Snake venom serine protease 1

Overview
NameSnake venom serine protease 1
Smed IDSMED30019162
Length (bp)802
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Snake venom serine protease 1 (SMED30019162) t-SNE clustered cells

Violin plots show distribution of expression levels for Snake venom serine protease 1 (SMED30019162) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Snake venom serine protease 1 (SMED30019162) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Snake venom serine protease 1 (SMED30019162) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019162

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30019162h1SMcG0002480 dd_Smed_v4_5109_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30019162h1SMcG0002480 dd_Smed_v4_5109_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30019162h1SMcG0002480 dd_Smed_v4_5109_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30019162h1SMcG0002480 dd_Smed_v4_5109_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Snake venom serine protease 1 vs. Ensembl Fly
Match: CG17475 (gene:FBgn0038481 transcript:FBtr0346149)

HSP 1 Score: 54.299 bits (129), Expect = 2.790e-8
Identity = 45/177 (25.42%), Postives = 82/177 (46.33%), Query Frame = 3
Query:  186 GTGFCSGSIINQWKIVTAAHWIHKRHNIYIQPYNHRMLNISKNKIVRCHFMKEFIKNCLIEKPNNICYNDLSICTVDKKIIFNKYIQPASISTTFHGNNLSVYFLGYGS-DLFGTNTYRLRQKYAT----------INSCDSNKL--YCSYSVHSKPDVSPGDSGGPVIYKNKQIGI 677
            G   C G II++  ++TAAH ++  +  Y++        +   K    +F++E   +C    P+   +ND+++  ++  I FN+Y QPA + T    N   +   G+GS +L+G     L++ Y T          +N+  SN     C+ +   +     GDSGGP+ +     G+
Sbjct:   72 GGHICGGCIIDERHVLTAAHCVYGYNPTYLRVITG---TVEYEKPDAVYFVEEHWIHCNYNSPDY--HNDIALIRLNDTIKFNEYTQPAELPTAPVANGTQLLLTGWGSTELWGDTPDILQKAYLTHVVYSTCQEIMNNDPSNGPCHICTLTTGGQ-GACHGDSGGPLTHNGVLYGL 242          
BLAST of Snake venom serine protease 1 vs. Ensembl Fly
Match: CG17475 (gene:FBgn0038481 transcript:FBtr0083417)

HSP 1 Score: 54.299 bits (129), Expect = 2.790e-8
Identity = 45/177 (25.42%), Postives = 82/177 (46.33%), Query Frame = 3
Query:  186 GTGFCSGSIINQWKIVTAAHWIHKRHNIYIQPYNHRMLNISKNKIVRCHFMKEFIKNCLIEKPNNICYNDLSICTVDKKIIFNKYIQPASISTTFHGNNLSVYFLGYGS-DLFGTNTYRLRQKYAT----------INSCDSNKL--YCSYSVHSKPDVSPGDSGGPVIYKNKQIGI 677
            G   C G II++  ++TAAH ++  +  Y++        +   K    +F++E   +C    P+   +ND+++  ++  I FN+Y QPA + T    N   +   G+GS +L+G     L++ Y T          +N+  SN     C+ +   +     GDSGGP+ +     G+
Sbjct:   72 GGHICGGCIIDERHVLTAAHCVYGYNPTYLRVITG---TVEYEKPDAVYFVEEHWIHCNYNSPDY--HNDIALIRLNDTIKFNEYTQPAELPTAPVANGTQLLLTGWGSTELWGDTPDILQKAYLTHVVYSTCQEIMNNDPSNGPCHICTLTTGGQ-GACHGDSGGPLTHNGVLYGL 242          
BLAST of Snake venom serine protease 1 vs. Ensembl Fly
Match: CG31265 (gene:FBgn0051265 transcript:FBtr0083402)

HSP 1 Score: 50.0618 bits (118), Expect = 5.522e-7
Identity = 43/182 (23.63%), Postives = 84/182 (46.15%), Query Frame = 3
Query:  186 GTGFCSGSIINQWKIVTAAHWIHKRHNIYIQPYNHRMLNI--SKNKIVR---CHFMKEFIKNCLIEKPNNICYNDLSICTVDKKIIFNKYIQPASISTTFHGNNLSVYFLGYGSDL-FGTNTYRLR----------QKYATINSCDSNKL--YCSYSVHSKPDVSPGDSGGPVIYKNKQIGI 677
            G+  C G+I+N+  I+TA H +          +   ++N+    NK       ++  E  K+C+ ++P    +ND+++  + + I FN+  QP ++ T        +   G+GSD+ +G++   L           + Y T N   S  +   C++S   +     GDSGGP++   + +G+
Sbjct:   59 GSHNCGGAILNENWIITAGHCVEN--------FIPALVNVITGTNKWAEPGAIYYTAEIHKHCMYDQP--YMHNDIALVKLTENITFNELTQPIALPTRPVQLGEEIVLTGWGSDVAYGSSMEDLHKLTVGLVPLDECYETFNRTSSMGVGHICTFSREGE-GACHGDSGGPLVSNGQLVGV 229          
BLAST of Snake venom serine protease 1 vs. Ensembl Fly
Match: lambdaTry (gene:FBgn0043470 transcript:FBtr0088121)

HSP 1 Score: 49.2914 bits (116), Expect = 1.048e-6
Identity = 43/180 (23.89%), Postives = 74/180 (41.11%), Query Frame = 3
Query:  183 KGTGFCSGSIINQWKIVTAAHWIHKRHNIYIQPYNHRMLNISKNKIVRCHFMKEFIKNCLIEKPNNICYN---DLSICTVDKKIIFNKYIQPASISTTFHGNNLSVYFLGYGSDLFGTNTYRLRQKYATINSCD------------SNKLYCSYSVHSKPDVSPGDSGGPVIYKNKQIGI 677
            +G   C G+I    +I++AAH +    N    P N  ++  S N        +E     +I  P     N   D +I  +D    FN  +QP  ++     ++  V   G+G+   G     + Q+  ++N  D            ++++ C+       D   GDSGGP++Y N  +GI
Sbjct:   56 RGNHRCGGTIYRSNQIISAAHCV----NTLSGPENLTIVAGSSNIWFPTGPQQELEVREIIIHPKYRTLNNDYDAAILILDGDFEFNDAVQPIELAKERPDHDTPVTVTGWGTTSEGGTISDVLQE-VSVNVVDNSNCKNAYSIMLTSRMLCAGVNGGGKDACQGDSGGPLVYNNTLLGI 230          
BLAST of Snake venom serine protease 1 vs. Ensembl Fly
Match: CG9372 (gene:FBgn0036891 transcript:FBtr0074945)

HSP 1 Score: 47.7506 bits (112), Expect = 5.673e-6
Identity = 44/171 (25.73%), Postives = 74/171 (43.27%), Query Frame = 3
Query:  195 FCSGSIINQWKIVTAAHWIHKR--HNIYIQ--PYNHRMLNISKNKIVRCHFMKEFIKNCLIEKPNNICYNDLSICTVDKKIIFNKYIQPASISTTFHG-NNLSVYFLGYGSDLFGTN----TYRLRQKYATINSCDS-------NKLYCSYSVHSKPDVSPGDSGGPVIYK 659
            +C G +I    ++TAAH I+K+   +I+++   YN  MLN ++ +  R   M   I       P N   ND++I  +D+  IFN YI P  +       ++ +    G+G+  FG         +       + C S       +   C+       D   GDSGGP++ +
Sbjct:  200 WCGGVLITDRHVLTAAHCIYKKNKEDIFVRLGEYNTHMLNETRARDFRIANMVLHIDY----NPQNY-DNDIAIVRIDRATIFNTYIWPVCMPPVNEDWSDRNAIVTGWGTQKFGGPHSNILMEVNLPVWKQSDCRSSFVQHVPDTAMCAGFPEGGQDSCQGDSGGPLLVQ 365          
BLAST of Snake venom serine protease 1 vs. Ensembl Zebrafish
Match: zgc:100868 (zgc:100868 [Source:ZFIN;Acc:ZDB-GENE-040801-33])

