Match: sp|Q96BY6|DOC10_HUMAN (Dedicator of cytokinesis protein 10 OS=Homo sapiens OX=9606 GN=DOCK10 PE=1 SV=3)

HSP 1 Score: 362.844 bits (930), Expect = 2.366e-99
Identity = 266/913 (29.13%), Postives = 407/913 (44.58%), Query Frame = 2
Query: 5120 LNDKTQKDIFVCLLHIFHTISSDDLKATICNLTVQERLEFLQLLILSIHHLKYQG-----RKVINNFESISTGCAKSKIQLRPHGPRSSVTAILDD-----VDHGDHKAY-----------------------------------------LEGNVSTEVGLIVLDVLSAYCSAFKQEILTYTPDHVIFKKIVDIYLTLLSVNQSEIVLKHVFVSMRVFVSTFAKVLFANCHNVISDLSLHTLRFLDTRFTSVRIEACGFLYRMMRSSYDTFNKPGINRVHLQMIVAVSKLDRTVGI---RFKESLNYLKRLAEIEMXXXXXXXXXXXXXGTPTGTSKSITIGVHSTTKLSMQTFFEEVTDLTQRIRTVLMATVQMNEHVDDPEMQVDLQYSLAKSYSSNPALRRTWLEKIYAIHNKNNSRAEMAMCKAHIVAMIVEYLRRK---------------------------------EQYSMSCANFKAISPNIPLEESGMRDDSVQLEVHYTKEEVVKLLRELAHEFDAGCLWEVLRHVYKLVIPIYERKRDYEQLAEIYKHMSDGYNKIKTAESTNQRIIGSYYRVVLYGKPFDSLAGKV-FIYRLDSGKQFCVVREELQKLFSKKYGAGKVQMLVE-NHIDRSKLDPELASIQVTHVEPFFNEDEELERHSMFERQYNISKFMLETPFVKMNHVEHESRWKKYKEHDIDGVLKSKQTDDLSIQWKRRTILTVEASFPHLKRRLEVISIKEIDFSPIERAIDEIQLKNRQLAMHLAYXXXXXXXXXXXXXXXXXXXXXVGSSQTRANNIPLLMDMHMSGALLPQVNQGPMAYARVFLHKETQANYSQEKVKQLKIQFMEFLTLCYLLLRDFNELMSHIQQQKYI-AMREALDSYRVELSNLINEEICVFEDIS 7588
            L+    + + +C LHI  TIS + L A        E  +F  +L + + + +Y G     RK+   F+ + +   ++   L+   P    + +L         H  HK +                                          E N++TEV L +LD+LS +    ++++      + + K++ D Y+    VNQS   LKHVF S+R+FV  F    F    ++        L+  + R  S + EA   LY  MR +++   +  I R HLQ+I AVS+L    GI   RF+ SL      A                               +   ++    F  EV DLT+RIRTVLMAT QM EH  DPEM VDLQYSLA SY+S P LRRTWLE +  IH +N   +E AMC  HI A+I EYL+RK                                   +SM    F +I+PNI  EE  M++DS   +  Y +  +V+ L            +E++  V K +I ++E++RD+++L+++Y  +   Y K+    ++ +R+ G YYRV  YG+ F        +IY+         + + L KL++ K+GA  V+++ + N ++   LDP+ A IQVT+V PFF E E  +R + FE  +NI++F+ ETPF                       L  K+   ++ Q KRRTILT    FP++K+R++VIS    + +PIE AIDE+  K  +L       +                               + + + + G++  +VN GPMAYAR FL +     Y   +VK LK  F +F   C   L D NE +    Q +Y   +R        ELS ++NE+I   +D+S
Sbjct: 1329 LDQAETRSLLMCFLHIMKTISYETLIAYWQRAPSPEVSDFFSILDVCLQNFRYLGKRNIIRKIAAAFKFVQS--TQNNGTLKGSNPSCQTSGLLSQWMHSTSSHEGHKQHRSQTLPIIRGKNALSNPKLLQMLDNTMTSNSNEIDIVHHVDTEANIATEVCLTILDLLSLFTQTHQRQLQQCDCQNSLMKRVFDTYMLFFQVNQSATALKHVFASLRLFVCKFPSAFFQGPADLCGSFCYEVLKCCNHRSRSTQTEASALLYFFMRKNFEFNKQKSIVRSHLQLIKAVSQLIADAGIGGSRFQHSLAITNNFA-------------------------------NGDKQMKNSNFPAEVKDLTKRIRTVLMATAQMKEHEKDPEMLVDLQYSLANSYASTPELRRTWLESMAKIHARNGDLSEAAMCYIHIAALIAEYLKRKGYWKVEKICTASLLSEDTHPCDSNSLLTTPSGGSMFSMGWPAFLSITPNIK-EEGAMKEDSGMQDTPYNENILVEQLYMCVEFLWKSERYELIADVNKPIIAVFEKQRDFKKLSDLYYDIHRSYLKVAEVVNSEKRLFGRYYRVAFYGQGFFEEEEGKEYIYKEPKLTGLSEISQRLLKLYADKFGADNVKIIQDSNKVNPKDLDPKYAYIQVTYVTPFFEEKEIEDRKTDFEMHHNINRFVFETPF----------------------TLSGKKHGGVAEQCKRRTILTTSHLFPYVKKRIQVISQSSTELNPIEVAIDEMSKKVSELNQLCTMEEVDM----------------------------IRLQLKLQGSVSVKVNAGPMAYARAFLEETNAKKYPDNQVKLLKEIFRQFADACGQAL-DVNERLIKEDQLEYQEELRSHYKDMLSELSTVMNEQITGRDDLS 2156          

HSP 2 Score: 264.618 bits (675), Expect = 2.643e-69
Identity = 197/693 (28.43%), Postives = 321/693 (46.32%), Query Frame = 2
Query: 2411 LYIYPRTLNFSNQNVFHRARNLSCFVELRDVDKSDAPPLKVFYSRPSRKQPAFDYWSNTSVIYHDSSPTFNEEIKIALPLNLHSKHHLLFRFYHVSCDTAAIPNVREKGSNKKSLETPVGVTWLTLMDQNLNLKSGSFSLPVATQLVPDYLEEKQQSIYYKKDSLWKLSTSFGQPKPRNSSTDKVIDESVNKRHSGPTFKSYINPRSSRDLEDIFSIKSDDVEQSHDTTVQWVDGQKSIFTVVIRPETTIFTQSTHLHKFFQVCSEKLDELTNPTVVEKKESIFTKPRSGSDPTTPKPVSDDTLLLQTSNKDVEIKNAIKALATVNVTNLIKFFAPTFNQLLHVVVCTAISHSEISKTAVTSMITLASSLRTPSMESLSSKATKRNTKIIKSYIKFAFDAEKIVPTKVKRTVHESLIQAISELIRPPFRDTXXXXXXXXXXXXXYSIITKSMIQSLTKQSKITIDKGGDKFFSTSYMDSLQNMIHLIINCILEITSTVGNQSGMNGQLRPNNSFQSLATSANKDLARFISRLFNVMDRGFIFQIIHQYMKIFIARINAYSGHREHLCRMKFDFLEIVTNHEHYLPLNL----LKIINPSDKGQSVRKRQAPPSLELILSETYCRQHYLAGLLLQEVHRQMSDVYSHNAVRRLPFVMLRNLLAKHLFDDRYSSINMQARIAALYLPLVSIILEN 4477
            +YIYP+ L + +Q  F++ARN++  +E ++ D+  A PLK  Y +P    P F   + T+V++H  +P F++E+KI LP  LH KHH+LF FYHV+CD  A    +     K++LET VG  WL LM  +  + S  +++P+AT L P+YL                                    +S + +H G   K                               WVDG K +F V     +T+ TQ  H++ FFQ C ++  +++                      +P           TSN    I++    L    +  ++ F     NQL  V+V       EI+ T    +  + +      ++             ++SYIKF F          +RTVHE L + ++ L++    D+  V   L +S+ F++II KSM Q L   +KI + +   + F  SY + L N++ ++ + ++        +  +    R N+S           +ARF+ R F  MDRG++F++++ Y+ +F       SG  + LC+ KFDFL+ V  HEH++PL L      I +P    +S ++  A    E  ++  +CR+H+L G+LL+EV   + +      VR L   +L+NL+AKH FDDRY     QA+IA+LY+PL  ++L+N
Sbjct:  675 IYIYPKHLKYDSQKCFNKARNITVCIEFKNSDEESAKPLKCIYGKPG--GPLFTSAAYTAVLHHSQNPDFSDEVKIELPTQLHEKHHILFSFYHVTCDINA----KANAKKKEALETSVGYAWLPLMKHD-QIASQEYNIPIATSLPPNYLS---------------------------------FQDSASGKHGGSDIK-------------------------------WVDGGKPLFKVSTFVVSTVNTQDPHVNAFFQECQKREKDMSQ---------------------SP-----------TSNF---IRSCKNLLNVEKIHAIMSFLPIILNQLFKVLVQN--EEDEITTTVTRVLTDIVAKCHEEQLD-----------HSVQSYIKFVFKTRAC----KERTVHEELAKNVTGLLKS--NDSTTVKHVLKHSWFFFAIILKSMAQHLIDTNKIQLPRP--QRFPESYQNELDNLVMVLSDHVI-----WKYKDALEETRRANHS-----------VARFLKRCFTFMDRGYVFKMVNNYISMF------SSGDLKTLCQYKFDFLQEVCQHEHFIPLCLPIRSANIPDPLTPSESTQELHASDMPEYSVTNEFCRKHFLIGILLREVGFALQE---DQDVRHLALAVLKNLMAKHSFDDRYREPRKQAQIASLYMPLYGMLLDN 1215          

HSP 3 Score: 75.485 bits (184), Expect = 9.225e-12
Identity = 83/340 (24.41%), Postives = 142/340 (41.76%), Query Frame = 2
Query:  923 VSSESIERSEETVHGMLSKFLQENEQSAVILRKKDHQKILVIYSEIRNQIKMKSQQTPIYDIGIIEKSQLDDCHIRPQVEQSIPKTFIKLTANRFITSVGISDENSNPKGVIPAEPFFISFSLFHIADGRRISEEFYWNPNRPQIEDLLPSDLFAYKFGGHPVHATINGNCDNRTPL-----NLPTMSDRVLQSTNSFILKVPCLPDKICLFIKSEKVFSGAIGPTVDKYIKSGGSLLKKKDREEELFVENPDV-KTGASINKTMSVYCANIGHYRMPFGWTACRLNIKGK--NCLRFHKY------ENNKTSEDDIIKLVQNMSSQHVDNNASKYTTIP 1900
             + E  + SE  +H   +K+L E E +    R  +   +  +  +I + +K++ +        ++E   +    I+P  E++  +  I   A        +++  ++P  +   EPFF+S +L+ + D R+IS +F+ + N   +  +L     A +          NGN D  TP      ++  + +  L+     +  V     +I L  K EKV  G I    + YIK                  NPD  K    I K+   +C+ +G YRMPF W A R   K    N  R  ++      E++K S +D++KLV   S     +  SK  TIP
Sbjct:  321 CTPEETDSSENNLHADFAKYLTETEDTVKTTRNMERLNLFSLDPDI-DTLKLQKKD-------LLEPESV----IKPFEEKAAKRIMIICKALNSNLQGCVTENENDP--ITNIEPFFVSVALYDLRDSRKISADFHVDLNHAAVRQMLLGASVALE----------NGNIDTITPRQSEEPHIKGLPEEWLKFPKQAVFSVSNPHSEIVLVAKIEKVLMGNIASGAEPYIK------------------NPDSNKYAQKILKSNRQFCSKLGKYRMPFAW-AVRSVFKDNQGNVDRDSRFSPLFRQESSKISTEDLVKLV---SDYRRADRISKMQTIP 614          
BLAST of Dedicator of cytokinesis vs. TrEMBL
Match: A0A4W2IFV1 (Dedicator of cytokinesis 9 OS=Bos indicus x Bos taurus OX=30522 GN=DOCK9 PE=3 SV=1)

HSP 1 Score: 699.508 bits (1804), Expect = 0.000e+0
Identity = 523/1749 (29.90%), Postives = 809/1749 (46.26%), Query Frame = 2
Query: 2411 LYIYPRTLNFSNQNVFHRARNLSCFVELRDVDKSDAPPLKVFYSRPSRKQPAFDYWSNTSVIYHDSSPTFNEEIKIALPLNLHSKHHLLFRFYHVSCDTAAIPNVREKGSNKKS--LETPVGVTWLTLMDQNLNLKSGSFSLPVATQLVPDYLEEKQQSIYYKKDSLWKLSTSFGQPKPRNSSTDKVIDESVNKRHSGPTFKSYINPRSSRDLEDIFSIKSDDVEQSHDTTVQWVDGQKSIFTVVIRPETTIFTQSTHLHKFFQVCSEKLDELTNPTVVEKKESIFTKPRSGSDPTTPKPVSDDTLLLQTSNKDVEIKNAIKALATVNVTNLIKFFAPTFNQLLHVVVCTAISHSEISKTAVTSMITLASSLRTPSMESLSSKATKRNTKIIKSYIKFAFDAEKIVPTKVKRTVHESLIQAISELIRPPFRDTXXXXXXXXXXXXXYSIITKSMIQSLTKQSKITIDKGGDKFFSTSYMDSLQNMIHLIINCILEITSTVGNQSGMNGQLRPNNSFQSLATSANKDLARFISRLFNVMDRGFIFQIIHQYMKIFIARINAYSGHREHLCRMKFDFLEIVTNHEHYLPLNLLKIINPSDKGQSVRKRQAPPSLELILSETYCRQHYLAGLLLQEVHRQMSDVYSHNAVRRLPFVMLRNLLAKHLFDDRYSSINMQARIAALYLPLVSIILENQKSFSLPGNLHTKVNLLNDIYDHSDRSLSARPLST--LSGDTLST--HSSINGSSGDGAGGSVYGLGFGTNSSKSARSSQVYLGKDGHVEDHWLKQIAGLTDGGNIRTLSTRRKXXXXXXXXXXXXXXXGLDEMHESGDTNSLDDEMVIHSKVPLNSESVVKRSSLQRPPVSNSNSWGRKAGLSLNIKKSVAPTHPSQRASILNKASNKNHETKSSIYLNDKTQKDIFVCLLHIFHTISSDDLKATICNLTVQERLEFLQLLILSIHHLKYQGRKVINNFESISTGCAKSKIQLRPHGPRSSVTAILDDVDHGD----HKAYLEGNVSTEVGLIVLDVLSAYCSAFKQEILTYTPDHVIFKKIVDIYLTLLSVNQSEIVLKHVFVSMRVFVSTFAKVLFANCHNVISDLSLHTLRFLDTRFTSVRIEACGFLYRMMRSSYDTFNKPGINRVHLQMIVAVSKLDRTV----GIRFKESLNYLKRLAEIEMXXXXXXXXXXXXXGTPTGTSKSITIGVHSTTKLSMQTFFEEVTDLTQRIRTVLMATVQMNEHVDDPEMQVDLQYSLAKSYSSNPALRRTWLEKIYAIHNKNNSRAEMAMCKAHIVAMIVEYLRRKEQYSMSCANFKAISPNIPLEESGMRDDSVQLEVHYTKEEVVKLLRELAHEFDAGCLWEVLRHVYKLVIPIYERKRDYEQLAEIYKHMSDGYNKIKTAESTNQRIIGSYYRVVLYGKP-FDSLAGKVFIYRLDSGKQFCVVREELQKLFSKKYGAGKVQMLVEN-HIDRSKLDPELASIQVTHVEPFFNEDEELERHSMFERQYNISKFMLETPFVKMNHVEHESRWKKYKEHDIDGVLKSKQTDDLSIQWKRRTILTVEASFPHLKRRLEVISIKEIDFSPIERAIDEIQLKNRQLAMHLAYXXXXXXXXXXXXXXXXXXXXXVGSSQTRANNIPLLMDMHMSGALLPQVNQGPMAYARVFLHKETQANYSQEKVKQLKIQFMEFLTLCYLLLRDFNELMSHIQQQKYIAMREALDSYRVELSNLINEEICVFEDISVISTSAL 7609
            LY+YP++L + +Q  F +ARN++  +E +D D+ D+ PLK  Y RP    P F   +  +V++H  +P F +EIKI LP  LH KHHLLF F+HVSCD +       KGS KK   +ET VG +WL L+     + S    +PV+  L   YL  ++  +                                  RH GP  K                               WVDG K +  V     +T++TQ  HLH FFQ C                     K  SG+                      E+   +K+L  +    +I F     NQL  V+  T  +  E++      +I + +      +E             ++SY+K+A+ AE  + ++ K TVHE L ++++ +++P   D    N  L  S+ F+ ++ KSM Q L + SK+ + +  ++ F  SY  +++ ++ +++  I +             + R N      + +AN  LA FI R F  MDRGF+F+ I+ Y+  F        G  + L   KF+FL +V NHEHY+PLNL     P   G+   +R     L+  L++ +CR H+L GLLL+EV   + +      VR +   +L+NLL KH FDDRY+S + QARIA LYLPL  +++EN +  ++       VN  + + + S    +  PL T   SG TL T  H  + G+   G            NS ++A S    +                 TD GN  +L  R    S++           L   H +   +   +E     +      + V  S L  PP+      G   GLS     S   T   Q++  L  +  +  +      L+    K + +C L+I  ++S D L       +  E ++F  +  + +H  +Y G++ I       TG   +++Q  P G   +         H D    H++ LE N++TEV L  LD LS +  AFK ++L     + + KK+ D+YL  L  +QSE  LKHVF ++R  +  F    +    ++ + L   TL+  +++ +S+R EA   LY +MR+++D   K    R HLQ++++VS+L   V    G RF++SL+ +   A                               +S   +   TF  +V DLT+RIRTVLMAT QM EH  DPEM VDLQYSLAKSY+S P LR+TWL+ +  IH KN   +E AMC  H+ A++ EYL RK  +   C  F+ I+PNI  E S M D  +Q +VH+ ++ + +LL + A        +E++  +YKL+IPIYE++RD+E+LA +Y  +   Y+K+     + +R++G+Y+RV  +G+  F+   GK +IY+         + + L KL+S K+GA  V+M+ ++  ++   LD + A IQVTHV PFF+E E  ER + FER +NI +FM E PF +                        K+   +  Q KRRTILT    FP++K+R+ V+     D +PIE AIDE+  K  +L                              S    + I L   + + G++  QVN GP+AYAR FL       Y   KVK LK  F +F+  C   L     L+   Q +    M+        ELS +++E+IC  E+ + +  ++L
Sbjct:  642 LYVYPKSLKYDSQKSFAKARNIAICIEFKDSDEEDSKPLKCIYGRPG--GPLFTESAFAAVLHHHQNPEFYDEIKIELPTQLHEKHHLLFTFFHVSCDNS------NKGSTKKKDVVETQVGYSWLPLLKDGRVVTSEQ-HIPVSANLPSGYLGFQEHGM---------------------------------GRHYGPEIK-------------------------------WVDGSKPLLKVSTHLVSTVYTQDQHLHNFFQYCQ--------------------KTESGAQALGS-----------------ELVKYLKSLHAMEGHVMIAFLPTILNQLFRVL--TRATQEEVAVNVTRVIIHVVAQCHEEGLEGH-----------LRSYVKYAYKAEPYIASEYK-TVHEELTKSMTTILKPS-ADFLTSNKLLKYSWFFFEVLIKSMAQHLIENSKVKLLR--NQRFPASYHHAVETVVTMLMPHITQ-------------KYRDN---PDASKNANHSLAVFIKRCFTFMDRGFVFKQINNYISCFAP------GDPKTLFEYKFEFLRVVCNHEHYIPLNL-----PMPFGKGRIQRYQDLQLDYALTDEFCRNHFLVGLLLREVGAALQEF---REVRVIAISVLKNLLIKHSFDDRYASRSHQARIATLYLPLFGLLIENVQRINVRDVSPFPVNPGSTVKEESLTLPAVNPLVTPQKSGGTLDTSLHKDLFGAIS-GIASPYTNSTPNINSVRNADSRGSLIS----------------TDSGN--SLPERNSEKSNSLEKRER-----LLRRHSACVVHGAGEEEEERDQPARRHRATVDFSLLTLPPLPEEAPLG--GGLS-----SPRGTEEHQQSGTLGNSVVRCDK------LDQSEIKSLLMCFLYILKSMSDDALFTYWNKASTAELMDFFTISEVCLHQFQYMGKRYIAR-----TGMMHARLQ--PLGSLDNSLTFNHSYGHSDADVLHQSLLEANIATEVCLTALDTLSLFTLAFKNQLLADHGHNPLMKKVFDVYLCFLQKHQSETALKHVFTALRSLIYKFPSTFYEGRADMCAALCYETLKCCNSKLSSIRTEASQLLYFLMRNNFDYSGKKSFVRTHLQIVISVSQLIADVVGIGGTRFQQSLSIINNCA-------------------------------NSDRLIKHTTFSSDVKDLTKRIRTVLMATAQMKEHEADPEMLVDLQYSLAKSYASTPELRKTWLDSMARIHVKNGDLSEAAMCYVHVTALVAEYLTRKGMFRQGCTAFRVITPNIDEEASMMEDVGMQ-DVHFNEDVLTELLEQCADGLWKAERYELIADIYKLIIPIYEKRRDFERLAHLYDTLHRAYSKVTEVMHSGRRLLGTYFRVAFFGQGFFEDEDGKEYIYKEPKLTPLSEISQRLLKLYSDKFGAENVKMIQDSGKVNPKDLDSKYAYIQVTHVIPFFDEKELQERKTEFERSHNIRRFMFEMPFTQ----------------------SGKRQGGVEEQCKRRTILTAIHCFPYVKKRIPVMYQHHTDLNPIEVAIDEMSKKVAELRQL--------------------------CSSAEVDMIKL--QLKLQGSVSVQVNAGPLAYARAFLDDTNTKRYPDNKVKLLKEVFRQFVEACGQALVVNERLIKEDQIEYQEEMKANYREMTKELSEIMHEQICPLEEKTSVLPNSL 2107          

HSP 2 Score: 68.5514 bits (166), Expect = 3.271e-7
Identity = 58/243 (23.87%), Postives = 96/243 (39.51%), Query Frame = 2
Query: 1145 IRPQVEQSIPKTFIKLTANRFITSVGISDENSNPKGVIPAEPFFISFSLFHIADGRRISEEFYWNPNRPQIEDLLPSDLFAYKFGGHPVHATINGNCDNRTPLNLPTMSDRVLQSTNSFILKVPCLPDKICLFIKSEKVFSGAIGPTVDKYIKSGGSLLKKKDREEELFVENPDVKTGASINKTMSVYCANIGHYRMPFGWTACRLNIKGKNCL----RF---HKYENNKTSEDDIIKLVQNM 1852
            ++P  E+   +  +K     F     +++    P   +  EPFF++ SLF +   R+IS +F+ + N   +  +L +   + + G                P  L  + +  +Q     I  V C    I L  + EKV  G+I    + Y+KS  S                  K    + K     C  +G YRMPF W A  L       L    RF   +K ++NK S +D++KL+ + 
Sbjct:  356 VKPFEEKFGKRILVKCNDLSFNLQCCVAENEEGPTTNV--EPFFVTLSLFDVKCNRKISADFHVDLNHFSVRQMLATTSPSLRNGDR-----------QSLPAPLGILHEASMQYPKQGIFSVTCPHPDIFLVARIEKVLQGSITHGAEPYMKSSDS-----------------SKVAQKVLKNAKQACQRLGQYRMPFAWAARTLFKDASGNLDKSARFSALYKQDSNKLSNEDMLKLLADF 568          
BLAST of Dedicator of cytokinesis vs. TrEMBL
Match: A0A4W2IG25 (Dedicator of cytokinesis 9 OS=Bos indicus x Bos taurus OX=30522 GN=DOCK9 PE=3 SV=1)

HSP 1 Score: 699.123 bits (1803), Expect = 0.000e+0
Identity = 523/1749 (29.90%), Postives = 809/1749 (46.26%), Query Frame = 2
Query: 2411 LYIYPRTLNFSNQNVFHRARNLSCFVELRDVDKSDAPPLKVFYSRPSRKQPAFDYWSNTSVIYHDSSPTFNEEIKIALPLNLHSKHHLLFRFYHVSCDTAAIPNVREKGSNKKS--LETPVGVTWLTLMDQNLNLKSGSFSLPVATQLVPDYLEEKQQSIYYKKDSLWKLSTSFGQPKPRNSSTDKVIDESVNKRHSGPTFKSYINPRSSRDLEDIFSIKSDDVEQSHDTTVQWVDGQKSIFTVVIRPETTIFTQSTHLHKFFQVCSEKLDELTNPTVVEKKESIFTKPRSGSDPTTPKPVSDDTLLLQTSNKDVEIKNAIKALATVNVTNLIKFFAPTFNQLLHVVVCTAISHSEISKTAVTSMITLASSLRTPSMESLSSKATKRNTKIIKSYIKFAFDAEKIVPTKVKRTVHESLIQAISELIRPPFRDTXXXXXXXXXXXXXYSIITKSMIQSLTKQSKITIDKGGDKFFSTSYMDSLQNMIHLIINCILEITSTVGNQSGMNGQLRPNNSFQSLATSANKDLARFISRLFNVMDRGFIFQIIHQYMKIFIARINAYSGHREHLCRMKFDFLEIVTNHEHYLPLNLLKIINPSDKGQSVRKRQAPPSLELILSETYCRQHYLAGLLLQEVHRQMSDVYSHNAVRRLPFVMLRNLLAKHLFDDRYSSINMQARIAALYLPLVSIILENQKSFSLPGNLHTKVNLLNDIYDHSDRSLSARPLST--LSGDTLST--HSSINGSSGDGAGGSVYGLGFGTNSSKSARSSQVYLGKDGHVEDHWLKQIAGLTDGGNIRTLSTRRKXXXXXXXXXXXXXXXGLDEMHESGDTNSLDDEMVIHSKVPLNSESVVKRSSLQRPPVSNSNSWGRKAGLSLNIKKSVAPTHPSQRASILNKASNKNHETKSSIYLNDKTQKDIFVCLLHIFHTISSDDLKATICNLTVQERLEFLQLLILSIHHLKYQGRKVINNFESISTGCAKSKIQLRPHGPRSSVTAILDDVDHGD----HKAYLEGNVSTEVGLIVLDVLSAYCSAFKQEILTYTPDHVIFKKIVDIYLTLLSVNQSEIVLKHVFVSMRVFVSTFAKVLFANCHNVISDLSLHTLRFLDTRFTSVRIEACGFLYRMMRSSYDTFNKPGINRVHLQMIVAVSKLDRTV----GIRFKESLNYLKRLAEIEMXXXXXXXXXXXXXGTPTGTSKSITIGVHSTTKLSMQTFFEEVTDLTQRIRTVLMATVQMNEHVDDPEMQVDLQYSLAKSYSSNPALRRTWLEKIYAIHNKNNSRAEMAMCKAHIVAMIVEYLRRKEQYSMSCANFKAISPNIPLEESGMRDDSVQLEVHYTKEEVVKLLRELAHEFDAGCLWEVLRHVYKLVIPIYERKRDYEQLAEIYKHMSDGYNKIKTAESTNQRIIGSYYRVVLYGKP-FDSLAGKVFIYRLDSGKQFCVVREELQKLFSKKYGAGKVQMLVEN-HIDRSKLDPELASIQVTHVEPFFNEDEELERHSMFERQYNISKFMLETPFVKMNHVEHESRWKKYKEHDIDGVLKSKQTDDLSIQWKRRTILTVEASFPHLKRRLEVISIKEIDFSPIERAIDEIQLKNRQLAMHLAYXXXXXXXXXXXXXXXXXXXXXVGSSQTRANNIPLLMDMHMSGALLPQVNQGPMAYARVFLHKETQANYSQEKVKQLKIQFMEFLTLCYLLLRDFNELMSHIQQQKYIAMREALDSYRVELSNLINEEICVFEDISVISTSAL 7609
            LY+YP++L + +Q  F +ARN++  +E +D D+ D+ PLK  Y RP    P F   +  +V++H  +P F +EIKI LP  LH KHHLLF F+HVSCD +       KGS KK   +ET VG +WL L+     + S    +PV+  L   YL  ++  +                                  RH GP  K                               WVDG K +  V     +T++TQ  HLH FFQ C                     K  SG+                      E+   +K+L  +    +I F     NQL  V+  T  +  E++      +I + +      +E             ++SY+K+A+ AE  + ++ K TVHE L ++++ +++P   D    N  L  S+ F+ ++ KSM Q L + SK+ + +  ++ F  SY  +++ ++ +++  I +             + R N      + +AN  LA FI R F  MDRGF+F+ I+ Y+  F        G  + L   KF+FL +V NHEHY+PLNL     P   G+   +R     L+  L++ +CR H+L GLLL+EV   + +      VR +   +L+NLL KH FDDRY+S + QARIA LYLPL  +++EN +  ++       VN  + + + S    +  PL T   SG TL T  H  + G+   G            NS ++A S    +                 TD GN  +L  R    S++           L   H +   +   +E     +      + V  S L  PP+      G   GLS     S   T   Q++  L  +  +  +      L+    K + +C L+I  ++S D L       +  E ++F  +  + +H  +Y G++ I       TG   +++Q  P G   +         H D    H++ LE N++TEV L  LD LS +  AFK ++L     + + KK+ D+YL  L  +QSE  LKHVF ++R  +  F    +    ++ + L   TL+  +++ +S+R EA   LY +MR+++D   K    R HLQ++++VS+L   V    G RF++SL+ +   A                               +S   +   TF  +V DLT+RIRTVLMAT QM EH  DPEM VDLQYSLAKSY+S P LR+TWL+ +  IH KN   +E AMC  H+ A++ EYL RK  +   C  F+ I+PNI  E S M D  +Q +VH+ ++ + +LL + A        +E++  +YKL+IPIYE++RD+E+LA +Y  +   Y+K+     + +R++G+Y+RV  +G+  F+   GK +IY+         + + L KL+S K+GA  V+M+ ++  ++   LD + A IQVTHV PFF+E E  ER + FER +NI +FM E PF +                        K+   +  Q KRRTILT    FP++K+R+ V+     D +PIE AIDE+  K  +L                              S    + I L   + + G++  QVN GP+AYAR FL       Y   KVK LK  F +F+  C   L     L+   Q +    M+        ELS +++E+IC  E+ + +  ++L
Sbjct:  643 LYVYPKSLKYDSQKSFAKARNIAICIEFKDSDEEDSKPLKCIYGRPG--GPLFTESAFAAVLHHHQNPEFYDEIKIELPTQLHEKHHLLFTFFHVSCDNS------NKGSTKKKDVVETQVGYSWLPLLKDGRVVTSEQ-HIPVSANLPSGYLGFQEHGM---------------------------------GRHYGPEIK-------------------------------WVDGSKPLLKVSTHLVSTVYTQDQHLHNFFQYCQ--------------------KTESGAQALGS-----------------ELVKYLKSLHAMEGHVMIAFLPTILNQLFRVL--TRATQEEVAVNVTRVIIHVVAQCHEEGLEGH-----------LRSYVKYAYKAEPYIASEYK-TVHEELTKSMTTILKPS-ADFLTSNKLLKYSWFFFEVLIKSMAQHLIENSKVKLLR--NQRFPASYHHAVETVVTMLMPHITQ-------------KYRDN---PDASKNANHSLAVFIKRCFTFMDRGFVFKQINNYISCFAP------GDPKTLFEYKFEFLRVVCNHEHYIPLNL-----PMPFGKGRIQRYQDLQLDYALTDEFCRNHFLVGLLLREVGAALQEF---REVRVIAISVLKNLLIKHSFDDRYASRSHQARIATLYLPLFGLLIENVQRINVRDVSPFPVNPGSTVKEESLTLPAVNPLVTPQKSGGTLDTSLHKDLFGAIS-GIASPYTNSTPNINSVRNADSRGSLIS----------------TDSGN--SLPERNSEKSNSLEKRER-----LLRRHSACVVHGAGEEEEERDQPARRHRATVDFSLLTLPPLPEEAPLG--GGLS-----SPRGTEEHQQSGTLGNSVVRCDK------LDQSEIKSLLMCFLYILKSMSDDALFTYWNKASTAELMDFFTISEVCLHQFQYMGKRYIAR-----TGMMHARLQ--PLGSLDNSLTFNHSYGHSDADVLHQSLLEANIATEVCLTALDTLSLFTLAFKNQLLADHGHNPLMKKVFDVYLCFLQKHQSETALKHVFTALRSLIYKFPSTFYEGRADMCAALCYETLKCCNSKLSSIRTEASQLLYFLMRNNFDYSGKKSFVRTHLQIVISVSQLIADVVGIGGTRFQQSLSIINNCA-------------------------------NSDRLIKHTTFSSDVKDLTKRIRTVLMATAQMKEHEADPEMLVDLQYSLAKSYASTPELRKTWLDSMARIHVKNGDLSEAAMCYVHVTALVAEYLTRKGMFRQGCTAFRVITPNIDEEASMMEDVGMQ-DVHFNEDVLTELLEQCADGLWKAERYELIADIYKLIIPIYEKRRDFERLAHLYDTLHRAYSKVTEVMHSGRRLLGTYFRVAFFGQGFFEDEDGKEYIYKEPKLTPLSEISQRLLKLYSDKFGAENVKMIQDSGKVNPKDLDSKYAYIQVTHVIPFFDEKELQERKTEFERSHNIRRFMFEMPFTQ----------------------SGKRQGGVEEQCKRRTILTAIHCFPYVKKRIPVMYQHHTDLNPIEVAIDEMSKKVAELRQL--------------------------CSSAEVDMIKL--QLKLQGSVSVQVNAGPLAYARAFLDDTNTKRYPDNKVKLLKEVFRQFVEACGQALVVNERLIKEDQIEYQEEMKANYREMTKELSEIMHEQICPLEEKTSVLPNSL 2108          

HSP 2 Score: 68.5514 bits (166), Expect = 3.558e-7
Identity = 58/243 (23.87%), Postives = 96/243 (39.51%), Query Frame = 2
Query: 1145 IRPQVEQSIPKTFIKLTANRFITSVGISDENSNPKGVIPAEPFFISFSLFHIADGRRISEEFYWNPNRPQIEDLLPSDLFAYKFGGHPVHATINGNCDNRTPLNLPTMSDRVLQSTNSFILKVPCLPDKICLFIKSEKVFSGAIGPTVDKYIKSGGSLLKKKDREEELFVENPDVKTGASINKTMSVYCANIGHYRMPFGWTACRLNIKGKNCL----RF---HKYENNKTSEDDIIKLVQNM 1852
            ++P  E+   +  +K     F     +++    P   +  EPFF++ SLF +   R+IS +F+ + N   +  +L +   + + G                P  L  + +  +Q     I  V C    I L  + EKV  G+I    + Y+KS  S                  K    + K     C  +G YRMPF W A  L       L    RF   +K ++NK S +D++KL+ + 
Sbjct:  357 VKPFEEKFGKRILVKCNDLSFNLQCCVAENEEGPTTNV--EPFFVTLSLFDVKCNRKISADFHVDLNHFSVRQMLATTSPSLRNGDR-----------QSLPAPLGILHEASMQYPKQGIFSVTCPHPDIFLVARIEKVLQGSITHGAEPYMKSSDS-----------------SKVAQKVLKNAKQACQRLGQYRMPFAWAARTLFKDASGNLDKSARFSALYKQDSNKLSNEDMLKLLADF 569          
BLAST of Dedicator of cytokinesis vs. TrEMBL
Match: A0A4W2GYR9 (Dedicator of cytokinesis 9 OS=Bos indicus x Bos taurus OX=30522 GN=DOCK9 PE=3 SV=1)