HSP 1 Score: 51.9878 bits (123), Expect = 2.750e-7
Identity = 50/188 (26.60%), Postives = 84/188 (44.68%), Query Frame = 3
Query:  177 QKKGTGFCSGSIINQWKIVTAAHWIHKRHNIYIQPYNHRMLNISKNKIVRCHFMKEFIKNCLIEKPN---NICYNDLSICTVDKKIIFNKYIQP----ASISTTFHGNNLSVYFLGYGSDLFGT---NTYRLRQKYATI---NSCD--------SNKLYCSYSVHSKPDVSPGDSGGPVIYKNKQIGI 677
            Q+ G+ FC GS+IN   I+TAAH         +  Y    L + K      + M   + N +I+ PN   +   ND+++  +   + F+ YI+P    AS ST F+G    V+  G+G+   G    +   L++    I     C+        ++ + C+  +    D   GDSGGP++ K   + I
Sbjct:   55 QRDGSHFCGGSLINNQWILTAAHCFPNPSTTGLLVY----LGLQKLASFESYSMSSAVSN-IIKHPNYNSDTEDNDITLLQLASTVSFSNYIRPICLAASDSTFFNGT--LVWITGWGNTATGVSLPSPGTLQEVQVPIVGNRKCNCLYGVSKITDNMVCAGLLQGGKDSCQGDSGGPMVSKQGSVWI 235          
BLAST of Snake venom serine protease 1 vs. Ensembl Zebrafish
Match: zgc:100868 (zgc:100868 [Source:ZFIN;Acc:ZDB-GENE-040801-33])

HSP 1 Score: 51.9878 bits (123), Expect = 3.450e-7
Identity = 50/188 (26.60%), Postives = 84/188 (44.68%), Query Frame = 3
Query:  177 QKKGTGFCSGSIINQWKIVTAAHWIHKRHNIYIQPYNHRMLNISKNKIVRCHFMKEFIKNCLIEKPN---NICYNDLSICTVDKKIIFNKYIQP----ASISTTFHGNNLSVYFLGYGSDLFGT---NTYRLRQKYATI---NSCD--------SNKLYCSYSVHSKPDVSPGDSGGPVIYKNKQIGI 677
            Q+ G+ FC GS+IN   I+TAAH         +  Y    L + K      + M   + N +I+ PN   +   ND+++  +   + F+ YI+P    AS ST F+G    V+  G+G+   G    +   L++    I     C+        ++ + C+  +    D   GDSGGP++ K   + I
Sbjct:   55 QRDGSHFCGGSLINNQWILTAAHCFPNPSTTGLLVY----LGLQKLASFESYSMSSAVSN-IIKHPNYNSDTEDNDITLLQLASTVSFSNYIRPICLAASDSTFFNGT--LVWITGWGNTATGVSLPSPGTLQEVQVPIVGNRKCNCLYGVSKITDNMVCAGLLQGGKDSCQGDSGGPMVSKQGSVWI 235          
BLAST of Snake venom serine protease 1 vs. Ensembl Zebrafish
Match: st14a (suppression of tumorigenicity 14a [Source:ZFIN;Acc:ZDB-GENE-030131-6496])

HSP 1 Score: 51.2174 bits (121), Expect = 7.255e-7
Identity = 53/174 (30.46%), Postives = 80/174 (45.98%), Query Frame = 3
Query:  198 CSGSIINQWKIVTAAHWIHKRHNI-YIQPYNHRM---LNISKNKIVRCHFMKEFIKNCLIEKP--NNICY-NDLSICTVDKKIIFNKYIQPASIST---TFHGNNLSVYFLGYGSDLFGTNTYRLRQKYAT--INSCDSNKLY---------CSYSVHSKPDVSPGDSGGPVIY 656
            C GSIIN+  IVTAAH +     I Y QP    +   L+  K+K+      K  +K  +I  P  N   Y ND+++  ++  + F+  I+P  + T   TF     SV+  G+G+   G +   + QK     INS   N+L          C+  +    D   GDSGGP+ +
Sbjct:  623 CGGSIINERWIVTAAHCVQDDVKIKYSQPGTWEVFLGLHSQKDKLTA---TKRLLKQ-VIPHPYYNAYTYDNDIALMEMESPVTFSDTIRPVCLPTATDTFPAGT-SVFISGWGATREGGSGATVLQKAEVRIINSTVCNQLMGGQITSRMTCAGVLSGGVDACQGDSGGPLSF 791          
BLAST of Snake venom serine protease 1 vs. Ensembl Zebrafish
Match: st14a (suppression of tumorigenicity 14a [Source:ZFIN;Acc:ZDB-GENE-030131-6496])

HSP 1 Score: 51.2174 bits (121), Expect = 7.255e-7
Identity = 53/174 (30.46%), Postives = 80/174 (45.98%), Query Frame = 3
Query:  198 CSGSIINQWKIVTAAHWIHKRHNI-YIQPYNHRM---LNISKNKIVRCHFMKEFIKNCLIEKP--NNICY-NDLSICTVDKKIIFNKYIQPASIST---TFHGNNLSVYFLGYGSDLFGTNTYRLRQKYAT--INSCDSNKLY---------CSYSVHSKPDVSPGDSGGPVIY 656
            C GSIIN+  IVTAAH +     I Y QP    +   L+  K+K+      K  +K  +I  P  N   Y ND+++  ++  + F+  I+P  + T   TF     SV+  G+G+   G +   + QK     INS   N+L          C+  +    D   GDSGGP+ +
Sbjct:  623 CGGSIINERWIVTAAHCVQDDVKIKYSQPGTWEVFLGLHSQKDKLTA---TKRLLKQ-VIPHPYYNAYTYDNDIALMEMESPVTFSDTIRPVCLPTATDTFPAGT-SVFISGWGATREGGSGATVLQKAEVRIINSTVCNQLMGGQITSRMTCAGVLSGGVDACQGDSGGPLSF 791          
BLAST of Snake venom serine protease 1 vs. Ensembl Zebrafish
Match: prss59.1 (serine protease 59, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-030131-1173])

HSP 1 Score: 49.2914 bits (116), Expect = 1.346e-6
Identity = 42/176 (23.86%), Postives = 81/176 (46.02%), Query Frame = 3
Query:  195 FCSGSIINQWKIVTAAHWIHKRHNIYIQPYNHRMLNISKNKIVRCHFMKEFIKNC-LIEKPNNICYN---DLSICTVDKKIIFNKYIQPASISTTFHGNNLSVYFLGYGSDLFGT-NTYRLRQKYATINS---CD-------SNKLYCSYSVHSKPDVSPGDSGGPVIYKNKQIGI 677
            FC GS+++++ +V+AAH    R  + +  +N          IV     ++FI +  +I  PN   ++   D+ +  + K    NKY+QP ++      +       G+G+ +  T ++ +L+     I S   C+       ++ ++C+  +    D   GDSGGPV+   +  GI
Sbjct:   52 FCGGSLVSEYWVVSAAHCYKSRVEVRLGEHN----------IVINEGTEQFITSEKVIRNPNYDSWDLDSDIMLIKLSKPATLNKYVQPVALPNGCAADGTMCRVSGWGNTMSSTADSNKLQCLEIPILSDRDCNNSYPGMITDTMFCAGYLEGGKDSCQGDSGGPVVCNGELHGI 217          
BLAST of Snake venom serine protease 1 vs. Ensembl Xenopus
Match: comp (cartilage oligomeric matrix protein [Source:Xenbase;Acc:XB-GENE-994160])

HSP 1 Score: 52.373 bits (124), Expect = 2.480e-7
Identity = 50/193 (25.91%), Postives = 80/193 (41.45%), Query Frame = 3
Query:  180 KKGTGFCSGSIINQWKIVTAAHWIHKRHNIYIQPYNHRMLNISKNKIVRCHFMKEFIKNCLIEKPNNICYNDLSICTVDKKIIFNKYIQPASISTTFHG--NNLSVYFLGYG----SDLFGTNTYRLRQKYATINSCDSNKL--------------YCSYSVHSKPDVSPGDSGGPVIYKNKQ------IGIT 680
            K+ +  C GS++N+  ++TAAH       +     N ++L  S    V+   +KE ++            ND+++  +DK I+F  Y+QPA   T F         Y  G+G       F      L Q+ A ++  DSNK                C+       D   GDSGGP++ K ++      +GIT
Sbjct:   73 KEFSHLCGGSVLNEIWVLTAAHCFKHLERLVFGANNLKVLESS----VQMRRIKEVVQPKAYNPTTEA--NDITLLRLDKPIVFTDYVQPACFPTEFANVEKKTDYYIAGWGVLDEEFKFSGEPSELLQE-ARVHQIDSNKCNSKDWYDGAIGEYNLCAGHEKGGIDSCQGDSGGPLMCKTQKSRTYAVVGIT 258          
BLAST of Snake venom serine protease 1 vs. Ensembl Xenopus
Match: comp (cartilage oligomeric matrix protein [Source:Xenbase;Acc:XB-GENE-994160])

HSP 1 Score: 51.9878 bits (123), Expect = 3.350e-7
Identity = 53/192 (27.60%), Postives = 77/192 (40.10%), Query Frame = 3
Query:  195 FCSGSIINQWKIVTAAHWIHKRHNIYIQPYNHRMLNISKN--KIVRCHFMKEFIKNCLIEKPNNIC--YNDLSICTVDKKIIFNKYIQPASISTTFHG--NNLSVYFLGYG----SDLFGTNTYRLRQKYATINSCDSNKL--------------YCSYSVHSKPDVSPGDSGGPVIYKNKQ------IGIT 680
             C GS++N+  ++TAAH   K      Q  N   L    N  K++        IK  +  K  N     ND+++  +DK I+F  Y+QPA   T F         Y  G+G       F      L Q+ A ++  DSNK                C+       D   GDSGGP++ K ++      +GIT
Sbjct:   64 LCGGSVLNEIWVLTAAHCFKK------QKTNSLRLVFGANNLKVLESSVQMRRIKEVVQPKAYNPTTEANDITLLRLDKPIVFTDYVQPACFPTEFANVEKKTDYYIAGWGVLDEEFKFSGEPSELLQE-ARVHQIDSNKCNSKDWYDGAIGEYNLCAGHEKGGIDSCQGDSGGPLMCKTQKSRTYAVVGIT 248          
BLAST of Snake venom serine protease 1 vs. Ensembl Xenopus
Match: fus (FUS RNA binding protein [Source:Xenbase;Acc:XB-GENE-495119])

HSP 1 Score: 51.9878 bits (123), Expect = 4.225e-7
Identity = 49/184 (26.63%), Postives = 80/184 (43.48%), Query Frame = 3
Query:  195 FCSGSIINQWKIVTAAHWIHKRHNIYIQPYNHRMLNISKNKIVRCHFMKEFIKNCLIEKPNNICYNDLSICTVDKKIIFNKYIQPASISTTFHG--NNLSVYFLGYG--SDLFGTNTYRLRQ-KYATINS--CDSNKLY---------CSYSVHSKPDVSPGDSGGPVIYKNKQ------IGIT 680
             C GS++N+  ++TAAH       +     N ++L  S    V+   +KE I+            ND+++  +DK I+F  Y+QPA   T F         Y  G+G   +  G  +  L++ +   I+S  C+S   Y         C+       D   GDSGGP++ K ++      +GIT
Sbjct:   64 LCGGSVLNEIWVLTAAHCFKHLQRLVFGANNLKVLESS----VQIRKIKEVIQPKAYNPTTEA--NDITLLRLDKPIVFTDYVQPACFPTEFANVEKKTDCYIAGWGVLDEESGEPSEILQEARVHQIDSKKCNSKDWYDGAIGEYNLCAGHEKGGIDSCQGDSGGPLMCKTQKSRTYAVVGIT 241          
BLAST of Snake venom serine protease 1 vs. Ensembl Xenopus
Match: ENSXETT00000035256.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:KV461533.1:11712:13373:1 gene:ENSXETG00000011244.1 transcript:ENSXETT00000035256.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 49.6766 bits (117), Expect = 1.474e-6
Identity = 50/187 (26.74%), Postives = 82/187 (43.85%), Query Frame = 3
Query:  195 FCSGSIINQWKIVTAAHWIHKRHNIYIQPYNHRMLNISKN-KIVRCHFMKEFIKNCLIEKPNNIC--YNDLSICTVDKKIIFNKYIQPASISTTFHG--NNLSVYFLGYG--SDLFGTNTYRLRQ-KYATINS--CDSNKLY---------CSYSVHSKPDVSPGDSGGPVIYKNKQ------IGIT 680
             C GS++N+  ++TAAH   K         + R++  + N K++        IK  +  K  N     ND+++  +DK I+F  Y+QPA   T F         Y  G+G   +  G  +  L++ +   I+S  C+S   Y         C+       D   GDSGGP++ K ++      +GIT
Sbjct:   59 LCGGSVLNEIWVLTAAHCFKKEET-----KSWRLVFGANNLKVLESSVQIRKIKEVVQPKAYNPTTEANDITLLRLDKPIVFTDYVQPACFPTEFANVEKKTDCYIAGWGVLDEESGEPSEILQEARVHQIDSKKCNSKDWYDGSIGEYNLCAGHEKGGIDSCQGDSGGPLMCKTQKSRTYAVVGIT 240          
BLAST of Snake venom serine protease 1 vs. Ensembl Xenopus
Match: ENSXETT00000055749.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:2:57548386:57550995:-1 gene:ENSXETG00000017081.1 transcript:ENSXETT00000055749.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.0618 bits (118), Expect = 1.516e-6
Identity = 44/172 (25.58%), Postives = 77/172 (44.77%), Query Frame = 3
Query:  198 CSGSIINQWKIVTAAHWIHK-RHNIYIQPYNHRMLNISK-NKIVRCHFMKEFIKNCLIEKPNNICYNDLSICTVDKKIIFNKYIQPASI----STTFHGNNLSVYFLGYGSDLFGTNTYRLRQKYATI---NSCDSNKLY---------CSYSVHSKPDVSPGDSGGPVIYK 659
            C G+++N   ++TAAH + K +    +      + N+S      +   +KE I++    K  N   ND+++  +D+ + F+ YIQPA +    S     N+  +   G   D F   T  L++    +   + C+ +  Y         C+   H  PD   GDSGGP++ K
Sbjct:   52 CGGTVLNHHWVMTAAHCLLKYQSEQSLARIVFGLFNVSDLGPETQIRKIKEMIRHEHFNKKEN--KNDIALIYLDRPVAFSDYIQPACLPQQSSDITRMNDCYIAGWGLVDDYFRIRTDVLQEAKTELIANSRCNQSDWYNGRIKEYNLCAGFEHGGPDTCDGDSGGPLMCK 221          
BLAST of Snake venom serine protease 1 vs. UniProt/SwissProt
Match: sp|P35032|TRY2_SALSA (Trypsin-2 (Fragment) OS=Salmo salar OX=8030 PE=2 SV=1)

HSP 1 Score: 53.5286 bits (127), Expect = 3.266e-7
Identity = 46/192 (23.96%), Postives = 83/192 (43.23%), Query Frame = 3
Query:  147 HFIHMLSGY*QKKGTGFCSGSIINQWKIVTAAHWIHKRHNIYIQPYNHRMLNISKNKIVRCHFMKEFIKNC-LIEKPNNICY---NDLSICTVDKKIIFNKYIQPASISTTFHGNNLSVYFLGYGSDLFGTNTYRLRQ----KYATINSCD-------SNKLYCSYSVHSKPDVSPGDSGGPVIYKNKQIGI 677
            H + + SGY       FC GS++N+  +V+AAH    R  + +  +N ++   S          ++FI +  +I  PN   Y   ND+ +  + K    N Y+QP ++ T+           G+G+ +  T      Q       + + C+       +N ++C+  +    D   GDSGGPV+   +  G+
Sbjct:   23 HQVSLNSGY------HFCGGSLVNENWVVSAAHCYQSRVEVRLGEHNIQVTEGS----------EQFISSSRVIRHPNYSSYNIDNDIMLIKLSKPATLNTYVQPVALPTSCAPAGTMCTVSGWGNTMSSTADKNKLQCLNIPILSYSDCNNSYPGMITNAMFCAGYLEGGKDSCQGDSGGPVVCNGELQGV 198          
BLAST of Snake venom serine protease 1 vs. UniProt/SwissProt
Match: sp|P35031|TRY1_SALSA (Trypsin-1 OS=Salmo salar OX=8030 PE=1 SV=1)