HSP 1 Score: 697.197 bits (1798), Expect = 0.000e+0
Identity = 523/1751 (29.87%), Postives = 807/1751 (46.09%), Query Frame = 2
Query: 2411 LYIYPRTLNFSNQNVFHRARNLSCFVELRDVDKSDAPPLKVFYSRPSRKQPAFDYWSNTSVIYHDSSPTFNEEIKIALPLNLHSKHHLLFRFYHVSCDTAAIPNVREKGSNKKS--LETPVGVTWLTLMDQNLNLKSGSFSLPVATQLVPDYLEEKQQSIYYKKDSLWKLSTSFGQPKPRNSSTDKVIDESVNKRHSGPTFKSYINPRSSRDLEDIFSIKSDDVEQSHDTTVQWVDGQKSIFTVVIRPETTIFTQSTHLHKFFQVCSEKLDELTNPTVVEKKESIFTKPRSGSDPTTPKPVSDDTLLLQTSNKDVEIKNAIKALATVNVTNLIKFFAPTFNQLLHVVVCTAISHSEISKTAVTSMITLASSLRTPSMESLSSKATKRNTKIIKSYIKFAFDAEKIVPTKVKRTVHESLIQAISELIRPPFRDTXXXXXXXXXXXXXYSIITKSMIQSLTKQSKITIDKGGDKFFSTSYMDSLQNMIHLIINCILEITSTVGNQSGMNGQLRPNNSFQSLATSANKDLARFISRLFNVMDRGFIFQIIHQYMKIFIARINAYSGHREHLCRMKFDFLEIVTNHEHYLPLNLLKIINPSDKGQSVRKRQAPPSLELILSETYCRQHYLAGLLLQEVHRQMSDVYSHNAVRRLPFVMLRNLLAKHLFDDRYSSINMQARIAALYLPLVSIILENQKSFSLPGNLHTKVNLLNDIYDHSDRSLSARPLST--LSGDTLST--HSSINGSSGDGAGGSVYGLGFGTNSSKSARSSQVYLGKDGHVEDHWLKQIAGLTDGGNIRTLSTRRKXXXXXXXXXXXXXXXGLDEMHESGDTNSLDDEMVIHSKVPLNSESVVKRSSLQRPPVSNSNSWGRKAGLSLNIKKSVAPTHPSQRASILNKASNKNHETKSSIYLNDKTQKDIFVCLLHIFHTISSDDLKATICNLTVQERLEFLQLLILSIHHLKYQGRKVINNFESISTGCAKSKIQLRPHGPRSSVTAILDDVDHGD------HKAYLEGNVSTEVGLIVLDVLSAYCSAFKQEILTYTPDHVIFKKIVDIYLTLLSVNQSEIVLKHVFVSMRVFVSTFAKVLFANCHNVISDLSLHTLRFLDTRFTSVRIEACGFLYRMMRSSYDTFNKPGINRVHLQMIVAVSKLDRTV----GIRFKESLNYLKRLAEIEMXXXXXXXXXXXXXGTPTGTSKSITIGVHSTTKLSMQTFFEEVTDLTQRIRTVLMATVQMNEHVDDPEMQVDLQYSLAKSYSSNPALRRTWLEKIYAIHNKNNSRAEMAMCKAHIVAMIVEYLRRKEQYSMSCANFKAISPNIPLEESGMRDDSVQLEVHYTKEEVVKLLRELAHEFDAGCLWEVLRHVYKLVIPIYERKRDYEQLAEIYKHMSDGYNKIKTAESTNQRIIGSYYRVVLYGKP-FDSLAGKVFIYRLDSGKQFCVVREELQKLFSKKYGAGKVQMLVEN-HIDRSKLDPELASIQVTHVEPFFNEDEELERHSMFERQYNISKFMLETPFVKMNHVEHESRWKKYKEHDIDGVLKSKQTDDLSIQWKRRTILTVEASFPHLKRRLEVISIKEIDFSPIERAIDEIQLKNRQLAMHLAYXXXXXXXXXXXXXXXXXXXXXVGSSQTRANNIPLLMDMHMSGALLPQVNQGPMAYARVFLHKETQANYSQEKVKQLKIQFMEFLTLCYLLLRDFNELMSHIQQQKYIAMREALDSYRVELSNLINEEICVFEDISVISTSAL 7609
            LY+YP++L + +Q  F +ARN++  +E +D D+ D+ PLK  Y RP    P F   +  +V++H  +P F +EIKI LP  LH KHHLLF F+HVSCD +       KGS KK   +ET VG +WL L+     + S    +PV+  L   YL  ++  +                                  RH GP  K                               WVDG K +  V     +T++TQ  HLH FFQ C                     K  SG+                      E+   +K+L  +    +I F     NQL  V+  T  +  E++      +I + +      +E             ++SY+K+A+ AE  + ++ K TVHE L ++++ +++P   D    N  L  S+ F+ ++ KSM Q L + SK+ + +  ++ F  SY  +++ ++ +++  I +             + R N      + +AN  LA FI R F  MDRGF+F+ I+ Y+  F        G  + L   KF+FL +V NHEHY+PLNL     P   G+   +R     L+  L++ +CR H+L GLLL+EV   + +      VR +   +L+NLL KH FDDRY+S + QARIA LYLPL  +++EN +  ++       VN  + + + S    +  PL T   SG TL T  H  + G+   G            NS ++A S    +                 TD GN  +L  R    S++           L   H +   +   +E     +      + V  S L  PP+      G   GLS     S   T   Q++  L  +  +  +      L+    K + +C L+I  ++S D L       +  E ++F  +  + +H  +Y G++ I +   IS                 SV  I  D  +G       H++ LE N++TEV L  LD LS +  AFK ++L     + + KK+ D+YL  L  +QSE  LKHVF ++R  +  F    +    ++ + L   TL+  +++ +S+R EA   LY +MR+++D   K    R HLQ++++VS+L   V    G RF++SL+ +   A                               +S   +   TF  +V DLT+RIRTVLMAT QM EH  DPEM VDLQYSLAKSY+S P LR+TWL+ +  IH KN   +E AMC  H+ A++ EYL RK  +   C  F+ I+PNI  E S M D  +Q +VH+ ++ + +LL + A        +E++  +YKL+IPIYE++RD+E+LA +Y  +   Y+K+     + +R++G+Y+RV  +G+  F+   GK +IY+         + + L KL+S K+GA  V+M+ ++  ++   LD + A IQVTHV PFF+E E  ER + FER +NI +FM E PF +                        K+   +  Q KRRTILT    FP++K+R+ V+     D +PIE AIDE+  K  +L                              S    + I L   + + G++  QVN GP+AYAR FL       Y   KVK LK  F +F+  C   L     L+   Q +    M+        ELS +++E+IC  E+ + +  ++L
Sbjct:  642 LYVYPKSLKYDSQKSFAKARNIAICIEFKDSDEEDSKPLKCIYGRPG--GPLFTESAFAAVLHHHQNPEFYDEIKIELPTQLHEKHHLLFTFFHVSCDNS------NKGSTKKKDVVETQVGYSWLPLLKDGRVVTSEQ-HIPVSANLPSGYLGFQEHGM---------------------------------GRHYGPEIK-------------------------------WVDGSKPLLKVSTHLVSTVYTQDQHLHNFFQYCQ--------------------KTESGAQALGS-----------------ELVKYLKSLHAMEGHVMIAFLPTILNQLFRVL--TRATQEEVAVNVTRVIIHVVAQCHEEGLEGH-----------LRSYVKYAYKAEPYIASEYK-TVHEELTKSMTTILKPS-ADFLTSNKLLKYSWFFFEVLIKSMAQHLIENSKVKLLR--NQRFPASYHHAVETVVTMLMPHITQ-------------KYRDN---PDASKNANHSLAVFIKRCFTFMDRGFVFKQINNYISCFAP------GDPKTLFEYKFEFLRVVCNHEHYIPLNL-----PMPFGKGRIQRYQDLQLDYALTDEFCRNHFLVGLLLREVGAALQEF---REVRVIAISVLKNLLIKHSFDDRYASRSHQARIATLYLPLFGLLIENVQRINVRDVSPFPVNPGSTVKEESLTLPAVNPLVTPQKSGGTLDTSLHKDLFGAIS-GIASPYTNSTPNINSVRNADSRGSLIS----------------TDSGN--SLPERNSEKSNSLEKRER-----LLRRHSACVVHGAGEEEEERDQPARRHRATVDFSLLTLPPLPEEAPLG--GGLS-----SPRGTEEHQQSGTLGNSVVRCDK------LDQSEIKSLLMCFLYILKSMSDDALFTYWNKASTAELMDFFTISEVCLHQFQYMGKRYIASVRKIS-----------------SVLGISVDNGYGHSDADVLHQSLLEANIATEVCLTALDTLSLFTLAFKNQLLADHGHNPLMKKVFDVYLCFLQKHQSETALKHVFTALRSLIYKFPSTFYEGRADMCAALCYETLKCCNSKLSSIRTEASQLLYFLMRNNFDYSGKKSFVRTHLQIVISVSQLIADVVGIGGTRFQQSLSIINNCA-------------------------------NSDRLIKHTTFSSDVKDLTKRIRTVLMATAQMKEHEADPEMLVDLQYSLAKSYASTPELRKTWLDSMARIHVKNGDLSEAAMCYVHVTALVAEYLTRKGMFRQGCTAFRVITPNIDEEASMMEDVGMQ-DVHFNEDVLTELLEQCADGLWKAERYELIADIYKLIIPIYEKRRDFERLAHLYDTLHRAYSKVTEVMHSGRRLLGTYFRVAFFGQGFFEDEDGKEYIYKEPKLTPLSEISQRLLKLYSDKFGAENVKMIQDSGKVNPKDLDSKYAYIQVTHVIPFFDEKELQERKTEFERSHNIRRFMFEMPFTQ----------------------SGKRQGGVEEQCKRRTILTAIHCFPYVKKRIPVMYQHHTDLNPIEVAIDEMSKKVAELRQL--------------------------CSSAEVDMIKL--QLKLQGSVSVQVNAGPLAYARAFLDDTNTKRYPDNKVKLLKEVFRQFVEACGQALVVNERLIKEDQIEYQEEMKANYREMTKELSEIMHEQICPLEEKTSVLPNSL 2099          

HSP 2 Score: 68.1662 bits (165), Expect = 3.932e-7
Identity = 58/243 (23.87%), Postives = 96/243 (39.51%), Query Frame = 2
Query: 1145 IRPQVEQSIPKTFIKLTANRFITSVGISDENSNPKGVIPAEPFFISFSLFHIADGRRISEEFYWNPNRPQIEDLLPSDLFAYKFGGHPVHATINGNCDNRTPLNLPTMSDRVLQSTNSFILKVPCLPDKICLFIKSEKVFSGAIGPTVDKYIKSGGSLLKKKDREEELFVENPDVKTGASINKTMSVYCANIGHYRMPFGWTACRLNIKGKNCL----RF---HKYENNKTSEDDIIKLVQNM 1852
            ++P  E+   +  +K     F     +++    P   +  EPFF++ SLF +   R+IS +F+ + N   +  +L +   + + G                P  L  + +  +Q     I  V C    I L  + EKV  G+I    + Y+KS  S                  K    + K     C  +G YRMPF W A  L       L    RF   +K ++NK S +D++KL+ + 
Sbjct:  356 VKPFEEKFGKRILVKCNDLSFNLQCCVAENEEGPTTNV--EPFFVTLSLFDVKCNRKISADFHVDLNHFSVRQMLATTSPSLRNGDR-----------QSLPAPLGILHEASMQYPKQGIFSVTCPHPDIFLVARIEKVLQGSITHGAEPYMKSSDS-----------------SKVAQKVLKNAKQACQRLGQYRMPFAWAARTLFKDASGNLDKSARFSALYKQDSNKLSNEDMLKLLADF 568          
BLAST of Dedicator of cytokinesis vs. TrEMBL
Match: A0A4W2CW70 (Dedicator of cytokinesis 9 OS=Bos indicus x Bos taurus OX=30522 GN=DOCK9 PE=3 SV=1)

HSP 1 Score: 696.427 bits (1796), Expect = 0.000e+0
Identity = 523/1761 (29.70%), Postives = 809/1761 (45.94%), Query Frame = 2
Query: 2411 LYIYPRTLNFSNQNVFHRARNLSCFVELRDVDKSDAPPLKVFYSRPSRKQPAFDYWSNTSVIYHDSSPTFNEEIKIALPLNLHSKHHLLFRFYHVSCDTAAIPNVREKGSNKKS--LETPVGVTWLTLMDQNLNLKSGSFSLPVATQLVPDYLEEKQQSIYYKKDSLWKLSTSFGQPKPRNSSTDKVIDESVNKRHSGPTFKSYINPRSSRDLEDIFSIKSDDVEQSHDTTVQWVDGQKSIFTVVIRPETTIFTQSTHLHKFFQVCSEKLDELTNPTVVEKKESIFTKPRSGSDPTTPKPVSDDTLLLQTSNKDVEIKNAIKALATVNVTNLIKFFAPTFNQLLHVVVCTAISHSEISKTAVTSMITLASSLRTPSMESLSSKATKRNTKIIKSYIKFAFDAEKIVPTKVKRTVHESLIQAISELIRPPFRDTXXXXXXXXXXXXXYSIITKSMIQSLTKQSKITIDKGGDKFFSTSYMDSLQNMIHLIINCILEITSTVGNQSGMNGQLRPNNSFQSLATSANKDLARFISRLFNVMDRGFIFQIIHQYMKIFIARINAYSGHREHLCRMKFDFLEIVTNHEHYLPLNLLKIINPSDKGQSVRKRQAPPSLELILSETYCRQHYLAGLLLQEVHRQMSDVYSHNAVRRLPFVMLRNLLAKHLFDDRYSSINMQARIAALYLPLVSIILENQKSFSLPGNLHTKVNLLNDIYDHSDRSLSARPLST--LSGDTLST--HSSINGSSGDGAGGSVYGLGFGTNSSKSARSSQVYLGKDGHVEDHWLKQIAGLTDGGNIRTLSTRRKXXXXXXXXXXXXXXXGLDEMHESGDTNSLDDEMVIHSKVPLNSESVVKRSSLQRPPVSNSNSWGRKAGLSLNIKKSVAPTHPSQRASILNKASNKNHETKSSIYLNDKTQKDIFVCLLHIFHTISSDDLKATICNLTVQERLEFLQLLILSIHHLKYQGRKVINNFESISTGCAKSKIQLRPHGPRSSVTAILDDVDHGD----HKAYLEGNVSTEVGLIVLDVLSAYCSAFKQEILTYTPDHVIFKKIVDIYLTLLSVNQSEIVLKHVFVSMRVFVSTFAKVLFANCHNVISDLSLHTLRFLDTRFTSVRIEACGFLYRMMRSSYDTFNKPGINRVHLQMIVAVSKLDRTV----GIRFKESLNYLKRLAEIEMXXXXXXXXXXXXXGTPTGTSKSITIGVHSTTKLSMQTFFEEVTDLTQRIRTVLMATVQMNEHVDDPEMQVDLQYSLAKSYSSNPALRRTWLEKIYAIHNKNNSRAEMAMCKAHIVAMIVEYLRRKEQYSMSCANFKAISPNIPLEESGMRDDSVQLEVHYTKEEVVKLLRELAHEFDAGCLWEVLRHVYKLVIPIYERKRDYEQLAEIYKHMSDGYNKIKTAESTNQRIIGSYYRVVLYGKP-------------FDSLAGKVFIYRLDSGKQFCVVREELQKLFSKKYGAGKVQMLVEN-HIDRSKLDPELASIQVTHVEPFFNEDEELERHSMFERQYNISKFMLETPFVKMNHVEHESRWKKYKEHDIDGVLKSKQTDDLSIQWKRRTILTVEASFPHLKRRLEVISIKEIDFSPIERAIDEIQLKNRQLAMHLAYXXXXXXXXXXXXXXXXXXXXXVGSSQTRANNIPLLMDMHMSGALLPQVNQGPMAYARVFLHKETQANYSQEKVKQLKIQFMEFLTLCYLLLRDFNELMSHIQQQKYIAMREALDSYRVELSNLINEEICVFEDISVISTSAL 7609
            LY+YP++L + +Q  F +ARN++  +E +D D+ D+ PLK  Y RP    P F   +  +V++H  +P F +EIKI LP  LH KHHLLF F+HVSCD +       KGS KK   +ET VG +WL L+     + S    +PV+  L   YL  ++  +                                  RH GP  K                               WVDG K +  V     +T++TQ  HLH FFQ C                     K  SG+                      E+   +K+L  +    +I F     NQL  V+  T  +  E++      +I + +      +E             ++SY+K+A+ AE  + ++ K TVHE L ++++ +++P   D    N  L  S+ F+ ++ KSM Q L + SK+ + +  ++ F  SY  +++ ++ +++  I +             + R N      + +AN  LA FI R F  MDRGF+F+ I+ Y+  F        G  + L   KF+FL +V NHEHY+PLNL     P   G+   +R     L+  L++ +CR H+L GLLL+EV   + +      VR +   +L+NLL KH FDDRY+S + QARIA LYLPL  +++EN +  ++       VN  + + + S    +  PL T   SG TL T  H  + G+   G            NS ++A S    +                 TD GN  +L  R    S++           L   H +   +   +E     +      + V  S L  PP+      G   GLS     S   T   Q++  L  +  +  +      L+    K + +C L+I  ++S D L       +  E ++F  +  + +H  +Y G++ I       TG   +++Q  P G   +         H D    H++ LE N++TEV L  LD LS +  AFK ++L     + + KK+ D+YL  L  +QSE  LKHVF ++R  +  F    +    ++ + L   TL+  +++ +S+R EA   LY +MR+++D   K    R HLQ++++VS+L   V    G RF++SL+ +   A                               +S   +   TF  +V DLT+RIRTVLMAT QM EH  DPEM VDLQYSLAKSY+S P LR+TWL+ +  IH KN   +E AMC  H+ A++ EYL RK  +   C  F+ I+PNI  E S M D  +Q +VH+ ++ + +LL + A        +E++  +YKL+IPIYE++RD+E+LA +Y  +   Y+K+     + +R++G+Y+RV  +G+              F+   GK +IY+         + + L KL+S K+GA  V+M+ ++  ++   LD + A IQVTHV PFF+E E  ER + FER +NI +FM E PF +                        K+   +  Q KRRTILT    FP++K+R+ V+     D +PIE AIDE+  K  +L                              S    + I L   + + G++  QVN GP+AYAR FL       Y   KVK LK  F +F+  C   L     L+   Q +    M+        ELS +++E+IC  E+ + +  ++L
Sbjct:  642 LYVYPKSLKYDSQKSFAKARNIAICIEFKDSDEEDSKPLKCIYGRPG--GPLFTESAFAAVLHHHQNPEFYDEIKIELPTQLHEKHHLLFTFFHVSCDNS------NKGSTKKKDVVETQVGYSWLPLLKDGRVVTSEQ-HIPVSANLPSGYLGFQEHGM---------------------------------GRHYGPEIK-------------------------------WVDGSKPLLKVSTHLVSTVYTQDQHLHNFFQYCQ--------------------KTESGAQALGS-----------------ELVKYLKSLHAMEGHVMIAFLPTILNQLFRVL--TRATQEEVAVNVTRVIIHVVAQCHEEGLEGH-----------LRSYVKYAYKAEPYIASEYK-TVHEELTKSMTTILKPS-ADFLTSNKLLKYSWFFFEVLIKSMAQHLIENSKVKLLR--NQRFPASYHHAVETVVTMLMPHITQ-------------KYRDN---PDASKNANHSLAVFIKRCFTFMDRGFVFKQINNYISCFAP------GDPKTLFEYKFEFLRVVCNHEHYIPLNL-----PMPFGKGRIQRYQDLQLDYALTDEFCRNHFLVGLLLREVGAALQEF---REVRVIAISVLKNLLIKHSFDDRYASRSHQARIATLYLPLFGLLIENVQRINVRDVSPFPVNPGSTVKEESLTLPAVNPLVTPQKSGGTLDTSLHKDLFGAIS-GIASPYTNSTPNINSVRNADSRGSLIS----------------TDSGN--SLPERNSEKSNSLEKRER-----LLRRHSACVVHGAGEEEEERDQPARRHRATVDFSLLTLPPLPEEAPLG--GGLS-----SPRGTEEHQQSGTLGNSVVRCDK------LDQSEIKSLLMCFLYILKSMSDDALFTYWNKASTAELMDFFTISEVCLHQFQYMGKRYIAR-----TGMMHARLQ--PLGSLDNSLTFNHSYGHSDADVLHQSLLEANIATEVCLTALDTLSLFTLAFKNQLLADHGHNPLMKKVFDVYLCFLQKHQSETALKHVFTALRSLIYKFPSTFYEGRADMCAALCYETLKCCNSKLSSIRTEASQLLYFLMRNNFDYSGKKSFVRTHLQIVISVSQLIADVVGIGGTRFQQSLSIINNCA-------------------------------NSDRLIKHTTFSSDVKDLTKRIRTVLMATAQMKEHEADPEMLVDLQYSLAKSYASTPELRKTWLDSMARIHVKNGDLSEAAMCYVHVTALVAEYLTRKGMFRQGCTAFRVITPNIDEEASMMEDVGMQ-DVHFNEDVLTELLEQCADGLWKAERYELIADIYKLIIPIYEKRRDFERLAHLYDTLHRAYSKVTEVMHSGRRLLGTYFRVAFFGQQYQFTDSETDVEGFFEDEDGKEYIYKEPKLTPLSEISQRLLKLYSDKFGAENVKMIQDSGKVNPKDLDSKYAYIQVTHVIPFFDEKELQERKTEFERSHNIRRFMFEMPFTQ----------------------SGKRQGGVEEQCKRRTILTAIHCFPYVKKRIPVMYQHHTDLNPIEVAIDEMSKKVAELRQL--------------------------CSSAEVDMIKL--QLKLQGSVSVQVNAGPLAYARAFLDDTNTKRYPDNKVKLLKEVFRQFVEACGQALVVNERLIKEDQIEYQEEMKANYREMTKELSEIMHEQICPLEEKTSVLPNSL 2119          

HSP 2 Score: 68.5514 bits (166), Expect = 2.960e-7
Identity = 58/243 (23.87%), Postives = 96/243 (39.51%), Query Frame = 2
Query: 1145 IRPQVEQSIPKTFIKLTANRFITSVGISDENSNPKGVIPAEPFFISFSLFHIADGRRISEEFYWNPNRPQIEDLLPSDLFAYKFGGHPVHATINGNCDNRTPLNLPTMSDRVLQSTNSFILKVPCLPDKICLFIKSEKVFSGAIGPTVDKYIKSGGSLLKKKDREEELFVENPDVKTGASINKTMSVYCANIGHYRMPFGWTACRLNIKGKNCL----RF---HKYENNKTSEDDIIKLVQNM 1852
            ++P  E+   +  +K     F     +++    P   +  EPFF++ SLF +   R+IS +F+ + N   +  +L +   + + G                P  L  + +  +Q     I  V C    I L  + EKV  G+I    + Y+KS  S                  K    + K     C  +G YRMPF W A  L       L    RF   +K ++NK S +D++KL+ + 
Sbjct:  356 VKPFEEKFGKRILVKCNDLSFNLQCCVAENEEGPTTNV--EPFFVTLSLFDVKCNRKISADFHVDLNHFSVRQMLATTSPSLRNGDR-----------QSLPAPLGILHEASMQYPKQGIFSVTCPHPDIFLVARIEKVLQGSITHGAEPYMKSSDS-----------------SKVAQKVLKNAKQACQRLGQYRMPFAWAARTLFKDASGNLDKSARFSALYKQDSNKLSNEDMLKLLADF 568          
BLAST of Dedicator of cytokinesis vs. TrEMBL
Match: A0A4W2EH68 (Dedicator of cytokinesis 9 OS=Bos indicus x Bos taurus OX=30522 GN=DOCK9 PE=3 SV=1)

HSP 1 Score: 695.656 bits (1794), Expect = 0.000e+0
Identity = 526/1761 (29.87%), Postives = 812/1761 (46.11%), Query Frame = 2
Query: 2411 LYIYPRTLNFSNQNVFHRARNLSCFVELRDVDKSDAPPLKVFYSRPSRKQPAFDYWSNTSVIYHDSSPTFNEEIKIALPLNLHSKHHLLFRFYHVSCDTAAIPNVREKGSNKKS--LETPVGVTWLTLMDQNLNLKSGSFSLPVATQLVPDYLEEKQQSIYYKKDSLWKLSTSFGQPKPRNSSTDKVIDESVNKRHSGPTFKSYINPRSSRDLEDIFSIKSDDVEQSHDTTVQWVDGQKSIFTVVIRPETTIFTQSTHLHKFFQVCSEKLDELTNPTVVEKKESIFTKPRSGSDPTTPKPVSDDTLLLQTSNKDVEIKNAIKALATVNVTNLIKFFAPTFNQLLHVVVCTAISHSEISKTAVTSMITLASSLRTPSMESLSSKATKRNTKIIKSYIKFAFDAEKIVPTKVKRTVHESLIQAISELIRPPFRDTXXXXXXXXXXXXXYSIITKSMIQSLTKQSKITIDKGGDKFFSTSYMDSLQNMIHLIINCILEITSTVGNQSGMNGQLRPNNSFQSLATSANKDLARFISRLFNVMDRGFIFQIIHQYMKIFIARINAYSGHREHLCRMKFDFLEIVTNHEHYLPLNLLKIINPSDKGQ----------SVRKRQAPPSLEL--ILSETYCRQHYLAGLLLQEVHRQMSDVYSHNAVRRLPFVMLRNLLAKHLFDDRYSSINMQARIAALYLPLVSIILENQKSFSLPGNLHTKVNLLNDIYDHSDRSLSARPLST--LSGDTLST--HSSINGSSGDGAGGSVYGLGFGTNSSKSARSSQVYLGKDGHVEDHWLKQIAGLTDGGNIRTLSTRRKXXXXXXXXXXXXXXXGLDEMHESGDTNSLDDEMVIHSKVPLNSESVVKRSSLQRPPVSNSNSWGRKAGLSLNIKKSVAPTHPSQRASILNKASNKNHETKSSIYLNDKTQKDIFVCLLHIFHTISSDDLKATICNLTVQERLEFLQLLILSIHHLKYQGRKVINNFESISTGCAKSKIQLRPHGPRSSVTAILDDVDHGD----HKAYLEGNVSTEVGLIVLDVLSAYCSAFKQEILTYTPDHVIFKKIVDIYLTLLSVNQSEIVLKHVFVSMRVFVSTFAKVLFANCHNVISDLSLHTLRFLDTRFTSVRIEACGFLYRMMRSSYDTFNKPGINRVHLQMIVAVSKLDRTV----GIRFKESLNYLKRLAEIEMXXXXXXXXXXXXXGTPTGTSKSITIGVHSTTKLSMQTFFEEVTDLTQRIRTVLMATVQMNEHVDDPEMQVDLQYSLAKSYSSNPALRRTWLEKIYAIHNKNNSRAEMAMCKAHIVAMIVEYLRRKEQYSMSCANFKAISPNIPLEESGMRDDSVQLEVHYTKEEVVKLLRELAHEFDAGCLWEVLRHVYKLVIPIYERKRDYEQLAEIYKHMSDGYNKIKTAESTNQRIIGSYYRVVLYGKP-FDSLAGKVFIYRLDSGKQFCVVREELQKLFSKKYGAGKVQMLVEN-HIDRSKLDPELASIQVTHVEPFFNEDEELERHSMFERQYNISKFMLETPFVKMNHVEHESRWKKYKEHDIDGVLKSKQTDDLSIQWKRRTILTVEASFPHLKRRLEVISIKEIDFSPIERAIDEIQLKNRQLAMHLAYXXXXXXXXXXXXXXXXXXXXXVGSSQTRANNIPLLMDMHMSGALLPQVNQGPMAYARVFLHKETQANYSQEKVKQLKIQFMEFLTLCYLLLRDFNELMSHIQQQKYIAMREALDSYRVELSNLINEEICVFEDISVISTSAL 7609
            LY+YP++L + +Q  F +ARN++  +E +D D+ D+ PLK  Y RP    P F   +  +V++H  +P F +EIKI LP  LH KHHLLF F+HVSCD +       KGS KK   +ET VG +WL L+     + S    +PV+  L   YL  ++  +                                  RH GP  K                               WVDG K +  V     +T++TQ  HLH FFQ C                     K  SG+                      E+   +K+L  +    +I F     NQL  V+  T  +  E++      +I + +      +E             ++SY+K+A+ AE  + ++ K TVHE L ++++ +++P   D    N  L  S+ F+ ++ KSM Q L + SK+ + +  ++ F  SY  +++ ++ +++  I +             + R N      + +AN  LA FI R F  MDRGF+F+ I+ Y+  F        G  + L   KF+FL +V NHEHY+PLNL     P  KG+          +V     P  L+L   L++ +CR H+L GLLL+EV   + +      VR +   +L+NLL KH FDDRY+S + QARIA LYLPL  +++EN +  ++       VN  + + + S    +  PL T   SG TL T  H  + G+   G            NS ++A S    +                 TD GN  +L  R    S++           L   H +   +   +E     +      + V  S L  PP+      G   GLS     S   T   Q++  L  +  +  +      L+    K + +C L+I  ++S D L       +  E ++F  +  + +H  +Y G++ I       TG   +++Q  P G   +         H D    H++ LE N++TEV L  LD LS +  AFK ++L     + + KK+ D+YL  L  +QSE  LKHVF ++R  +  F    +    ++ + L   TL+  +++ +S+R EA   LY +MR+++D   K    R HLQ++++VS+L   V    G RF++SL+ +   A                               +S   +   TF  +V DLT+RIRTVLMAT QM EH  DPEM VDLQYSLAKSY+S P LR+TWL+ +  IH KN   +E AMC  H+ A++ EYL RK  +   C  F+ I+PNI  E S M D  +Q +VH+ ++ + +LL + A        +E++  +YKL+IPIYE++RD+E+LA +Y  +   Y+K+     + +R++G+Y+RV  +G+  F+   GK +IY+         + + L KL+S K+GA  V+M+ ++  ++   LD + A IQVTHV PFF+E E  ER + FER +NI +FM E PF +                        K+   +  Q KRRTILT    FP++K+R+ V+     D +PIE AIDE+  K  +L                              S    + I L   + + G++  QVN GP+AYAR FL       Y   KVK LK  F +F+  C   L     L+   Q +    M+        ELS +++E+IC  E+ + +  ++L
Sbjct:  654 LYVYPKSLKYDSQKSFAKARNIAICIEFKDSDEEDSKPLKCIYGRPG--GPLFTESAFAAVLHHHQNPEFYDEIKIELPTQLHEKHHLLFTFFHVSCDNS------NKGSTKKKDVVETQVGYSWLPLLKDGRVVTSEQ-HIPVSANLPSGYLGFQEHGM---------------------------------GRHYGPEIK-------------------------------WVDGSKPLLKVSTHLVSTVYTQDQHLHNFFQYCQ--------------------KTESGAQALGS-----------------ELVKYLKSLHAMEGHVMIAFLPTILNQLFRVL--TRATQEEVAVNVTRVIIHVVAQCHEEGLEGH-----------LRSYVKYAYKAEPYIASEYK-TVHEELTKSMTTILKPS-ADFLTSNKLLKYSWFFFEVLIKSMAQHLIENSKVKLLR--NQRFPASYHHAVETVVTMLMPHITQ-------------KYRDN---PDASKNANHSLAVFIKRCFTFMDRGFVFKQINNYISCFAP------GDPKTLFEYKFEFLRVVCNHEHYIPLNLPM---PFGKGRIQRYQAFLSPTVESNDTPVDLQLDYALTDEFCRNHFLVGLLLREVGAALQEF---REVRVIAISVLKNLLIKHSFDDRYASRSHQARIATLYLPLFGLLIENVQRINVRDVSPFPVNPGSTVKEESLTLPAVNPLVTPQKSGGTLDTSLHKDLFGAIS-GIASPYTNSTPNINSVRNADSRGSLIS----------------TDSGN--SLPERNSEKSNSLEKRER-----LLRRHSACVVHGAGEEEEERDQPARRHRATVDFSLLTLPPLPEEAPLG--GGLS-----SPRGTEEHQQSGTLGNSVVRCDK------LDQSEIKSLLMCFLYILKSMSDDALFTYWNKASTAELMDFFTISEVCLHQFQYMGKRYIAR-----TGMMHARLQ--PLGSLDNSLTFNHSYGHSDADVLHQSLLEANIATEVCLTALDTLSLFTLAFKNQLLADHGHNPLMKKVFDVYLCFLQKHQSETALKHVFTALRSLIYKFPSTFYEGRADMCAALCYETLKCCNSKLSSIRTEASQLLYFLMRNNFDYSGKKSFVRTHLQIVISVSQLIADVVGIGGTRFQQSLSIINNCA-------------------------------NSDRLIKHTTFSSDVKDLTKRIRTVLMATAQMKEHEADPEMLVDLQYSLAKSYASTPELRKTWLDSMARIHVKNGDLSEAAMCYVHVTALVAEYLTRKGMFRQGCTAFRVITPNIDEEASMMEDVGMQ-DVHFNEDVLTELLEQCADGLWKAERYELIADIYKLIIPIYEKRRDFERLAHLYDTLHRAYSKVTEVMHSGRRLLGTYFRVAFFGQGFFEDEDGKEYIYKEPKLTPLSEISQRLLKLYSDKFGAENVKMIQDSGKVNPKDLDSKYAYIQVTHVIPFFDEKELQERKTEFERSHNIRRFMFEMPFTQ----------------------SGKRQGGVEEQCKRRTILTAIHCFPYVKKRIPVMYQHHTDLNPIEVAIDEMSKKVAELRQL--------------------------CSSAEVDMIKL--QLKLQGSVSVQVNAGPLAYARAFLDDTNTKRYPDNKVKLLKEVFRQFVEACGQALVVNERLIKEDQIEYQEEMKANYREMTKELSEIMHEQICPLEEKTSVLPNSL 2133          

HSP 2 Score: 68.1662 bits (165), Expect = 4.146e-7
Identity = 58/243 (23.87%), Postives = 96/243 (39.51%), Query Frame = 2
Query: 1145 IRPQVEQSIPKTFIKLTANRFITSVGISDENSNPKGVIPAEPFFISFSLFHIADGRRISEEFYWNPNRPQIEDLLPSDLFAYKFGGHPVHATINGNCDNRTPLNLPTMSDRVLQSTNSFILKVPCLPDKICLFIKSEKVFSGAIGPTVDKYIKSGGSLLKKKDREEELFVENPDVKTGASINKTMSVYCANIGHYRMPFGWTACRLNIKGKNCL----RF---HKYENNKTSEDDIIKLVQNM 1852
            ++P  E+   +  +K     F     +++    P   +  EPFF++ SLF +   R+IS +F+ + N   +  +L +   + + G                P  L  + +  +Q     I  V C    I L  + EKV  G+I    + Y+KS  S                  K    + K     C  +G YRMPF W A  L       L    RF   +K ++NK S +D++KL+ + 
Sbjct:  368 VKPFEEKFGKRILVKCNDLSFNLQCCVAENEEGPTTNV--EPFFVTLSLFDVKCNRKISADFHVDLNHFSVRQMLATTSPSLRNGDR-----------QSLPAPLGILHEASMQYPKQGIFSVTCPHPDIFLVARIEKVLQGSITHGAEPYMKSSDS-----------------SKVAQKVLKNAKQACQRLGQYRMPFAWAARTLFKDASGNLDKSARFSALYKQDSNKLSNEDMLKLLADF 580          
BLAST of Dedicator of cytokinesis vs. Ensembl Cavefish
Match: DOCK9 (dedicator of cytokinesis 9 [Source:HGNC Symbol;Acc:HGNC:14132])