HSP 1 Score: 53.1434 bits (126), Expect = 4.365e-7
Identity = 46/192 (23.96%), Postives = 83/192 (43.23%), Query Frame = 3
Query:  147 HFIHMLSGY*QKKGTGFCSGSIINQWKIVTAAHWIHKRHNIYIQPYNHRMLNISKNKIVRCHFMKEFIKNC-LIEKPNNICY---NDLSICTVDKKIIFNKYIQPASISTTFHGNNLSVYFLGYGSDLFGTNTYRLRQ----KYATINSCD-------SNKLYCSYSVHSKPDVSPGDSGGPVIYKNKQIGI 677
            H + + SGY       FC GS++N+  +V+AAH    R  + +  +N ++   S          ++FI +  +I  PN   Y   ND+ +  + K    N Y+QP ++ T+           G+G+ +  T      Q       + + C+       +N ++C+  +    D   GDSGGPV+   +  G+
Sbjct:   34 HQVSLNSGY------HFCGGSLVNENWVVSAAHCYKSRVEVRLGEHNIKVTEGS----------EQFISSSRVIRHPNYSSYNIDNDIMLIKLSKPATLNTYVQPVALPTSCAPAGTMCTVSGWGNTMSSTADSNKLQCLNIPILSYSDCNNSYPGMITNAMFCAGYLEGGKDSCQGDSGGPVVCNGELQGV 209          
BLAST of Snake venom serine protease 1 vs. UniProt/SwissProt
Match: sp|Q804X6|FA9_CHICK (Coagulation factor IX OS=Gallus gallus OX=9031 GN=F9 PE=2 SV=1)

HSP 1 Score: 53.1434 bits (126), Expect = 9.067e-7
Identity = 42/172 (24.42%), Postives = 74/172 (43.02%), Query Frame = 3
Query:  183 KGTGFCSGSIINQWKIVTAAHWIHKRHNI--YIQPYNHRMLNISKNKIVRCHFMKEFIKNCLIEKPNNICYNDLSICTVDKKIIFNKYIQPASISTTFHGNNL------------SVYFLGYGSDLFGTNTYRLRQKYATINSCDS---NKLYCSYSVHSKPDVSPGDSGGP 647
            +G GFC GSIIN+  +VTAAH +    N+      YN +  + ++ +      +     N    +  N  +ND+++  +D+ + FN Y+ P  I +    NNL            S+ + G  + +    T     +   + S  +   + ++C+       D   GDSGGP
Sbjct:  257 RGLGFCGGSIINEKWVVTAAHCLEPGDNVTAVAGEYNTKEDDHTEQRRQVVKILPYPTYN----RTRNKHHNDIALLELDQPLTFNSYVTPICIGSRDFTNNLLSNGPGTVSGWGSMLYRGRSAIVLQVLTVPFVDRVTCLKSTSTTILHSMFCAGYTAGGKDTCGGDSGGP 424          
BLAST of Snake venom serine protease 1 vs. TrEMBL
Match: B4M3T0 (Peptidase S1 domain-containing protein OS=Drosophila virilis OX=7244 GN=Dvir\GJ18895 PE=3 SV=1)

HSP 1 Score: 62.003 bits (149), Expect = 1.347e-7
Identity = 50/196 (25.51%), Postives = 90/196 (45.92%), Query Frame = 3
Query:  129 TKLYFEHFIHMLSGY*QKKGTGFCSGSIINQWKIVTAAHWI---HKRHNIYIQPYNHRMLNISKNKIVRCHFMKEFIKNCLIEKPNNICYNDLSICTVDKKIIFNKYIQPASISTTFHGNNLSVYFLGYGSDLFGTNTYRLRQ----KYATINSCDSNKLYCSYSV-----HSKPDVSPGDSGGPVIYKNKQIGIT 680
            T+  F H I + +G      +  C GSII++  ++TAAH +        + IQP +   +    N  ++   + + ++  + E   N   ND++I  V+   I++  IQP ++ T +  ++  +   G+G    G +  R  Q    K  ++  CDS   Y   ++      +   V  GDSGGP +Y N+ +GI 
Sbjct:   35 TQAQFPHQISLRNG-----DSHSCGGSIISRNWVLTAAHCVSYEDANGELVIQPASRYSIRAGSNDRLKGGVLLQVVEIIVHEDYGNF-LNDVAILRVEAPFIYSANIQPIALPTKYTPDDADIIVSGWGRLTQGGDVPRYLQWTTLKSLSLLECDSRIGYGYPNILCLLHEADNGVCNGDSGGPALYNNEVVGIA 224          
BLAST of Snake venom serine protease 1 vs. TrEMBL
Match: Q9W7Q6 (Trypsinogen 2 (Fragment) OS=Paralichthys olivaceus OX=8255 PE=2 SV=1)

HSP 1 Score: 61.2326 bits (147), Expect = 1.984e-7
Identity = 49/191 (25.65%), Postives = 87/191 (45.55%), Query Frame = 3
Query:  147 HFIHMLSGY*QKKGTGFCSGSIINQWKIVTAAHWIHKRHNIYIQPYNHRMLNISKNKIVRCHFMKEFIKNC-LIEKPNNICY---NDLSICTVDKKIIFNKYIQPASISTTFHGNNLSVYFLGYGSDLFGTNTYRLRQKYATINS---CD-------SNKLYCSYSVHSKPDVSPGDSGGPVIYKNKQIGI 677
            H + + SGY       FC GS++N+  +V+AAH    R  + I  +N R+   +          ++FI +  +I  PN   Y   ND+ +  + +    N+Y+QP ++ T+           G+G  +  T++ RL+     I S   C+       +N ++C+  +    D   GDSGGPV+   +  G+
Sbjct:   31 HQVSLNSGY------HFCGGSLVNENWVVSAAHCYKSRVEVRIGEHNLRVYEET----------EQFISSSRVIRHPNYSSYNINNDIMLIKLSEPATLNQYVQPVALPTSCAPAGTMCTVSGWGDTMSSTDSSRLQCLDLPILSERDCENSYPGMITNAMFCAGYLEGGKDSCQGDSGGPVVCNGQLQGV 205          
BLAST of Snake venom serine protease 1 vs. TrEMBL
Match: B0WH74 (Chymotrypsin-2 OS=Culex quinquefasciatus OX=7176 GN=6038213 PE=3 SV=1)

HSP 1 Score: 61.2326 bits (147), Expect = 2.422e-7
Identity = 51/198 (25.76%), Postives = 92/198 (46.46%), Query Frame = 3
Query:  129 TKLYFEHFIHMLSGY*QKKGTGFCSGSIINQWKIVTAAHWIHKRHNIYIQPYNHRMLNISKNKIVRCHFMKEFIKNCLIEKPNNICYNDLSICTVDKKIIFNKYIQPASIST----TFHGNNLSVYFLGYGS-DLFGTNTYRLRQ-KYATI-----NSCDSNKLYCSYSVHSKPDVS----PGDSGGPVIYKNKQIGI 677
            T    E +  M+S    + G+  C GSI+N+  ++TAAH +     +Y Q       ++S++     HF+++ I +     P+N   ND+++  +   ++F   IQP  + T        +N  V  +G+G  +  G    RL+Q  Y  +     N    + +Y S+   + P+       GDSGGP+++   Q+GI
Sbjct:   29 TDATIEDYPFMIS-LRSRTGSHSCGGSILNERWVLTAAHCVDYYSTVYYQSVQVGRSDVSRDVDESVHFIEDVIVHPHY-NPDNSYINDIALIRLKTTLVFGATIQPVQLPTLKWSEVEESNRDVTLIGWGRLESDGALPTRLQQVDYFAVPNEQCNEFHRSHIYPSHICAAVPEGGKGQCSGDSGGPLLHNGVQVGI 224          
BLAST of Snake venom serine protease 1 vs. TrEMBL
Match: A0A1B0CS98 (Uncharacterized protein OS=Lutzomyia longipalpis OX=7200 PE=3 SV=1)

HSP 1 Score: 62.7734 bits (151), Expect = 2.441e-7
Identity = 46/169 (27.22%), Postives = 83/169 (49.11%), Query Frame = 3
Query:  195 FCSGSIINQWKIVTAAHWIHKRHNIYIQPYNHRMLNISKNKIVRCHFMKEFIKNCLIEKPNNICYNDLSICTVDKKIIFNKYIQPASISTTFHGNNLSVYFLGYGSDLF-GTNTYRLRQ---KYATINSCDSNKL-------------YCSYSVHSKPDVSPGDSGGPV 650
            FC GS+I++  I+TAAH + +     ++   H +L+   N  V    ++  I + L        YND+++  ++K++ F K I+PA +S   + N+L +  +G+G   F GT +  L++   +Y + + C  + L              C+ S   + D   GDSGGP+
Sbjct:  678 FCGGSLISERYILTAAHCLTRATPTIVRLGEHNLLSHLGNDDVEDFGIESLIPHPLYH--TTSVYNDIALIKLNKRVKFKKNIRPACLSDEKNENHLGLIAIGWGDTSFSGTPSSILQEVALEYFSFDECSKDYLPVRRMKKGLQHTQLCAGSRSGEKDTCQGDSGGPL 844          
BLAST of Snake venom serine protease 1 vs. TrEMBL
Match: A0A1Q3FII4 (Putative trypsin OS=Culex tarsalis OX=7177 PE=3 SV=1)

HSP 1 Score: 61.2326 bits (147), Expect = 2.642e-7
Identity = 53/197 (26.90%), Postives = 90/197 (45.69%), Query Frame = 3
Query:  129 TKLYFEHFIHMLSGY*QKKGTGFCSGSIINQWKIVTAAHWIHKRHNIYIQPYNHRMLNISKNKIVRCHFMKEFIKNCLIEKPNNICYNDLSICTVDKKIIFNKYIQPASISTTFHGN--NLSVYFLGYGS-DLFGTNTYRLRQ-KYATI-----NSCDSNKLYCSYSVHSKPDVS----PGDSGGPVIYKNKQIGIT 680
            T    E +  M+S    + G+  C GSI+N+  I+TAAH +     +Y Q       ++S+      HF+++ I +     P N   ND+++  +   ++F+  +QP  + T       NL V  +G+G  +  G    RL+Q  Y  +     N    + +Y S+   + PD       GDSGGP++    Q+GI 
Sbjct:   29 TDATIEDYPFMIS-LRSRTGSHSCGGSILNERWILTAAHCVDYYSTVYYQSVQVGRSDVSREVDESVHFIEDVIIHPHY-NPGNSYVNDIALIRLKTPLVFSDTVQPVRLPTLKWSEVANLDVTLIGWGRLESDGDLPTRLQQVDYFVVPNDRCNEFHRSHIYPSHICAAVPDGGKGQCSGDSGGPLLSNGVQVGIV 223          
BLAST of Snake venom serine protease 1 vs. Ensembl Cavefish
Match: si:dkeyp-93a5.2 (si:dkeyp-93a5.2 [Source:ZFIN;Acc:ZDB-GENE-131127-18])

HSP 1 Score: 52.373 bits (124), Expect = 1.159e-7
Identity = 48/192 (25.00%), Postives = 81/192 (42.19%), Query Frame = 3
Query:  177 QKKGTGFCSGSIINQWKIVTAAHWIHKRHNIYIQPYNHRMLNISKNKIVRCHFMKEFIKNCLIEK--PNNICYNDLSICTVDKKIIFNKYIQP---ASISTTFHGNNLSVYFLGYGSDLFGT---NTYRLRQKYATI---NSCDS----------NKLYCSYSVHSKPDVSPGDSGGPVIYKNKQIGITIAY 689
            Q  G  FC GS+IN+  ++TAAH   K  ++ +      +   + N+I R       ++  ++ +    N   ND+++  +D  + FNK+I P   A+  ++F     S +  G+G    G    +   L++    I     C S          N + C+       D   GDSGGP++ K   I I   Y
Sbjct:   54 QSFGFHFCGGSLINKDWVLTAAHCFQKLKDVKVLLGKQTLTGSNPNQIQRG------VRKVIVHERYDPNTQDNDITLLQLDSSVTFNKFIMPVCLAAAGSSFPAATAS-WITGWGDIASGVSLPDPGLLQEAQVPIVDQKQCASLLSLFKMKITNNMICAGLKQGGKDTCQGDSGGPMVNKKSTIWIQSVY 238          
BLAST of Snake venom serine protease 1 vs. Ensembl Cavefish
Match: si:dkeyp-93a5.2 (si:dkeyp-93a5.2 [Source:ZFIN;Acc:ZDB-GENE-131127-18])

HSP 1 Score: 49.6766 bits (117), Expect = 8.784e-7
Identity = 48/203 (23.65%), Postives = 88/203 (43.35%), Query Frame = 3
Query:  177 QKKGTGFCSGSIINQWKIVTAAHWIHKRHNIYIQPYNHRMLNISKNKIVRCHFMKEFIKNCLIEK--PNNICYNDLSICTVDKKIIFNKYIQP---ASISTTFHGNNLSVYFLGYGSDLFGTNTYRLRQKYATINSCDSNKLYCSYSVHSKPDVSPGDSGGPVIYKNKQI----GITI--------AYLEKKVSLVLPFHIHN 734
            Q  G  FC GS+IN+  ++TAAH   K     +      +   + N+I R       ++  ++ +    N   ND+++  +D  + FNK+I P   A+  ++F     S +  G+G      + ++++          +N + C+       D   GDSGGP++ K   I    GIT+         ++ +K+   LP  + N
Sbjct:   36 QSFGFHFCGGSLINKDWVLTAAHCFQK----LVLLGKQTLTGSNPNQIQRG------VRKVIVHERYDPNTQDNDITLLQLDSSVTFNKFIMPVCLAAAGSSFPAATAS-WITGWGDIPDSHSLFKMK---------ITNNMICAGLKQGGKDTCQGDSGGPMVNKKSTIWIQSGITMYTRLSQYQGWISQKIIQNLPGFLQN 218          
BLAST of Snake venom serine protease 1 vs. Ensembl Cavefish
Match: st14a (suppression of tumorigenicity 14a [Source:ZFIN;Acc:ZDB-GENE-030131-6496])

HSP 1 Score: 48.9062 bits (115), Expect = 1.378e-6
Identity = 45/175 (25.71%), Postives = 82/175 (46.86%), Query Frame = 3
Query:  198 CSGSIINQWKIVTAAHWIHKRHNIYI-QPYNHRM-LNISKNKIVRCHFMKEFIKNCLIEKPNNICY---NDLSICTVDKKIIFNKYIQPASISTTFHG--NNLSVYFLGYGSDLFGTNTYRLRQKYAT--INS--CDS-------NKLYCSYSVHSKPDVSPGDSGGPVIYKNKQ 668
            C  SII++  +VTAAH +     + + QP +    L +   K +     K ++K  +I  PN   Y   ND+++  +++ + F   I+P  + +  +      +V+  G+G+   G +  ++ QK     INS  CDS       +++ C+  +    D   GDSGGP+   N +
Sbjct:   21 CGASIISEHWLVTAAHCVQDDAKVRLSQPGSWEAYLGLHDQKQLEVA-QKRYLKR-VIPHPNYNEYTFDNDIALMELEQPVTFTDTIRPICLPSASYDFPAGTTVWITGWGATREGGSGAKVLQKAQVRIINSTVCDSLMDGQITSRMTCAGVLSGGVDACQGDSGGPLSSSNGE 193          
BLAST of Snake venom serine protease 1 vs. Ensembl Cavefish
Match: si:dkeyp-93a5.2 (si:dkeyp-93a5.2 [Source:ZFIN;Acc:ZDB-GENE-131127-18])