HSP 1 Score: 429.098 bits (1102), Expect = 3.526e-121
Identity = 269/825 (32.61%), Postives = 416/825 (50.42%), Query Frame = 2
Query: 5138 KDIFVCLLHIFHTISSDDLKATICNLTVQERLEFLQLLILSIHHLKYQGRKVINNFESISTGCAKSKIQLRPHGPRSSVTAILDDVDHGD----HKAYLEGNVSTEVGLIVLDVLSAYCSAFKQEILTYTPDHVIFKKIVDIYLTLLSVNQSEIVLKHVFVSMRVFVSTFAKVLFANCHNVISDLSLHTLRFLDTRFTSVRIEACGFLYRMMRSSYDTFNKPGINRVHLQMIVAVSKLDRTV----GIRFKESLNYLKRLAEIEMXXXXXXXXXXXXXGTPTGTSKSITIGVHSTTKLSMQTFFEEVTDLTQRIRTVLMATVQMNEHVDDPEMQVDLQYSLAKSYSSNPALRRTWLEKIYAIHNKNNSRAEMAMCKAHIVAMIVEYLRRKEQYSMSCANFKAISPNIPLEESGMRDDSVQLEVHYTKEEVVKLLRELAHEFDAGCLWEVLRHVYKLVIPIYERKRDYEQLAEIYKHMSDGYNKIKTAESTNQRIIGSYYRVVLYGKP-FDSLAGKVFIYRLDSGKQFCVVREELQKLFSKKYGAGKVQMLVEN-HIDRSKLDPELASIQVTHVEPFFNEDEELERHSMFERQYNISKFMLETPFVKMNHVEHESRWKKYKEHDIDGVLKSKQTDDLSIQWKRRTILTVEASFPHLKRRLEVISIKEIDFSPIERAIDEIQLKNRQLAMHLAYXXXXXXXXXXXXXXXXXXXXXVGSSQTRANNIPLLMDMHMSGALLPQVNQGPMAYARVFLHKETQANYSQEKVKQLKIQFMEFLTLCYLLLRDFNELMSHIQQQKYIAMREALDSYRVELSNLINEEICVFED 7582
            K + +C LH+  ++S D L       +  + ++F  LL   +HH              + TG   +++Q       S          H D    +++ LE N++TEV L VLD LS +   FK ++      + + KK+  ++L  L +NQSE  LK VF  +R F+  F    F    ++ +      L+  +++ +S+R +A   LY +M+S++D   +    R HLQ+++AVSKL   V    G RF++SL+ +   A                               +S   +    F  +V DLT+RIRTVLMAT QM EH  DPEM VDLQYSLAKSY+S P LR+TWL+ +  IH KN   +E AMC  H+ A++ EYLRRK  +   C+ F+ ++PNI  E S M D  +Q +VH+ ++ +++L+ E A        +E++  +YKL+IPIYE++RD+E+LA +Y+ +   Y+K+     T +R++G+Y+RV  +G+  F+   GK +IY+         + + L KL+S+K+GA  V+M+ ++  I+   LD + A IQVTHV PF  E E  +R + FE+ +NI +F+ ETPF                       +  K+   +  QWKRRTILT    FP++K+R+ V+     D +PIE AIDE+  K  +L    A                        SS+       + + + + G++  QVN GP+AYAR FL   T   Y   KVK LK  F +F+  C   L     L+   QQ+ +  M+        ELS +++E I   ED
Sbjct: 1216 KSLLMCFLHVLKSMSEDALFTYWNKASSGDLMDFFTLLEYVLHH-------------HMKTGMMHARLQQLSSLDNS--YTFNHTYSHSDADVLNQSLLEANIATEVCLTVLDTLSVFIMGFKTQLSLDYGHNPLMKKVFAVHLCFLQINQSETALKQVFTFLRTFIYKFPCTFFEGRADMCASFCYEILKCCNSKLSSIRSDAAHLLYFLMKSNFDYTGRKSFVRTHLQVVIAVSKLIADVIGIGGTRFQQSLSIINNCA-------------------------------NSDKTIKNTAFPSDVKDLTKRIRTVLMATAQMKEHERDPEMLVDLQYSLAKSYASTPELRKTWLDSMARIHVKNGDLSEAAMCYVHVAALVAEYLRRKGMFKQGCSAFRVVTPNIEEEASMMEDVGMQ-DVHFNEDVLMELVEECADGLWKAERYELISDIYKLIIPIYEKRRDFEKLAHLYERLHRAYSKVAEVMHTGKRLLGTYFRVAFFGQGFFEDEDGKEYIYKEPKFTPLSEISQRLLKLYSEKFGAENVKMIQDSGRINPKDLDSKYAYIQVTHVTPFLEEKELADRKTEFEKSHNICRFVFETPF----------------------TVTGKKQGGIEEQWKRRTILTTTHFFPYVKKRIAVMYQHHTDLNPIEVAIDEMSKKVAELRQLCA------------------------SSEVDM----IKLQLKLQGSISVQVNAGPLAYARAFLDDTTSKRYPDNKVKLLKEVFRQFVEACGHGLGINERLIKEDQQEYHDEMKANYRDLTRELSAIMHEPINPVED 1943          

HSP 2 Score: 278.87 bits (712), Expect = 1.201e-74
Identity = 199/689 (28.88%), Postives = 314/689 (45.57%), Query Frame = 2
Query: 2411 LYIYPRTLNFSNQNVFHRARNLSCFVELRDVDKSDAPPLKVFYSRPSRKQPAFDYWSNTSVIYHDSSPTFNEEIKIALPLNLHSKHHLLFRFYHVSCDTAAIPNVREKGSNKKSLETPVGVTWLTLMDQNLNLKSGSFSLPVATQLVPDYLEEKQQSIYYKKDSLWKLSTSFGQPKPRNSSTDKVIDESVNKRHSGPTFKSYINPRSSRDLEDIFSIKSDDVEQSHDTTVQWVDGQKSIFTVVIRPETTIFTQSTHLHKFFQVCSEKLDELTNPTVVEKKESIFTKPRSGSDPTTPKPVSDDTLLLQTSNKDVEIKNAIKALATVNVTNLIKFFAPTFNQLLHVVVCTAISHSEISKTAVTSMITLASSLRTPSMESLSSKATKRNTKIIKSYIKFAFDAEKIVPTKVKRTVHESLIQAISELIRPPFRDTXXXXXXXXXXXXXYSIITKSMIQSLTKQSKITIDKGGDKFFSTSYMDSLQNMIHLIINCILEITSTVGNQSGMNGQLRPNNSFQSLATSANKDLARFISRLFNVMDRGFIFQIIHQYMKIFIARINAYSGHREHLCRMKFDFLEIVTNHEHYLPLNLLKIINPSDKGQSVRKRQAPPSLELILSETYCRQHYLAGLLLQEVHRQMSDVYSHNAVRRLPFVMLRNLLAKHLFDDRYSSINMQARIAALYLPLVSIILEN 4477
            LY+YPR L +  Q  F +ARN++  VE RD D+ DA P+K  Y RP    P F      +V++H  +P F +E KI LP  L+ KHHLLF FYHVSCD+    N +     ++ +ET VG  WL L+     + +    +PVA  L   YL                                    ES +K+H+GP                                V+WVDG KS+F V     +T++TQ  HLH FF  C               + S++    +G                       E+   +K+L  +    +I F     NQL  V+  T+ +  +++      M+ + +      +E             ++SY+K+ F  +    T   +TVHE L +A++ +++P   D    N  L  S+ F+  + KSM Q L +  K+ + +  ++ FS S+  +++ ++++++  I     T   +  ++            A +AN  LA FI R F  MDRGF+F+ I+ Y+  F+       G  + L   KF+FL++V NHEHY+PLNL     P   G+   +R     L+  L++ +CR H+L GLLL+E    + +      +R++   +L+NL+ KH FDDRY+S + QAR+A LYLPL  ++ EN
Sbjct:  559 LYVYPRQLRYDGQKAFAKARNIAVCVEFRDSDEEDALPVKCIYGRPG--GPLFTKNIIAAVLHHQQTPEFYDEFKIELPTQLNEKHHLLFTFYHVSCDS----NSKASTKKREQVETQVGYAWLPLLKDGRVIMNEQ-QIPVAANLPAGYLS---------------------------------CLESNSKQHAGPE-------------------------------VKWVDGGKSLFKVSTHLVSTVYTQDQHLHNFFHHC---------------ESSVYPPQSTGG----------------------ELIKYLKSLHAMEAHVMINFLPTVLNQLFRVL--TSAAQDDVAVNVTRVMVHIVAQCHEEGLE-----------HYLRSYVKYVFKTD--ANTATGKTVHEELAKAMTTILKPS-TDFLTSNKLLKYSWYFFEALVKSMAQYLIESGKVRLSR--NQRFSASFHHTVETLVNMMMPHI-----TQKYKDNLDA-----------ARNANHSLAVFIKRCFTFMDRGFVFKQINNYINCFMP------GDAKTLYEFKFEFLKVVCNHEHYIPLNL-----PMPFGKGRIQRFQDLQLDYSLTDDFCRNHFLVGLLLREASGALQEF---RDIRQIAIQVLKNLMIKHTFDDRYTSKSQQARMATLYLPLFGLLQEN 1091          

HSP 3 Score: 78.5666 bits (192), Expect = 1.078e-13
Identity = 71/285 (24.91%), Postives = 115/285 (40.35%), Query Frame = 2
Query: 1046 IYSEIRNQIKMK----SQQTPIYDIGIIEKSQLDDCHIRPQVEQSIPKTFIKLTANRFITSVGISDENSNPKGVIPAEPFFISFSLFHIADGRRISEEFYWNPNRPQIEDLLPSDLFAYKFGGHPVHATINGNCD--NRTPLNLPTMSDRVLQSTNSFILKVPCLPDKICLFIKSEKVFSGAIGPTVDKYIKSGGSLLKKKDREEELFVENPDVKTGASINKTMSVYCANIGHYRMPFGWTACRLNIKGKNCL----RF---HKYENNKTSEDDIIKLVQNMSSQ 1861
            I S++RN+ ++K       T   D   IE        ++P  E+   +  +K     F     +++    P   +  EPFF++ SLF I + R+IS +F+ + N P +  ++P        G       +NG  D    T   LP   +  LQ     +  V C    I L  + EK+  G I    + Y+K+  S                  K    + K   + C+ +G YRMPF W A  L       L    RF   ++ ++NK S +D+ KL+ +   Q
Sbjct:  242 IESKMRNETRLKLFTLDPDTQKLDFSGIEPE------VKPFEEKFGKRILVKCNDLAFNLQSCVAENEEGPTTNV--EPFFVTLSLFDIQNSRKISADFHVDLNHPSVRAMVPGS------GAQ----IMNGASDLTQHTTNGLP---ESALQYPRQGVFSVMCPHPDIFLVARIEKILQGGITHCAEPYMKNSDS-----------------TKAAQKVLKNAKLACSRLGQYRMPFAWAARPLFKDASGTLDKSARFSPIYRQDSNKLSNEDMFKLLADFRKQ 488          
BLAST of Dedicator of cytokinesis vs. Ensembl Cavefish
Match: dock11 (dedicator of cytokinesis 11 [Source:ZFIN;Acc:ZDB-GENE-060503-196])

HSP 1 Score: 419.853 bits (1078), Expect = 2.508e-118
Identity = 278/846 (32.86%), Postives = 436/846 (51.54%), Query Frame = 2
Query: 5138 KDIFVCLLHIFHTISSDDLKATICNLTVQERLEFLQLL--ILSI----------HHLKYQGRKVINNFESISTGCAKSKIQLRPHGPRSSVTAILD-----DVDHG------------DHKAYLEGNVSTEVGLIVLDVLSAYCSAFKQEILTYTPDHVIFKKIVDIYLTLLSVNQSEIVLKHVFVSMRVFVSTFAKVLFANCHNVISDLSLHTLRFLDTRFTSVRIEACGFLYRMMRSSYDTFNKPGINRVHLQMIVAVSKLDRTVGI----RFKESLNYLKRLAEIEMXXXXXXXXXXXXXGTPTGTSKSITIGVHSTTKLSMQTFFEEVTDLTQRIRTVLMATVQMNEHVDDPEMQVDLQYSLAKSYSSNPALRRTWLEKIYAIHNKNNSRAEMAMCKAHIVAMIVEYLRRKEQYSMSCANFKAISPNIPLEESGMRDDSVQLEVHYTKEEVVKLLRELAHEFDAGCLWEVLRHVYKLVIPIYERKRDYEQLAEIYKHMSDGYNKIKTAESTNQRIIGSYYRVVLYGKP-FDSLAGKVFIYRLDSGKQFCVVREELQKLFSKKYGAGKVQMLVE-NHIDRSKLDPELASIQVTHVEPFFNEDEELERHSMFERQYNISKFMLETPFVKMNHVEHESRWKKYKEHDIDGVLKSKQTDDLSIQWKRRTILTVEASFPHLKRRLEVISIKEIDFSPIERAIDEIQLKNRQLAMHLAYXXXXXXXXXXXXXXXXXXXXXVGSSQTRANNIPLLMDMHMSGALLPQVNQGPMAYARVFLHKETQANYSQEKVKQLKIQFMEFLTLCYLLLRDFNE-LMSHIQQQKYIAMREALDSYRVELSNLINEEI 7567
            K + +C LHI  T+S D L A    +  Q+ + FL LL  ++SI             + Q   V   F    T   KS+      G  S + A +      +  H             +H+A LEG++STE  LIVLD LS +  +FK ++L     + + KK+ DIYLT L + QSE  ++HVF S+R F++ F   LF     +   L    L+   ++   +R EA G LY +MR++++   +    R+HLQ+I+AVS+L   V +    RF+ESL+ +   A                               +S   +    F  EV  LT+RIRTVLMAT QM EH  DPEM +DLQYSLA+SY+S P LRRTWL+ +   H KN   +E AMC  H+ A++ EYL RK+ +S   A FK I+ NI  EE+ M++DS   +V+YT++ +V+ L            +E++ H+ +L+IP+YE++ ++E+L  +Y  +   Y+KI     T +R++G+Y+RV  YG+  F+   GK +IY+         +   L  L+ +K+GA  V+++ + N +++  LDP+ A IQVT V+P+F+E +  ER + FE+ +NI++F+ ETP+                       L  K+   +  Q KRRT+LT   +FP++K+R+EV+  K ++  PI+ AIDE++ ++ +L                              S    + I L   + + G +  QVN GPMAYAR FL  E+++  S +KVK+LK  F  F+  C + L D NE L+   Q + +  ++    S   ELS++I+E++
Sbjct: 1186 KGLLLCFLHIIKTVSEDTLLAYWNKVNPQDIMNFLSLLDWLVSIITRVCGGCVCCLCRCQDSWVSKVF----TSNRKSQTMPVMRGRSSLLQASIQQFGTMEASHSVNIGVGLTEPEINHQACLEGSISTEACLIVLDTLSLFTQSFKNQLLDSDGHNTLMKKVFDIYLTFLRMGQSETAIRHVFASLRAFITKFQVTLFKGRVTLCGSLCYEVLKCCMSKLGVLRGEAAGLLYLLMRNNFEYTKRKTFLRMHLQIIIAVSQLIADVALTGSSRFQESLSIINNFA-------------------------------NSDKAMKTTPFPGEVKGLTKRIRTVLMATAQMREHEKDPEMLLDLQYSLARSYASTPELRRTWLDSMARAHLKNGDFSEAAMCYVHVAALVAEYLHRKKLFSTGLAAFKKITFNID-EEAAMKEDSGMQDVYYTEDVLVEQLEVCVEGLWKAERFELITHIARLIIPVYEKRHEFEKLRRLYDTLQRAYSKILEVMQTGRRLLGTYFRVAFYGQGFFEEEDGKEYIYKEPKLTGLSEISHRLLTLYGEKFGAENVKIIQDSNKVNQKDLDPKFAYIQVTFVKPYFDEKDLSERTTDFEKCHNINRFVFETPY----------------------TLSGKKHGGIEEQCKRRTVLTTANTFPYVKKRIEVVGEKHLELKPIDVAIDEMRERSTELTKL--------------------------CSNQEVDMIQL--QLKLQGCVSVQVNAGPMAYARAFL-DESRSGQSNKKVKELKDIFRRFVQACSMAL-DINERLIKEDQYEYHEGLKGNFKSMVKELSDIIHEQV 1943          

HSP 2 Score: 124.02 bits (310), Expect = 1.709e-27
Identity = 72/173 (41.62%), Postives = 96/173 (55.49%), Query Frame = 2
Query: 3962 ATSANKDLARFISRLFNVMDRGFIFQIIHQYMKIFIARINAYSGHREHLCRMKFDFLEIVTNHEHYLPLNLLKIINPSDKGQSVRKRQAPPSLELILSETYCRQHYLAGLLLQEVHRQMSDVYSHNAVRRLPFVMLRNLLAKHLFDDRYSSI-NMQARIAALYLPLVSIILEN 4477
            A   N  LA FI R    M+RGF F +++ YM  F  +        + L  MKF FL  V NHEHY+PLNL     P   G++  +R    SLE  L+E YCR H+L GLLL+EV      +     +R+L   +L+NL+ KH  DDRY++  N QARI  LYLPL  ++ +N
Sbjct:  959 ARCVNISLANFIKRCLTFMNRGFAFSLVNDYMCGFSQK------DPKVLTEMKFYFLMTVCNHEHYIPLNL-----PMAFGRTKLQRVQDQSLEYSLTEDYCRNHFLVGLLLREV---ADGLQGSPEIRQLAVAVLKNLIIKHAMDDRYTAYKNQQARICVLYLPLFELLYQN 1117          

HSP 3 Score: 119.783 bits (299), Expect = 3.249e-26
Identity = 61/158 (38.61%), Postives = 93/158 (58.86%), Query Frame = 2
Query: 2411 LYIYPRTLNFSNQNVFHRARNLSCFVELRDVDKSDAPPLKVFYSRPSRKQPAFDYWSNTSVIYHDSSPTFNEEIKIALPLNLHSKHHLLFRFYHVSCDTAAIPNVREKGSNKK--SLETPVGVTWLTLMDQNLNLKSGSFSLPVATQLVPDYLEEKQQ 2878
            LYIYP  L + NQ  F +ARN++  V+ +D D   A P+K  + +P    P F   +  +V++H+ SP F +EIKI LP+++H KHH+LF F+H+SC+ +       K S+KK   +ET VG  W+ L+ ++  L+     LPV+  L   YL +K Q
Sbjct:  636 LYIYPLQLKYENQKTFAKARNIAVCVQFKDSDDEGAGPVKCIFGKPG--GPLFTTSAFAAVLHHNQSPEFYDEIKIELPVHVHEKHHILFTFFHISCELS------NKASSKKREGVETLVGYAWMPLL-KDGKLQPSDLQLPVSANLPAGYLYDKNQ 784          

HSP 4 Score: 97.4413 bits (241), Expect = 2.165e-19
Identity = 145/608 (23.85%), Postives = 243/608 (39.97%), Query Frame = 2
Query:  134 SELVKPIDFESVYLQNKNNISNDPNRVLVKIPDNDVKINKVSRKETVYNNGVPTNIHEIFDCNLLAKLCVDFYTSEWTATCYKDFTYNSSFWTLPNVHNQLTMAKEQKFIIXXXXXXXXXXLLTFKTKGSYFESNLAICDRNAYQKHLKHREDELANTSSNAGINYSKAAVPELLSFSLNELSDGSTVLK----ESMPRDGHEQIIVYLDNV------DSLRELGGYWILLSFKGKQSESY---LFTGGNDNQKLWANKLKDAIES---------ETKTKQIERPVSSESIERSEETVHGMLSKFLQENEQSAVILRKKDHQKILVIYSEIRNQIKMKSQQTPIYDIGIIEKSQLDDCHIRPQVEQSIPKTFIKLTANRFITSVGISDENSNPKGVIP-AEPFFISFSLFHIADGRRISEEFYWNPNRPQIEDLLPSDLFAYKFGGHPVHATINGNCDNRTPLN-LPTM---SDRVLQSTNSFILKVPCLPDKICLFIKSEKVFSGAIGPTVDKYIKSGGSLLKKKDREEELFVENPDVKTGASINKTMSVYCANIGHYRMPFGWTACR--------LNIKGKNCLRFHKYENNKTSEDDIIKLVQNM 1852
            +++++P+D+E+V  Q K  I +DP R L+  P +DV   +  R+ T+  + VP N       +L AK C+  Y ++W    Y    Y+  F  LP   ++        F +DE                   E + ++C     QK    ++  L   + N+ ++ S   V +   F L++L DGS +L     E   +D    I  YLD+         +R  G       F+ K  E Y   L        + W N LK  I S         +  T    +P S   +E    ++H  L K+ +E +Q   I R +  QKIL +  E           T   D   IE        ++P  E+   +  +      F     +S++N    G++   EPFFI+ +LF +  G +IS +F+ + N P + ++L                T  G   + + +N LP +   S+ +L+  +  +  V      I L  + EKV    I    + Y+K+                     KT   + KT    C  +G YRMPF W A +        L++ GK     ++ ++NK S +D+IK + ++
Sbjct:   37 TKIIEPLDYENVVFQRKAQIHSDPQRDLLLWPADDVSQIERQRRTTI--SSVPQNAENEAK-SLFAKECIKMYNTDWNVINYNYEAYSGCFRMLPCKGSKAEKLPSHVFEVDEGE-----------------EDSSSLCS----QKGGVMKQGWLQKANINSSLSVS-MKVFKRRYFYLSQLPDGSYILNSYKDEKNCKDTKGSI--YLDSCIDVVQCPKMRRNG-------FELKMQERYSHYLAADSEAEMEDWVNTLKLHIISIFSLYVSPLDEDTVSQGKPESV--VENFGRSLHPELMKYARETDQLNKINRNECRQKILSLDPE-----------TQRLDFSGIEPD------VKPFEERFGRRIMVSCHDLTFSLQGSVSEKND---GILTNLEPFFITLALFDVTKGCKISGDFHVDLNPPCVREMLCEG------SSQTPTETEGGEAGDLSKINGLPVIQRISESLLRFPSQGVFSVTNPHTDIFLVARVEKVLQNGITHCAEPYVKTSDM-----------------SKTVQKVLKTAKQTCQRLGQYRMPFAWAAKQVFKDAQGSLDMDGKFS-PLYRQDSNKISTEDLIKFLLDI 564          
BLAST of Dedicator of cytokinesis vs. Ensembl Cavefish
Match: dock9b (dedicator of cytokinesis 9b [Source:ZFIN;Acc:ZDB-GENE-090916-2])

HSP 1 Score: 406.757 bits (1044), Expect = 3.618e-114
Identity = 269/854 (31.50%), Postives = 429/854 (50.23%), Query Frame = 2
Query: 5042 PTHPSQRASILNKASNKNHETKSSIYLNDKTQ----KDIFVCLLHIFHTISSDDLKATICNLTVQERLEFLQLLILSIHHLKYQGRKVINNFESISTGCAKSKIQLRPHGPRSSVTAILDDVDHGDHKA-YLEGNVSTEVGLIVLDVLSAYCSAFKQEILTYTPDHVIFKKIVDIYLTLLSVNQSEIVLKHVFVSMRVFVSTFAKVLFANCHNVISDLSLHTLRFLDTRFTSVRIEACGFLYRMMRSSYDTFNKPGINRVHLQMIVAVSKLDRTV----GIRFKESLNYLKRLAEIEMXXXXXXXXXXXXXGTPTGTSKSITIGVHSTTKLSMQTFFEEVTDLTQRIRTVLMATVQMNEHVDDPEMQVDLQYSLAKSYSSNPALRRTWLEKIYAIHNKNNSRAEMAMCKAHIVAMIVEYLRRKEQYSMSCANFKAISPNIPLEESGMRDDSVQLEVHYTKEEVVKLLRELAHEFDAGCLWEVLRHVYKLVIPIYERKRDYEQLAEIYKHMSDGYNKIKTAESTNQRIIGSYYRVVLYGKP-FDSLAGKVFIYRLDSGKQFCVVREELQKLFSKKYGAGKVQMLVEN-HIDRSKLDPELASIQVTHVEPFFNEDEELERHSMFERQYNISKFMLETPFVKMNHVEHESRWKKYKEHDIDGVLKSKQTDDLSIQWKRRTILTVEASFPHLKRRLEVISIKEIDFSPIERAIDEIQLKNRQLAMHLAYXXXXXXXXXXXXXXXXXXXXXVGSSQTRANNIPLL-MDMHMSGALLPQVNQGPMAYARVFLHKETQANYSQEKVKQLKIQFMEFLTLCYLLLRDFNELMSHIQQQKYIAMREALDSYRVELSNLINEEI 7567
            P   S+++S L+K  + +    SSI   DK      K++ +C L++  ++S D L       T  E  +F  L+ + +H  +Y G++ I          A   I+                  H D +A  L+ N+STEV L VLD LS +   FK ++      + + KK+  ++L  L + QSE  LKH+F S+R F+  F    F    ++ + L    L+  +++ +++R +A   LY +M+S++D   +    R HLQ+++AVS+L   V    G RF++SL+ +   A                               +S   +    F  +V DLT+RIRTVLMAT QM EH  DPEM VDLQYSLAKSY+S P LR+TWL+ +  IH KN   +E AMC  H+ A++ EYL+RK  +   C+ F+ I+PNI  EE+ M +D    +VH+ +E +++LL E A        +E++  +Y+L+IPIYE++RD+E+LA +Y  +   Y K+     + +R++G+++RV  +G+  F+   GK +IY+         + + L KL+S K+G   V+M+ ++  ++   L+ + A IQVTHV P+  E E  ER + FE+ +NI +F+ ETPF                          K+   +  Q KRRT+LT    FP++K+R+ V+     D SPIE AIDE+  K  +L    A                             A+ + ++ + + + G++  QVN GP+AYAR FL       Y   KVKQLK  F +F+  C   L     L+   QQ+ +  M+ +      ELS +++E++
Sbjct: 1186 PEKNSEKSSSLDKTQSAS-ALGSSILRCDKLDREEIKNLLMCFLYVLKSMSEDALFTYWNKATSSEMTDFFTLIEVCLHQFRYMGKRFI----------ASEHIKY--------------TYTHADSEACLLDANISTEVCLTVLDTLSIFIMGFKTQLCADLGHNPLMKKVFQVHLCFLQIPQSETALKHIFTSLRTFIYKFPCTFFDGRADMCACLCYEILKCCNSKLSTIRSDAAHLLYFLMKSNFDYTGRKSFVRTHLQVVIAVSQLIADVIGIGGTRFQQSLSIINNCA-------------------------------NSDKTVKHTAFPSDVKDLTKRIRTVLMATEQMKEHEKDPEMLVDLQYSLAKSYTSTPELRKTWLDSMAKIHVKNGDLSEAAMCYVHVAALVAEYLKRKGMFRQGCSAFRVITPNID-EEAAMMEDVGMQDVHFNEEVLMELLEECADGLWKAERYELISDIYRLIIPIYEQRRDFEKLAHLYDTLHRAYTKVMEVMHSGKRLLGTFFRVAFFGQGFFEDEDGKEYIYKEPKFTPLSEISQRLLKLYSDKFGQENVKMIQDSGRVNPKDLEAKFAYIQVTHVTPYLEEKELEERRTDFEKSHNIRRFVFETPFTA----------------------SGKRHGGVDEQCKRRTVLTTTHCFPYVKKRIAVMYQHHTDLSPIEVAIDEMSSKVAELKALCA-----------------------------ASEVDMIRLQLKLQGSISVQVNAGPLAYARAFLDDACAKKYPDNKVKQLKEVFRQFVEACGQALGVNERLIKEDQQEYHDEMKASYRELTRELSLIMHEQV 1931          

HSP 2 Score: 236.498 bits (602), Expect = 1.122e-61
Identity = 196/741 (26.45%), Postives = 320/741 (43.18%), Query Frame = 2
Query: 2411 LYIYPRTLNFSNQNVFHRARNLSCFVELRDVDKSDAPPLKVFYSRPSRKQPAFDYWSNTSVIYHDSSPTFNEEIKIALPLNLHSKHHLLFRFYHVSCDTAAIPNVREKGSNKKSLETPVGVTWLTLMDQNLNLKSGSFSLPVATQLVPDYLEEKQQSIYYKKDSLWKLSTSFGQPKPRNSSTDKVIDESVNKRHSGPTFKSYINPRSSRDLEDIFSIKSDDVEQSHDTTVQWVDGQKSIFTVVIRPETTIFTQSTHLHKFFQVCSEKLDELTNPTVVEKKESIFTKPRSGSDPTTPKPVSDDTLLLQTSNKDVEIKNAIKALATVNVTNLIKFFAPTFNQLLHVVVCTAISHSEISKTAVTSMITLASSLRTPSMESLSSKATKRNTKIIKSYIKFAFDAEKIVPTKVK-RTVHESLIQAISELIRPPFRDTXXXXXXXXXXXXXYSIITKSMIQSLTKQSKITIDKGGDKFFSTSYMDSLQNMIHLIINCILEITSTVGNQSGMNGQLRPNNSFQSLATSANKDLARFISRLFNVMDRGFIFQIIHQYMKIFIARINAYSGHREHLCRMKFDFLEIVTNHEHYLPLNLLKIINPSDKGQSVRKRQAPPSLELILSETYCRQHYLAGLLLQEVHRQMSDVYSHNAVRRLPFVMLRNLLAKHLFDDRYSSINMQARIAALYLPLVSIILENQKSFSLPGNLHTKVNLLNDIYDHSDRSLSARPLSTLSGDTLSTHSSINGSS 4630
            LY+YP+ L + +Q  F +   +    E   V        +  Y RP    P F   +  +V++H  +P F +EIKI LP  LH KHHLLF FYH+SCD++           +  +ET VG  WL L+     + S    + VA+ L   YL                                    E +NK HSGP                                V+WVDG + +F V     +T++TQ  HLH FF  C                                          +    + E+   +K+L  +    +I F     NQL+ V+  T  SH +++      M+ + +      +E             ++SY+KF F  E    +    +TVHE L +A++ +++P   D    N  L  S+ F+  + KSM Q L +  K+ + +  ++ F+ S+  +++ ++++++  I     T   +  ++            A +AN  LA FI R F  MDRGF+F++I+ Y+  F+       G  + L   KF FL +V NHEH++PLNL     P  KG+ +R +     L+  L++ +CR H+L GLLL+EV   + +      +R++   +L++L+ KH FDDRY+S + QAR+A LYLPL  ++ EN    ++      +V+ +N    H+    +  P S+L  D       I+G++
Sbjct:  591 LYVYPKHLKYDSQKSFAKYVFICIGSEYACVF------FQCIYGRPG--GPLFCRSAYAAVLHHQQNPEFYDEIKIELPTQLHEKHHLLFTFYHISCDSST--------KKRDMVETQVGSAWLPLLKDGRVIMSEQ-QISVASNLPAGYLS---------------------------------CQEGLNK-HSGPE-------------------------------VKWVDGGRPLFRVSTHLVSTVYTQDQHLHNFFHHCQ-----------------------------------------KAQATEGELVKYLKSLHAMESHVMINFLPTILNQLVRVL--TTTSHEDVAVNTTRVMVHIVAQCHEEGLE-----------HYLRSYVKFVFKTECYSASNSNGKTVHEELAKAMTAILKPS-TDFLTSNKLLKYSWYFFEALVKSMAQHLIESGKVKLSR--NQRFTASFHHAVETLVNMLMPHI-----TQKYKDNLDA-----------ARNANHSLAVFIKRCFTFMDRGFVFKLINNYINCFVP------GDPKTLYEFKFAFLRVVCNHEHFVPLNLPM---PFGKGRIMRFQDL--QLDYSLTDDFCRNHFLVGLLLREVGGALQEF---GEIRQISIHVLKSLMIKHTFDDRYTSKSQQARLATLYLPLFGLLQENVHRLNVREPSTNQVSYIN----HTPHKPAGNPESSLHKDVFGV---ISGTA 1155          

HSP 3 Score: 76.2554 bits (186), Expect = 5.311e-13
Identity = 53/204 (25.98%), Postives = 85/204 (41.67%), Query Frame = 2
Query: 1265 EPFFISFSLFHIADGRRISEEFYWNPNRPQIEDLLPSDLFAYKFGGHPVHATINGNCDN-RTPLNLPTMSDRVLQSTNSFILKVPCLPDKICLFIKSEKVFSGAIGPTVDKYIKSGGSLLKKKDREEELFVENPDVKTGASINKTMSVYCANIGHYRMPFGWTACRLNIKGKNCL----RF---HKYENNKTSEDDIIKLVQNM 1852
            EPFF+  SLF + + R+IS +F+ + N P +  ++            P    ING  D    P+ L  + +  LQ     +  V C    I L  + EKV  G I    + Y+KS  S                  K    + K   + C+ +  Y+MPF W A  +       L    RF   ++ ++NK S++D+ KL+ + 
Sbjct:  344 EPFFVVLSLFDVQNSRKISADFHVDLNHPLVRSMIS-----------PTSTVINGAMDTPHMPMQLNGLPEGALQYPTQGVFSVTCPHPDIFLVARIEKVLQGGITHCAEPYMKSSDS-----------------AKVAQKVLKNAKLACSRLSPYKMPFAWAARPVFKDASGTLEKSARFSALYRQDSNKLSDEDLFKLLADF 519          
BLAST of Dedicator of cytokinesis vs. Ensembl Cavefish
Match: dock10 (dedicator of cytokinesis 10 [Source:ZFIN;Acc:ZDB-GENE-130530-773])

HSP 1 Score: 389.037 bits (998), Expect = 1.955e-108
Identity = 257/735 (34.97%), Postives = 379/735 (51.56%), Query Frame = 2
Query: 5420 LEGNVSTEVGLIVLDVLSAYCSAFKQEILTYTPDHVIFKKIVDIYLTLLSVNQSEIVLKHVFVSMRVFVSTFAKVLFANCHNVISDLSLHTLRFLDTRFTSVRIEACGFLYRMMRSSYDTFNKPGINRVHLQMIVAVSKLDRTVGI---RFKESLNYLKRLAEIEMXXXXXXXXXXXXXGTPTGTSKSITIGVHSTTKLSMQTFFEEVTDLTQRIRTVLMATVQMNEHVDDPEMQVDLQYSLAKSYSSNPALRRTWLEKIYAIHNKNNSRAEMAMCKAHIVAMIVEYLRRKEQ-----YSMSCANFKAISPNIPLEESGMRDDSVQLEVHYTKEEVVKLLRELAHEFDAGCLWEVLRH-----VYKLVIPIYERKRDYEQLAEIYKHMSDGYNKIKTAESTNQRIIGSYYRVVLYGK-PFDSLAGKVFIYRLDSGKQFCVVREELQKLFSKKYGAGKVQMLVE-NHIDRSKLDPELASIQVTHVEPFFNEDEELERHSMFERQYNISKFMLETPFVKMNHVEHESRWKKYKEHDIDGVLKSKQTDDLSIQWKRRTILTVEASFPHLKRRLEVISIKEIDFSPIERAIDEIQLKNRQLAMHLAYXXXXXXXXXXXXXXXXXXXXXVGSSQTRANNIPLLMDMHMSGALLPQVNQGPMAYARVFLHKETQANYSQEKVKQLKIQFMEFLTLCYLLLRDFNELMSHIQQQKYI-AMREALDSYRVELSNLINEEICVF 7576
            +E N+STEV L VLDVL  +    K+++L     + + KK+ D YL    +NQS   L+HVF ++R+F+  F  V F    ++   L    L+  + R +S + EA   LY +MR +++      I R HLQ+I AVS+L    GI   RF++SL  +   A                               +    L   +F  EV DLT+RIRTVLMAT QM EH  DPEM VDLQYSLA SY+S P LRRTWLE +  IH +N   +E AMC  HI A+I E L+R+ +     +SM  A F  ISPN+  EE  M++D+   +  YT++ +V+ L EL  ++    LW+  RH     + K VI ++E++RD+++L+E+Y  +   Y K+    ++ +R+ G YYRV  YG+  F+    K FIY+         + + L KL+S K+GA  V+M+ + N ++   LDP  A IQVT+V P+F+E E+ E+ + FE  +NI++F+ ETPF                       L  K+  D+  Q KRRTILT  ++FP+LK+R++V+  +  + +PIE AIDE+  K  +L                              S    + I L   + + G++  +VN GPMAYAR FL ++    Y   +VK LK  F +F   C   L D NE +    Q +Y   MR        ELS ++NE++C  
Sbjct: 1358 IEANLSTEVALTVLDVLGLFVHHHKKQLLHDEGQNSLMKKVFDTYLLFFQINQSTTTLRHVFAALRLFIQKFPGVFFQGKADLCGCLCYEILKCCNHRSSSTQTEAAALLYFLMRKNFEYTKGKSIVRSHLQVIKAVSQLIADAGIGGSRFQQSLAIINNFA-------------------------------NGDAPLKSTSFPAEVKDLTKRIRTVLMATSQMKEHEKDPEMLVDLQYSLANSYASTPELRRTWLESMAKIHVRNGDLSEAAMCYIHISALIAESLKRRGESAPSSFSMGWAAFMNISPNVQ-EEGAMKEDTGTQDTPYTEDTLVEQL-ELCVDY----LWKSERHELIADINKPVIAVFEKRRDFKRLSELYYDIHRSYLKVTEVVNSEKRLFGRYYRVAFYGQGFFEEEENKEFIYKEPKLTGLSEISQRLLKLYSDKFGADNVKMIQDSNKVNPKDLDPRFAYIQVTYVVPYFDEKEQQEKKTDFEHHHNINRFVFETPF----------------------TLSGKKHGDVEEQCKRRTILTTSSTFPYLKKRIQVVKQQSTEMNPIEVAIDEMSRKVSELNQL--------------------------CSMAEVDMIRL--QLKLQGSVSVKVNAGPMAYARAFLEEKNAKKYPDNQVKLLKEIFRQFADACGQAL-DVNERLIKEDQLEYQEEMRAHYKDMLNELSAVMNEQVCTL 2004          

HSP 2 Score: 134.806 bits (338), Expect = 9.427e-31
Identity = 66/157 (42.04%), Postives = 95/157 (60.51%), Query Frame = 2
Query: 2411 LYIYPRTLNFSNQNVFHRARNLSCFVELRDVDKSDAPPLKVFYSRPSRKQPAFDYWSNTSVIYHDSSPTFNEEIKIALPLNLHSKHHLLFRFYHVSCDTAAIPNVREKGSNKKSLETPVGVTWLTLMDQNLNLKSGSFSLPVATQLVPDYLEEKQQS 2881
            +Y+YP+ L + +Q  F +ARN++ +VE R+ D+  A PLK  Y +P    P F   + ++V++H  +P F +E+KI LP  LH KHHLLF FYHV+CD     N +     K++LETPVG  WL L+ +   L S  FS+PV+  L   YL  K+ S
Sbjct:  605 IYVYPKHLKYDSQKSFAKARNIAVYVEFRNSDEEHAKPLKCIYGKPG--GPVFTTAACSNVLHHSQNPDFYDEVKIELPTQLHEKHHLLFSFYHVTCDI----NAKTSSKKKEALETPVGYAWLPLLKEG-RLSSQEFSVPVSCSLPSGYLLIKEPS 754          

HSP 3 Score: 115.546 bits (288), Expect = 6.223e-25
Identity = 75/176 (42.61%), Postives = 104/176 (59.09%), Query Frame = 2
Query: 3968 SANKDLARFISRLFNVMDRGFIFQIIHQYMKIFIARINAYSGHREHLCRMKFDFLEIVTNHEHYLPLNLLKIINPSDKGQSVRKRQAPPSLELILSETYCRQHYLAGLLLQEVHRQMSDVYSHNAVRRLPFVMLRNLLAKHLFDDRYSSINMQARIAALYLPLVSIILENQKSFSL 4495
            SAN+ +A F+ R F +MDRGF F++I+ Y+       N  +G  + LC  KF+FL+ V NHEHY+PL+ L I +    GQS  +    P  E  L+  +CR+H+L GLLL+E+   + D      +R L    L+NL+AKH  D RY     QARIA+LYLPL  +IL+N   F L
Sbjct:  939 SANQAVAAFVKRCFTLMDRGFTFKLINSYVS------NITAGDNKMLCEFKFEFLKEVCNHEHYIPLS-LPIPSARITGQSALQILDMP--EYSLTGEFCRKHFLTGLLLKELGLALQD---EQDIRHLALASLKNLMAKHSLDSRYEK---QARIASLYLPLYGLILDNMPRFFL 1099          

HSP 4 Score: 54.6842 bits (130), Expect = 1.807e-6
Identity = 71/330 (21.52%), Postives = 127/330 (38.48%), Query Frame = 2
Query:  932 ESIERSEETVHGMLSKFLQENEQSAVILRKKDHQKILVIYSEIRNQIKMKSQQTPIYDIGIIEKSQLDDCHIRPQVEQSIPKTFIKLTANRFITSVGISDENSNPKGVIPAEPFFISFSLFHIADGRRISEEFYWNPNRPQIEDLLPSDLFAYKFGGHPVHATINGNCDNRTPLNLPTMSDRVLQSTNSFILKVPCLPDKICLFIKSEKVFSGAIGPTVDKYIKSGGSLLKKKDREEELFVENPDVKTGASINKTMSVYCANIGHYRMPFGWTACRLNIKGKNCL----RF---HKYENNKTSEDDIIKLVQNMSSQHVDNNASKYTTIP 1900
            E+ E +E  ++  L+K++ E E      R+++   +  +              TP+   G       D   IRP  E+ + +  +    +  +T  G  +E +  + V   EPFF++ +L  + + R++S +F+ + N   +  +L                  +G+C       L    +  L      I  +      I +  + EKV  G I    + YIK+                   + KT   + K+   +C+ +G YRMPF W+   +    +  +    RF    K E+NK S +D++KLV            SK  TIP
Sbjct:  271 ENEETTENGINPELAKYITETEDVVRAARREERLNLFSL-----------DPDTPVRQCG-------DSAPIRP-FEEKLGRRLMIYCGSLNLTLQGCVNE-AETEPVTNIEPFFVTVALLDMRENRKVSADFHVDLNHEMVRKMLSGS----------GSPGRSGDC------QLSQELENWLCFPKQAIFSITNPHTDIVMVARVEKVLMGNITSGTEPYIKN-----------------TDNSKTVQKMLKSNKQFCSKLGKYRMPFAWSVRSVFKDNQGTVDRESRFSPLFKQESNKISTEDLLKLVTEYRRAE---KTSKLQTIP 544          
BLAST of Dedicator of cytokinesis vs. Ensembl Cavefish
Match: dock7 (dedicator of cytokinesis 7 [Source:ZFIN;Acc:ZDB-GENE-050302-15])

HSP 1 Score: 322.398 bits (825), Expect = 6.116e-88
Identity = 240/908 (26.43%), Postives = 414/908 (45.59%), Query Frame = 2
Query: 4988 NSWGRKAG-----------------LSLNIKKSVAPTHPSQRASILNKASNKNHETKSSIYLNDKTQKDIFVCLLHIFHTISSDDLKATICNLTVQERLEFLQLLILSIHHLKYQGRKVINNFESI------------------STGC-------AKSKIQLRPHGP----------RSSVTAILDDVDHGD-------HKAYLEGNVSTEVGLIVLDVLSAYCSAFKQEILTYTPDHVIFKKIVDIYLTLLSVNQSEIVLKHVFVSMRVFVSTFAKVLFANCHNVISDLSLHTLRFLDTRFTSVRIEACGFLYRMMRSSYDTFNKPGINRVHLQMIVAVSKLDRTVGIRFKESLNYLKRLAEIEMXXXXXXXXXXXXXGTPTGTSKSITIGVHSTTKLSMQTFFEEVTDLTQRIRTVLMATVQMNEHVDDPEMQVDLQYSLAKSYSSNPALRRTWLEKIYAIHNKNNSRAEMAMCKAHIVAMIVEYLRRKEQ---YSMSCANFKAISPNIPLEESGMRDDSVQLE-------VHYTKEEVVKLLRELAHEFDAGCLWEVLRHVYKLVIPIYERKRDYEQLAEIYKHMSDGYNKIKTAESTNQRIIGSYYRVVLYGKPFDSLAGKVFIYRLDSGKQFCVVREELQKLFSKKYGAGKVQMLVE-NHIDRSKLDPELASIQVTHVEPFFNEDEELERHSMFERQYNISKFMLETPFVKMNHVEHESRWKKYKEHDIDGVLKSKQTDDLSIQWKRRTILTVEASFPHLKRRLEVISIKEIDFSPIERAIDEIQLKNRQLAMHLAYXXXXXXXXXXXXXXXXXXXXXVGSSQTRANNIPLLMDMHMSGALLPQVNQGPMAYARVFLHKETQANYSQEKVKQLKIQFMEFLTLCYLLLRDFNELMSHIQQQKY 7501
            N WGR  G                 +++ I  +  P      + +LN  + + H T S      ++ + + +CLL +        L+    +L+V +    L +L L +   +Y+G+K      S+                  S G        ++ +++  P G           R  +T    + +  D       H+A ++GN++TE  LI+LD L        Q +        I   ++ + L  ++ NQS + L+H F + R  VS F ++LF       +DL L  LR   +  +++R  A   LY +MR +++  N     RV +Q+ +++S L   VG     +  +L+R                        + K+I        +L   TF ++V DL   +  +L  TV+M EH +DPEM +DL Y +AK Y ++P LR TWL+ +   H++ N+ AE A C  H  A++ EYL   E      + C  F+ IS N+ LEES + DD V  +        ++T+  +V LL + A  F    ++E +  VYK++IPI+E  RD ++LA I+  + + + KI       +R+ G+Y+RV  YG  F  L  + F+Y+  +  +   +   L+  + +++G  +V+++ + N +D+ KLDP  A IQ+T+VEP+F+  E  +R + F++ YN+ +F+  TPF                   +DG    +   DL  Q+KR+TILT   +FP++K R+ +I  +EI   PIE AI+++Q K ++LA                            + Q  A+    ++ M + G++   VNQGP+  A+VFL +            +L++ F +F   C   LR  N+ +    Q++Y
Sbjct: 1079 NQWGRPGGPGTEEQEAEGNSMISQTVAMAIAGTSVPQMSRPSSFLLNPQATRQHGTFSP-----ESSRSLLICLLWVLKNADEMVLQKWFTDLSVSQLNRLLDMLYLCVSCFEYKGKKAFERMNSLTFKKSKDMKAKLEEAILGSIGARQEMVRRSRGQLERSPSGSAFGSQENLRWRKDMTHWRQNSEKMDKTRAELEHEALIDGNLATEANLIILDTLEIIV----QTVSVTESKESILGGVLKVLLHSMACNQSALYLQHCFATQRALVSKFPELLFEEETEQCADLCLRLLRNCSSSISTIRAHASASLYLLMRQNFEIGN--NFARVKMQVTMSLSSL---VGTSQNFNEEFLRR------------------------SLKTILTYAEEDLELRETTFPDQVQDLVFNLHMILSDTVKMKEHQEDPEMLIDLMYRIAKGYQTSPDLRLTWLQNMAGKHSERNNHAEAAQCLVHSAALVAEYLSMLEDRKYLPVGCVTFQNISSNV-LEESAVSDDVVSPDEEGICSGKYFTEAGLVGLLEQAAASFSMAGMYEAVNEVYKVLIPIHEANRDAKKLATIHGKLQEAFGKI--VHQDGKRMFGTYFRVGFYGSKFGDLDEQEFVYKEPAITKLAEISHRLEGFYGERFGEDQVEVIKDSNPVDKCKLDPNKAFIQITYVEPYFDTYEMKDRITYFDKNYNLRRFVYCTPFT------------------LDG----RAHGDLHEQYKRKTILTTSHAFPYIKTRINIIHKEEIISMPIEVAIEDMQKKTQELAF--------------------------ATHQDPAD--AKMLQMVLQGSVGTTVNQGPLEVAQVFLSEIPSDPKLYRHHNKLRLCFKDFTKRCEDALRK-NKCLIGPDQKEY 1894          

HSP 2 Score: 103.605 bits (257), Expect = 3.120e-21
Identity = 60/161 (37.27%), Postives = 95/161 (59.01%), Query Frame = 2
Query: 2375 ELVAPNLDFIHTLYIYPRTLNFSNQNVFHRARNLSCFVE-LRDVDKSDAPPLKVFYSRPSRKQPAFDYWSNTSVIYHDSSPTFNEEIKIALPLNLHSKHHLLFRFYHVSCDTAAIPNVREKGSNKKSLETPVGVTWLTLMDQNLNLKSGSFSLPVATQLVP 2854
            ++  PN  + + LY+ P++LNF+N+     ARN++  V+ +   D S+A P  V + + S  + A + +  T+V+YH+ SP F++E+KI LP +L   HH+LF FYHVSC          +      LETPVG TW+ ++ QN  L++G F LPV+ +  P
Sbjct:  399 DIYVPNTKYRNLLYVNPQSLNFANRQ--GSARNITVKVQFMNGEDPSNAMP--VIFGKSSCAEFAKEAY--TAVVYHNRSPDFHDEVKIKLPASLTDHHHILFTFYHVSC----------QQKQNTPLETPVGYTWIPML-QNGRLRTGHFCLPVSLEKPP 542          

HSP 3 Score: 86.2705 bits (212), Expect = 5.293e-16
Identity = 59/187 (31.55%), Postives = 92/187 (49.20%), Query Frame = 2
Query: 3959 LATSANKDLARFISRLFNVMDRGFIFQIIHQYMKIFIARINAYSGHREHLCRMKFDFLEIVTNHEHYLPLNL--------------LKIINPSDKGQSVRKRQAPPSLELILSETYCRQHYLAGLLLQEVHRQMS-DVYSHNAVRRLPFVMLRNLLAKHLFDDRYSSINMQARIAALYLPLVSIILE 4474
            L    N  LA F++ L +VMDRGF+F ++  Y K    ++  Y+     L  ++ DFL IV +HEHY+ LNL              +        G S   +    +    LS  +  QHYLAGL+L E+   +  +      + +    ++ NLL+ H  D RY+   ++AR+A LYLPL+ I++E
Sbjct:  882 LVERLNASLAFFLNDLLSVMDRGFVFSLVKTYWKQVSTKL--YALQNPTLESLRLDFLRIVCSHEHYVTLNLPCSLLTPPASPSPSVSSATSQSSGFSTHVQDQKIANMFELSVPFREQHYLAGLVLTELALILDPEADGMFGLHKKVISVVHNLLSSHDSDPRYADPEVKARVAMLYLPLIGIVME 1066          
BLAST of Dedicator of cytokinesis vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009336.1 (pep scaffold:Pmarinus_7.0:GL476376:61013:130269:-1 gene:ENSPMAG00000008407.1 transcript:ENSPMAT00000009336.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 245.743 bits (626), Expect = 3.349e-65
Identity = 187/717 (26.08%), Postives = 328/717 (45.75%), Query Frame = 2
Query: 5405 DHKAYLEGNVSTEVGLIVLDVLSAYCSAFKQEILTYTPDHVIFKKIVDIYLTLLSVNQSEIVLKHVFVSMRVFVSTFAKVLFANCHNVISDLSLHTLRFLDTRFTSVRIEACGFLYRMMRSSYDTFNKPGINRVHLQMIVAVSKLDRTVGIRFKESLNYLKRLAEIEMXXXXXXXXXXXXXGTPTGTSKSITIGVHSTTKLSMQTFFEEVTDLTQRIRTVLMATVQMNEHVDDPEMQVDLQYSLAKSYSSNPALRRTWLEKIYAIHNKNNSRAEMAMCKAHIVAMIVEYLRRKEQ---YSMSCANFKAISPN---------IPLEESGMRDDSVQLEVHYTKEEVVKLLRELAHEFDAGCLWEVLRHVYKLVIPIYERKRDYEQLAE-----IYKHMSDGYNKIKTAESTNQRIIGSYYRVVLYGKPFDSLAGKVFIYRLDSGKQFCVVREELQKLFSKKYGAGKVQMLVE-NHIDRSKLDPELASIQVTHVEPFFNEDEELERHSMFERQYNISKFMLETPFVKMNHVEHESRWKKYKEHDIDGVLKSKQTDDLSIQWKRRTILTVEASFPHLKRRLEVISIKEIDFSPIERAIDEIQLKNRQLAMHLAYXXXXXXXXXXXXXXXXXXXXXVGSSQTRANNIPLLMDMHMSGALLPQVNQGPMAYARVFLHKETQANYSQEKVKQLKIQFMEFLTLCYLLLRDFNELMSHIQQQKY 7501
            +H++ ++GN+STE  ++VLD L           L+ T D V+   ++ + L  ++ NQS   L+H F + R  VS F ++LF       +DL L  LR   +   + R  A   LY +MR +++  N     RV +Q+ +++S L   VG     +  +L+R                        + K+I        +L   TF E+V DL   +  +L  TV+M EH +DPEM +DL Y +AK Y ++P LR TWL+ +   H++    AE A C  H  A++ EYL   E      + C +F+  +           + L E   RD S      ++   + K           G L  ++  +   + P       +  L       +Y  +   +  + ++    +R+ G+Y+RV  YG  F  L  + F+Y+  +  +   +   L+  +S+++G   ++++ + N +DR+KLDP  A IQ+T+VEP+F+  E  +R + F++ YN+ +F+  TPF                   +DG    +   DL  Q+KR+T+LT   +FP++K R+ V   +EI  +P+E AI+++Q K ++LA                            + Q   ++   ++ M + G++   VNQGP+  A+VFL +            +L++ F +F   C   LR  N+++    Q++Y
Sbjct: 1415 EHESLVDGNLSTETNMVVLDSLEIVVQTVS---LSETKDSVL-GGVLKVLLHSMACNQSSSYLQHCFATQRALVSRFPELLFEEETEQCADLCLRLLRHCSSSINNTRSHASASLYLLMRQNFEIGNN--FARVKMQVTMSLSSL---VGTSQNFNEEFLRR------------------------SLKTILTYAEEDFELQSTTFPEQVQDLVFNLHMILSDTVKMKEHQEDPEMLLDLMYRIAKGYQTSPDLRLTWLQNMAGKHSERGQHAEAAHCLVHSAALVSEYLSMLEDRKYLPIGCVSFQNANKTGSTGTECSMLALNEFRERDRS------FSPTGLCKAAASALGSLSLGVLHALMLIILHGIYPSLPHPIVFGSLCVRSAHCVYGRLQRQHTHVSSSPQGGKRMFGTYFRVGFYGSKFGDLDEQEFVYKEPAITKLAEISHRLEGFYSERFGEENMEVIKDSNPVDRNKLDPNKAYIQITYVEPYFDMYELKDRITYFDKNYNLRRFLFATPFT------------------LDG----RAHGDLHEQYKRKTVLTTSHAFPYIKTRINVGHKEEIILTPMEVAIEDMQKKTQELAF--------------------------ATHQEPPDHK--MLQMVLQGSVGTTVNQGPLEVAQVFLAEIPDDPKLYRHHNKLRLCFKDFTKRCADALRK-NKVLIGPDQKEY 2041          

HSP 2 Score: 103.99 bits (258), Expect = 3.839e-22
Identity = 64/161 (39.75%), Postives = 93/161 (57.76%), Query Frame = 2
Query: 2375 ELVAPNLDFIHTLYIYPRTLNFSNQNVFHRARNLSCFVE-LRDVDKSDAPPLKVFYSRPSRKQPAFDYWSNTSVIYHDSSPTFNEEIKIALPLNLHSKHHLLFRFYHVSCDTAAIPNVREKGSNKKSLETPVGVTWLTLMDQNLNLKSGSFSLPVATQLVP 2854
            E+  P   + + L+IYP++LNF+N+     ARN++  V+ +   D S+A P  V + + S   P F   S TSV+YH+ SP F EEIK+ LP +L   HH+LF F+H+SC          +      LETPVG TW+ L+ QN  L++G F LPV+ +  P
Sbjct:  540 EVYDPYTTYRNLLHIYPQSLNFANRQ--GSARNIAVKVQFMSGEDVSNAMP--VIFGKSS--CPEFLRESYTSVVYHNKSPDFYEEIKVKLPAHLTDYHHILFTFFHISC----------QQKQNTPLETPVGYTWIPLL-QNGRLRTGQFCLPVSLEKPP 683          

HSP 3 Score: 92.8189 bits (229), Expect = 1.073e-18
Identity = 63/183 (34.43%), Postives = 96/183 (52.46%), Query Frame = 2
Query: 3974 NKDLARFISRLFNVMDRGFIFQIIHQYMKIFIARINAYSGHREHLCRMKFDFLEIVTNHEHYLPLNLLKIINPSDKG---------------QSVRKRQAPPSLELILSETYCRQHYLAGLLLQEVHRQM-SDVYSHNAVRRLPFVMLRNLLAKHLFDDRYSSINMQARIAALYLPLVSIILE 4474
            N  LA F++ LF++MDRGF+F +I  Y K   ++IN+       L  +K +FL I+ +HEHY+ LNL                          SV  R+     E  LS  + +QH+LAGLLL E+   +  DV S + + +     + NLL+ H  D R+S  +++A +A LYLPL+ I++E
Sbjct: 1033 NVSLAFFLNDLFSIMDRGFVFNLIKTYFKQVSSKINSLPTPNV-LISLKLEFLRIICSHEHYVTLNLPCSSLSPPSSPSPSVSSATSQSSGFSSVHDRRIANMFE--LSPEFRQQHFLAGLLLSELAIILDPDVESLSTLHKKAINTVHNLLSCHDADSRFSHPDVKAHVAMLYLPLIGIVME 1212          
BLAST of Dedicator of cytokinesis vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002343.1 (pep scaffold:Pmarinus_7.0:GL491723:27:4970:1 gene:ENSPMAG00000002135.1 transcript:ENSPMAT00000002343.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 75.8702 bits (185), Expect = 6.575e-15
Identity = 65/244 (26.64%), Postives = 105/244 (43.03%), Query Frame = 2
Query: 5405 DHKAYLEGNVSTEVGLIVLDVLSAYCSAFKQEILTYTPDHVIFKKIVDIYLTLLSVNQSEIVLKHVFVSMRVFVSTFAKVLFANCHNVISDLSLHTLRFLDTRFTSVRIEACGFLYRMMRSSYDTFNKPGINRVHLQMIVAVSKLDRTVGIRFKESLNYLKRLAEIEMXXXXXXXXXXXXXGTPTGTSKSITIGVHSTTKLSMQ--TFFEEVTDLTQRIRTVLMATVQMNEHVDDPEMQVDLQY 6130
            + +A ++GN++TE  LIVLD L        Q +        +   ++ + L  LS NQS + L+H   + R  VS     L        + L LH LR   +   + R  A   LY +MR +++  N     RV +Q+ ++++ L   VG     S + L+R                             T+  ++     MQ  TF  +V +L   ++T+L  TV+M E+  DPEM +DL Y
Sbjct:   37 EQEAIIDGNLATEANLIVLDSLELVV----QTVAVTEAKDGVLGGVLKVLLHSLSCNQSSVFLQHSLATQRALVSRVGPHLPTPPTAPYTPLCLHLLRHCSSSLVATRAHASASLYLLMRQNFEIGNN--FARVKMQVTMSLASL---VGTSASFSEDALRRSLH--------------------------TMLAYAAADGDMQPTTFPLQVRELVLNLQTILSDTVKMKEYKQDPEMLMDLMY 245          
BLAST of Dedicator of cytokinesis vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008301.1 (pep scaffold:Pmarinus_7.0:GL477297:188469:211033:-1 gene:ENSPMAG00000007508.1 transcript:ENSPMAT00000008301.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.151 bits (139), Expect = 1.831e-8
Identity = 61/246 (24.80%), Postives = 108/246 (43.90%), Query Frame = 2
Query: 6434 FDAGCLWEVLRHVYKLVIPIYERK-RDYEQLAEIYKHMSDGYNKIKTAESTNQRIIGSYYRVVLYGKPFDS-LAGKVFIYRLDSGKQFCVVREELQKLFSKKYGAGKVQMLVENHIDRSKLDPELASIQVTHVEPFFNEDEELERHSMFERQYNISKFMLETPFVKMNHVEHESRWKKYKEHDIDGVLKSKQTDDLSIQWKRRTILTVEASFPHLKRRLEVISIKEIDFSPIERAIDEIQLKNRQL 7165
            FD G +WE    + K +   YE +  DYEQL+ I +  +  Y  I T      R    Y+ V  +G+ F S L  K+FIYR   GK++   RE+ +     ++   +         +  +  P   +IQ   V+P   +  + +  S+ ++  N         F K+N V+  +  +  ++ D D        ++ +  W  RT  + E   P + R  EVI   +++ SP+E AI+ +   N ++
Sbjct:   74 FDKGKMWEEAIGLCKELAQQYETEIFDYEQLSNILRRQAKFYENIITV----MRPKPDYFAVGYFGQGFPSFLRNKMFIYR---GKEY-ERREDFEARLLAQFPNAEKMKTTSPPGENVRSAPS-QNIQCFTVQPLQRDQPKFKNKSVNDQILN---------FYKVNEVQCFTYSRPVRKGDKD------PDNEFANMWIERTTYSTEYRLPGILRWFEVIETSKVEISPLENAIETMNKTNEKI 295          
BLAST of Dedicator of cytokinesis vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010350.1 (pep scaffold:Pmarinus_7.0:GL476865:2751:57127:1 gene:ENSPMAG00000009372.1 transcript:ENSPMAT00000010350.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.1434 bits (126), Expect = 7.417e-7
Identity = 75/341 (21.99%), Postives = 141/341 (41.35%), Query Frame = 2
Query: 6410 LLRELAHEFDAGCLWEVLRHVYKLVIPIYERK-RDYEQLAEIYKHMSDGYNKIKTAESTNQRIIGSYYRVVLYGKPFDS-LAGKVFIYRLDSGKQFCVVREELQKLFSKKYGAGKVQMLVENHIDRSKLDPELASIQVTHVEPFFNEDEELERHSMFERQYNISKFMLETPFVKMNHVEHESRWKKYKEHDIDGVLKSKQTDDLSIQWKRRTILTVEASFPHLKRRLEVISIKEIDFSPIERAIDEIQLKNRQ-LAMHLAYXXXXXXXXXXXXXXXXXXXXXVGSSQTRANNIPL-LMDMHMSGALLPQVNQGPMAYARVFLHKETQANYSQ--EKVKQLK 7414
            L +++   FD G +WE    + K +   YE +  DYEQL+++ +  +  Y KI   +  N R    Y+ V  YG  F + L  KVF++R   G ++   RE+ +      +   +         D  +       +Q   V+P   E  +        +  N+ + ++   F K NHV   S  + +++ + D        ++ +  W  RTI       P + R  E     +++ SP+E AI+ + + N + L M L ++ +                           N+P+  + M +SG + P V  G   Y + F + + +  + +  EK+++LK
Sbjct:  211 LYQDIIKYFDDGKMWEEAIVLCKELAEQYEMEIFDYEQLSQLLQKQALFYQKIINIK--NPRPKRDYFSVGYYGYRFPTFLRNKVFVHR---GGEY-ERREDFEMRIMTMFPNAEKMKTTSPPGDDIRNASGQQDVQCFTVQPILEEQPQF-------KGKNVPESLMS--FYKNNHVHKFSYSRPFRKGEKD------PDNEFATMWIERTIFVTAYKLPGILRWFETNRYLQVEISPLENAIEAMGIANDEILTMVLQHHNNP--------------------------NLPINPLSMRLSGIVDPAVMGGLANYEKAFFNDKYEKEHPEDYEKLEKLK 504          
BLAST of Dedicator of cytokinesis vs. Ensembl Nematostella
Match: EDO44372 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RW14])

HSP 1 Score: 269.24 bits (687), Expect = 4.274e-72
Identity = 187/624 (29.97%), Postives = 310/624 (49.68%), Query Frame = 2
Query: 5621 FVSTFAKVLFANCHNVISDLSLHTLRFLDTRFTSVRIEACGFLYRMMRSSYDTFNKPGINRVHLQMIVAVSKLDRTVGIRFKESLNYLKRLAEIEMXXXXXXXXXXXXXGTPTGTSKSITIGVHSTTKLSMQTFFEEVTDLTQRIRTVLMATVQMNEHVDDPEMQVDLQYSLAKSYSSNPALRRTWLEKIYAIHNKNNSRAEMAMCKAHIVAMIVEYLRRKEQ---YSMSCANFKAISPNIPLEESGMRDD----SVQLEVHYTKEEVVKLLRELAHEFDAGCLWEVLRHVYKLVIPIYERKRDYEQLAEIYKHMSDGYNKIKTAESTNQRIIGSYYRVVLYGKPFDSLAGKVFIYRLDSGKQFCVVREELQKLFSKKYGAGKVQMLVE-NHIDRSKLDPELASIQVTHVEPFFNEDEELERHSMFERQYNISKFMLETPFVKMNHVEHESRWKKYKEHDIDGVLKSKQTDDLSIQWKRRTILTVEASFPHLKRRLEVISIKEIDFSPIERAIDEIQLKNRQLAMHLAYXXXXXXXXXXXXXXXXXXXXXVGSSQTRANNIPLLMDMHMSGALLPQVNQGPMAYARVFLHKETQANYSQEKVKQ--------LKIQFMEFLTLC 7444
             +  F ++LF     + +DL    L    +   ++R +A   LY +MR +++  N     RV +Q+ +++S L   VG     S   L+R                        + K+I     S  +L   TF E+V +L   +  +L  TV+M E  +DPEM VDL Y +AK Y ++P LR TWL  + A H +  +  E A+C  H  A++ EYL   E      + C  F+ ISPN+ LEES + DD     +    ++++  ++ LL + A +F    ++E    VYKL+IPI E +R+Y++LA ++  +S+ + KI   E   +R++G+Y+RV  YG  F  L G+ ++Y+  +  +   +   LQ  +  K+G   V+++ + N +DR KLDP LA IQ+T+VEPFF+E E  +R + F++ YN+  +      ++   V ++  + ++  +        K   DL  Q+KR+TILTV  SFP+LK R+ V+  ++I  SPIE AI+++Q +  +L                           + S    A     ++ M + G++   VNQGP+  A VFLH +T A+   +   Q        L++ F EF+  C
Sbjct: 1503 LIVKFPELLFEEDTELCADLCNRLLNHCSSSIGAIRAQASASLYLLMRQNFEIGN--NFARVKMQVTMSLSTL---VGTSHVFSEECLRR------------------------SLKTIITYAESDHELKNTTFPEQVRELVFNLHMILSDTVKMKEFQEDPEMLVDLMYRIAKGYQNSPDLRLTWLHNMAAKHGELKNDVEAALCIVHAAALVSEYLSMMEDKRFLPVGCVAFEKISPNV-LEESAVSDDVDEEGICTGKYFSENGLIGLLEQAAIKFMDAQMFECTNEVYKLLIPILEARREYDKLAMVHSKISEAFKKIIQTE--GKRMMGTYFRVGFYGSKFGDLDGEEYVYKEPAITKLPEISHRLQAFYGDKFGEEFVEVIKDSNAVDRDKLDPNLAYIQLTYVEPFFDEYEMKDRKTYFDKNYNLRTYSPYGHKLQPTCVPYKLAFGRFL-YVTPFTPSGKARGDLCNQYKRKTILTVANSFPYLKTRVSVMHREQIVLSPIEVAIEDMQNRTHEL------------------------YNAIYSHSPDAK----MLQMVLQGSIGTTVNQGPLEIAIVFLHSDTNADDEPDLEPQVFNRHHHKLRLSFKEFMKRC 2065          

HSP 2 Score: 100.523 bits (249), Expect = 8.598e-21
Identity = 60/188 (31.91%), Postives = 102/188 (54.26%), Query Frame = 2
Query: 2300 LESSQHKSFDYSD---HDINYYENINQEELVAPNLDFIHTLYIYPRTLNFSNQNVFHRARNLSCFVELRDVDKSDAPPLKVFYSRPSRKQPAFDYWSNTSVIYHDSSPTFNEEIKIALPLNLHSKHHLLFRFYHVSCDTAAIPNVREKGSNKKSLETPVGVTWLTLMDQNLNLKSGSFSLPVATQLVP 2854
            L SS H+   Y D         E     E+ +P + + + LYIYP+++NFS++     ARN++C V++    + +   ++  + + S    + + +  T V YH+ +P FNEEIK+  P +L  +HH+LF FYH+SC     P       ++K +ETP+G TW+ ++ ++  L  G F+LPV+    P
Sbjct:  563 LTSSLHQVHPYPDGQGRPTKEIEEFAPREVFSPFVIYENLLYIYPQSVNFSSRGT--SARNIACKVQIMS-GEDEQNCIECIFGKSSCASMSKEAY--THVTYHNRTPDFNEEIKVKCPAHLTDQHHILFTFYHISCSPGKKP-------DEKEVETPIGYTWIPML-KDGRLALGEFNLPVSLDKPP 737          

HSP 3 Score: 77.411 bits (189), Expect = 9.270e-14
Identity = 69/260 (26.54%), Postives = 117/260 (45.00%), Query Frame = 2
Query: 3743 YSIITKSMIQSLTKQSKITIDKGGDKFF---STSYMDSLQNMIHLIINCILEITSTVGNQSGMNGQLRPNNSFQSLATSANKDLARFISRLFNVMDRGFIFQIIHQYMKIFIARINAYSGHREHLCRMKFDFLEIVTNHEHYLPLNLL--KIINPSDKGQSVRKRQ-----------APPSLELILSETYCRQHYLAGLLLQEVHRQMSDVYSHNAVRRLPFVMLRNLLAKHLFDDRYSSINMQARIAALYLPLVSIILE 4474
            + ++ KSM Q L            DKFF    T + D     +  ++N  +        Q  +N Q    N F ++    N  L  F+  L + +DRGF+F+++  Y K  + + + +S     L +++ + L IV +HEHY+ LNL     + PS+                     P S    LS  + +QH+L GLLL E+   +     +  ++      +R+LLA H  D R+     + R+AALYLPL+ ++++
Sbjct: 1021 FEVMIKSMAQHLDNT---------DKFFWPRKTRFPDQFLGDLRALVNTTV--------QEIVNKQ----NDF-AVVQDLNSSLGFFLYDLLSFIDRGFVFELLKNYCKEMLYQGSLHSS----LGQLRLELLRIVCSHEHYVTLNLPYPTSLYPSEPSSPTTSLSSLSSTTSGDTLTPGSSMAELSVAFRQQHFLVGLLLSELAMALEGCDFN--LQSQAIDTIRDLLACHDSDTRFDDPVCRRRVAALYLPLLGVVID 1252          
BLAST of Dedicator of cytokinesis vs. Ensembl Nematostella
Match: EDO28844 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T5C0])

HSP 1 Score: 61.6178 bits (148), Expect = 4.810e-11
Identity = 38/121 (31.40%), Postives = 67/121 (55.37%), Query Frame = 2
Query: 4112 RMKFDFLEIVTNHEHYLPLNLLKIINPSDKGQSVRKRQAPPSLELILSETYCRQHYLAGLLLQEVHRQMSDVYSHNAVRRLPFVMLRNLLAKHLFDDRYSSINMQARIAALYLPLVSIILE 4474
            +++ + L IV +HEHY+ LNL    + +  G ++     P S    LS  + +QH+L GLLL E+   +   ++   ++      +R+LLA H  D R+     + R+AALYLPL+ ++++
Sbjct:    1 QLRLELLRIVCSHEHYVTLNLPYPTSLTTSGDTL----TPGSSMAELSVAFRQQHFLVGLLLSELAMALEGDFN---LQSQAIDTIRDLLACHDSDTRFDDPVCRRRVAALYLPLLGVVID 114          
BLAST of Dedicator of cytokinesis vs. Ensembl Nematostella
Match: EDO33582 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRV1])

HSP 1 Score: 53.9138 bits (128), Expect = 4.785e-9
Identity = 26/56 (46.43%), Postives = 37/56 (66.07%), Query Frame = 2
Query: 4007 FNVMDRGFIFQIIHQYMKIFIARINAYSGHREHLCRMKFDFLEIVTNHEHYLPLNL 4174
            F  MDRGF+FQ+I  Y + F    ++ +  RE     KF+FL+++ NHEHY+PLNL
Sbjct:    4 FTYMDRGFVFQMISYYSEQFK---DSDTQMRE----FKFEFLQVICNHEHYIPLNL 52          
BLAST of Dedicator of cytokinesis vs. Ensembl Nematostella
Match: EDO34830 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN49])

HSP 1 Score: 53.1434 bits (126), Expect = 4.081e-8
Identity = 30/99 (30.30%), Postives = 54/99 (54.55%), Query Frame = 2
Query: 7301 MSGALLPQVNQGPMAYARVFLHKETQANYSQEKVKQLKIQFMEFLTLCYLLLRDFNELMSHIQQQKYIAMREALDSYRVELSNLINEEICVFEDISVIS 7597
            + G++  QVN GP+AYA+ FL K     +  + +++L+  + EFL  C   L   N+L+   Q+  +  M+E     R EL+  I+EE+ +   I++ +
Sbjct:   12 LHGSVSVQVNAGPLAYAQAFLDKTVCHKHPGKHIERLQNVYREFLKFCGKALEINNQLIKEDQRMYHDDMKEKYGLLRTELAKYIDEEVNIRISITIAT 110          
BLAST of Dedicator of cytokinesis vs. Ensembl Nematostella
Match: EDO28495 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T6B0])

HSP 1 Score: 49.2914 bits (116), Expect = 6.776e-7
Identity = 29/92 (31.52%), Postives = 49/92 (53.26%), Query Frame = 2
Query: 7322 QVNQGPMAYARVFLHKETQANYSQEKVKQLKIQFMEFLTLCYLLLRDFNELMSHIQQQKYIAMREALDSYRVELSNLINEEICVFEDISVIS 7597
            QVN GP+AYA+ FL K     +  + +++L+  + EFL  C   L   N+L+   Q+     M+E     R EL+  I+EE+ +   I++ +
Sbjct:    2 QVNAGPLAYAQAFLDKTVCHKHPGKHIERLQNVYREFLKFCGKALEINNQLIKEDQRMYQDDMKEKYGLLRTELAKYIDEEVNIRISITIAT 93          
BLAST of Dedicator of cytokinesis vs. Ensembl Medaka
Match: dock10 (dedicator of cytokinesis 10 [Source:NCBI gene;Acc:101166322])