HSP 1 Score: 47.3654 bits (111), Expect = 5.828e-6
Identity = 53/233 (22.75%), Postives = 98/233 (42.06%), Query Frame = 3
Query:  177 QKKGTGFCSGSIINQWKIVTAAHWIH--KRHNIYIQPYNHRMLNISKNKIVRCHFMKEFIKNCLIEK---PNNICYNDLSICTVDKKIIFNKYIQP---ASISTTFHGNNLSVYFLGYGSDLFGT---NTYRLRQKYATI---NSCDS----------NKLYCSYSVHSKPDVSPGDSGGPVIYKNKQI----GITI--------AYLEKKVSLVLPFHIHNDFINKDMAGTV 767
            Q  G  FC GS+IN+  ++TAAH        ++ +      +   + N+I R       ++  ++ +   PN    ND+++  +D  + FNK+I P   A+  ++F     S +  G+G    G    +   L++    I     C S          N + C+       D   GDSGGP++ K   I    GIT+         ++ +K+   LP  +   ++ +++ G +
Sbjct:   45 QSFGFHFCGGSLINKDWVLTAAHCFQNTNEKDVKVLLGKQTLTGSNPNQIQR------GVRKVIVHERYDPNTQ-DNDITLLQLDSSVTFNKFIMPVCLAAAGSSFPAATAS-WITGWGDIASGVSLPDPGLLQEAQVPIVDQKQCASLLSLFKMKITNNMICAGLKQGGKDTCQGDSGGPMVNKKSTIWIQSGITMYTRLSQYQGWISQKIIQNLPGFVKVIWVPREITGLI 269          
BLAST of Snake venom serine protease 1 vs. Ensembl Cavefish
Match: f10 (coagulation factor X [Source:ZFIN;Acc:ZDB-GENE-021206-9])

HSP 1 Score: 47.3654 bits (111), Expect = 7.505e-6
Identity = 42/174 (24.14%), Postives = 75/174 (43.10%), Query Frame = 3
Query:  192 GFCSGSIINQWKIVTAAHWIHKRHNIYIQPYNHRMLNISKNKIVRCHFMKEFIKNCLIEKPNNICYNDLSICTVDKKIIFNKYIQPASISTTFHGNNLSV-----YFLGYGSDLFGTNTYRLRQK----YATINSCD-------SNKLYCSYSVHSKPDVSPGDSGGPVIYKNK 665
            GFC G+I+N + I++AAH +++  +I +       L     ++   H + + + +  +       +ND+++  + K I F KYI PA +        + +        G+G    G     + QK    Y    +C        SN+++C+       D   GDSGGP + K K
Sbjct:  282 GFCGGTILNTYFILSAAHCMNQSRSITVILGEFDTLTREGREVT--HAVDQVLVH--MNYVPETYHNDIALIKLVKPITFTKYILPACLPERDFAERVLMQQEDGLVSGFGRVFEGGPQSTILQKLTVPYVDRATCMESTKFKISNRMFCAGYDQETKDACQGDSGGPHVTKYK 451          
BLAST of Snake venom serine protease 1 vs. Ensembl Sea Lamprey
Match: f10 (coagulation factor X [Source:ZFIN;Acc:ZDB-GENE-021206-9])

HSP 1 Score: 56.225 bits (134), Expect = 1.792e-9
Identity = 46/172 (26.74%), Postives = 79/172 (45.93%), Query Frame = 3
Query:  180 KKGTGFCSGSIINQWKIVTAAHWIHKRHNIYIQPYNHRMLNISKNKIVRCHFMKEFIKNCLIEKPNNICY-NDLSICTVDKKIIFNKYIQPASISTTFHGNNLSVYFLGYGSDLFGTNTYRLRQK--------YATINSCDSNK-------LYCSYSVHSKPDVSPGDSGGP 647
            KKG GFC G+I+++  ++TAAH I    +I I   ++R ++    + +    +K+ +   +  + NN  Y ND+++  + + I FNKY+ PA +      +N+    L   S         L+ K        Y  +  C  +        ++C+    SK D   GDSGGP
Sbjct:  245 KKGEGFCGGTILSREWVLTAAHCIPSEPDIVIVGEHNRTVSEPTEQTIS---IKQIV---MHNRFNNATYDNDIALLQMSEPIKFNKYVLPACLPEPDFADNVLKEELARISGWGYLRERGLKAKVLQTSFVPYQDMARCKESSSYTITKNMFCAGYSDSKTDACQGDSGGP 410          
BLAST of Snake venom serine protease 1 vs. Ensembl Medaka
Match: ENSORLT00000042451.1 (tryptase [Source:NCBI gene;Acc:101156896])

HSP 1 Score: 52.373 bits (124), Expect = 1.004e-7
Identity = 48/180 (26.67%), Postives = 77/180 (42.78%), Query Frame = 3
Query:  186 GTGFCSGSIINQWKIVTAAHWIHKRHNIYI-------QPYNHRMLNISKNKIVRCHFMKEFIKNCLIEKPNNICYNDLSICTVDKKIIFNKYIQP---ASISTTFHGNNLSVYFLGYGSDLFGTNTYRLRQKY----ATINSCDS------NKLYCSYSVHSKPDVSPGDSGGPVIYKNK 665
            GT  C GS+IN   I++AAH      N+ +       Q  N   +++S +KI+        +      + NN   NDL++  +   + FN YI P   A+  + F G   S +  G+G+   G       Q+      +   C+S      N++ C+       D   GDSGGP++ KN 
Sbjct:   24 GTALCGGSLINSQWILSAAHCFKSTSNVVVSLGRITEQGSNPHQVSLSVSKII--------VHPNYDSRTNN---NDLTLLKLASPVTFNDYISPVCLAAAGSDFPGGT-SSWVTGFGTLSSGGPLASTLQEVNIPIVSNTQCNSAYGGITNQMICAGLTTGGLDSCQGDSGGPLVIKNS 191          
BLAST of Snake venom serine protease 1 vs. Ensembl Medaka
Match: ENSORLT00000029624.1 (tryptase [Source:NCBI gene;Acc:101156896])

HSP 1 Score: 52.373 bits (124), Expect = 1.041e-7
Identity = 48/180 (26.67%), Postives = 77/180 (42.78%), Query Frame = 3
Query:  186 GTGFCSGSIINQWKIVTAAHWIHKRHNIYI-------QPYNHRMLNISKNKIVRCHFMKEFIKNCLIEKPNNICYNDLSICTVDKKIIFNKYIQP---ASISTTFHGNNLSVYFLGYGSDLFGTNTYRLRQKY----ATINSCDS------NKLYCSYSVHSKPDVSPGDSGGPVIYKNK 665
            GT  C GS+IN   I++AAH      N+ +       Q  N   +++S +KI+        +      + NN   NDL++  +   + FN YI P   A+  + F G   S +  G+G+   G       Q+      +   C+S      N++ C+       D   GDSGGP++ KN 
Sbjct:   45 GTALCGGSLINSQWILSAAHCFKSTSNVVVSLGRITEQGSNPHQVSLSVSKII--------VHPNYDSRTNN---NDLTLLKLASPVTFNDYISPVCLAAAGSDFPGGT-SSWVTGFGTLSSGGPLASTLQEVNIPIVSNTQCNSAYGGITNQMICAGLTTGGLDSCQGDSGGPLVIKNS 212          
BLAST of Snake venom serine protease 1 vs. Ensembl Medaka
Match: ENSORLT00000028466.1 (tryptase [Source:NCBI gene;Acc:101156896])