HSP 1 Score: 396.356 bits (1017), Expect = 7.858e-111
Identity = 251/748 (33.56%), Postives = 373/748 (49.87%), Query Frame = 2
Query: 5420 LEGNVSTEVGLIVLDVLSAYCSAFKQEILTYTPDHVIFKKIVDIYLTLLSVNQSEIVLKHVFVSMRVFVSTFAKVLFANCHNVISDLSLHTLRFLDTRFTSVRIEACGFLYRMMRSSYDTFNKPGINRVHLQMIVAVSKLDRTVGI---RFKESLNYLKRLAEIEMXXXXXXXXXXXXXGTPTGTSKSITIGVHSTTKLSMQTFFEEVTDLTQRIRTVLMATVQMNEHVDDPEMQVDLQYSLAKSYSSNPALRRTWLEKIYAIHNKNNSRAEMAMCKAHIVAMIVEYLRRK--------------------------EQYSMSCANFKAISPNIPLEESGMRDDSVQLEVHYTKEEVVKLLRELAHEFDAGCLWEVLRHVYKLVIPIYERKRDYEQLAEIYKHMSDGYNKIKTAESTNQRIIGSYYRVVLYGKP-FDSLAGKVFIYRLDSGKQFCVVREELQKLFSKKYGAGKVQMLVE-NHIDRSKLDPELASIQVTHVEPFFNEDEELERHSMFERQYNISKFMLETPFVKMNHVEHESRWKKYKEHDIDGVLKSKQTDDLSIQWKRRTILTVEASFPHLKRRLEVISIKEIDFSPIERAIDEIQLKNRQLAMHLAYXXXXXXXXXXXXXXXXXXXXXVGSSQTRANNIPLL-MDMHMSGALLPQVNQGPMAYARVFLHKETQANYSQEKVKQLKIQFMEFLTLCYLLLRDFNELMSHIQQQKYIAMREALDSYRVELSNLINEEI 7567
            +E N+STEV L VLDVL  +    K+++L     + + KK++D YL    +NQS   L+HVF ++R+FV  F    F    ++   L    L+  + R +S + EA   LY  MR +++      I R HLQ+I AVS+L    GI   RF++SL  +   A                               +  T L   +F  EV DLT+RIRTVLMAT QM EH  DPEM VDLQYSLA SY+S P LRRTWLE +  IH +N   +E AMC  HI A+I E L+R+                            +SM  A F  ISPN+  EE  M++D+   +  YT++ +V+ L +          +E++  + K VI ++E++RD+++L+E+Y  +   Y K+       +R+ G YYRV  YG+  FD    K FIY+         V + L KL+S K+GA  V+M+ + N ++   LDP+ A IQVT+V P+F+E E+ ++ + FER +NIS+F+ ETPF                       L  K+  D+  Q KRRTILT  +SFP+LK+R+EV+  +  + +PIE AIDE+  K  +L                             +       + ++ + + + G++  +VN GPMAYAR FL ++    Y   +VK LK  F +F   C   L   + L+   Q +    MR       +ELS ++NE++
Sbjct: 1317 IEANLSTEVALTVLDVLELFVHHHKKQLLLDDGQNTLMKKVLDTYLLFFQINQSTATLRHVFAALRLFVQKFPSAFFQGKADLCGCLCSEILKCCNHRSSSTQTEAAALLYFFMRQNFEFTKGKSIVRSHLQVIKAVSQLIADAGIGGSRFQQSLAIINNFA-------------------------------NGDTPLKNTSFPAEVKDLTKRIRTVLMATAQMKEHEKDPEMLVDLQYSLANSYASTPELRRTWLESMAKIHVRNGDLSEAAMCYIHISALIAESLKRRGYWRADKARMSIVSPEENPSFLFKTSASFSMGWAAFLCISPNVQ-EEGAMKEDTGTQDTPYTEDTLVEQLEQCVDYLWKSERYELIADINKPVIAVFEKRRDFKRLSELYYDIHRSYLKVTEVVDAEKRLFGRYYRVAFYGQGFFDEEESKEFIYKEPKLTGLSEVSQRLLKLYSDKFGADNVKMIQDSNKVNPKDLDPKFAYIQVTYVVPYFDEKEQHDKRTDFERHHNISRFVFETPF----------------------TLSGKKHGDVEEQCKRRTILTTSSSFPYLKKRIEVVEQQSTEMNPIEVAIDEMSRKVSEL-----------------------------NQLCNMEEVDMIRLQLKLQGSVSVKVNAGPMAYARAFLEEKNAKKYPDNQVKLLKEIFRQFAEACGQALDVNDRLIKEDQLEYQEEMRAHYRDMLIELSGIMNEQV 1981          

HSP 2 Score: 132.494 bits (332), Expect = 5.284e-30
Identity = 67/179 (37.43%), Postives = 102/179 (56.98%), Query Frame = 2
Query: 2360 NINQEELVAPNLDFIH-------TLYIYPRTLNFSNQNVFHRARNLSCFVELRDVDKSDAPPLKVFYSRPSRKQPAFDYWSNTSVIYHDSSPTFNEEIKIALPLNLHSKHHLLFRFYHVSCDTAAIPNVREKGSNKKSLETPVGVTWLTLMDQNLNLKSGSFSLPVATQLVPDYLEEKQ 2875
            ++  EE V   + F          +Y+YP+ L + +Q  F +ARN++  VE R  D+  A PLK  Y +P    P F   + ++V++H  +P F +E+KI LP  LH KHHLLF FYH++CD  A  N +     K++LETPVG +WL ++ +   + S  F++PV+  L P YL  K+
Sbjct:  566 SVEVEEFVQDTIKFTQPYRVYKNQIYVYPKHLKYDSQKSFAKARNITVCVEFRSSDEEVAKPLKCIYGKPG--GPVFTTAAFSTVLHHSQNPDFYDEVKIELPTQLHEKHHLLFYFYHITCDINAKTNAKR----KEALETPVGYSWLPILKEG-RMSSQEFNIPVSCNLPPGYLAIKE 737          

HSP 3 Score: 116.316 bits (290), Expect = 3.606e-25
Identity = 87/252 (34.52%), Postives = 127/252 (50.40%), Query Frame = 2
Query: 3743 YSIITKSMIQSLTKQSKITIDKGGDKFFSTSYMDSLQNMIHLIINCILEITSTVGNQSGMNGQLRPNNSFQSLATSANKDLARFISRLFNVMDRGFIFQIIHQYMKIFIARINAYSGHREHLCRMKFDFLEIVTNHEHYLPLNL-LKIINPSDKGQSVRKRQAPPSLELILSETYCRQHYLAGLLLQEVHRQMSDVYSHNAVRRLPFVMLRNLLAKHLFDDRYSSINMQARIAALYLPLVSIILENQKSFSL 4495
            + +I KSM Q L    K T+ +   + F +SY+  ++ ++  +   I      +  ++                 SAN  +A F+ R F +MDRGF F++I  Y+ +  A  N        LC +KFDFL  V NHEHY+PL+L L     + K  S+    A    E  L+  +CR+H+L GLLL+E+   + D      +R L    L+NL+AKH  D RY     QARIA+LYLPL  +IL+N   F L
Sbjct:  879 FELIIKSMAQHLADSEKATLPR--PQRFPSSYLSRVETLVETVSEHIFWKYKELVEET----------------RSANMAVAAFVKRCFTLMDRGFTFKLISNYINMITAADNKV------LCELKFDFLRDVCNHEHYIPLSLPLPSARITGKLISMPPFTAVSVPEYNLTGEFCRKHFLTGLLLRELGLALQD---EQDLRHLALATLKNLMAKHSLDARYEK---QARIASLYLPLYGLILDNMPRFFL 1100          

HSP 4 Score: 70.4774 bits (171), Expect = 3.452e-11
Identity = 84/328 (25.61%), Postives = 130/328 (39.63%), Query Frame = 2
Query:  941 ERSEETVHGMLSKFLQENEQSAVILRKKDHQKILVIYSEIRNQIKMKSQQTPIYDIGIIEKSQLDDCHIRPQVEQSIPKTFIKLTANRFITSVGISDENSNPKGVIPAEPFFISFSLFHIADGRRISEEFYWNPNRPQIEDLLPSDLFAYKFGGHPVHATINGNCDNRTPLNLPTMSDRVLQSTNSFILKVPCLPD-KICLFIKSEKVFSGAIGPTVDKYIKSGGSLLKKKDREEELFVENPDVKTGASINKTMSVYCANIGHYRMPFGWTACRLNIKGKNCL----RF---HKYENNKTSEDDIIKLVQNMSSQHVDNNASKYTTIP 1900
            E +E  ++  L+K++ E +     LR    ++ L ++S            TP+      E S  D+  + P  E+ + + F+    +  +   G   E  N   V   EPFF+S +L  + +GRR+S +F+ + N   +  ++     A    G  V +  NG C           S  +   TN         P+  I +  K EKV  G I    + YIK+  S                  KT   I K+   +C+ +G YRMPF W+   +       L    RF    K E+NK S DD+IKLV            SK  T+P
Sbjct:  255 ETTENGINPELAKYISETDDK---LRSARREERLNLFS--------LDPDTPVLRSPRNEHSSSDNKPVGP-FEEKLGRRFMITCKSLNLMLQGCVTETEN-GPVTNIEPFFVSLALLDVREGRRVSADFHVDLNHEAVRQMIGGCNSATGSSGPGVGSQENGLC-----------SPAIFSVTN---------PNTDIVMVAKIEKVLMGNITCGTEPYIKNTDS-----------------SKTVQKIIKSNKQFCSKLGKYRMPFAWSVRYVFKDNHGTLDRESRFSPLFKQESNKISTDDLIKLVTEYKRAE---KTSKLQTVP 529          
BLAST of Dedicator of cytokinesis vs. Ensembl Medaka
Match: dock9b (dedicator of cytokinesis 9b [Source:ZFIN;Acc:ZDB-GENE-090916-2])

HSP 1 Score: 358.992 bits (920), Expect = 2.090e-106
Identity = 237/760 (31.18%), Postives = 381/760 (50.13%), Query Frame = 2
Query: 5420 LEGNVSTEVGLIVLDVLSAYCSAFKQEILTYTPDHVIFKKIVDIYLTLLSVNQSEIVLKHVFVSMRVFVSTFAKVLFANCHNVISDLSLHTLRFLDTRFTSVRIEACGFLYRMMRSSYDTFNKPGINRVHLQMIVAVSKL-DRTVGI---RFKESLNYLKRLAEIEMXXXXXXXXXXXXXGTPTGTSKSITIGVHSTTKLSMQTFFEEVTDLTQRIRTVLMATVQMNEHVDDPEMQVDLQYSLAKSYSSNPALRRTWLEKIYAIHNKNNSRAEMAMCKAHIVAMIVEYLRRKEQYSM----------------------SCANFKAISPNIPLEESGMRDDSVQLEVHYTKEEVVKLLRELAHEFDAGCLWEVLRHVYKLVIPIYERKRDYEQLAEIYKHMSDGYNKIKTAESTNQRIIGSYYRVVLYGKP-FDSLAGKVFIYRLDSGKQFCVVREELQKLFSKKYGAGKVQMLVEN-HIDRSKLDPELASIQVTHVEPFFNEDEELERHSMFERQYNISKFMLETPFVKMNHVEHESRWKKYKEHDIDGVLKSKQTDDLSIQWKRRTILTVEASFPHLKRRLEVISIKEIDFSPIERAIDEIQLKNRQLAMHLAYXXXXXXXXXXXXXXXXXXXXXVGSSQTRANNIPLL-MDMHMSGALLPQVNQGPMAYARVFLHKETQANYSQEKVKQLKIQFMEFLTLCYLLLRDFNELMSHIQQQKYIAMREALDSYRVELSNLINEEICVFEDISVISTSALS 7612
            LE NVSTEV L VLD LS +   FK ++ +    + + KK+  ++L  L + QSE+ LK VF S+R F+  F    F    ++ + L    L+  +++ +S+R +A   LY +M+S++D   +    R HLQ+++AVS+L    +GI   RF++SL+ +   A                               +S   +    F  +V DLT+RIRTVLMAT QM +H +DPEM VDLQYSLAKSY+S P LR+TWL+ +  IHNKN+  +E AMC  H+ A++ EYL RK ++ +                       C+ F+ I+PNI  EE+ M +D    +VH+ +E +++LL E A        +E++  VYKL+IPIYE++RD+E+L  +Y  +   Y K+     T +R++G+++RV  +G+  F+   GK +IY+         V + L KL+S K+G   V+++ ++  ++   LD + A IQVTHV P+ ++ E  +R + FE+ +NI +F+ ETPF                       +  K+   +  Q KRRTILT    FP++K+R+ V+   + D SPIE AIDE+  K  +L +  +                             A+ + ++ + + + G++  QV   P A                  VK      M+F+  C   L     L+   Q + +  M+ +      ELSN+++E++C F D   +   AL+
Sbjct:   36 LEANVSTEVCLTVLDTLSVFIMGFKTQLTSDLGHNPLMKKVFQVHLCFLQIPQSEVALKQVFTSLRTFIYKFPCTFFDGRADMCACLCYEILKCCNSKLSSIRGDAAHLLYFLMKSNFDYTGRRSFVRTHLQVVIAVSQLIADVIGIGSTRFQQSLSIVNNCA-------------------------------NSDKNIKHTAFPSDVKDLTKRIRTVLMATEQMKDHENDPEMLVDLQYSLAKSYTSTPELRKTWLDSMARIHNKNSDLSEAAMCYVHVAALVAEYLWRKGEFRICLRRTLRRFGRSQKKTWGMFRQGCSAFRVITPNID-EEAAMMEDVGMQDVHFNEEVLLELLEECADGLWKAERYELIADVYKLIIPIYEQRRDFEKLTHLYDTLHRAYTKVMEVMHTGKRLLGTFFRVAFFGQGFFEDEDGKEYIYKEPKFTPLSEVSQRLLKLYSDKFGQENVKIIQDSGKVNPKDLDSKFAYIQVTHVTPYLDDKELEDRKTDFEKSHNIRRFVFETPF----------------------TVSGKKQGGVEEQCKRRTILTTTHCFPYVKKRIPVMYQHQTDLSPIEVAIDEMSCKVAELRLLCS-----------------------------ASEVDMIRLQLKLQGSISVQVQDRPFAV-----------------VKSTDTHRMQFVDACGHGLGVNERLIKEDQHEYHDEMKASYRDLTRELSNIMHEQVC-FSDFKDVWVRALT 694          
BLAST of Dedicator of cytokinesis vs. Ensembl Medaka
Match: dock9b (dedicator of cytokinesis 9b [Source:ZFIN;Acc:ZDB-GENE-090916-2])

HSP 1 Score: 324.324 bits (830), Expect = 1.175e-96
Identity = 192/545 (35.23%), Postives = 299/545 (54.86%), Query Frame = 2
Query: 5987 VHSTTKLSMQTFFEEVTDLTQRIRTVLMATVQMNEHVDDPEMQVDLQYSLAKSYSSNPALRRTWLEKIYAIHNKNNSRAEMAMCKAHIVAMIVEYLRRKEQYSMSCANFKAISPNIPLEESGMRDDSVQLEVHYTKEEVVKLLRELAHEFDAGCLWEVLRHVYKLVIPIYERKRDYEQLAEIYKHMSDGYNKIKTAESTNQRIIGSYYRVVLYGKP-FDSLAGKVFIYRLDSGKQFCVVREELQKLFSKKYGAGKVQMLVEN-HIDRSKLDPELASIQVTHVEPFFNEDEELERHSMFERQYNISKFMLETPFVKMNHVEHESRWKKYKEHDIDGVLKSKQTDDLSIQWKRRTILTVEASFPHLKRRLEVISIKEIDFSPIERAIDEIQLKNRQLAMHLAYXXXXXXXXXXXXXXXXXXXXXVGSSQTRANNIPLL-MDMHMSGALLPQVNQGPMAYARVFLHKETQANYSQEKVKQLKIQFMEFLTLCYLLLRDFNELMSHIQQQKYIAMREALDSYRVELSNLINEEICVFEDISVISTSALS 7612
             +S   +    F  +V DLT+RIRTVLMAT QM +H +DPEM VDLQYSLAKSY+S P LR+TWL+ +  IHNKN+  +E AMC  H+ A++ EYL RK  +   C+ F+ I+PNI  EE+ M +D    +VH+ +E +++LL E A        +E++  VYKL+IPIYE++RD+E+L  +Y  +   Y K+     T +R++G+++RV  +G+  F+   GK +IY+         V + L KL+S K+G   V+++ ++  ++   LD + A IQVTHV P+ ++ E  +R + FE+ +NI +F+ ETPF                       +  K+   +  Q KRRTILT    FP++K+R+ V+   + D SPIE AIDE+  K  +L +  +                             A+ + ++ + + + G++  QVN GP+AYAR FL   +   Y   KVKQLK  F +F+  C   L     L+   Q + +  M+ +      ELSN+++E++C F D   +   AL+
Sbjct:   31 ANSDKNIKHTAFPSDVKDLTKRIRTVLMATEQMKDHENDPEMLVDLQYSLAKSYTSTPELRKTWLDSMARIHNKNSDLSEAAMCYVHVAALVAEYLWRKGMFRQGCSAFRVITPNID-EEAAMMEDVGMQDVHFNEEVLLELLEECADGLWKAERYELIADVYKLIIPIYEQRRDFEKLTHLYDTLHRAYTKVMEVMHTGKRLLGTFFRVAFFGQGFFEDEDGKEYIYKEPKFTPLSEVSQRLLKLYSDKFGQENVKIIQDSGKVNPKDLDSKFAYIQVTHVTPYLDDKELEDRKTDFEKSHNIRRFVFETPF----------------------TVSGKKQGGVEEQCKRRTILTTTHCFPYVKKRIPVMYQHQTDLSPIEVAIDEMSCKVAELRLLCS-----------------------------ASEVDMIRLQLKLQGSISVQVNAGPLAYARAFLDGSSAKKYPDNKVKQLKEVFRQFVDACGHGLGVNERLIKEDQHEYHDEMKASYRDLTRELSNIMHEQVC-FSDFKDVWVRALT 522          
BLAST of Dedicator of cytokinesis vs. Ensembl Medaka
Match: dock7 (dedicator of cytokinesis 7 [Source:NCBI gene;Acc:101155675])

HSP 1 Score: 315.079 bits (806), Expect = 1.301e-85
Identity = 213/732 (29.10%), Postives = 360/732 (49.18%), Query Frame = 2
Query: 5405 DHKAYLEGNVSTEVGLIVLDVLSAYCSAFKQEILTYTPDHVIFKKIVDIYLTLLSVNQSEIVLKHVFVSMRVFVSTFAKVLFANCHNVISDLSLHTLRFLDTRFTSVRIEACGFLYRMMRSSYDTFNKPGINRVHLQMIVAVSKLDRTVGIRFKESLNYLKRLAEIEMXXXXXXXXXXXXXGTPTGTSKSITIGVHSTTKLSMQTFFEEVTDLTQRIRTVLMATVQMNEHVDDPEMQVDLQYSLAKSYSSNPALRRTWLEKIYAIHNKNNSRAEMAMCKAHIVAMIVEYLRRKEQ---YSMSCANFKAISPNIPLEESGMRDDSVQLE-------VHYTKEEVVKLLRELAHEFDAGCLWEVLRHVYKLVIPIYERKRDYEQLAEIYKHMSDGYNKIKTAESTNQRIIGSYYRVVLYGKPFDSLAGKVFIYRLDSGKQFCVVREELQKLFSKKYGAGKVQMLVE-NHIDRSKLDPELASIQVTHVEPFFNEDEELERHSMFERQYNISKFMLETPFVKMNHVEHESRWKKYKEHDIDGVLKSKQTDDLSIQWKRRTILTVEASFPHLKRRLEVISIKEIDFSPIERAIDEIQLKNRQLAMHLAYXXXXXXXXXXXXXXXXXXXXXVGSSQTRANNIPLLMDMHMSGALLPQVNQGPMAYARVFLHKETQANYSQEKVKQLKIQFMEFLTLCYLLLRDFNELMSHIQQQKYIAMREALDSYRVELSNLINEEI 7567
            +H+A ++GN++TE  LI+LD L        Q +        I   ++ + L  ++ NQS + L+H F + R  VS F ++LF       +DL L  LR   +  +++R  A   LY +MR +++  N     RV +Q+ +++S L   VG     +  +L+R                        + K+I        +L   TF ++V DL   +  +L  TV+M EH +DPEM VDL Y +AK Y ++P LR TWL+ +   H++ N+ AE A C  H  A++ EYL   E      + C  F+ IS N+ LEES + DD V  +        ++T+  +V LL + A  F    ++E +  VYK++IPI+E  RD ++LA I+  + + ++KI    +  +R+ G+Y+RV  YG  F  L  + F+Y+  +  +   +   L+  + +++G  +V+++ + N +D+ KLDP  A IQ+T+VEP+F+  E  +R + F++ YN+ +F+  TPF                   +DG    +   DL  Q+KR+TILT   +FP++K R+ +I  +EI  +PIE AI+++Q K ++LA                            + Q  A+    ++ M + G++   VNQGP+  A+VFL +            +L++ F +F   C   LR    L+   Q++    +       +  L  LIN +I
Sbjct: 1436 EHEALIDGNLATEANLIILDTLEIVV----QTVSVTESKESILGGVLKVLLHSMACNQSALYLQHCFATQRALVSKFPELLFEEETEQCADLCLRLLRSCSSSISTIRSHASASLYLLMRQNFEIGN--NFARVKMQVTMSLSSL---VGTSQNFNEEFLRR------------------------SLKTILTYAEEDLELRETTFPDQVQDLVFNLHMILSDTVKMKEHQEDPEMLVDLMYRIAKGYQTSPDLRLTWLQNMAGKHSERNNHAEAAQCLVHSAALVAEYLSMLEDRKYLPVGCVTFQNISSNV-LEESAVSDDVVSPDEEGICSGKYFTEIGLVGLLEQAAACFSMAGMYEAVNEVYKVLIPIHEANRDAKKLATIHGKLQEAFSKIVHQSTGWERMFGTYFRVGFYGSKFSDLDEQEFVYKEPAITKLAEISHRLEGFYGERFGEDQVEVIKDSNPVDKCKLDPNKAFIQITYVEPYFDTYEMKDRITYFDKNYNLRRFVYCTPFT------------------LDG----RAHGDLHEQFKRKTILTTSHAFPYIKTRINIIHKEEIISTPIEVAIEDMQKKTQELAF--------------------------ATHQDPAD--AKMLQMVLQGSVGTTVNQGPLEVAQVFLSEIPSDPKLYRHHNKLRLCFKDFTKRCEDALRKNKSLIGPDQKEYQRELERNYHRLKEALQPLINRKI 2083          

HSP 2 Score: 101.293 bits (251), Expect = 1.406e-20
Identity = 60/163 (36.81%), Postives = 94/163 (57.67%), Query Frame = 2
Query: 2375 ELVAPNLDFIHTLYIYPRTLNFSNQNVFHRARNLSCFVE-LRDVDKSDAPPLKVFYSRPSRKQPAFDYWSN--TSVIYHDSSPTFNEEIKIALPLNLHSKHHLLFRFYHVSCDTAAIPNVREKGSNKKSLETPVGVTWLTLMDQNLNLKSGSFSLPVATQLVP 2854
            ++  PN  + + LY+ P++LNF+N+     ARN++  V+ +   D ++A P  V + + S      D++    T+V+YH+ SP F++EIKI LP +L   HH+LF FYHVSC          +      LETPVG TW+ ++ QN  L++G F LPV+ +  P
Sbjct:  549 DVYVPNTTYRNLLYVNPQSLNFANRQ--GSARNITVKVQFMNGEDPNNAMP--VIFGKSS----CADFFKEAYTAVVYHNRSPDFHDEIKIKLPASLSDHHHILFTFYHVSC----------QQKQNTPLETPVGYTWIPML-QNGRLRTGHFCLPVSLEKPP 692          

HSP 3 Score: 86.2705 bits (212), Expect = 4.492e-16
Identity = 58/187 (31.02%), Postives = 93/187 (49.73%), Query Frame = 2
Query: 3959 LATSANKDLARFISRLFNVMDRGFIFQIIHQYMKIFIARINAYSGHREHLCRMKFDFLEIVTNHEHYLPLNL--------------LKIINPSDKGQSVRKRQAPPSLELILSETYCRQHYLAGLLLQEVHRQMS-DVYSHNAVRRLPFVMLRNLLAKHLFDDRYSSINMQARIAALYLPLVSIILE 4474
            L    N  LA F++ L +VMDRGF+F +I  Y K    ++  Y+     L  ++ DFL IV +HEHY+ LNL              +        G S   +    +    LS  +  QH+L+GL+L E+   +  +      + +    ++ NLL+ H  D RY+ + ++AR+A LYLPL+ I++E
Sbjct: 1032 LVERLNTSLAFFLNDLLSVMDRGFVFTLIRAYWKQVSTKL--YALQNPTLESLRLDFLRIVCSHEHYVTLNLPCSLLTPPASPSPSVSSATSQSSGFSTHVQDQKIANMFELSAPFREQHFLSGLVLSELSLILDPENEGMFGLHKKVVSVVHNLLSSHDSDPRYADVEVKARVAMLYLPLIGIVME 1216          
BLAST of Dedicator of cytokinesis vs. Ensembl Medaka
Match: dock7 (dedicator of cytokinesis 7 [Source:NCBI gene;Acc:101155675])

HSP 1 Score: 314.694 bits (805), Expect = 1.369e-85
Identity = 213/732 (29.10%), Postives = 360/732 (49.18%), Query Frame = 2
Query: 5405 DHKAYLEGNVSTEVGLIVLDVLSAYCSAFKQEILTYTPDHVIFKKIVDIYLTLLSVNQSEIVLKHVFVSMRVFVSTFAKVLFANCHNVISDLSLHTLRFLDTRFTSVRIEACGFLYRMMRSSYDTFNKPGINRVHLQMIVAVSKLDRTVGIRFKESLNYLKRLAEIEMXXXXXXXXXXXXXGTPTGTSKSITIGVHSTTKLSMQTFFEEVTDLTQRIRTVLMATVQMNEHVDDPEMQVDLQYSLAKSYSSNPALRRTWLEKIYAIHNKNNSRAEMAMCKAHIVAMIVEYLRRKEQ---YSMSCANFKAISPNIPLEESGMRDDSVQLE-------VHYTKEEVVKLLRELAHEFDAGCLWEVLRHVYKLVIPIYERKRDYEQLAEIYKHMSDGYNKIKTAESTNQRIIGSYYRVVLYGKPFDSLAGKVFIYRLDSGKQFCVVREELQKLFSKKYGAGKVQMLVE-NHIDRSKLDPELASIQVTHVEPFFNEDEELERHSMFERQYNISKFMLETPFVKMNHVEHESRWKKYKEHDIDGVLKSKQTDDLSIQWKRRTILTVEASFPHLKRRLEVISIKEIDFSPIERAIDEIQLKNRQLAMHLAYXXXXXXXXXXXXXXXXXXXXXVGSSQTRANNIPLLMDMHMSGALLPQVNQGPMAYARVFLHKETQANYSQEKVKQLKIQFMEFLTLCYLLLRDFNELMSHIQQQKYIAMREALDSYRVELSNLINEEI 7567
            +H+A ++GN++TE  LI+LD L        Q +        I   ++ + L  ++ NQS + L+H F + R  VS F ++LF       +DL L  LR   +  +++R  A   LY +MR +++  N     RV +Q+ +++S L   VG     +  +L+R                        + K+I        +L   TF ++V DL   +  +L  TV+M EH +DPEM VDL Y +AK Y ++P LR TWL+ +   H++ N+ AE A C  H  A++ EYL   E      + C  F+ IS N+ LEES + DD V  +        ++T+  +V LL + A  F    ++E +  VYK++IPI+E  RD ++LA I+  + + ++KI    +  +R+ G+Y+RV  YG  F  L  + F+Y+  +  +   +   L+  + +++G  +V+++ + N +D+ KLDP  A IQ+T+VEP+F+  E  +R + F++ YN+ +F+  TPF                   +DG    +   DL  Q+KR+TILT   +FP++K R+ +I  +EI  +PIE AI+++Q K ++LA                            + Q  A+    ++ M + G++   VNQGP+  A+VFL +            +L++ F +F   C   LR    L+   Q++    +       +  L  LIN +I
Sbjct: 1406 EHEALIDGNLATEANLIILDTLEIVV----QTVSVTESKESILGGVLKVLLHSMACNQSALYLQHCFATQRALVSKFPELLFEEETEQCADLCLRLLRSCSSSISTIRSHASASLYLLMRQNFEIGN--NFARVKMQVTMSLSSL---VGTSQNFNEEFLRR------------------------SLKTILTYAEEDLELRETTFPDQVQDLVFNLHMILSDTVKMKEHQEDPEMLVDLMYRIAKGYQTSPDLRLTWLQNMAGKHSERNNHAEAAQCLVHSAALVAEYLSMLEDRKYLPVGCVTFQNISSNV-LEESAVSDDVVSPDEEGICSGKYFTEIGLVGLLEQAAACFSMAGMYEAVNEVYKVLIPIHEANRDAKKLATIHGKLQEAFSKIVHQSTGWERMFGTYFRVGFYGSKFSDLDEQEFVYKEPAITKLAEISHRLEGFYGERFGEDQVEVIKDSNPVDKCKLDPNKAFIQITYVEPYFDTYEMKDRITYFDKNYNLRRFVYCTPFT------------------LDG----RAHGDLHEQFKRKTILTTSHAFPYIKTRINIIHKEEIISTPIEVAIEDMQKKTQELAF--------------------------ATHQDPAD--AKMLQMVLQGSVGTTVNQGPLEVAQVFLSEIPSDPKLYRHHNKLRLCFKDFTKRCEDALRKNKSLIGPDQKEYQRELERNYHRLKEALQPLINRKI 2053          

HSP 2 Score: 101.293 bits (251), Expect = 1.425e-20
Identity = 60/163 (36.81%), Postives = 94/163 (57.67%), Query Frame = 2
Query: 2375 ELVAPNLDFIHTLYIYPRTLNFSNQNVFHRARNLSCFVE-LRDVDKSDAPPLKVFYSRPSRKQPAFDYWSN--TSVIYHDSSPTFNEEIKIALPLNLHSKHHLLFRFYHVSCDTAAIPNVREKGSNKKSLETPVGVTWLTLMDQNLNLKSGSFSLPVATQLVP 2854
            ++  PN  + + LY+ P++LNF+N+     ARN++  V+ +   D ++A P  V + + S      D++    T+V+YH+ SP F++EIKI LP +L   HH+LF FYHVSC          +      LETPVG TW+ ++ QN  L++G F LPV+ +  P
Sbjct:  549 DVYVPNTTYRNLLYVNPQSLNFANRQ--GSARNITVKVQFMNGEDPNNAMP--VIFGKSS----CADFFKEAYTAVVYHNRSPDFHDEIKIKLPASLSDHHHILFTFYHVSC----------QQKQNTPLETPVGYTWIPML-QNGRLRTGHFCLPVSLEKPP 692          

HSP 3 Score: 86.2705 bits (212), Expect = 4.592e-16
Identity = 58/187 (31.02%), Postives = 93/187 (49.73%), Query Frame = 2
Query: 3959 LATSANKDLARFISRLFNVMDRGFIFQIIHQYMKIFIARINAYSGHREHLCRMKFDFLEIVTNHEHYLPLNL--------------LKIINPSDKGQSVRKRQAPPSLELILSETYCRQHYLAGLLLQEVHRQMS-DVYSHNAVRRLPFVMLRNLLAKHLFDDRYSSINMQARIAALYLPLVSIILE 4474
            L    N  LA F++ L +VMDRGF+F +I  Y K    ++  Y+     L  ++ DFL IV +HEHY+ LNL              +        G S   +    +    LS  +  QH+L+GL+L E+   +  +      + +    ++ NLL+ H  D RY+ + ++AR+A LYLPL+ I++E
Sbjct: 1002 LVERLNTSLAFFLNDLLSVMDRGFVFTLIRAYWKQVSTKL--YALQNPTLESLRLDFLRIVCSHEHYVTLNLPCSLLTPPASPSPSVSSATSQSSGFSTHVQDQKIANMFELSAPFREQHFLSGLVLSELSLILDPENEGMFGLHKKVVSVVHNLLSSHDSDPRYADVEVKARVAMLYLPLIGIVME 1186          
BLAST of Dedicator of cytokinesis vs. Planmine SMEST
Match: SMESG000016476.1 (SMESG000016476.1)

HSP 1 Score: 4935.93 bits (12802), Expect = 0.000e+0
Identity = 2518/2541 (99.09%), Postives = 2523/2541 (99.29%), Query Frame = 2
Query:   41 MKKTVNSLKNKKIENNSSQIQIKCDNQQINISELVKPIDFESVYLQNKNNISNDPNRVLVKIPDNDVKINKVSRKETVYNNGVPTNIHEIFDCNLLAKLCVDFYTSEWTATCYKDFTYNSSFWTLPNVHNQLTMAKEQKFIIXXXXXXXXXXLLTFKTKGSYFESNLAICDRNAYQKHLKHREDELANTSSNAGINYSKAAVPELLSFSLNELSDGSTVLKESMPRDGHEQIIVYLDNVDSLRELGGYWILLSFKGKQSESYLFTGGNDNQKLWANKLKDAIESETKTKQIERPVSSESIERSEETVHGMLSKFLQENEQSAVILRKKDHQKILVIYSEIRNQIKMKSQQTPIYDIGIIEKSQLDDCHIRPQVEQSIPKTFIKLTANRFITSVGISDENSNPKGVIPAEPFFISFSLFHIADGRRISEEFYWNPNRPQIEDLLPSDLFAYKFGGHPVHATINGNCDNRTPLNLPTMSDRVLQSTNSFILKVPCLPDKICLFIKSEKVFSGAIGPTVDKYIKSGGSLLKKKDREEELFVENPDVKTGASINKTMSVYCANIGHYRMPFGWTACRLNIKGKNCLRFHKYENNKTSEDDIIKLVQNMSSQHVDNNASKYTTIPXXXXXXXXXXXXDKINNMTDVVNYELVGKSRSEFSNASSCCKEVKDFIFDIPKSGNAANHPGNTLRNTYNPDXXXXXXXXXXXXXXTASLQHYSDDNSPGDVTPPGKFNFSNSQIKSINQMKVNSSSLGRINGLESSQHKSFDYSDHDINYYENINQEELVAPNLDFIHTLYIYPRTLNFSNQNVFHRARNLSCFVELRDVDKSDAPPLKVFYSRPSRKQPAFDYWSNTSVIYHDSSPTFNEEIKIALPLNLHSKHHLLFRFYHVSCDTAAIPNVREKGSNKKSLETPVGVTWLTLMDQNLNLKSGSFSLPVATQLVPDYLEEKQQSIYYKKDSLWKLSTSFGQPKPRNSSTDKVIDESVNKRHSGPTFKSYINPRSSRDLEDIFSIKSDDVEQSHDTTVQWVDGQKSIFTVVIRPETTIFTQSTHLHKFFQVCSEKLDELTNPTVVEKKESIFTKPRSGSDPTTPKPVSDDTLLLQTSNKDVEIKNAIKALATVNVTNLIKFFAPTFNQLLHVVVCTAISHSEISKTAVTSMITLASSLRTPSMESLSSKATKRNTKIIKSYIKFAFDAEKIVPTKVKRTVHESLIQAISELIRPPFRDTXXXXXXXXXXXXXYSIITKSMIQSLTKQSKITIDKGGDKFFSTSYMDSLQNMIHLIINCILEITSTVGNQSGMNGQLRPNNSFQSLATSANKDLARFISRLFNVMDRGFIFQIIHQYMKIFIARINAYSGHREHLCRMKFDFLEIVTNHEHYLPLNLLKIINPSDKGQSVRKRQAPPSLELILSETYCRQHYLAGLLLQEVHRQMSDVYSHNAVRRLPFVMLRNLLAKHLFDDRYSSINMQARIAALYLPLVSIILENQKSFSLPGNLHTKVNLLNDIYDHSDRSLSARPLSTLSGDTLSTHSSINGSSGDGAGGSVYGLGFGTNSSKSARSSQVYLGKDGHVEDHWLKQIAGLTDGGNIRTLSTRRKXXXXXXXXXXXXXXXGLDEMHESGDTNSLDDEMVIHSKVPLNSESVVKRSSLQRPPVSNSNSWGRKAGLSLNIKKSVAPTHPSQRASILNKASNKNHETKSSIYLNDKTQKDIFVCLLHIFHTISSDDLKATICNLTVQERLEFLQLLILSIHHLKYQGRKVINNFESISTGCAKSKIQLRPHGPRSSVTAILDDVDHGDHKAYLEGNVSTEVGLIVLDVLSAYCSAFKQEILTYTPDHVIFKKIVDIYLTLLSVNQSEIVLKHVFVSMRVFVSTFAKVLFANCHNVISDLSLHTLRFLDTRFTSVRIEACGFLYRMMRSSYDTFNKPGINRVHLQMIVAVSKLDRTVGIRFKESLNYLKRLAEIEMXXXXXXXXXXXXXGTPTGTSKSITIGVHSTTKLSMQTFFEEVTDLTQRIRTVLMATVQMNEHVDDPEMQVDLQYSLAKSYSSNPALRRTWLEKIYAIHNKNNSRAEMAMCKAHIVAMIVEYLRRKEQYSMSCANFKAISPNIPLEESGMRDDSVQLEVHYTKEEVVKLLRELAHEFDAGCLWEVLRHVYKLVIPIYERKRDYEQLAEIYKHMSDGYNKIKTAESTNQRIIGSYYRVVLYGKPFDSLAGKVFIYRLDSGKQFCVVREELQKLFSKKYGAGKVQMLVENHIDRSKLDPELASIQVTHVEPFFNEDEELERHSMFERQYNISKFMLETPFVKMNHVEHESRWKKYKEHDIDGVLKSKQTDDLSIQWKRRTILTVEASFPHLKRRLEVISIKEIDFSPIERAIDEIQLKNRQLAMHLAYXXXXXXXXXXXXXXXXXXXXXVGSSQTRANNIPLLMDMHMSGALLPQVNQGPMAYARVFLHKETQANYSQEKVKQLKIQFMEFLTLCYLLLRDFNELMSHIQQQKYIAMREALDSYRVELSNLINEEICVFEDISVISTSALSDDVKRSLQKRSSQENGS 7663
            MKKTVNSLKNKKIENNSSQIQIKCDNQQINISELVKPIDFESVYLQNKNNISNDPNRVLVKIPDNDVKINKVSRKETVYNNGVPTNIHEIFDCNLLAKLCVDFYTSEWT TCYKDFTYNSSFWTLPNVHNQLTMAKEQKFIIDEDSEKDDESLLTFKTKGSYFESNLAICDRNAYQKHLKHREDELANTSSNAGINYSKAAVPELLSFSLNELSDGSTVLKESMPRDGHEQIIVYLDNVDSLRELGGYWILLSFKGKQSESYLFTGGNDNQKLWANKLKDAIESETKTKQIERPVSSESIERSEETVHGMLSKFLQENEQSAVILRKKDHQKILVIYSEIRNQIKMKSQQTPIYDIGIIEKSQLDDCHIRPQVEQSIPKTFIKLTANRFITSVGISDENSNPKGVIPAEPFFISFSLFHIADGRRISEEFYWNPNRPQIEDLLPSDLFAYKFGG+PVHATINGNCDNRTPLNLPTMSDRVLQSTNSFILKVPCLPDKICLFIKSEKVFSGAIGPTVDKYIKSGGSLLKKKDREEELFVENPDVKTGASINKTMSVYCANIGHYRMPFGWTACRLNIKGKNCLRFHKYENNKTSEDDIIKLVQNMSSQHVDNNASKYTTIPSFVELSFEELSEDKINNMTDVVNYELVGKSRSEFSNASSCCKEVKDFIFDIPKSGNAANHPGNTLRNTYNPDSLSLSSKPNSSYGSTASLQHYSDDNSPGDVTPPGKFNFSNSQIKSINQMKVNSSSLGRINGLESSQHKSFDYSDHDINYYENINQEELVAPNLDFIHTLYIYPRTLNFSNQNVFHRARNLSCFVELRDVDKSDAPPLKVFYSRPSRKQPAFDYWSNTSVIYHDSSPTFNEEIKIALPLNLHSKHHLLFRFYHVSCDTAAIPNVREKGSNKKSLETPVGVTWLTLMDQNLNLKSGSFSLPVATQLVPDYLEEKQQSIYYKKDSLWKLSTSFGQPKPRNSSTDKVIDESVNKRHSGPTFKSYINPRSSRDLEDIFSIKSDDVEQSHDTTVQWVDGQKSIFTVVIRPETTIFTQSTHLHKFFQVCSEKLDELTNPTVVEKKESIFTKPRSGSDPTTPKPVSDDTLLLQTSNKDVEIKNAIKALATVNVTNLIKFFAPTFNQLLHVVVCTAISHSEISKTAVTSMITLASSLRTPSMESLSSKATKRNTKIIKSYIKFAFDAEKIVP+KVKRTVHESLIQAISELIRPPFRDTNFVNSFLFNSFLFYSIITKSMIQSLTKQSKITIDKGGDKFFSTSYMDSLQNMIHLIINCILEITSTVGNQSGMNGQLRPNNSFQSLATSANKDLARFISRLFNVMDRGFIFQIIHQYMKIFIARINAYSGHREHLCRMKFDFLEIVTNHEHYLPLNLLKIINPSDKGQSVRKRQAPPSLELILSETYCRQHYLAGLLLQEVHRQMSDVYSHNAVRRLPFVMLRNLLAKHLFDDRYSS+NMQARIAALYLPLVSIILENQKSFSLPGNLHTKVNLLNDIYDHSDRSLSARPLSTLSGDTLSTHSSINGSSGDGAGGSVYGLGFGTNSSKSARSSQVYLGKDGHVEDHWLKQIAGLTDGGNIRTLSTRRKVDSDTSSVHSTSTLTGLDEMHESGDTNSLDDEMVIHSKVPLNSESVVKRSSLQRPPVSNSNSWGRKAGLSLNIKKSVAPTHPSQRASILNKASNKNHETKSSIYLNDKTQKDIFVCLLHIFHTISSDDLKATICNLTVQERLEFLQLLILSIHHLKYQGRKVINNFESISTGCAKSKIQLRPHGPRSSVTAILDDVDHGDHKAYLEGNVSTEVGLIVLDVLSAYCSAFKQEILTYTPDHVIFKKIVDIYLTLLSVNQSEIVLKHVFVSMRVFVSTFAKVLFANCHNVISDLSLHTLRFLDTRFTSVRIEACGFLYRMMRSSYDTFNKPGINRVHLQMIVAVSKLDRTVGIRFKESLNYLKRLAEIEMQKSQS+SINKSRSGTPTGTSKSITIGVHSTTKLSMQTFFEEVTDLTQRIRTVLMATVQMNEHVDDPEMQVDLQYSLAKSYSSNPALRRTWLEKIYAIHNKNNSRAEMAMCKAHIVAMIVEYLRRKEQYSMSCANFKAISPNIPLEESGMRDDSVQLEVHYTKEEVVKLLRELAHEFDAGCLWEVLRHVYKLVIPIYERKRDYEQLAEIYKHMSDGYNKIKTAESTNQRIIGSYYRVVLYG    SLAGKVFIYRLDSGKQFCVVREELQKLFSKKYGAGKVQMLVENHIDRSKLDPELASIQVTHVEPFFNEDEELERHSMFERQYNISKFMLETPFVKMN            +HDIDGVLKSKQTDDLSIQWKRRTILTVEASFPHLKRRLEVISIKEIDFSPIERAIDEIQLKNRQLAMHLAYNKSTTISKSSSSLAVSNSNQTVGSSQTRANNIPLLMDMHMSGALLPQVNQGPMAYARVFLHKETQANYSQEKVKQLKIQFMEFLTLCYLLLRDFNELMSHIQQQKYIAMREALDSYRVELSNLINEEI VFEDISVISTSALSDDVKRSLQKRSSQENGS
Sbjct:    1 MKKTVNSLKNKKIENNSSQIQIKCDNQQINISELVKPIDFESVYLQNKNNISNDPNRVLVKIPDNDVKINKVSRKETVYNNGVPTNIHEIFDCNLLAKLCVDFYTSEWTVTCYKDFTYNSSFWTLPNVHNQLTMAKEQKFIIDEDSEKDDESLLTFKTKGSYFESNLAICDRNAYQKHLKHREDELANTSSNAGINYSKAAVPELLSFSLNELSDGSTVLKESMPRDGHEQIIVYLDNVDSLRELGGYWILLSFKGKQSESYLFTGGNDNQKLWANKLKDAIESETKTKQIERPVSSESIERSEETVHGMLSKFLQENEQSAVILRKKDHQKILVIYSEIRNQIKMKSQQTPIYDIGIIEKSQLDDCHIRPQVEQSIPKTFIKLTANRFITSVGISDENSNPKGVIPAEPFFISFSLFHIADGRRISEEFYWNPNRPQIEDLLPSDLFAYKFGGNPVHATINGNCDNRTPLNLPTMSDRVLQSTNSFILKVPCLPDKICLFIKSEKVFSGAIGPTVDKYIKSGGSLLKKKDREEELFVENPDVKTGASINKTMSVYCANIGHYRMPFGWTACRLNIKGKNCLRFHKYENNKTSEDDIIKLVQNMSSQHVDNNASKYTTIPSFVELSFEELSEDKINNMTDVVNYELVGKSRSEFSNASSCCKEVKDFIFDIPKSGNAANHPGNTLRNTYNPDSLSLSSKPNSSYGSTASLQHYSDDNSPGDVTPPGKFNFSNSQIKSINQMKVNSSSLGRINGLESSQHKSFDYSDHDINYYENINQEELVAPNLDFIHTLYIYPRTLNFSNQNVFHRARNLSCFVELRDVDKSDAPPLKVFYSRPSRKQPAFDYWSNTSVIYHDSSPTFNEEIKIALPLNLHSKHHLLFRFYHVSCDTAAIPNVREKGSNKKSLETPVGVTWLTLMDQNLNLKSGSFSLPVATQLVPDYLEEKQQSIYYKKDSLWKLSTSFGQPKPRNSSTDKVIDESVNKRHSGPTFKSYINPRSSRDLEDIFSIKSDDVEQSHDTTVQWVDGQKSIFTVVIRPETTIFTQSTHLHKFFQVCSEKLDELTNPTVVEKKESIFTKPRSGSDPTTPKPVSDDTLLLQTSNKDVEIKNAIKALATVNVTNLIKFFAPTFNQLLHVVVCTAISHSEISKTAVTSMITLASSLRTPSMESLSSKATKRNTKIIKSYIKFAFDAEKIVPSKVKRTVHESLIQAISELIRPPFRDTNFVNSFLFNSFLFYSIITKSMIQSLTKQSKITIDKGGDKFFSTSYMDSLQNMIHLIINCILEITSTVGNQSGMNGQLRPNNSFQSLATSANKDLARFISRLFNVMDRGFIFQIIHQYMKIFIARINAYSGHREHLCRMKFDFLEIVTNHEHYLPLNLLKIINPSDKGQSVRKRQAPPSLELILSETYCRQHYLAGLLLQEVHRQMSDVYSHNAVRRLPFVMLRNLLAKHLFDDRYSSVNMQARIAALYLPLVSIILENQKSFSLPGNLHTKVNLLNDIYDHSDRSLSARPLSTLSGDTLSTHSSINGSSGDGAGGSVYGLGFGTNSSKSARSSQVYLGKDGHVEDHWLKQIAGLTDGGNIRTLSTRRKVDSDTSSVHSTSTLTGLDEMHESGDTNSLDDEMVIHSKVPLNSESVVKRSSLQRPPVSNSNSWGRKAGLSLNIKKSVAPTHPSQRASILNKASNKNHETKSSIYLNDKTQKDIFVCLLHIFHTISSDDLKATICNLTVQERLEFLQLLILSIHHLKYQGRKVINNFESISTGCAKSKIQLRPHGPRSSVTAILDDVDHGDHKAYLEGNVSTEVGLIVLDVLSAYCSAFKQEILTYTPDHVIFKKIVDIYLTLLSVNQSEIVLKHVFVSMRVFVSTFAKVLFANCHNVISDLSLHTLRFLDTRFTSVRIEACGFLYRMMRSSYDTFNKPGINRVHLQMIVAVSKLDRTVGIRFKESLNYLKRLAEIEMQKSQSTSINKSRSGTPTGTSKSITIGVHSTTKLSMQTFFEEVTDLTQRIRTVLMATVQMNEHVDDPEMQVDLQYSLAKSYSSNPALRRTWLEKIYAIHNKNNSRAEMAMCKAHIVAMIVEYLRRKEQYSMSCANFKAISPNIPLEESGMRDDSVQLEVHYTKEEVVKLLRELAHEFDAGCLWEVLRHVYKLVIPIYERKRDYEQLAEIYKHMSDGYNKIKTAESTNQRIIGSYYRVVLYG----SLAGKVFIYRLDSGKQFCVVREELQKLFSKKYGAGKVQMLVENHIDRSKLDPELASIQVTHVEPFFNEDEELERHSMFERQYNISKFMLETPFVKMN------------QHDIDGVLKSKQTDDLSIQWKRRTILTVEASFPHLKRRLEVISIKEIDFSPIERAIDEIQLKNRQLAMHLAYNKSTTISKSSSSLAVSNSNQTVGSSQTRANNIPLLMDMHMSGALLPQVNQGPMAYARVFLHKETQANYSQEKVKQLKIQFMEFLTLCYLLLRDFNELMSHIQQQKYIAMREALDSYRVELSNLINEEISVFEDISVISTSALSDDVKRSLQKRSSQENGS 2525          
BLAST of Dedicator of cytokinesis vs. Planmine SMEST
Match: SMESG000016476.1 (SMESG000016476.1)

HSP 1 Score: 4655.51 bits (12074), Expect = 0.000e+0
Identity = 2386/2408 (99.09%), Postives = 2391/2408 (99.29%), Query Frame = 2
Query:  440 MAKEQKFIIXXXXXXXXXXLLTFKTKGSYFESNLAICDRNAYQKHLKHREDELANTSSNAGINYSKAAVPELLSFSLNELSDGSTVLKESMPRDGHEQIIVYLDNVDSLRELGGYWILLSFKGKQSESYLFTGGNDNQKLWANKLKDAIESETKTKQIERPVSSESIERSEETVHGMLSKFLQENEQSAVILRKKDHQKILVIYSEIRNQIKMKSQQTPIYDIGIIEKSQLDDCHIRPQVEQSIPKTFIKLTANRFITSVGISDENSNPKGVIPAEPFFISFSLFHIADGRRISEEFYWNPNRPQIEDLLPSDLFAYKFGGHPVHATINGNCDNRTPLNLPTMSDRVLQSTNSFILKVPCLPDKICLFIKSEKVFSGAIGPTVDKYIKSGGSLLKKKDREEELFVENPDVKTGASINKTMSVYCANIGHYRMPFGWTACRLNIKGKNCLRFHKYENNKTSEDDIIKLVQNMSSQHVDNNASKYTTIPXXXXXXXXXXXXDKINNMTDVVNYELVGKSRSEFSNASSCCKEVKDFIFDIPKSGNAANHPGNTLRNTYNPDXXXXXXXXXXXXXXTASLQHYSDDNSPGDVTPPGKFNFSNSQIKSINQMKVNSSSLGRINGLESSQHKSFDYSDHDINYYENINQEELVAPNLDFIHTLYIYPRTLNFSNQNVFHRARNLSCFVELRDVDKSDAPPLKVFYSRPSRKQPAFDYWSNTSVIYHDSSPTFNEEIKIALPLNLHSKHHLLFRFYHVSCDTAAIPNVREKGSNKKSLETPVGVTWLTLMDQNLNLKSGSFSLPVATQLVPDYLEEKQQSIYYKKDSLWKLSTSFGQPKPRNSSTDKVIDESVNKRHSGPTFKSYINPRSSRDLEDIFSIKSDDVEQSHDTTVQWVDGQKSIFTVVIRPETTIFTQSTHLHKFFQVCSEKLDELTNPTVVEKKESIFTKPRSGSDPTTPKPVSDDTLLLQTSNKDVEIKNAIKALATVNVTNLIKFFAPTFNQLLHVVVCTAISHSEISKTAVTSMITLASSLRTPSMESLSSKATKRNTKIIKSYIKFAFDAEKIVPTKVKRTVHESLIQAISELIRPPFRDTXXXXXXXXXXXXXYSIITKSMIQSLTKQSKITIDKGGDKFFSTSYMDSLQNMIHLIINCILEITSTVGNQSGMNGQLRPNNSFQSLATSANKDLARFISRLFNVMDRGFIFQIIHQYMKIFIARINAYSGHREHLCRMKFDFLEIVTNHEHYLPLNLLKIINPSDKGQSVRKRQAPPSLELILSETYCRQHYLAGLLLQEVHRQMSDVYSHNAVRRLPFVMLRNLLAKHLFDDRYSSINMQARIAALYLPLVSIILENQKSFSLPGNLHTKVNLLNDIYDHSDRSLSARPLSTLSGDTLSTHSSINGSSGDGAGGSVYGLGFGTNSSKSARSSQVYLGKDGHVEDHWLKQIAGLTDGGNIRTLSTRRKXXXXXXXXXXXXXXXGLDEMHESGDTNSLDDEMVIHSKVPLNSESVVKRSSLQRPPVSNSNSWGRKAGLSLNIKKSVAPTHPSQRASILNKASNKNHETKSSIYLNDKTQKDIFVCLLHIFHTISSDDLKATICNLTVQERLEFLQLLILSIHHLKYQGRKVINNFESISTGCAKSKIQLRPHGPRSSVTAILDDVDHGDHKAYLEGNVSTEVGLIVLDVLSAYCSAFKQEILTYTPDHVIFKKIVDIYLTLLSVNQSEIVLKHVFVSMRVFVSTFAKVLFANCHNVISDLSLHTLRFLDTRFTSVRIEACGFLYRMMRSSYDTFNKPGINRVHLQMIVAVSKLDRTVGIRFKESLNYLKRLAEIEMXXXXXXXXXXXXXGTPTGTSKSITIGVHSTTKLSMQTFFEEVTDLTQRIRTVLMATVQMNEHVDDPEMQVDLQYSLAKSYSSNPALRRTWLEKIYAIHNKNNSRAEMAMCKAHIVAMIVEYLRRKEQYSMSCANFKAISPNIPLEESGMRDDSVQLEVHYTKEEVVKLLRELAHEFDAGCLWEVLRHVYKLVIPIYERKRDYEQLAEIYKHMSDGYNKIKTAESTNQRIIGSYYRVVLYGKPFDSLAGKVFIYRLDSGKQFCVVREELQKLFSKKYGAGKVQMLVENHIDRSKLDPELASIQVTHVEPFFNEDEELERHSMFERQYNISKFMLETPFVKMNHVEHESRWKKYKEHDIDGVLKSKQTDDLSIQWKRRTILTVEASFPHLKRRLEVISIKEIDFSPIERAIDEIQLKNRQLAMHLAYXXXXXXXXXXXXXXXXXXXXXVGSSQTRANNIPLLMDMHMSGALLPQVNQGPMAYARVFLHKETQANYSQEKVKQLKIQFMEFLTLCYLLLRDFNELMSHIQQQKYIAMREALDSYRVELSNLINEEICVFEDISVISTSALSDDVKRSLQKRSSQENGS 7663
            MAKEQKFIIDEDSEKDDESLLTFKTKGSYFESNLAICDRNAYQKHLKHREDELANTSSNAGINYSKAAVPELLSFSLNELSDGSTVLKESMPRDGHEQIIVYLDNVDSLRELGGYWILLSFKGKQSESYLFTGGNDNQKLWANKLKDAIESETKTKQIERPVSSESIERSEETVHGMLSKFLQENEQSAVILRKKDHQKILVIYSEIRNQIKMKSQQTPIYDIGIIEKSQLDDCHIRPQVEQSIPKTFIKLTANRFITSVGISDENSNPKGVIPAEPFFISFSLFHIADGRRISEEFYWNPNRPQIEDLLPSDLFAYKFGG+PVHATINGNCDNRTPLNLPTMSDRVLQSTNSFILKVPCLPDKICLFIKSEKVFSGAIGPTVDKYIKSGGSLLKKKDREEELFVENPDVKTGASINKTMSVYCANIGHYRMPFGWTACRLNIKGKNCLRFHKYENNKTSEDDIIKLVQNMSSQHVDNNASKYTTIPSFVELSFEELSEDKINNMTDVVNYELVGKSRSEFSNASSCCKEVKDFIFDIPKSGNAANHPGNTLRNTYNPDSLSLSSKPNSSYGSTASLQHYSDDNSPGDVTPPGKFNFSNSQIKSINQMKVNSSSLGRINGLESSQHKSFDYSDHDINYYENINQEELVAPNLDFIHTLYIYPRTLNFSNQNVFHRARNLSCFVELRDVDKSDAPPLKVFYSRPSRKQPAFDYWSNTSVIYHDSSPTFNEEIKIALPLNLHSKHHLLFRFYHVSCDTAAIPNVREKGSNKKSLETPVGVTWLTLMDQNLNLKSGSFSLPVATQLVPDYLEEKQQSIYYKKDSLWKLSTSFGQPKPRNSSTDKVIDESVNKRHSGPTFKSYINPRSSRDLEDIFSIKSDDVEQSHDTTVQWVDGQKSIFTVVIRPETTIFTQSTHLHKFFQVCSEKLDELTNPTVVEKKESIFTKPRSGSDPTTPKPVSDDTLLLQTSNKDVEIKNAIKALATVNVTNLIKFFAPTFNQLLHVVVCTAISHSEISKTAVTSMITLASSLRTPSMESLSSKATKRNTKIIKSYIKFAFDAEKIVP+KVKRTVHESLIQAISELIRPPFRDTNFVNSFLFNSFLFYSIITKSMIQSLTKQSKITIDKGGDKFFSTSYMDSLQNMIHLIINCILEITSTVGNQSGMNGQLRPNNSFQSLATSANKDLARFISRLFNVMDRGFIFQIIHQYMKIFIARINAYSGHREHLCRMKFDFLEIVTNHEHYLPLNLLKIINPSDKGQSVRKRQAPPSLELILSETYCRQHYLAGLLLQEVHRQMSDVYSHNAVRRLPFVMLRNLLAKHLFDDRYSS+NMQARIAALYLPLVSIILENQKSFSLPGNLHTKVNLLNDIYDHSDRSLSARPLSTLSGDTLSTHSSINGSSGDGAGGSVYGLGFGTNSSKSARSSQVYLGKDGHVEDHWLKQIAGLTDGGNIRTLSTRRKVDSDTSSVHSTSTLTGLDEMHESGDTNSLDDEMVIHSKVPLNSESVVKRSSLQRPPVSNSNSWGRKAGLSLNIKKSVAPTHPSQRASILNKASNKNHETKSSIYLNDKTQKDIFVCLLHIFHTISSDDLKATICNLTVQERLEFLQLLILSIHHLKYQGRKVINNFESISTGCAKSKIQLRPHGPRSSVTAILDDVDHGDHKAYLEGNVSTEVGLIVLDVLSAYCSAFKQEILTYTPDHVIFKKIVDIYLTLLSVNQSEIVLKHVFVSMRVFVSTFAKVLFANCHNVISDLSLHTLRFLDTRFTSVRIEACGFLYRMMRSSYDTFNKPGINRVHLQMIVAVSKLDRTVGIRFKESLNYLKRLAEIEMQKSQS+SINKSRSGTPTGTSKSITIGVHSTTKLSMQTFFEEVTDLTQRIRTVLMATVQMNEHVDDPEMQVDLQYSLAKSYSSNPALRRTWLEKIYAIHNKNNSRAEMAMCKAHIVAMIVEYLRRKEQYSMSCANFKAISPNIPLEESGMRDDSVQLEVHYTKEEVVKLLRELAHEFDAGCLWEVLRHVYKLVIPIYERKRDYEQLAEIYKHMSDGYNKIKTAESTNQRIIGSYYRVVLYG    SLAGKVFIYRLDSGKQFCVVREELQKLFSKKYGAGKVQMLVENHIDRSKLDPELASIQVTHVEPFFNEDEELERHSMFERQYNISKFMLETPFVKMN            +HDIDGVLKSKQTDDLSIQWKRRTILTVEASFPHLKRRLEVISIKEIDFSPIERAIDEIQLKNRQLAMHLAYNKSTTISKSSSSLAVSNSNQTVGSSQTRANNIPLLMDMHMSGALLPQVNQGPMAYARVFLHKETQANYSQEKVKQLKIQFMEFLTLCYLLLRDFNELMSHIQQQKYIAMREALDSYRVELSNLINEEI VFEDISVISTSALSDDVKRSLQKRSSQENGS
Sbjct:    1 MAKEQKFIIDEDSEKDDESLLTFKTKGSYFESNLAICDRNAYQKHLKHREDELANTSSNAGINYSKAAVPELLSFSLNELSDGSTVLKESMPRDGHEQIIVYLDNVDSLRELGGYWILLSFKGKQSESYLFTGGNDNQKLWANKLKDAIESETKTKQIERPVSSESIERSEETVHGMLSKFLQENEQSAVILRKKDHQKILVIYSEIRNQIKMKSQQTPIYDIGIIEKSQLDDCHIRPQVEQSIPKTFIKLTANRFITSVGISDENSNPKGVIPAEPFFISFSLFHIADGRRISEEFYWNPNRPQIEDLLPSDLFAYKFGGNPVHATINGNCDNRTPLNLPTMSDRVLQSTNSFILKVPCLPDKICLFIKSEKVFSGAIGPTVDKYIKSGGSLLKKKDREEELFVENPDVKTGASINKTMSVYCANIGHYRMPFGWTACRLNIKGKNCLRFHKYENNKTSEDDIIKLVQNMSSQHVDNNASKYTTIPSFVELSFEELSEDKINNMTDVVNYELVGKSRSEFSNASSCCKEVKDFIFDIPKSGNAANHPGNTLRNTYNPDSLSLSSKPNSSYGSTASLQHYSDDNSPGDVTPPGKFNFSNSQIKSINQMKVNSSSLGRINGLESSQHKSFDYSDHDINYYENINQEELVAPNLDFIHTLYIYPRTLNFSNQNVFHRARNLSCFVELRDVDKSDAPPLKVFYSRPSRKQPAFDYWSNTSVIYHDSSPTFNEEIKIALPLNLHSKHHLLFRFYHVSCDTAAIPNVREKGSNKKSLETPVGVTWLTLMDQNLNLKSGSFSLPVATQLVPDYLEEKQQSIYYKKDSLWKLSTSFGQPKPRNSSTDKVIDESVNKRHSGPTFKSYINPRSSRDLEDIFSIKSDDVEQSHDTTVQWVDGQKSIFTVVIRPETTIFTQSTHLHKFFQVCSEKLDELTNPTVVEKKESIFTKPRSGSDPTTPKPVSDDTLLLQTSNKDVEIKNAIKALATVNVTNLIKFFAPTFNQLLHVVVCTAISHSEISKTAVTSMITLASSLRTPSMESLSSKATKRNTKIIKSYIKFAFDAEKIVPSKVKRTVHESLIQAISELIRPPFRDTNFVNSFLFNSFLFYSIITKSMIQSLTKQSKITIDKGGDKFFSTSYMDSLQNMIHLIINCILEITSTVGNQSGMNGQLRPNNSFQSLATSANKDLARFISRLFNVMDRGFIFQIIHQYMKIFIARINAYSGHREHLCRMKFDFLEIVTNHEHYLPLNLLKIINPSDKGQSVRKRQAPPSLELILSETYCRQHYLAGLLLQEVHRQMSDVYSHNAVRRLPFVMLRNLLAKHLFDDRYSSVNMQARIAALYLPLVSIILENQKSFSLPGNLHTKVNLLNDIYDHSDRSLSARPLSTLSGDTLSTHSSINGSSGDGAGGSVYGLGFGTNSSKSARSSQVYLGKDGHVEDHWLKQIAGLTDGGNIRTLSTRRKVDSDTSSVHSTSTLTGLDEMHESGDTNSLDDEMVIHSKVPLNSESVVKRSSLQRPPVSNSNSWGRKAGLSLNIKKSVAPTHPSQRASILNKASNKNHETKSSIYLNDKTQKDIFVCLLHIFHTISSDDLKATICNLTVQERLEFLQLLILSIHHLKYQGRKVINNFESISTGCAKSKIQLRPHGPRSSVTAILDDVDHGDHKAYLEGNVSTEVGLIVLDVLSAYCSAFKQEILTYTPDHVIFKKIVDIYLTLLSVNQSEIVLKHVFVSMRVFVSTFAKVLFANCHNVISDLSLHTLRFLDTRFTSVRIEACGFLYRMMRSSYDTFNKPGINRVHLQMIVAVSKLDRTVGIRFKESLNYLKRLAEIEMQKSQSTSINKSRSGTPTGTSKSITIGVHSTTKLSMQTFFEEVTDLTQRIRTVLMATVQMNEHVDDPEMQVDLQYSLAKSYSSNPALRRTWLEKIYAIHNKNNSRAEMAMCKAHIVAMIVEYLRRKEQYSMSCANFKAISPNIPLEESGMRDDSVQLEVHYTKEEVVKLLRELAHEFDAGCLWEVLRHVYKLVIPIYERKRDYEQLAEIYKHMSDGYNKIKTAESTNQRIIGSYYRVVLYG----SLAGKVFIYRLDSGKQFCVVREELQKLFSKKYGAGKVQMLVENHIDRSKLDPELASIQVTHVEPFFNEDEELERHSMFERQYNISKFMLETPFVKMN------------QHDIDGVLKSKQTDDLSIQWKRRTILTVEASFPHLKRRLEVISIKEIDFSPIERAIDEIQLKNRQLAMHLAYNKSTTISKSSSSLAVSNSNQTVGSSQTRANNIPLLMDMHMSGALLPQVNQGPMAYARVFLHKETQANYSQEKVKQLKIQFMEFLTLCYLLLRDFNELMSHIQQQKYIAMREALDSYRVELSNLINEEISVFEDISVISTSALSDDVKRSLQKRSSQENGS 2392          
BLAST of Dedicator of cytokinesis vs. Planmine SMEST
Match: SMESG000016476.1 (SMESG000016476.1)