HSP 1 Score: 52.373 bits (124), Expect = 1.058e-7
Identity = 48/180 (26.67%), Postives = 77/180 (42.78%), Query Frame = 3
Query:  186 GTGFCSGSIINQWKIVTAAHWIHKRHNIYI-------QPYNHRMLNISKNKIVRCHFMKEFIKNCLIEKPNNICYNDLSICTVDKKIIFNKYIQP---ASISTTFHGNNLSVYFLGYGSDLFGTNTYRLRQKY----ATINSCDS------NKLYCSYSVHSKPDVSPGDSGGPVIYKNK 665
            GT  C GS+IN   I++AAH      N+ +       Q  N   +++S +KI+        +      + NN   NDL++  +   + FN YI P   A+  + F G   S +  G+G+   G       Q+      +   C+S      N++ C+       D   GDSGGP++ KN 
Sbjct:   44 GTALCGGSLINSQWILSAAHCFKSTSNVVVSLGRITEQGSNPHQVSLSVSKII--------VHPNYDSRTNN---NDLTLLKLASPVTFNDYISPVCLAAAGSDFPGGT-SSWVTGFGTLSSGGPLASTLQEVNIPIVSNTQCNSAYGGITNQMICAGLTTGGLDSCQGDSGGPLVIKNS 211          
BLAST of Snake venom serine protease 1 vs. Ensembl Medaka
Match: ENSORLT00000028221.1 (tryptase [Source:NCBI gene;Acc:101156896])

HSP 1 Score: 52.373 bits (124), Expect = 1.094e-7
Identity = 48/180 (26.67%), Postives = 77/180 (42.78%), Query Frame = 3
Query:  186 GTGFCSGSIINQWKIVTAAHWIHKRHNIYI-------QPYNHRMLNISKNKIVRCHFMKEFIKNCLIEKPNNICYNDLSICTVDKKIIFNKYIQP---ASISTTFHGNNLSVYFLGYGSDLFGTNTYRLRQKY----ATINSCDS------NKLYCSYSVHSKPDVSPGDSGGPVIYKNK 665
            GT  C GS+IN   I++AAH      N+ +       Q  N   +++S +KI+        +      + NN   NDL++  +   + FN YI P   A+  + F G   S +  G+G+   G       Q+      +   C+S      N++ C+       D   GDSGGP++ KN 
Sbjct:   38 GTALCGGSLINSQWILSAAHCFKSTSNVVVSLGRITEQGSNPHQVSLSVSKII--------VHPNYDSRTNN---NDLTLLKLASPVTFNDYISPVCLAAAGSDFPGGT-SSWVTGFGTLSSGGPLASTLQEVNIPIVSNTQCNSAYGGITNQMICAGLTTGGLDSCQGDSGGPLVIKNS 205          
BLAST of Snake venom serine protease 1 vs. Ensembl Medaka
Match: ENSORLT00000000316.2 (tryptase [Source:NCBI gene;Acc:101156896])

HSP 1 Score: 52.373 bits (124), Expect = 1.104e-7
Identity = 48/180 (26.67%), Postives = 77/180 (42.78%), Query Frame = 3
Query:  186 GTGFCSGSIINQWKIVTAAHWIHKRHNIYI-------QPYNHRMLNISKNKIVRCHFMKEFIKNCLIEKPNNICYNDLSICTVDKKIIFNKYIQP---ASISTTFHGNNLSVYFLGYGSDLFGTNTYRLRQKY----ATINSCDS------NKLYCSYSVHSKPDVSPGDSGGPVIYKNK 665
            GT  C GS+IN   I++AAH      N+ +       Q  N   +++S +KI+        +      + NN   NDL++  +   + FN YI P   A+  + F G   S +  G+G+   G       Q+      +   C+S      N++ C+       D   GDSGGP++ KN 
Sbjct:   38 GTALCGGSLINSQWILSAAHCFKSTSNVVVSLGRITEQGSNPHQVSLSVSKII--------VHPNYDSRTNN---NDLTLLKLASPVTFNDYISPVCLAAAGSDFPGGT-SSWVTGFGTLSSGGPLASTLQEVNIPIVSNTQCNSAYGGITNQMICAGLTTGGLDSCQGDSGGPLVIKNS 205          
BLAST of Snake venom serine protease 1 vs. Planmine SMEST
Match: SMESG000045112.1 (SMESG000045112.1)

HSP 1 Score: 402.905 bits (1034), Expect = 1.419e-143
Identity = 196/198 (98.99%), Postives = 196/198 (98.99%), Query Frame = 3
Query:  180 KKGTGFCSGSIINQWKIVTAAHWIHKRHNIYIQPYNHRMLNISKNKIVRCHFMKEFIKNCLIEKPNNICYNDLSICTVDKKIIFNKYIQPASISTTFHGNNLSVYFLGYGSDLFGTNTYRLRQKYATINSCDSNKLYCSYSVHSKPDVSPGDSGGPVIYKNKQIGITIAYLEKKVSLVLPFHIHNDFINKDMAGTVLD 773
            KKGTGFCSGSIINQWKIVTAAH IHKRHNIYIQPYNHRMLNISKNKIVRCHFMKEFIKNCLIEKPNNICYNDLSICTVDKKIIFNKYIQPASISTTFHGNNLSVYFLGYGSDLFGTNTYRLRQKYATINSCDSNKLYCSYSVHSKPDVSPGDSGGPVIYKNKQIGITIAYLEKKVSLVLPFHIHNDFINK MAGTVLD
Sbjct:   53 KKGTGFCSGSIINQWKIVTAAHCIHKRHNIYIQPYNHRMLNISKNKIVRCHFMKEFIKNCLIEKPNNICYNDLSICTVDKKIIFNKYIQPASISTTFHGNNLSVYFLGYGSDLFGTNTYRLRQKYATINSCDSNKLYCSYSVHSKPDVSPGDSGGPVIYKNKQIGITIAYLEKKVSLVLPFHIHNDFINKHMAGTVLD 250          
BLAST of Snake venom serine protease 1 vs. Planmine SMEST
Match: SMESG000045112.1 (SMESG000045112.1)

HSP 1 Score: 255.758 bits (652), Expect = 3.960e-86
Identity = 122/125 (97.60%), Postives = 123/125 (98.40%), Query Frame = 3
Query:  180 KKGTGFCSGSIINQWKIVTAAHWIHKRHNIYIQPYNHRMLNISKNKIVRCHFMKEFIKNCLIEKPNNICYNDLSICTVDKKIIFNKYIQPASISTTFHGNNLSVYFLGYGSDLFGTNTYRLRQKY 554
            KKGTGFCSGSIINQWKIVTAAH IHKRHNIYIQPYNHRMLNISKNKIVRCHFMKEFIKNCLIEKPNNICYNDLSICTVDKKIIFNKYIQPASISTTFHGNNLSVYFLGYGSDLFGTNTYRLRQ +
Sbjct:   53 KKGTGFCSGSIINQWKIVTAAHCIHKRHNIYIQPYNHRMLNISKNKIVRCHFMKEFIKNCLIEKPNNICYNDLSICTVDKKIIFNKYIQPASISTTFHGNNLSVYFLGYGSDLFGTNTYRLRQNF 177          
BLAST of Snake venom serine protease 1 vs. Planmine SMEST
Match: SMESG000002831.1 (SMESG000002831.1)