HSP 1 Score: 4586.17 bits (11894), Expect = 0.000e+0
Identity = 2358/2408 (97.92%), Postives = 2363/2408 (98.13%), Query Frame = 2
Query:  440 MAKEQKFIIXXXXXXXXXXLLTFKTKGSYFESNLAICDRNAYQKHLKHREDELANTSSNAGINYSKAAVPELLSFSLNELSDGSTVLKESMPRDGHEQIIVYLDNVDSLRELGGYWILLSFKGKQSESYLFTGGNDNQKLWANKLKDAIESETKTKQIERPVSSESIERSEETVHGMLSKFLQENEQSAVILRKKDHQKILVIYSEIRNQIKMKSQQTPIYDIGIIEKSQLDDCHIRPQVEQSIPKTFIKLTANRFITSVGISDENSNPKGVIPAEPFFISFSLFHIADGRRISEEFYWNPNRPQIEDLLPSDLFAYKFGGHPVHATINGNCDNRTPLNLPTMSDRVLQSTNSFILKVPCLPDKICLFIKSEKVFSGAIGPTVDKYIKSGGSLLKKKDREEELFVENPDVKTGASINKTMSVYCANIGHYRMPFGWTACRLNIKGKNCLRFHKYENNKTSEDDIIKLVQNMSSQHVDNNASKYTTIPXXXXXXXXXXXXDKINNMTDVVNYELVGKSRSEFSNASSCCKEVKDFIFDIPKSGNAANHPGNTLRNTYNPDXXXXXXXXXXXXXXTASLQHYSDDNSPGDVTPPGKFNFSNSQIKSINQMKVNSSSLGRINGLESSQHKSFDYSDHDINYYENINQEELVAPNLDFIHTLYIYPRTLNFSNQNVFHRARNLSCFVELRDVDKSDAPPLKVFYSRPSRKQPAFDYWSNTSVIYHDSSPTFNEEIKIALPLNLHSKHHLLFRFYHVSCDTAAIPNVREKGSNKKSLETPVGVTWLTLMDQNLNLKSGSFSLPVATQLVPDYLEEKQQSIYYKKDSLWKLSTSFGQPKPRNSSTDKVIDESVNKRHSGPTFKSYINPRSSRDLEDIFSIKSDDVEQSHDTTVQWVDGQKSIFTVVIRPETTIFTQSTHLHKFFQVCSEKLDELTNPTVVEKKESIFTKPRSGSDPTTPKPVSDDTLLLQTSNKDVEIKNAIKALATVNVTNLIKFFAPTFNQLLHVVVCTAISHSEISKTAVTSMITLASSLRTPSMESLSSKATKRNTKIIKSYIKFAFDAEKIVPTKVKRTVHESLIQAISELIRPPFRDTXXXXXXXXXXXXXYSIITKSMIQSLTKQSKITIDKGGDKFFSTSYMDSLQNMIHLIINCILEITSTVGNQSGMNGQLRPNNSFQSLATSANKDLARFISRLFNVMDRGFIFQIIHQYMKIFIARINAYSGHREHLCRMKFDFLEIVTNHEHYLPLNLLKIINPSDKGQSVRKRQAPPSLELILSETYCRQHYLAGLLLQEVHRQMSDVYSHNAVRRLPFVMLRNLLAKHLFDDRYSSINMQARIAALYLPLVSIILENQKSFSLPGNLHTKVNLLNDIYDHSDRSLSARPLSTLSGDTLSTHSSINGSSGDGAGGSVYGLGFGTNSSKSARSSQVYLGKDGHVEDHWLKQIAGLTDGGNIRTLSTRRKXXXXXXXXXXXXXXXGLDEMHESGDTNSLDDEMVIHSKVPLNSESVVKRSSLQRPPVSNSNSWGRKAGLSLNIKKSVAPTHPSQRASILNKASNKNHETKSSIYLNDKTQKDIFVCLLHIFHTISSDDLKATICNLTVQERLEFLQLLILSIHHLKYQGRKVINNFESISTGCAKSKIQLRPHGPRSSVTAILDDVDHGDHKAYLEGNVSTEVGLIVLDVLSAYCSAFKQEILTYTPDHVIFKKIVDIYLTLLSVNQSEIVLKHVFVSMRVFVSTFAKVLFANCHNVISDLSLHTLRFLDTRFTSVRIEACGFLYRMMRSSYDTFNKPGINRVHLQMIVAVSKLDRTVGIRFKESLNYLKRLAEIEMXXXXXXXXXXXXXGTPTGTSKSITIGVHSTTKLSMQTFFEEVTDLTQRIRTVLMATVQMNEHVDDPEMQVDLQYSLAKSYSSNPALRRTWLEKIYAIHNKNNSRAEMAMCKAHIVAMIVEYLRRKEQYSMSCANFKAISPNIPLEESGMRDDSVQLEVHYTKEEVVKLLRELAHEFDAGCLWEVLRHVYKLVIPIYERKRDYEQLAEIYKHMSDGYNKIKTAESTNQRIIGSYYRVVLYGKPFDSLAGKVFIYRLDSGKQFCVVREELQKLFSKKYGAGKVQMLVENHIDRSKLDPELASIQVTHVEPFFNEDEELERHSMFERQYNISKFMLETPFVKMNHVEHESRWKKYKEHDIDGVLKSKQTDDLSIQWKRRTILTVEASFPHLKRRLEVISIKEIDFSPIERAIDEIQLKNRQLAMHLAYXXXXXXXXXXXXXXXXXXXXXVGSSQTRANNIPLLMDMHMSGALLPQVNQGPMAYARVFLHKETQANYSQEKVKQLKIQFMEFLTLCYLLLRDFNELMSHIQQQKYIAMREALDSYRVELSNLINEEICVFEDISVISTSALSDDVKRSLQKRSSQENGS 7663
            MAKEQKFIIDEDSEKDDESLLTFKTKGSYFESNLAICDRNAYQKHLKHREDELANTSSNAGINYSKAAVPELLSFSLNELSDGSTVLKESMPRDGHEQIIVYLDNVDSLRELGGYWILLSFKGKQSESYLFTGGNDNQKLWANKLKDAIESETKTKQIERPVSSESIERSEETVHGMLSK                            NQIKMKSQQTPIYDIGIIEKSQLDDCHIRPQVEQSIPKTFIKLTANRFITSVGISDENSNPKGVIPAEPFFISFSLFHIADGRRISEEFYWNPNRPQIEDLLPSDLFAYKFGG+PVHATINGNCDNRTPLNLPTMSDRVLQSTNSFILKVPCLPDKICLFIKSEKVFSGAIGPTVDKYIKSGGSLLKKKDREEELFVENPDVKTGASINKTMSVYCANIGHYRMPFGWTACRLNIKGKNCLRFHKYENNKTSEDDIIKLVQNMSSQHVDNNASKYTTIPSFVELSFEELSEDKINNMTDVVNYELVGKSRSEFSNASSCCKEVKDFIFDIPKSGNAANHPGNTLRNTYNPDSLSLSSKPNSSYGSTASLQHYSDDNSPGDVTPPGKFNFSNSQIKSINQMKVNSSSLGRINGLESSQHKSFDYSDHDINYYENINQEELVAPNLDFIHTLYIYPRTLNFSNQNVFHRARNLSCFVELRDVDKSDAPPLKVFYSRPSRKQPAFDYWSNTSVIYHDSSPTFNEEIKIALPLNLHSKHHLLFRFYHVSCDTAAIPNVREKGSNKKSLETPVGVTWLTLMDQNLNLKSGSFSLPVATQLVPDYLEEKQQSIYYKKDSLWKLSTSFGQPKPRNSSTDKVIDESVNKRHSGPTFKSYINPRSSRDLEDIFSIKSDDVEQSHDTTVQWVDGQKSIFTVVIRPETTIFTQSTHLHKFFQVCSEKLDELTNPTVVEKKESIFTKPRSGSDPTTPKPVSDDTLLLQTSNKDVEIKNAIKALATVNVTNLIKFFAPTFNQLLHVVVCTAISHSEISKTAVTSMITLASSLRTPSMESLSSKATKRNTKIIKSYIKFAFDAEKIVP+KVKRTVHESLIQAISELIRPPFRDTNFVNSFLFNSFLFYSIITKSMIQSLTKQSKITIDKGGDKFFSTSYMDSLQNMIHLIINCILEITSTVGNQSGMNGQLRPNNSFQSLATSANKDLARFISRLFNVMDRGFIFQIIHQYMKIFIARINAYSGHREHLCRMKFDFLEIVTNHEHYLPLNLLKIINPSDKGQSVRKRQAPPSLELILSETYCRQHYLAGLLLQEVHRQMSDVYSHNAVRRLPFVMLRNLLAKHLFDDRYSS+NMQARIAALYLPLVSIILENQKSFSLPGNLHTKVNLLNDIYDHSDRSLSARPLSTLSGDTLSTHSSINGSSGDGAGGSVYGLGFGTNSSKSARSSQVYLGKDGHVEDHWLKQIAGLTDGGNIRTLSTRRKVDSDTSSVHSTSTLTGLDEMHESGDTNSLDDEMVIHSKVPLNSESVVKRSSLQRPPVSNSNSWGRKAGLSLNIKKSVAPTHPSQRASILNKASNKNHETKSSIYLNDKTQKDIFVCLLHIFHTISSDDLKATICNLTVQERLEFLQLLILSIHHLKYQGRKVINNFESISTGCAKSKIQLRPHGPRSSVTAILDDVDHGDHKAYLEGNVSTEVGLIVLDVLSAYCSAFKQEILTYTPDHVIFKKIVDIYLTLLSVNQSEIVLKHVFVSMRVFVSTFAKVLFANCHNVISDLSLHTLRFLDTRFTSVRIEACGFLYRMMRSSYDTFNKPGINRVHLQMIVAVSKLDRTVGIRFKESLNYLKRLAEIEMQKSQS+SINKSRSGTPTGTSKSITIGVHSTTKLSMQTFFEEVTDLTQRIRTVLMATVQMNEHVDDPEMQVDLQYSLAKSYSSNPALRRTWLEKIYAIHNKNNSRAEMAMCKAHIVAMIVEYLRRKEQYSMSCANFKAISPNIPLEESGMRDDSVQLEVHYTKEEVVKLLRELAHEFDAGCLWEVLRHVYKLVIPIYERKRDYEQLAEIYKHMSDGYNKIKTAESTNQRIIGSYYRVVLYG    SLAGKVFIYRLDSGKQFCVVREELQKLFSKKYGAGKVQMLVENHIDRSKLDPELASIQVTHVEPFFNEDEELERHSMFERQYNISKFMLETPFVKMN            +HDIDGVLKSKQTDDLSIQWKRRTILTVEASFPHLKRRLEVISIKEIDFSPIERAIDEIQLKNRQLAMHLAYNKSTTISKSSSSLAVSNSNQTVGSSQTRANNIPLLMDMHMSGALLPQVNQGPMAYARVFLHKETQANYSQEKVKQLKIQFMEFLTLCYLLLRDFNELMSHIQQQKYIAMREALDSYRVELSNLINEEI VFEDISVISTSALSDDVKRSLQKRSSQENGS
Sbjct:    1 MAKEQKFIIDEDSEKDDESLLTFKTKGSYFESNLAICDRNAYQKHLKHREDELANTSSNAGINYSKAAVPELLSFSLNELSDGSTVLKESMPRDGHEQIIVYLDNVDSLRELGGYWILLSFKGKQSESYLFTGGNDNQKLWANKLKDAIESETKTKQIERPVSSESIERSEETVHGMLSK----------------------------NQIKMKSQQTPIYDIGIIEKSQLDDCHIRPQVEQSIPKTFIKLTANRFITSVGISDENSNPKGVIPAEPFFISFSLFHIADGRRISEEFYWNPNRPQIEDLLPSDLFAYKFGGNPVHATINGNCDNRTPLNLPTMSDRVLQSTNSFILKVPCLPDKICLFIKSEKVFSGAIGPTVDKYIKSGGSLLKKKDREEELFVENPDVKTGASINKTMSVYCANIGHYRMPFGWTACRLNIKGKNCLRFHKYENNKTSEDDIIKLVQNMSSQHVDNNASKYTTIPSFVELSFEELSEDKINNMTDVVNYELVGKSRSEFSNASSCCKEVKDFIFDIPKSGNAANHPGNTLRNTYNPDSLSLSSKPNSSYGSTASLQHYSDDNSPGDVTPPGKFNFSNSQIKSINQMKVNSSSLGRINGLESSQHKSFDYSDHDINYYENINQEELVAPNLDFIHTLYIYPRTLNFSNQNVFHRARNLSCFVELRDVDKSDAPPLKVFYSRPSRKQPAFDYWSNTSVIYHDSSPTFNEEIKIALPLNLHSKHHLLFRFYHVSCDTAAIPNVREKGSNKKSLETPVGVTWLTLMDQNLNLKSGSFSLPVATQLVPDYLEEKQQSIYYKKDSLWKLSTSFGQPKPRNSSTDKVIDESVNKRHSGPTFKSYINPRSSRDLEDIFSIKSDDVEQSHDTTVQWVDGQKSIFTVVIRPETTIFTQSTHLHKFFQVCSEKLDELTNPTVVEKKESIFTKPRSGSDPTTPKPVSDDTLLLQTSNKDVEIKNAIKALATVNVTNLIKFFAPTFNQLLHVVVCTAISHSEISKTAVTSMITLASSLRTPSMESLSSKATKRNTKIIKSYIKFAFDAEKIVPSKVKRTVHESLIQAISELIRPPFRDTNFVNSFLFNSFLFYSIITKSMIQSLTKQSKITIDKGGDKFFSTSYMDSLQNMIHLIINCILEITSTVGNQSGMNGQLRPNNSFQSLATSANKDLARFISRLFNVMDRGFIFQIIHQYMKIFIARINAYSGHREHLCRMKFDFLEIVTNHEHYLPLNLLKIINPSDKGQSVRKRQAPPSLELILSETYCRQHYLAGLLLQEVHRQMSDVYSHNAVRRLPFVMLRNLLAKHLFDDRYSSVNMQARIAALYLPLVSIILENQKSFSLPGNLHTKVNLLNDIYDHSDRSLSARPLSTLSGDTLSTHSSINGSSGDGAGGSVYGLGFGTNSSKSARSSQVYLGKDGHVEDHWLKQIAGLTDGGNIRTLSTRRKVDSDTSSVHSTSTLTGLDEMHESGDTNSLDDEMVIHSKVPLNSESVVKRSSLQRPPVSNSNSWGRKAGLSLNIKKSVAPTHPSQRASILNKASNKNHETKSSIYLNDKTQKDIFVCLLHIFHTISSDDLKATICNLTVQERLEFLQLLILSIHHLKYQGRKVINNFESISTGCAKSKIQLRPHGPRSSVTAILDDVDHGDHKAYLEGNVSTEVGLIVLDVLSAYCSAFKQEILTYTPDHVIFKKIVDIYLTLLSVNQSEIVLKHVFVSMRVFVSTFAKVLFANCHNVISDLSLHTLRFLDTRFTSVRIEACGFLYRMMRSSYDTFNKPGINRVHLQMIVAVSKLDRTVGIRFKESLNYLKRLAEIEMQKSQSTSINKSRSGTPTGTSKSITIGVHSTTKLSMQTFFEEVTDLTQRIRTVLMATVQMNEHVDDPEMQVDLQYSLAKSYSSNPALRRTWLEKIYAIHNKNNSRAEMAMCKAHIVAMIVEYLRRKEQYSMSCANFKAISPNIPLEESGMRDDSVQLEVHYTKEEVVKLLRELAHEFDAGCLWEVLRHVYKLVIPIYERKRDYEQLAEIYKHMSDGYNKIKTAESTNQRIIGSYYRVVLYG----SLAGKVFIYRLDSGKQFCVVREELQKLFSKKYGAGKVQMLVENHIDRSKLDPELASIQVTHVEPFFNEDEELERHSMFERQYNISKFMLETPFVKMN------------QHDIDGVLKSKQTDDLSIQWKRRTILTVEASFPHLKRRLEVISIKEIDFSPIERAIDEIQLKNRQLAMHLAYNKSTTISKSSSSLAVSNSNQTVGSSQTRANNIPLLMDMHMSGALLPQVNQGPMAYARVFLHKETQANYSQEKVKQLKIQFMEFLTLCYLLLRDFNELMSHIQQQKYIAMREALDSYRVELSNLINEEISVFEDISVISTSALSDDVKRSLQKRSSQENGS 2364          
BLAST of Dedicator of cytokinesis vs. Planmine SMEST
Match: SMESG000016476.1 (SMESG000016476.1)

HSP 1 Score: 4585.02 bits (11891), Expect = 0.000e+0
Identity = 2390/2546 (93.87%), Postives = 2412/2546 (94.74%), Query Frame = 2
Query:   41 MKKTVNSLKNKKIENNSSQIQIKCDNQQINISELVKPIDFESVYLQNKNNISNDPNRVLVKIPDNDVKINKVSRKETVYNNGVPTNIHEIFDCNLLAKLCVDFYTSEWTATCYKDFTYNSSFWTLPNVHNQLTMAKEQKFIIXXXXXXXXXXLLTFKTKGSYFESNLAICDRNAYQKHLKHREDELANTSSNAGINYSKAAVPELLSFSLNELSDGSTVLKESMPRDGHEQIIVYLDNVDSLRELGGYWILLSFKGKQSESYLFTGGNDNQKLWANKLKDAIESETKTKQIERPVSSESIERSEETVHGMLSKFLQENEQSAVILRKKDHQKILVIYSEIRNQIKMKSQQTPIYDIGIIEKSQLDDCHIRPQVEQSIPKTFIKLTANRFITSVGISDENSNPKGVIPAEPFFISFSLFHIADGRRISEEFYWNPNRPQIEDLLPSDLFAYKFGGHPVHATINGNCDNRTPLNLPTMSDRVLQSTNSFILKVPCLPDKICLFIKSEKVFSGAIGPTVDKYIKSGGSLLKKKDREEELFVENPDVKTGASINKTMSVYCANIGHYRMPFGWTACRLNIKGKNCLRFHKYENNKTSEDDIIKLVQNMSSQHVDNNASKYTTIPXXXXXXXXXXXXDKINNMTDVVNYELVGKSRSEFSNASSCCKEVKDFIFDIPKSGNAANHPGNTLRNTYNPDXXXXXXXXXXXXXXTASLQHYSDDNSPGDVTPPGKFNFSNSQIKSINQMKVNSSSLGRINGLESSQHKSFDYSDHDINYYENINQEELVAPNLDFIHTLYIYPRTLNFSNQNVFHRARNLSCFVELRDVDKSDAPPLKVFYSRPSRKQPAFDYWSNTSVIYHDSSPTFNEEIKIALPLNLHSKHHLLFRFYHVSCDTAAIPNVREKGSNKKSLETPVGVTWLTLMDQNLNLKSGSFSLPVATQLVPDYLEEKQQSIYYKKDSLWKLSTSFGQPKPRNSSTDKVIDESVNKRHSGPTFKSYINPRS-----SRDLEDIFSIKSDDVEQSHDTTVQWVDGQKSIFTVVIRPETTIFTQSTHLHKFFQVCSEKLDELTNPTVVEKKESIFTKPRSGSDPTTPKPVSDDTLLLQTSNKDVEIKNAIKALATVNVTNLIKFFAPTFNQLLHVVVCTAISHSEISKTAVTSMITLASSLRTPSMESLSSKATKRNTKIIKSYIKFAFDAEKIVPTKVKRTVHESLIQAISELIRPPFRDTXXXXXXXXXXXXXYSIITKSMIQSLTKQSKITIDKGGDKFFSTSYMDSLQNMIHLIINCILEITSTVGNQSGMNGQLRPNNSFQSLATSANKDLARFISRLFNVMDRGFIFQIIHQYMKIFIARINAYSGHREHLCRMKFDFLEIVTNHEHYLPLNLLKIINPSDKGQSVRKRQAPPSLELILSETYCRQHYLAGLLLQEVHRQMSDVYSHNAVRRLPFVMLRNLLAKHLFDDRYSSINMQARIAALYLPLVSIILENQKSFSLPGNLHTKVNLLNDIYDHSDRSLSARPLSTLSGDTLSTHSSINGSSGDGAGGSVYGLGFGTNSSKSARSSQVYLGKDGHVEDHWLKQIAGLTDGGNIRTLSTRRKXXXXXXXXXXXXXXXGLDEMHESGDTNSLDDEMVIHSKVPLNSESVVKRSSLQRPPVSNSNSWGRKAGLSLNIKKSVAPTHPSQRASILNKASNKNHETKSSIYLNDKTQKDIFVCLLHIFHTISSDDLKATICNLTVQERLEFLQLLILSIHHLKYQGRKVINNFESISTGCAKSKIQLRPHGPRSSVTAILDDVDHGDHKAYLEGNVSTEVGLIVLDVLSAYCSAFKQEILTYTPDHVIFKKIVDIYLTLLSVNQSEIVLKHVFVSMRVFVSTFAKVLFANCHNVISDLSLHTLRFLDTRFTSVRIEACGFLYRMMRSSYDTFNKPGINRVHLQMIVAVSKLDRTVGIRFKESLNYLKRLAEIEMXXXXXXXXXXXXXGTPTGTSKSITIGVHSTTKLSMQTFFEEVTDLTQRIRTVLMATVQMNEHVDDPEMQVDLQYSLAKSYSSNPALRRTWLEKIYAIHNKNNSRAEMAMCKAHIVAMIVEYLRRKEQYSMSCANFKAISPNIPLEESGMRDDSVQLEVHYTKEEVVKLLRELAHEFDAGCLWEVLRHVYKLVIPIYERKRDYEQLAEIYKHMSDGYNKIKTAESTNQRIIGSYYRVVLYGKPFDSLAGKVFIYRLDSGKQFCVVREELQKLFSKKYGAGKVQMLVENHIDRSKLDPELASIQVTHVEPFFNEDEELERHSMFERQYNISKFMLETPFVKMNHVEHESRWKKYKEHDIDGVLKSKQTDDLSIQWKRRTILTVEASFPHLKRRLEVISIKEIDFSPIERAIDEIQLKNRQLAMHLAYXXXXXXXXXXXXXXXXXXXXXVGSSQTRANNIPLLMDMHMSGALLPQVNQGPMAYARVFLHKETQANYSQEKVKQLKIQFMEFLTLCYLLLRDFNELMSHIQQQKYIAMREALDSYRVELSNLINEEICVFEDISVISTSALSDDVKRSLQKRSSQENGS 7663
            MKKTVNSLKNKKIENNSSQIQIKCDNQQINISELVKPIDFESVYLQNKNNISNDPNRVLVKIPDNDVKINKVSRKETVYNNGVPTNIHEIFDCNLLAKLCVDFYTSEWT TCYKDFTYNSSFWTLPNVHNQLTMAKEQKFIIDEDSEKDDESLLTFKTKGSYFESNLAICDRNAYQKHLKHREDELANTSSNAGINYSKAAVPELLSFSLNELSDGSTVLKESMPRDGHEQIIVYLDNVDSLRELGGYWILLSFKGKQSESYLFTGGNDNQKLWANKLKDAIESETKTKQIERPVSSESIERSEETVHGMLSKFLQENEQSAVILRKKDHQKILVIYSEIRNQIKMKSQQTPIYDIGIIEKSQLDDCHIRPQVEQSIPKTFIKLTANRFITSVGISDENSNPKGVIPAEPFFISFSLFHIADGRRISEEFYWNPNRPQIEDLLPSDLFAYKFGG+PVHATINGNCDNRTPLNLPTMSDRVLQSTNSFILKVPCLPDKICLFIKSEKVFSGAIGPTVDKYIKSGGSLLKKKDREEELFVENPDVKTGASINKTMSVYCANIGHYRMPFGWTACRLNIKGKNCLRFHKYENNKTSEDDIIKLVQNMSSQHVDNNASKYTTIPSFVELSFEELSEDKINNMTDVVNYELVGKSRSEFSNASSCCKEVKDFIFDIPKSGNAANHPGNTLRNTYNPDSLSLSSKPNSSYGSTASLQHYSDDNSPGDVTPPGKFNFSNSQIKSINQMKVNSSSLGRINGLESSQHKSFDYSDHDINYYENINQEELVAPNLDFIHTLYIYPRTLNFSNQNVFHRARNLSCFVELRDVDKSDAPPLKVFYSRPSRKQPAFDYWSNTSVIYHDSSPTFNEEIKIALPLNLHSKHHLLFRFYHVSCDTAAIPNVREKGSNKKSLETPVGVTWLTLMDQNLNLKSGSFSLPVATQLVPDYLEEKQQS   +    W                       V+ + S   F   I P +     S  L   F + S+ +++  + TV  V+ ++SIFT   +P +                       ++PT          KP S           DDTLLLQTSNKDVEIKNAIKALATVNVTNLIKFFAPTFNQLLHVVVCTAISHSEISKTAVTSMITLASSLRTPSMESLSSKATKRNTKIIKSYIKFAFDAEKIVP+KVKRTVHESLIQAISELIRPPFRDTNFVNSFLFNSFLFYSIITKSMIQSLTKQSKITIDKGGDKFFSTSYMDSLQNMIHLIINCILEITSTVGNQSGMNGQLRPNNSFQSLATSANKDLARFISRLFNVMDRGFIFQIIHQYMKIFIARINAYSGHREHLCRMKFDFLEIVTNHEHYLPLNLLKIINPSDK        APPSLELILSETYCRQHYLAGLLLQEVHRQMSDVYSHNAVRRLPFVMLRNLLAKHLFDDRYSS+NMQARIAALYLPLVSIILENQKSFSLPGNLHTKVNLLNDIYDHSDRSLSARPLSTLSGDTLSTHSSINGSSGDGAGGSVYGLGFGTNSSKSARSSQVYLGKDGHVEDHWLKQIAGLTDGGNIRTLSTRRKVDSDTSSVHSTSTLTGLDEMHESGDTNSLDDEMVIHSKVPLNSESVVKRSSLQRPPVSNSNSWGRKAGLSLNIKKSVAPTHPSQRASILNKASNKNHETKSSIYLNDKTQKDIFVCLLHIFHTISSDDLKATICNLTVQERLEFLQLLILSIHHLKYQGRKVINNFESISTGCAKSKIQLRPHGPRSSVTAILDDVDHGDHKAYLEGNVSTEVGLIVLDVLSAYCSAFKQEILTYTPDHVIFKKIVDIYLTLLSVNQSEIVLKHVFVSMRVFVSTFAKVLFANCHNVISDLSLHTLRFLDTRFTSVRIEACGFLYRMMRSSYDTFNKPGINRVHLQMIVAVSKLDRTVGIRFKESLNYLKRLAEIEMQKSQS+SINKSRSGTPTGTSKSITIGVHSTTKLSMQTFFEEVTDLTQRIRTVLMATVQMNEHVDDPEMQVDLQYSLAKSYSSNPALRRTWLEKIYAIHNKNNSRAEMAMCKAHIVAMIVEYLRRKEQYSMSCANFKAISPNIPLEESGMRDDSVQLEVHYTKEEVVKLLRELAHEFDAGCLWEVLRHVYKLVIPIYERKRDYEQLAEIYKHMSDGYNKIKTAESTNQRIIGSYYRVVLYG    SLAGKVFIYRLDSGKQFCVVREELQKLFSKKYGAGKVQMLVENHIDRSKLDPELASIQVTHVEPFFNEDEELERHSMFERQYNISKFMLETPFVKMN            +HDIDGVLKSKQTDDLSIQWKRRTILTVEASFPHLKRRLEVISIKEIDFSPIERAIDEIQLKNRQLAMHLAYNKSTTISKSSSSLAVSNSNQTVGSSQTRANNIPLLMDMHMSGALLPQVNQGPMAYARVFLHKETQANYSQEKVKQLKIQFMEFLTLCYLLLRDFNELMSHIQQQKYIAMREALDSYRVELSNLINEEI VFEDISVISTSALSDDVKRSLQKRSSQENGS
Sbjct:    1 MKKTVNSLKNKKIENNSSQIQIKCDNQQINISELVKPIDFESVYLQNKNNISNDPNRVLVKIPDNDVKINKVSRKETVYNNGVPTNIHEIFDCNLLAKLCVDFYTSEWTVTCYKDFTYNSSFWTLPNVHNQLTMAKEQKFIIDEDSEKDDESLLTFKTKGSYFESNLAICDRNAYQKHLKHREDELANTSSNAGINYSKAAVPELLSFSLNELSDGSTVLKESMPRDGHEQIIVYLDNVDSLRELGGYWILLSFKGKQSESYLFTGGNDNQKLWANKLKDAIESETKTKQIERPVSSESIERSEETVHGMLSKFLQENEQSAVILRKKDHQKILVIYSEIRNQIKMKSQQTPIYDIGIIEKSQLDDCHIRPQVEQSIPKTFIKLTANRFITSVGISDENSNPKGVIPAEPFFISFSLFHIADGRRISEEFYWNPNRPQIEDLLPSDLFAYKFGGNPVHATINGNCDNRTPLNLPTMSDRVLQSTNSFILKVPCLPDKICLFIKSEKVFSGAIGPTVDKYIKSGGSLLKKKDREEELFVENPDVKTGASINKTMSVYCANIGHYRMPFGWTACRLNIKGKNCLRFHKYENNKTSEDDIIKLVQNMSSQHVDNNASKYTTIPSFVELSFEELSEDKINNMTDVVNYELVGKSRSEFSNASSCCKEVKDFIFDIPKSGNAANHPGNTLRNTYNPDSLSLSSKPNSSYGSTASLQHYSDDNSPGDVTPPGKFNFSNSQIKSINQMKVNSSSLGRINGLESSQHKSFDYSDHDINYYENINQEELVAPNLDFIHTLYIYPRTLNFSNQNVFHRARNLSCFVELRDVDKSDAPPLKVFYSRPSRKQPAFDYWSNTSVIYHDSSPTFNEEIKIALPLNLHSKHHLLFRFYHVSCDTAAIPNVREKGSNKKSLETPVGVTWLTLMDQNLNLKSGSFSLPVATQLVPDYLEEKQQSTTVQ----W-----------------------VDGQKS--IFTVVIRPETTIFTQSTHLHKFFQVCSEKLDELTNPTV--VEKKESIFT---KPRSG----------------------SDPTT--------PKPVS-----------DDTLLLQTSNKDVEIKNAIKALATVNVTNLIKFFAPTFNQLLHVVVCTAISHSEISKTAVTSMITLASSLRTPSMESLSSKATKRNTKIIKSYIKFAFDAEKIVPSKVKRTVHESLIQAISELIRPPFRDTNFVNSFLFNSFLFYSIITKSMIQSLTKQSKITIDKGGDKFFSTSYMDSLQNMIHLIINCILEITSTVGNQSGMNGQLRPNNSFQSLATSANKDLARFISRLFNVMDRGFIFQIIHQYMKIFIARINAYSGHREHLCRMKFDFLEIVTNHEHYLPLNLLKIINPSDK--------APPSLELILSETYCRQHYLAGLLLQEVHRQMSDVYSHNAVRRLPFVMLRNLLAKHLFDDRYSSVNMQARIAALYLPLVSIILENQKSFSLPGNLHTKVNLLNDIYDHSDRSLSARPLSTLSGDTLSTHSSINGSSGDGAGGSVYGLGFGTNSSKSARSSQVYLGKDGHVEDHWLKQIAGLTDGGNIRTLSTRRKVDSDTSSVHSTSTLTGLDEMHESGDTNSLDDEMVIHSKVPLNSESVVKRSSLQRPPVSNSNSWGRKAGLSLNIKKSVAPTHPSQRASILNKASNKNHETKSSIYLNDKTQKDIFVCLLHIFHTISSDDLKATICNLTVQERLEFLQLLILSIHHLKYQGRKVINNFESISTGCAKSKIQLRPHGPRSSVTAILDDVDHGDHKAYLEGNVSTEVGLIVLDVLSAYCSAFKQEILTYTPDHVIFKKIVDIYLTLLSVNQSEIVLKHVFVSMRVFVSTFAKVLFANCHNVISDLSLHTLRFLDTRFTSVRIEACGFLYRMMRSSYDTFNKPGINRVHLQMIVAVSKLDRTVGIRFKESLNYLKRLAEIEMQKSQSTSINKSRSGTPTGTSKSITIGVHSTTKLSMQTFFEEVTDLTQRIRTVLMATVQMNEHVDDPEMQVDLQYSLAKSYSSNPALRRTWLEKIYAIHNKNNSRAEMAMCKAHIVAMIVEYLRRKEQYSMSCANFKAISPNIPLEESGMRDDSVQLEVHYTKEEVVKLLRELAHEFDAGCLWEVLRHVYKLVIPIYERKRDYEQLAEIYKHMSDGYNKIKTAESTNQRIIGSYYRVVLYG----SLAGKVFIYRLDSGKQFCVVREELQKLFSKKYGAGKVQMLVENHIDRSKLDPELASIQVTHVEPFFNEDEELERHSMFERQYNISKFMLETPFVKMN------------QHDIDGVLKSKQTDDLSIQWKRRTILTVEASFPHLKRRLEVISIKEIDFSPIERAIDEIQLKNRQLAMHLAYNKSTTISKSSSSLAVSNSNQTVGSSQTRANNIPLLMDMHMSGALLPQVNQGPMAYARVFLHKETQANYSQEKVKQLKIQFMEFLTLCYLLLRDFNELMSHIQQQKYIAMREALDSYRVELSNLINEEISVFEDISVISTSALSDDVKRSLQKRSSQENGS 2447          
BLAST of Dedicator of cytokinesis vs. Planmine SMEST
Match: SMESG000016476.1 (SMESG000016476.1)

HSP 1 Score: 4551.12 bits (11803), Expect = 0.000e+0
Identity = 2347/2408 (97.47%), Postives = 2352/2408 (97.67%), Query Frame = 2
Query:  440 MAKEQKFIIXXXXXXXXXXLLTFKTKGSYFESNLAICDRNAYQKHLKHREDELANTSSNAGINYSKAAVPELLSFSLNELSDGSTVLKESMPRDGHEQIIVYLDNVDSLRELGGYWILLSFKGKQSESYLFTGGNDNQKLWANKLKDAIESETKTKQIERPVSSESIERSEETVHGMLSKFLQENEQSAVILRKKDHQKILVIYSEIRNQIKMKSQQTPIYDIGIIEKSQLDDCHIRPQVEQSIPKTFIKLTANRFITSVGISDENSNPKGVIPAEPFFISFSLFHIADGRRISEEFYWNPNRPQIEDLLPSDLFAYKFGGHPVHATINGNCDNRTPLNLPTMSDRVLQSTNSFILKVPCLPDKICLFIKSEKVFSGAIGPTVDKYIKSGGSLLKKKDREEELFVENPDVKTGASINKTMSVYCANIGHYRMPFGWTACRLNIKGKNCLRFHKYENNKTSEDDIIKLVQNMSSQHVDNNASKYTTIPXXXXXXXXXXXXDKINNMTDVVNYELVGKSRSEFSNASSCCKEVKDFIFDIPKSGNAANHPGNTLRNTYNPDXXXXXXXXXXXXXXTASLQHYSDDNSPGDVTPPGKFNFSNSQIKSINQMKVNSSSLGRINGLESSQHKSFDYSDHDINYYENINQEELVAPNLDFIHTLYIYPRTLNFSNQNVFHRARNLSCFVELRDVDKSDAPPLKVFYSRPSRKQPAFDYWSNTSVIYHDSSPTFNEEIKIALPLNLHSKHHLLFRFYHVSCDTAAIPNVREKGSNKKSLETPVGVTWLTLMDQNLNLKSGSFSLPVATQLVPDYLEEKQQSIYYKKDSLWKLSTSFGQPKPRNSSTDKVIDESVNKRHSGPTFKSYINPRSSRDLEDIFSIKSDDVEQSHDTTVQWVDGQKSIFTVVIRPETTIFTQSTHLHKFFQVCSEKLDELTNPTVVEKKESIFTKPRSGSDPTTPKPVSDDTLLLQTSNKDVEIKNAIKALATVNVTNLIKFFAPTFNQLLHVVVCTAISHSEISKTAVTSMITLASSLRTPSMESLSSKATKRNTKIIKSYIKFAFDAEKIVPTKVKRTVHESLIQAISELIRPPFRDTXXXXXXXXXXXXXYSIITKSMIQSLTKQSKITIDKGGDKFFSTSYMDSLQNMIHLIINCILEITSTVGNQSGMNGQLRPNNSFQSLATSANKDLARFISRLFNVMDRGFIFQIIHQYMKIFIARINAYSGHREHLCRMKFDFLEIVTNHEHYLPLNLLKIINPSDKGQSVRKRQAPPSLELILSETYCRQHYLAGLLLQEVHRQMSDVYSHNAVRRLPFVMLRNLLAKHLFDDRYSSINMQARIAALYLPLVSIILENQKSFSLPGNLHTKVNLLNDIYDHSDRSLSARPLSTLSGDTLSTHSSINGSSGDGAGGSVYGLGFGTNSSKSARSSQVYLGKDGHVEDHWLKQIAGLTDGGNIRTLSTRRKXXXXXXXXXXXXXXXGLDEMHESGDTNSLDDEMVIHSKVPLNSESVVKRSSLQRPPVSNSNSWGRKAGLSLNIKKSVAPTHPSQRASILNKASNKNHETKSSIYLNDKTQKDIFVCLLHIFHTISSDDLKATICNLTVQERLEFLQLLILSIHHLKYQGRKVINNFESISTGCAKSKIQLRPHGPRSSVTAILDDVDHGDHKAYLEGNVSTEVGLIVLDVLSAYCSAFKQEILTYTPDHVIFKKIVDIYLTLLSVNQSEIVLKHVFVSMRVFVSTFAKVLFANCHNVISDLSLHTLRFLDTRFTSVRIEACGFLYRMMRSSYDTFNKPGINRVHLQMIVAVSKLDRTVGIRFKESLNYLKRLAEIEMXXXXXXXXXXXXXGTPTGTSKSITIGVHSTTKLSMQTFFEEVTDLTQRIRTVLMATVQMNEHVDDPEMQVDLQYSLAKSYSSNPALRRTWLEKIYAIHNKNNSRAEMAMCKAHIVAMIVEYLRRKEQYSMSCANFKAISPNIPLEESGMRDDSVQLEVHYTKEEVVKLLRELAHEFDAGCLWEVLRHVYKLVIPIYERKRDYEQLAEIYKHMSDGYNKIKTAESTNQRIIGSYYRVVLYGKPFDSLAGKVFIYRLDSGKQFCVVREELQKLFSKKYGAGKVQMLVENHIDRSKLDPELASIQVTHVEPFFNEDEELERHSMFERQYNISKFMLETPFVKMNHVEHESRWKKYKEHDIDGVLKSKQTDDLSIQWKRRTILTVEASFPHLKRRLEVISIKEIDFSPIERAIDEIQLKNRQLAMHLAYXXXXXXXXXXXXXXXXXXXXXVGSSQTRANNIPLLMDMHMSGALLPQVNQGPMAYARVFLHKETQANYSQEKVKQLKIQFMEFLTLCYLLLRDFNELMSHIQQQKYIAMREALDSYRVELSNLINEEICVFEDISVISTSALSDDVKRSLQKRSSQENGS 7663
            MAKEQKFIIDEDSEKDDESLLTFKTKGSYFESNLAICDRNAYQKHLKHREDELANTSSNAGINYSKAAVPELLSFSLNELSDGSTVLKESMPRDGHEQIIVYLDNVDSLRELGGYWILLSFKGKQSESYLFTGGNDNQKLWANKLKDAIESETKTKQIERPVSSESIERSEETVHGMLSK                            NQIKMKSQQTPIYDIGIIEKSQLDDCHIRPQVEQSIPKTFIKLTANRFITSVGISDENSNPKG   AEPFFISFSLFHIADGRRISEEFYWNPNRPQIEDLLPSDLFAYKFGG+PVHATINGNCDNRTPLNLPTMSDRVLQSTNSFILKVPCLPDKICLFIKSEKVFSGAIGPTVDKYIKSGGSLLKKKDREEELFVENPDVKTGASINKTMSVYCANIGHYRMPFGWTACRLNIKGKNCLRFHKYENNKTSEDDIIKLVQNMSSQHVDNNASKYTTIPSFVELSFEELSEDKINNMTDVVNYELVGKSRSEFSNASSCCKEVKDFIFDIPKSGNAANHPGNTLRNTYNPDSLSLSSKPNSSYGSTASLQHYSDDNSPGDVTPPGKFNFSNSQIKSINQMKVNSSSLGRINGLESSQHKSFDYSDHDINYYENINQEELVAPNLDFIHTLYIYPRTLNFSNQNVFHRARNLSCFVELRDVDKSDAPPLKVFYSRPSRKQPAFDYWSNTSVIYHDSSPTFNEEIKIALPLNLHSKHHLLFRFYHVSCDTAAIPNVREKGSNKKSLETPVGVTWLTLMDQNLNLKSGSFSLPVATQLVPDYLEEKQQSIYYKKDSLWKLSTSFGQPKPRNSSTDKVIDESVNKRHSGPTFKSYINPRSSRDLEDIFSIKSDDVEQSHDTTVQWVDGQKSIFTVVIRPETTIFTQSTHLHKFFQVCSEKLDELTNPTVVEKKESIFTKPRSGSDPTTPKPVSDDTLLLQTSNKDVEIKNAIKALATVNVTNLIKFFAPTFNQLLHVVVCTAISHSEISKTAVTSMITLASSLRTPSMESLSSKATKRNTKIIKSYIKFAFDAEKIVP+KVKRTVHESLIQAISELIRPPFRDTNFVNSFLFNSFLFYSIITKSMIQSLTKQSKITIDKGGDKFFSTSYMDSLQNMIHLIINCILEITSTVGNQSGMNGQLRPNNSFQSLATSANKDLARFISRLFNVMDRGFIFQIIHQYMKIFIARINAYSGHREHLCRMKFDFLEIVTNHEHYLPLNLLKIINPSDK        APPSLELILSETYCRQHYLAGLLLQEVHRQMSDVYSHNAVRRLPFVMLRNLLAKHLFDDRYSS+NMQARIAALYLPLVSIILENQKSFSLPGNLHTKVNLLNDIYDHSDRSLSARPLSTLSGDTLSTHSSINGSSGDGAGGSVYGLGFGTNSSKSARSSQVYLGKDGHVEDHWLKQIAGLTDGGNIRTLSTRRKVDSDTSSVHSTSTLTGLDEMHESGDTNSLDDEMVIHSKVPLNSESVVKRSSLQRPPVSNSNSWGRKAGLSLNIKKSVAPTHPSQRASILNKASNKNHETKSSIYLNDKTQKDIFVCLLHIFHTISSDDLKATICNLTVQERLEFLQLLILSIHHLKYQGRKVINNFESISTGCAKSKIQLRPHGPRSSVTAILDDVDHGDHKAYLEGNVSTEVGLIVLDVLSAYCSAFKQEILTYTPDHVIFKKIVDIYLTLLSVNQSEIVLKHVFVSMRVFVSTFAKVLFANCHNVISDLSLHTLRFLDTRFTSVRIEACGFLYRMMRSSYDTFNKPGINRVHLQMIVAVSKLDRTVGIRFKESLNYLKRLAEIEMQKSQS+SINKSRSGTPTGTSKSITIGVHSTTKLSMQTFFEEVTDLTQRIRTVLMATVQMNEHVDDPEMQVDLQYSLAKSYSSNPALRRTWLEKIYAIHNKNNSRAEMAMCKAHIVAMIVEYLRRKEQYSMSCANFKAISPNIPLEESGMRDDSVQLEVHYTKEEVVKLLRELAHEFDAGCLWEVLRHVYKLVIPIYERKRDYEQLAEIYKHMSDGYNKIKTAESTNQRIIGSYYRVVLYG    SLAGKVFIYRLDSGKQFCVVREELQKLFSKKYGAGKVQMLVENHIDRSKLDPELASIQVTHVEPFFNEDEELERHSMFERQYNISKFMLETPFVKMN            +HDIDGVLKSKQTDDLSIQWKRRTILTVEASFPHLKRRLEVISIKEIDFSPIERAIDEIQLKNRQLAMHLAYNKSTTISKSSSSLAVSNSNQTVGSSQTRANNIPLLMDMHMSGALLPQVNQGPMAYARVFLHKETQANYSQEKVKQLKIQFMEFLTLCYLLLRDFNELMSHIQQQKYIAMREALDSYRVELSNLINEEI VFEDISVISTSALSDDVKRSLQKRSSQENGS
Sbjct:    1 MAKEQKFIIDEDSEKDDESLLTFKTKGSYFESNLAICDRNAYQKHLKHREDELANTSSNAGINYSKAAVPELLSFSLNELSDGSTVLKESMPRDGHEQIIVYLDNVDSLRELGGYWILLSFKGKQSESYLFTGGNDNQKLWANKLKDAIESETKTKQIERPVSSESIERSEETVHGMLSK----------------------------NQIKMKSQQTPIYDIGIIEKSQLDDCHIRPQVEQSIPKTFIKLTANRFITSVGISDENSNPKG---AEPFFISFSLFHIADGRRISEEFYWNPNRPQIEDLLPSDLFAYKFGGNPVHATINGNCDNRTPLNLPTMSDRVLQSTNSFILKVPCLPDKICLFIKSEKVFSGAIGPTVDKYIKSGGSLLKKKDREEELFVENPDVKTGASINKTMSVYCANIGHYRMPFGWTACRLNIKGKNCLRFHKYENNKTSEDDIIKLVQNMSSQHVDNNASKYTTIPSFVELSFEELSEDKINNMTDVVNYELVGKSRSEFSNASSCCKEVKDFIFDIPKSGNAANHPGNTLRNTYNPDSLSLSSKPNSSYGSTASLQHYSDDNSPGDVTPPGKFNFSNSQIKSINQMKVNSSSLGRINGLESSQHKSFDYSDHDINYYENINQEELVAPNLDFIHTLYIYPRTLNFSNQNVFHRARNLSCFVELRDVDKSDAPPLKVFYSRPSRKQPAFDYWSNTSVIYHDSSPTFNEEIKIALPLNLHSKHHLLFRFYHVSCDTAAIPNVREKGSNKKSLETPVGVTWLTLMDQNLNLKSGSFSLPVATQLVPDYLEEKQQSIYYKKDSLWKLSTSFGQPKPRNSSTDKVIDESVNKRHSGPTFKSYINPRSSRDLEDIFSIKSDDVEQSHDTTVQWVDGQKSIFTVVIRPETTIFTQSTHLHKFFQVCSEKLDELTNPTVVEKKESIFTKPRSGSDPTTPKPVSDDTLLLQTSNKDVEIKNAIKALATVNVTNLIKFFAPTFNQLLHVVVCTAISHSEISKTAVTSMITLASSLRTPSMESLSSKATKRNTKIIKSYIKFAFDAEKIVPSKVKRTVHESLIQAISELIRPPFRDTNFVNSFLFNSFLFYSIITKSMIQSLTKQSKITIDKGGDKFFSTSYMDSLQNMIHLIINCILEITSTVGNQSGMNGQLRPNNSFQSLATSANKDLARFISRLFNVMDRGFIFQIIHQYMKIFIARINAYSGHREHLCRMKFDFLEIVTNHEHYLPLNLLKIINPSDK--------APPSLELILSETYCRQHYLAGLLLQEVHRQMSDVYSHNAVRRLPFVMLRNLLAKHLFDDRYSSVNMQARIAALYLPLVSIILENQKSFSLPGNLHTKVNLLNDIYDHSDRSLSARPLSTLSGDTLSTHSSINGSSGDGAGGSVYGLGFGTNSSKSARSSQVYLGKDGHVEDHWLKQIAGLTDGGNIRTLSTRRKVDSDTSSVHSTSTLTGLDEMHESGDTNSLDDEMVIHSKVPLNSESVVKRSSLQRPPVSNSNSWGRKAGLSLNIKKSVAPTHPSQRASILNKASNKNHETKSSIYLNDKTQKDIFVCLLHIFHTISSDDLKATICNLTVQERLEFLQLLILSIHHLKYQGRKVINNFESISTGCAKSKIQLRPHGPRSSVTAILDDVDHGDHKAYLEGNVSTEVGLIVLDVLSAYCSAFKQEILTYTPDHVIFKKIVDIYLTLLSVNQSEIVLKHVFVSMRVFVSTFAKVLFANCHNVISDLSLHTLRFLDTRFTSVRIEACGFLYRMMRSSYDTFNKPGINRVHLQMIVAVSKLDRTVGIRFKESLNYLKRLAEIEMQKSQSTSINKSRSGTPTGTSKSITIGVHSTTKLSMQTFFEEVTDLTQRIRTVLMATVQMNEHVDDPEMQVDLQYSLAKSYSSNPALRRTWLEKIYAIHNKNNSRAEMAMCKAHIVAMIVEYLRRKEQYSMSCANFKAISPNIPLEESGMRDDSVQLEVHYTKEEVVKLLRELAHEFDAGCLWEVLRHVYKLVIPIYERKRDYEQLAEIYKHMSDGYNKIKTAESTNQRIIGSYYRVVLYG----SLAGKVFIYRLDSGKQFCVVREELQKLFSKKYGAGKVQMLVENHIDRSKLDPELASIQVTHVEPFFNEDEELERHSMFERQYNISKFMLETPFVKMN------------QHDIDGVLKSKQTDDLSIQWKRRTILTVEASFPHLKRRLEVISIKEIDFSPIERAIDEIQLKNRQLAMHLAYNKSTTISKSSSSLAVSNSNQTVGSSQTRANNIPLLMDMHMSGALLPQVNQGPMAYARVFLHKETQANYSQEKVKQLKIQFMEFLTLCYLLLRDFNELMSHIQQQKYIAMREALDSYRVELSNLINEEISVFEDISVISTSALSDDVKRSLQKRSSQENGS 2353          
The following BLAST results are available for this feature:
BLAST of Dedicator of cytokinesis vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DOCK93.602e-12232.38dedicator of cytokinesis 9 [Source:HGNC Symbol;Acc... [more]
DOCK112.640e-12031.98dedicator of cytokinesis 11 [Source:HGNC Symbol;Ac... [more]
DOCK117.123e-12031.98dedicator of cytokinesis 11 [Source:HGNC Symbol;Ac... [more]
DOCK112.323e-11931.79dedicator of cytokinesis 11 [Source:HGNC Symbol;Ac... [more]
DOCK91.757e-11531.17dedicator of cytokinesis 9 [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of Dedicator of cytokinesis vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
F46H5.41.276e-6224.47pep chromosome:WBcel235:X:7245057:7254612:-1 gene:... [more]
F46H5.41.276e-6224.47pep chromosome:WBcel235:X:7245079:7254792:-1 gene:... [more]
F22G12.52.303e-4224.50pep chromosome:WBcel235:I:13162492:13182725:1 gene... [more]
F22G12.52.421e-4224.50pep chromosome:WBcel235:I:13162499:13182659:1 gene... [more]
F22G12.51.168e-4124.50pep chromosome:WBcel235:I:13171598:13182659:1 gene... [more]
back to top
BLAST of Dedicator of cytokinesis vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ziz2.489e-11031.26gene:FBgn0260486 transcript:FBtr0330721[more]
Ziz2.520e-11031.26gene:FBgn0260486 transcript:FBtr0330722[more]
Ziz2.546e-11031.26gene:FBgn0260486 transcript:FBtr0330726[more]
Ziz2.568e-11031.26gene:FBgn0260486 transcript:FBtr0330723[more]
Ziz2.573e-11031.26gene:FBgn0260486 transcript:FBtr0332201[more]
back to top
BLAST of Dedicator of cytokinesis vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dock116.389e-12333.73dedicator of cytokinesis 11 [Source:ZFIN;Acc:ZDB-G... [more]
dock117.526e-12333.73dedicator of cytokinesis 11 [Source:ZFIN;Acc:ZDB-G... [more]
dock119.569e-12333.73dedicator of cytokinesis 11 [Source:ZFIN;Acc:ZDB-G... [more]
dock9b1.709e-11831.62dedicator of cytokinesis 9b [Source:ZFIN;Acc:ZDB-G... [more]
dock9b1.703e-11731.59dedicator of cytokinesis 9b [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of Dedicator of cytokinesis vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DOCK98.803e-12433.13dedicator of cytokinesis 9 [Source:NCBI gene;Acc:1... [more]
DOCK91.974e-12332.63dedicator of cytokinesis 9 [Source:NCBI gene;Acc:1... [more]
DOCK92.552e-12332.63dedicator of cytokinesis 9 [Source:NCBI gene;Acc:1... [more]
DOCK93.039e-12332.69dedicator of cytokinesis 9 [Source:NCBI gene;Acc:1... [more]
DOCK93.433e-12332.69dedicator of cytokinesis 9 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Dedicator of cytokinesis vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dock91.440e-12332.30dedicator of cytokinesis 9 [Source:MGI Symbol;Acc:... [more]
Dock91.370e-12131.89dedicator of cytokinesis 9 [Source:MGI Symbol;Acc:... [more]
Dock91.541e-12032.13dedicator of cytokinesis 9 [Source:MGI Symbol;Acc:... [more]
Dock111.848e-11932.30dedicator of cytokinesis 11 [Source:MGI Symbol;Acc... [more]
Dock113.576e-11932.30dedicator of cytokinesis 11 [Source:MGI Symbol;Acc... [more]
back to top
BLAST of Dedicator of cytokinesis vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5JSL3|DOC11_HUMAN3.421e-11931.98Dedicator of cytokinesis protein 11 OS=Homo sapien... [more]
sp|A2AF47|DOC11_MOUSE2.501e-11832.30Dedicator of cytokinesis protein 11 OS=Mus musculu... [more]
sp|Q8BIK4|DOCK9_MOUSE3.534e-11831.67Dedicator of cytokinesis protein 9 OS=Mus musculus... [more]
sp|Q9BZ29|DOCK9_HUMAN1.326e-11431.17Dedicator of cytokinesis protein 9 OS=Homo sapiens... [more]
sp|Q96BY6|DOC10_HUMAN2.366e-9929.13Dedicator of cytokinesis protein 10 OS=Homo sapien... [more]
back to top
BLAST of Dedicator of cytokinesis vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4W2IFV13.271e-729.90Dedicator of cytokinesis 9 OS=Bos indicus x Bos ta... [more]
A0A4W2IG253.558e-729.90Dedicator of cytokinesis 9 OS=Bos indicus x Bos ta... [more]
A0A4W2GYR93.932e-729.87Dedicator of cytokinesis 9 OS=Bos indicus x Bos ta... [more]
A0A4W2CW702.960e-729.70Dedicator of cytokinesis 9 OS=Bos indicus x Bos ta... [more]
A0A4W2EH684.146e-729.87Dedicator of cytokinesis 9 OS=Bos indicus x Bos ta... [more]
back to top
BLAST of Dedicator of cytokinesis vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DOCK93.526e-12132.61dedicator of cytokinesis 9 [Source:HGNC Symbol;Acc... [more]
dock112.508e-11832.86dedicator of cytokinesis 11 [Source:ZFIN;Acc:ZDB-G... [more]
dock9b3.618e-11431.50dedicator of cytokinesis 9b [Source:ZFIN;Acc:ZDB-G... [more]
dock101.955e-10834.97dedicator of cytokinesis 10 [Source:ZFIN;Acc:ZDB-G... [more]
dock76.116e-8826.43dedicator of cytokinesis 7 [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Dedicator of cytokinesis vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000009336.13.349e-6526.08pep scaffold:Pmarinus_7.0:GL476376:61013:130269:-1... [more]
ENSPMAT00000002343.16.575e-1526.64pep scaffold:Pmarinus_7.0:GL491723:27:4970:1 gene:... [more]
ENSPMAT00000008301.11.831e-824.80pep scaffold:Pmarinus_7.0:GL477297:188469:211033:-... [more]
ENSPMAT00000010350.17.417e-721.99pep scaffold:Pmarinus_7.0:GL476865:2751:57127:1 ge... [more]
back to top
BLAST of Dedicator of cytokinesis vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dedicator of cytokinesis vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO443724.274e-7229.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO288444.810e-1131.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO335824.785e-946.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO348304.081e-830.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO284956.776e-731.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dedicator of cytokinesis vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dock107.858e-11133.56dedicator of cytokinesis 10 [Source:NCBI gene;Acc:... [more]
dock9b2.090e-10631.18dedicator of cytokinesis 9b [Source:ZFIN;Acc:ZDB-G... [more]
dock9b1.175e-9635.23dedicator of cytokinesis 9b [Source:ZFIN;Acc:ZDB-G... [more]
dock71.301e-8529.10dedicator of cytokinesis 7 [Source:NCBI gene;Acc:1... [more]
dock71.369e-8529.10dedicator of cytokinesis 7 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Dedicator of cytokinesis vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000016476.10.000e+099.09SMESG000016476.1[more]
SMESG000016476.10.000e+099.09SMESG000016476.1[more]
SMESG000016476.10.000e+097.92SMESG000016476.1[more]
SMESG000016476.10.000e+093.87SMESG000016476.1[more]
SMESG000016476.10.000e+097.47SMESG000016476.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019167 ID=SMED30019167|Name=Dedicator of cytokinesis|organism=Schmidtea mediterranea sexual|type=transcript|length=7921bp
TTAAGTTGATCTTTTAATTATATATAAATTTATATGATAAATGAAAAAGA
CTGTCAATAGTTTAAAGAATAAAAAGATAGAAAATAATTCCTCACAAATT
CAAATTAAATGTGACAATCAACAAATTAATATTTCAGAGTTGGTGAAGCC
TATTGATTTTGAATCAGTTTATTTACAAAATAAAAATAATATTTCCAATG
ATCCTAATAGGGTTTTAGTGAAAATACCTGACAATGATGTCAAAATAAAC
AAAGTTTCTCGAAAGGAAACCGTTTACAATAATGGTGTTCCTACAAACAT
TCACGAAATTTTCGATTGTAATTTATTAGCAAAACTCTGTGTTGATTTTT
ACACGTCAGAATGGACCGCAACTTGCTATAAAGATTTCACTTATAACTCA
TCATTTTGGACTCTTCCTAATGTTCATAACCAATTAACAATGGCGAAAGA
GCAAAAATTCATAATTGATGAGGATTCCGAAAAGGATGACGAAAGCTTGT
TGACATTCAAAACAAAAGGAAGCTATTTCGAAAGCAATCTGGCCATTTGC
GATCGTAACGCGTACCAGAAACATTTGAAACATCGTGAAGATGAATTGGC
AAATACCTCTTCAAATGCCGGTATCAACTATTCGAAAGCTGCTGTTCCTG
AATTGTTGTCGTTCTCGTTGAATGAACTCAGTGATGGATCAACTGTTCTT
AAGGAATCAATGCCCCGTGATGGACATGAACAAATTATTGTATATCTAGA
TAATGTCGACTCACTGCGAGAACTTGGTGGCTATTGGATATTGCTGTCTT
TTAAAGGGAAACAGAGCGAATCGTATTTATTTACTGGCGGTAATGACAAT
CAGAAATTGTGGGCTAACAAATTGAAAGATGCAATAGAATCAGAGACTAA
AACAAAACAAATTGAGCGACCGGTTTCCAGCGAATCGATAGAAAGGTCTG
AAGAAACTGTGCATGGCATGCTTTCAAAGTTTCTCCAAGAAAACGAGCAA
TCAGCAGTCATTTTACGTAAGAAAGATCATCAGAAAATATTAGTTATTTA
TTCTGAAATTAGAAATCAAATAAAAATGAAATCCCAACAGACACCAATTT
ATGATATTGGGATAATTGAAAAATCACAATTGGATGATTGTCATATTCGG
CCGCAAGTCGAACAGTCCATTCCCAAAACTTTTATCAAGTTAACAGCAAA
TAGATTTATAACCAGCGTTGGGATTTCCGATGAAAACAGTAACCCAAAGG
GAGTGATTCCGGCAGAACCGTTTTTCATATCATTTTCATTGTTTCACATT
GCTGATGGCAGGCGGATCAGCGAAGAATTTTATTGGAATCCTAACAGACC
TCAGATTGAAGATTTGCTTCCTTCAGATTTATTTGCTTATAAATTTGGTG
GTCATCCGGTTCATGCTACAATAAATGGGAATTGTGATAATAGAACTCCT
CTAAATCTACCAACTATGTCAGATCGAGTCTTGCAAAGCACAAATTCATT
CATTCTGAAAGTTCCTTGTCTTCCTGATAAAATATGTTTGTTCATAAAAT
CCGAAAAGGTTTTCAGTGGTGCAATTGGCCCAACTGTTGACAAGTATATT
AAAAGTGGAGGTAGTCTATTAAAAAAAAAAGATCGAGAAGAGGAGTTATT
TGTAGAAAATCCCGATGTTAAGACCGGTGCATCAATCAATAAAACAATGT
CAGTTTACTGTGCTAATATCGGACATTATCGCATGCCTTTCGGTTGGACA
GCATGTCGCCTTAATATTAAAGGGAAAAATTGTTTAAGATTCCATAAATA
TGAGAACAATAAAACTTCAGAGGATGATATTATCAAATTGGTTCAAAATA
TGAGTTCTCAACATGTCGACAATAATGCTAGTAAATACACTACCATACCG
TCTTTCGTAGAATTATCTTTTGAAGAGTTATCTGAAGACAAAATTAATAA
TATGACAGATGTAGTCAATTATGAGTTAGTTGGGAAATCCAGATCAGAAT
TTTCAAATGCTTCGAGTTGCTGCAAAGAGGTTAAAGACTTTATTTTTGAT
ATTCCAAAAAGTGGAAATGCTGCAAATCATCCAGGAAATACACTAAGAAA
TACGTATAATCCTGACTCGTTATCATTGAGTTCTAAACCCAATAGCTCGT
ATGGTTCTACTGCATCATTACAGCATTATTCGGATGACAATTCACCTGGT
GATGTTACTCCTCCTGGCAAATTTAATTTTTCCAATTCTCAAATTAAATC
CATCAATCAAATGAAAGTGAACAGTTCTTCTTTAGGCCGGATAAATGGTT
TAGAAAGTAGCCAGCATAAAAGCTTTGATTATTCTGATCATGATATTAAT
TATTATGAGAACATCAATCAAGAAGAATTAGTAGCTCCTAACTTAGACTT
CATTCACACACTTTACATTTATCCTCGGACTCTGAATTTTTCCAATCAAA
ATGTATTTCACAGGGCGAGGAATCTGTCATGTTTTGTGGAACTGCGAGAC
GTTGACAAATCAGATGCACCACCATTAAAAGTATTTTATTCCAGACCAAG
TCGGAAACAGCCAGCATTTGATTATTGGTCAAACACATCTGTGATCTATC
ATGATTCTAGTCCGACTTTCAACGAAGAGATTAAAATTGCCCTTCCACTC
AATCTTCATTCCAAGCATCATTTATTATTCCGATTCTATCACGTCAGTTG
TGACACTGCTGCTATTCCAAATGTCAGAGAAAAAGGCTCCAACAAAAAGT
CCTTAGAAACTCCAGTCGGAGTGACATGGTTGACACTGATGGATCAGAAT
CTCAACTTAAAAAGCGGCTCATTTTCTCTTCCTGTTGCTACTCAACTTGT
GCCAGACTATCTCGAAGAGAAACAACAATCGATTTATTATAAAAAGGACT
CCCTCTGGAAGCTTTCGACAAGTTTTGGCCAACCGAAGCCAAGAAATAGT
TCCACTGACAAAGTTATTGATGAAAGTGTTAATAAACGACATTCGGGACC
GACTTTTAAGAGCTATATAAATCCTCGTAGTTCGCGTGATCTGGAGGATA
TTTTCTCTATTAAATCAGACGACGTGGAGCAATCTCATGATACAACTGTA
CAATGGGTTGATGGTCAGAAATCTATTTTCACTGTCGTAATTCGACCTGA
GACTACGATTTTCACACAAAGCACGCATTTACACAAGTTTTTCCAAGTTT
GTTCCGAAAAATTAGATGAATTGACTAATCCAACTGTCGTTGAGAAAAAA
GAATCGATATTTACAAAGCCAAGATCAGGAAGTGATCCGACCACACCAAA
GCCGGTTTCGGACGATACTTTGCTTCTTCAAACATCAAATAAAGATGTGG
AAATCAAAAATGCAATAAAAGCTTTGGCTACAGTCAATGTGACGAATCTT
ATTAAATTTTTTGCTCCAACGTTCAATCAGTTGTTACACGTTGTCGTTTG
CACCGCGATCTCTCATTCGGAAATCAGCAAAACCGCTGTTACGTCAATGA
TAACCTTGGCTTCATCACTGAGAACACCATCTATGGAATCGTTATCTTCA
AAAGCCACGAAACGAAATACCAAGATAATTAAATCTTATATAAAGTTTGC
ATTTGATGCTGAAAAAATTGTTCCTACGAAGGTCAAACGAACAGTTCATG
AATCTCTCATTCAGGCAATATCAGAACTAATTAGACCTCCTTTTAGAGAT
ACGAATTTTGTCAATTCCTTTCTCTTCAATTCATTCCTTTTTTATTCCAT
AATTACAAAAAGCATGATACAGAGTCTAACCAAGCAATCAAAAATTACGA
TCGATAAAGGGGGTGACAAGTTCTTTTCTACGAGCTATATGGATAGCTTG
CAGAACATGATTCATTTGATCATCAACTGTATTCTCGAGATAACAAGTAC
CGTTGGCAATCAATCGGGAATGAATGGTCAACTTAGACCTAATAACAGTT
TCCAATCATTAGCAACATCAGCAAATAAAGATCTAGCTAGATTCATCTCA
CGCCTTTTCAATGTGATGGATAGGGGTTTCATATTTCAGATCATCCATCA
ATATATGAAGATATTCATCGCTAGAATAAATGCATATTCCGGTCATCGGG
AGCATCTTTGCAGGATGAAATTCGACTTCTTGGAAATCGTAACAAATCAC
GAGCATTACTTGCCCTTGAACTTGCTGAAAATTATTAATCCTTCCGATAA
AGGTCAGTCTGTTCGAAAAAGACAAGCTCCTCCGAGTCTTGAATTAATCC
TATCAGAAACATATTGTCGACAGCATTATCTAGCTGGCTTACTCTTACAA
GAAGTCCATCGCCAAATGAGCGATGTGTACTCACACAATGCTGTCAGAAG
ATTACCATTTGTCATGCTGAGAAATTTACTGGCTAAGCATTTATTTGACG
ATCGGTACTCTAGTATCAACATGCAGGCAAGAATAGCCGCACTCTATTTA
CCACTGGTATCCATTATTCTTGAAAATCAAAAATCTTTTAGTCTGCCAGG
AAATCTCCATACCAAAGTAAATCTATTAAATGATATATATGATCATTCCG
ATCGATCTTTATCTGCCCGACCGTTAAGCACACTTTCTGGAGATACATTG
AGTACGCATAGTTCTATAAATGGAAGTTCTGGGGATGGAGCCGGGGGGAG
TGTTTATGGGCTTGGTTTTGGAACAAACTCTAGTAAATCGGCCAGAAGTA
GTCAAGTTTATCTAGGTAAGGATGGACACGTAGAAGATCATTGGTTGAAA
CAAATAGCTGGATTGACTGATGGTGGAAATATTAGGACTCTGAGTACACG
TCGGAAAGTTGACTCTGATACGAGTAGTGTCCATAGCACTAGTACTTTAA
CGGGTTTGGATGAAATGCATGAGTCTGGTGACACAAATAGCTTAGATGAC
GAGATGGTTATACATTCGAAAGTTCCATTAAATAGCGAGTCTGTAGTTAA
AAGGTCTTCATTACAAAGACCACCAGTGTCAAATAGTAATTCTTGGGGAA
GAAAAGCTGGATTATCCCTGAATATAAAAAAATCAGTTGCTCCTACGCAT
CCCTCTCAAAGAGCCAGTATACTTAATAAAGCATCGAATAAGAATCATGA
AACAAAATCATCAATTTACCTCAATGACAAAACACAAAAAGATATATTTG
TTTGCTTACTCCATATATTTCATACTATTTCTTCTGATGATTTGAAAGCG
ACTATTTGCAATCTTACAGTTCAAGAACGACTGGAATTTCTGCAGTTACT
AATACTCTCAATTCATCATTTGAAATATCAAGGTAGAAAGGTCATCAATA
ACTTTGAATCAATTAGTACCGGTTGTGCCAAATCAAAGATTCAATTGCGC
CCCCACGGACCGAGATCAAGTGTGACAGCAATTCTTGATGACGTGGACCA
CGGAGACCACAAGGCTTATTTGGAGGGTAATGTTAGCACCGAGGTCGGAT
TGATTGTCCTAGATGTTCTCTCAGCATATTGTTCCGCTTTCAAGCAAGAA
ATCCTCACCTACACGCCAGATCATGTCATTTTCAAGAAAATTGTTGATAT
ATATTTGACTCTTTTGTCGGTCAATCAATCCGAAATTGTATTGAAGCATG
TTTTTGTTTCAATGCGTGTTTTTGTGTCAACATTCGCAAAGGTTTTATTT
GCCAATTGTCACAATGTAATAAGTGATTTGAGTTTGCACACTTTGAGGTT
TCTCGATACTAGATTTACCAGTGTTCGCATTGAAGCCTGTGGGTTTCTTT
ATCGAATGATGAGAAGTAGTTATGATACATTCAATAAACCCGGGATCAAC
CGAGTTCATTTACAAATGATTGTCGCTGTTTCAAAATTAGACCGAACTGT
CGGTATCAGGTTCAAGGAGAGTCTTAACTATTTAAAACGACTCGCTGAAA
TTGAAATGCAAAAATCGCAATCCTCATCAATTAACAAATCCAGATCTGGT
ACACCTACTGGCACTTCTAAATCCATAACAATTGGAGTTCATTCGACAAC
GAAGTTGAGCATGCAAACCTTTTTCGAAGAGGTAACAGATTTAACTCAAC
GAATCAGAACAGTATTGATGGCGACGGTGCAAATGAATGAGCACGTCGAT
GATCCAGAAATGCAAGTAGACCTGCAATATTCACTGGCTAAAAGCTATTC
CAGTAATCCGGCTTTACGAAGAACTTGGTTAGAAAAGATTTATGCTATTC
ACAACAAGAACAATTCTAGAGCAGAAATGGCGATGTGTAAGGCTCACATC
GTGGCGATGATTGTTGAATATTTGAGGAGAAAAGAACAATATTCAATGTC
GTGTGCAAATTTTAAAGCTATTTCGCCGAATATACCTCTGGAAGAAAGTG
GAATGAGAGATGATTCCGTGCAGTTGGAAGTTCATTATACGAAGGAAGAA
GTCGTAAAGCTTTTGCGGGAGTTAGCGCATGAATTCGATGCAGGTTGTTT
GTGGGAAGTGTTACGACATGTGTATAAACTGGTTATTCCAATTTATGAAA
GGAAAAGAGATTATGAACAATTGGCAGAAATCTATAAACACATGTCTGAT
GGATATAACAAAATCAAAACTGCCGAATCTACAAATCAAAGAATTATTGG
TTCATATTACCGTGTAGTTTTATATGGCAAGCCATTTGATAGCTTAGCTG
GAAAGGTTTTCATTTATCGATTAGACAGTGGCAAGCAGTTCTGTGTTGTT
CGCGAAGAACTACAGAAATTGTTTTCTAAGAAATATGGTGCTGGTAAAGT
GCAAATGCTTGTCGAAAATCACATAGATCGCTCAAAGCTCGATCCGGAAC
TGGCATCGATTCAAGTAACACATGTGGAACCATTTTTCAATGAAGACGAA
GAACTAGAACGTCACAGCATGTTTGAAAGGCAATACAACATTTCCAAATT
TATGCTGGAAACTCCATTCGTGAAAATGAACCATGTTGAGCACGAGTCTC
GGTGGAAAAAGTACAAAGAACATGACATCGACGGAGTGTTGAAATCGAAG
CAGACAGATGATCTAAGTATTCAATGGAAACGGCGGACTATTTTAACAGT
GGAGGCAAGTTTTCCTCATCTAAAGCGGCGGCTTGAAGTTATCAGTATTA
AAGAAATTGATTTTTCACCCATTGAAAGAGCAATTGATGAGATCCAATTG
AAAAATCGTCAGCTAGCAATGCATCTTGCATACAACAAATCGACAACGAT
TTCCAAATCTTCCAGTTCTTTAGCGGTTTCAAATTCCAATCAGACAGTTG
GCTCCAGTCAAACTAGAGCTAATAATATTCCATTGTTGATGGATATGCAT
ATGTCTGGTGCTCTCCTTCCTCAGGTCAATCAGGGTCCGATGGCTTATGC
TAGAGTTTTCTTACATAAGGAAACTCAAGCCAATTATTCACAAGAGAAAG
TAAAGCAATTAAAAATTCAATTCATGGAATTTTTAACGTTGTGCTATTTA
CTGTTACGTGATTTCAATGAGCTCATGTCCCATATTCAACAGCAGAAATA
CATTGCAATGCGTGAAGCACTTGATAGTTATCGAGTGGAATTGAGCAACC
TGATCAATGAAGAGATCTGCGTATTTGAGGATATTTCTGTCATTTCAACA
TCTGCGTTGTCGGACGATGTGAAAAGGAGTTTACAGAAGCGCAGCAGTCA
AGAAAATGGCAGCATTTGATATTGATTATTATTATTCCTAATTATTGATT
ATTTGTATTCAAATGATGCAACAGGTATTGTCATTTGTCATTCATTGATG
TTGTCTGCCGAGCCGCGGTATTGATGCCGATATTGTGCTTACTGTTTTAT
TTTGATGCTCGCCGCCACTGGCAGACTACTATGATTTGTTTTTATTGTCG
ATACTGAGGCACGCGATGACCGATACCAGAGATTGTAATTATTTTAATAA
ATTATTGTTTCTTAAAAAAAA
back to top

protein sequence of SMED30019167-orf-1

>SMED30019167-orf-1 ID=SMED30019167-orf-1|Name=SMED30019167-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2543bp
MKKTVNSLKNKKIENNSSQIQIKCDNQQINISELVKPIDFESVYLQNKNN
ISNDPNRVLVKIPDNDVKINKVSRKETVYNNGVPTNIHEIFDCNLLAKLC
VDFYTSEWTATCYKDFTYNSSFWTLPNVHNQLTMAKEQKFIIDEDSEKDD
ESLLTFKTKGSYFESNLAICDRNAYQKHLKHREDELANTSSNAGINYSKA
AVPELLSFSLNELSDGSTVLKESMPRDGHEQIIVYLDNVDSLRELGGYWI
LLSFKGKQSESYLFTGGNDNQKLWANKLKDAIESETKTKQIERPVSSESI
ERSEETVHGMLSKFLQENEQSAVILRKKDHQKILVIYSEIRNQIKMKSQQ
TPIYDIGIIEKSQLDDCHIRPQVEQSIPKTFIKLTANRFITSVGISDENS
NPKGVIPAEPFFISFSLFHIADGRRISEEFYWNPNRPQIEDLLPSDLFAY
KFGGHPVHATINGNCDNRTPLNLPTMSDRVLQSTNSFILKVPCLPDKICL
FIKSEKVFSGAIGPTVDKYIKSGGSLLKKKDREEELFVENPDVKTGASIN
KTMSVYCANIGHYRMPFGWTACRLNIKGKNCLRFHKYENNKTSEDDIIKL
VQNMSSQHVDNNASKYTTIPSFVELSFEELSEDKINNMTDVVNYELVGKS
RSEFSNASSCCKEVKDFIFDIPKSGNAANHPGNTLRNTYNPDSLSLSSKP
NSSYGSTASLQHYSDDNSPGDVTPPGKFNFSNSQIKSINQMKVNSSSLGR
INGLESSQHKSFDYSDHDINYYENINQEELVAPNLDFIHTLYIYPRTLNF
SNQNVFHRARNLSCFVELRDVDKSDAPPLKVFYSRPSRKQPAFDYWSNTS
VIYHDSSPTFNEEIKIALPLNLHSKHHLLFRFYHVSCDTAAIPNVREKGS
NKKSLETPVGVTWLTLMDQNLNLKSGSFSLPVATQLVPDYLEEKQQSIYY
KKDSLWKLSTSFGQPKPRNSSTDKVIDESVNKRHSGPTFKSYINPRSSRD
LEDIFSIKSDDVEQSHDTTVQWVDGQKSIFTVVIRPETTIFTQSTHLHKF
FQVCSEKLDELTNPTVVEKKESIFTKPRSGSDPTTPKPVSDDTLLLQTSN
KDVEIKNAIKALATVNVTNLIKFFAPTFNQLLHVVVCTAISHSEISKTAV
TSMITLASSLRTPSMESLSSKATKRNTKIIKSYIKFAFDAEKIVPTKVKR
TVHESLIQAISELIRPPFRDTNFVNSFLFNSFLFYSIITKSMIQSLTKQS
KITIDKGGDKFFSTSYMDSLQNMIHLIINCILEITSTVGNQSGMNGQLRP
NNSFQSLATSANKDLARFISRLFNVMDRGFIFQIIHQYMKIFIARINAYS
GHREHLCRMKFDFLEIVTNHEHYLPLNLLKIINPSDKGQSVRKRQAPPSL
ELILSETYCRQHYLAGLLLQEVHRQMSDVYSHNAVRRLPFVMLRNLLAKH
LFDDRYSSINMQARIAALYLPLVSIILENQKSFSLPGNLHTKVNLLNDIY
DHSDRSLSARPLSTLSGDTLSTHSSINGSSGDGAGGSVYGLGFGTNSSKS
ARSSQVYLGKDGHVEDHWLKQIAGLTDGGNIRTLSTRRKVDSDTSSVHST
STLTGLDEMHESGDTNSLDDEMVIHSKVPLNSESVVKRSSLQRPPVSNSN
SWGRKAGLSLNIKKSVAPTHPSQRASILNKASNKNHETKSSIYLNDKTQK
DIFVCLLHIFHTISSDDLKATICNLTVQERLEFLQLLILSIHHLKYQGRK
VINNFESISTGCAKSKIQLRPHGPRSSVTAILDDVDHGDHKAYLEGNVST
EVGLIVLDVLSAYCSAFKQEILTYTPDHVIFKKIVDIYLTLLSVNQSEIV
LKHVFVSMRVFVSTFAKVLFANCHNVISDLSLHTLRFLDTRFTSVRIEAC
GFLYRMMRSSYDTFNKPGINRVHLQMIVAVSKLDRTVGIRFKESLNYLKR
LAEIEMQKSQSSSINKSRSGTPTGTSKSITIGVHSTTKLSMQTFFEEVTD
LTQRIRTVLMATVQMNEHVDDPEMQVDLQYSLAKSYSSNPALRRTWLEKI
YAIHNKNNSRAEMAMCKAHIVAMIVEYLRRKEQYSMSCANFKAISPNIPL
EESGMRDDSVQLEVHYTKEEVVKLLRELAHEFDAGCLWEVLRHVYKLVIP
IYERKRDYEQLAEIYKHMSDGYNKIKTAESTNQRIIGSYYRVVLYGKPFD
SLAGKVFIYRLDSGKQFCVVREELQKLFSKKYGAGKVQMLVENHIDRSKL
DPELASIQVTHVEPFFNEDEELERHSMFERQYNISKFMLETPFVKMNHVE
HESRWKKYKEHDIDGVLKSKQTDDLSIQWKRRTILTVEASFPHLKRRLEV
ISIKEIDFSPIERAIDEIQLKNRQLAMHLAYNKSTTISKSSSSLAVSNSN
QTVGSSQTRANNIPLLMDMHMSGALLPQVNQGPMAYARVFLHKETQANYS
QEKVKQLKIQFMEFLTLCYLLLRDFNELMSHIQQQKYIAMREALDSYRVE
LSNLINEEICVFEDISVISTSALSDDVKRSLQKRSSQENGSI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR027007DHR-1_domain
IPR021816DOCK_C/D_N
IPR010703DOCK_C
IPR027357DHR-2
Vocabulary: molecular function
TermDefinition
GO:0005085guanyl-nucleotide exchange factor activity
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
Vocabulary: biological process
TermDefinition
GO:0007264small GTPase mediated signal transduction
GO:0043547positive regulation of GTPase activity