HSP 1 Score: 57.7658 bits (138), Expect = 2.427e-9
Identity = 49/177 (27.68%), Postives = 83/177 (46.89%), Query Frame = 3
Query:  195 FCSGSIINQWKIVTAAHWIHKRHNIYIQPYNHRMLNISKN-KIVRCHFMKEFIKNCLIEKPNNICYNDLSICTVDKKIIFNKYIQPASISTTFHGNNLSVYFLGYG-SDLFGTNTYRLRQKYATI--NSCD-------SNKLYCSYSVHSKPDVSPGDSGGPVI----YKNKQIGIT 680
             C GSI+N   IVTAAH +  R +      +     ++ N + ++ + +++ IKN      NN   ND+++  +   +  N Y++P  I T+   +N   Y  G+G +   G + Y  + K   I  N+C        S+ + C+   +   D   GDSGGP++     K + IGIT
Sbjct:  220 LCGGSIVNSKWIVTAAHCVEGRSSPQTWTVHAGRFTLNGNDRNLQVNRVEKVIKNENYRSENN--ENDIAMMKLSGILRLNDYVEPVCIGTSVPRDNAECYITGWGVTHGTGGDGYLKQAKVPIIDQNTCQSWYGNSLSDGMICAGYENGGTDSCQGDSGGPLVCRINSKFQLIGIT 394          
The following BLAST results are available for this feature:
BLAST of Snake venom serine protease 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Snake venom serine protease 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Snake venom serine protease 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG174752.790e-825.42gene:FBgn0038481 transcript:FBtr0346149[more]
CG174752.790e-825.42gene:FBgn0038481 transcript:FBtr0083417[more]
CG312655.522e-723.63gene:FBgn0051265 transcript:FBtr0083402[more]
lambdaTry1.048e-623.89gene:FBgn0043470 transcript:FBtr0088121[more]
CG93725.673e-625.73gene:FBgn0036891 transcript:FBtr0074945[more]
back to top
BLAST of Snake venom serine protease 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:1008682.750e-726.60zgc:100868 [Source:ZFIN;Acc:ZDB-GENE-040801-33][more]
zgc:1008683.450e-726.60zgc:100868 [Source:ZFIN;Acc:ZDB-GENE-040801-33][more]
st14a7.255e-730.46suppression of tumorigenicity 14a [Source:ZFIN;Acc... [more]
st14a7.255e-730.46suppression of tumorigenicity 14a [Source:ZFIN;Acc... [more]
prss59.11.346e-623.86serine protease 59, tandem duplicate 1 [Source:ZFI... [more]
back to top
BLAST of Snake venom serine protease 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
comp2.480e-725.91cartilage oligomeric matrix protein [Source:Xenbas... [more]
comp3.350e-727.60cartilage oligomeric matrix protein [Source:Xenbas... [more]
fus4.225e-726.63FUS RNA binding protein [Source:Xenbase;Acc:XB-GEN... [more]
ENSXETT00000035256.11.474e-626.74pep primary_assembly:Xenopus_tropicalis_v9.1:KV461... [more]
ENSXETT00000055749.11.516e-625.58pep primary_assembly:Xenopus_tropicalis_v9.1:2:575... [more]
back to top
BLAST of Snake venom serine protease 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Snake venom serine protease 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|P35032|TRY2_SALSA3.266e-723.96Trypsin-2 (Fragment) OS=Salmo salar OX=8030 PE=2 S... [more]
sp|P35031|TRY1_SALSA4.365e-723.96Trypsin-1 OS=Salmo salar OX=8030 PE=1 SV=1[more]
sp|Q804X6|FA9_CHICK9.067e-724.42Coagulation factor IX OS=Gallus gallus OX=9031 GN=... [more]
back to top
BLAST of Snake venom serine protease 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
B4M3T01.347e-725.51Peptidase S1 domain-containing protein OS=Drosophi... [more]
Q9W7Q61.984e-725.65Trypsinogen 2 (Fragment) OS=Paralichthys olivaceus... [more]
B0WH742.422e-725.76Chymotrypsin-2 OS=Culex quinquefasciatus OX=7176 G... [more]
A0A1B0CS982.441e-727.22Uncharacterized protein OS=Lutzomyia longipalpis O... [more]
A0A1Q3FII42.642e-726.90Putative trypsin OS=Culex tarsalis OX=7177 PE=3 SV... [more]
back to top
BLAST of Snake venom serine protease 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkeyp-93a5.21.159e-725.00si:dkeyp-93a5.2 [Source:ZFIN;Acc:ZDB-GENE-131127-1... [more]
si:dkeyp-93a5.28.784e-723.65si:dkeyp-93a5.2 [Source:ZFIN;Acc:ZDB-GENE-131127-1... [more]
st14a1.378e-625.71suppression of tumorigenicity 14a [Source:ZFIN;Acc... [more]
si:dkeyp-93a5.25.828e-622.75si:dkeyp-93a5.2 [Source:ZFIN;Acc:ZDB-GENE-131127-1... [more]
f107.505e-624.14coagulation factor X [Source:ZFIN;Acc:ZDB-GENE-021... [more]
back to top
BLAST of Snake venom serine protease 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
f101.792e-926.74coagulation factor X [Source:ZFIN;Acc:ZDB-GENE-021... [more]
back to top
BLAST of Snake venom serine protease 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Snake venom serine protease 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Snake venom serine protease 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000042451.11.004e-726.67tryptase [Source:NCBI gene;Acc:101156896][more]
ENSORLT00000029624.11.041e-726.67tryptase [Source:NCBI gene;Acc:101156896][more]
ENSORLT00000028466.11.058e-726.67tryptase [Source:NCBI gene;Acc:101156896][more]
ENSORLT00000028221.11.094e-726.67tryptase [Source:NCBI gene;Acc:101156896][more]
ENSORLT00000000316.21.104e-726.67tryptase [Source:NCBI gene;Acc:101156896][more]
back to top
BLAST of Snake venom serine protease 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000045112.11.419e-14398.99SMESG000045112.1[more]
SMESG000045112.13.960e-8697.60SMESG000045112.1[more]
SMESG000002831.12.427e-927.68SMESG000002831.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019162 ID=SMED30019162|Name=Snake venom serine protease 1|organism=Schmidtea mediterranea sexual|type=transcript|length=802bp
AATTTATAAATTTGAAAAATTCATGGCCTCAGGGAATGTAGTATTTTCTA
TTATTATGTCCATTATCATTCTGGTACTTGTAATCATCAATTCATTCTAT
AATAATTCCAAATTTAAAAATTTTAATAACAAAGTTATATTTCGAACACT
TCATCCATATGTTATCAGGTTATTGACAAAAAAAAGGCACCGGGTTTTGC
TCCGGAAGCATCATCAACCAATGGAAAATAGTTACTGCTGCCCATTGGAT
ACATAAACGGCATAATATATATATTCAGCCATATAATCATCGAATGCTGA
ATATTTCCAAAAATAAAATTGTACGATGTCATTTTATGAAAGAATTTATT
AAAAACTGCTTGATTGAGAAACCGAATAATATATGTTACAATGATTTGTC
TATTTGTACTGTTGACAAGAAAATCATATTCAACAAATACATCCAGCCAG
CTTCAATATCAACAACATTTCATGGAAATAATTTATCGGTTTACTTTCTT
GGCTACGGATCAGATTTATTTGGAACAAATACATATCGGTTAAGGCAAAA
ATACGCTACAATAAATAGTTGTGATTCAAACAAATTATATTGTTCTTATT
CCGTTCATTCAAAACCCGATGTTTCTCCTGGGGATAGTGGCGGACCGGTG
ATTTATAAAAACAAACAAATTGGAATTACTATAGCATATTTGGAGAAAAA
GGTTTCATTGGTATTACCATTCCATATTCATAATGATTTTATTAATAAAG
ATATGGCTGGTACGGTATTGGATTAAATATAATTTGTTAAAGTGAAAAAA
AA
back to top

protein sequence of SMED30019162-orf-1

>SMED30019162-orf-1 ID=SMED30019162-orf-1|Name=SMED30019162-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=161bp
MLNISKNKIVRCHFMKEFIKNCLIEKPNNICYNDLSICTVDKKIIFNKYI
QPASISTTFHGNNLSVYFLGYGSDLFGTNTYRLRQKYATINSCDSNKLYC
SYSVHSKPDVSPGDSGGPVIYKNKQIGITIAYLEKKVSLVLPFHIHNDFI
NKDMAGTVLD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0090729toxin activity
GO:0004252serine-type endopeptidase activity
GO:0005509calcium ion binding
GO:0008233peptidase activity
GO:0008236serine-type peptidase activity
GO:0016787hydrolase activity
Vocabulary: INTERPRO
TermDefinition
IPR001254Trypsin_dom
IPR033116TRYPSIN_SER
IPR009003Peptidase_S1_PA
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
GO:0007596blood coagulation
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:2.40.10.10coord: 45..83
e-value: 1.6E-8
score: 36.3
NoneNo IPR availableTMHMMTMhelixcoord: 15..34
IPR001254Serine proteases, trypsin domainPFAMPF00089Trypsincoord: 48..84
e-value: 2.4E-6
score: 27.5
IPR009003Peptidase S1, PA clanSUPERFAMILYSSF50494Trypsin-like serine proteasescoord: 40..83