Glycine amidinotransferase mitochondrial

Overview
NameGlycine amidinotransferase mitochondrial
Smed IDSMED30019154
Length (bp)1444
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Glycine amidinotransferase mitochondrial (SMED30019154) t-SNE clustered cells

Violin plots show distribution of expression levels for Glycine amidinotransferase mitochondrial (SMED30019154) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Glycine amidinotransferase mitochondrial (SMED30019154) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Glycine amidinotransferase mitochondrial (SMED30019154) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019154

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30019154SMESG000068402.1 dd_Smed_v4_2385_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30019154SMESG000068402.1 dd_Smed_v4_2385_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019154SMESG000068402.1 Contig35384newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019154SMESG000068402.1 Contig35384uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019154SMESG000068402.1 SMESG000068399.1 SMESG000020950.1 Contig36089newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019154SMESG000068402.1 SMESG000068399.1 SMESG000020950.1 Contig36089uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019154SMESG000068402.1 Contig35383newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019154SMESG000068402.1 Contig35383uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
gutSMED30019154SMESG000068402.1 SMED30019154smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30019154SMESG000068402.1 SMED30019154smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
Category 3 cellSMED30019154SMESG000068402.1 dd_Smed_v6_2385_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30019154SMESG000068402.1 dd_Smed_v4_2385_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30019154SMESG000068402.1 NB.2.5dncbi_smed_estsPMID:18786419
Eisenhoffer et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
Category 3 cellSMED30019154SMESG000068402.1 NB.2.5dncbi_smed_estsPMID:18786419
Eisenhoffer et al., 2008
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Glycine amidinotransferase mitochondrial vs. Ensembl Human
Match: GATM (glycine amidinotransferase [Source:HGNC Symbol;Acc:HGNC:4175])

HSP 1 Score: 343.969 bits (881), Expect = 5.011e-114
Identity = 181/393 (46.06%), Postives = 248/393 (63.10%), Query Frame = 1
Query:  160 YQLTRCMSNSLANNPFTNPTALAERKKKSPVWSWNEWDHLEECVVGIPDNAVVPTMTPEVKACMSPDLWDFLDANGGKYWSDILPDGHWKQLQNEIEEFAKVLEGEGVKVVRPEAQDFGKIFTGLGFCSHGIYAAMPRDLVLVVGDELIESTMTWKSRYFEFVSYRKLLKGYYDKGAKWTVAPKPLMLDELLEKDYDFYGT---NKL----KRITTEKEICFDAADFFRCGQDIFGQRSQVTNSAAINWMRRHLAPQGIRVHELNFYDAFCMHVDATLVPVKPGVFLKNPKYPLVEMDNFTNCGWEFVDVPTPLLSEER-LYMSSNYLAMNTLMMDPGRVFIEKEETGTQKLFESIGVKSIPVSMKHCFSIGGGFHCWTSDIKRRGTLENYFN 1314
            +Q T+  + S  N+   +  A     K  PV S+NEWD LEE +VG  +NA VP  T EVKA      W F    GG Y     P  H K+   EIEE   +L+ EGV V RP+  D+   +    F S G+Y+AMPRD+++VVG+E+IE+ M W+SR+FE+ +YR ++K Y+ +GAKWT APKP M DEL  +DY  +     +KL    K +TTE E CFDAADF R G+DIF QRSQVTN   I WMRRHLAP   RVH ++F D   MH+DAT   + PG+ L NP  P  ++D F   GW  +  PTP++ ++  L+MSS +L+MN LM+D  RV ++  E   QK+FE +G+ +I V++++  S+GGGFHCWT D++RRGTL++Y +
Sbjct:   36 FQSTQAATASSRNSCAADDKATEPLPKDCPVSSYNEWDPLEEVIVGRAENACVPPFTIEVKANTYEKYWPFYQKQGGHY----FPKDHLKKAVAEIEEMCNILKTEGVTVRRPDPIDWSLKYKTPDFESTGLYSAMPRDILIVVGNEIIEAPMAWRSRFFEYRAYRSIIKDYFHRGAKWTTAPKPTMADELYNQDYPIHSVEDRHKLAAQGKFVTTEFEPCFDAADFIRAGRDIFAQRSQVTNYLGIEWMRRHLAPD-YRVHIISFKDPNPMHIDATFNIIGPGIVLSNPDRPCHQIDLFKKAGWTIITPPTPIIPDDHPLWMSSKWLSMNVLMLDEKRVMVDANEVPIQKMFEKLGITTIKVNIRNANSLGGGFHCWTCDVRRRGTLQSYLD 423          
BLAST of Glycine amidinotransferase mitochondrial vs. Ensembl Human
Match: GATM (glycine amidinotransferase [Source:HGNC Symbol;Acc:HGNC:4175])

HSP 1 Score: 297.745 bits (761), Expect = 2.262e-96
Identity = 163/358 (45.53%), Postives = 219/358 (61.17%), Query Frame = 1
Query:  160 YQLTRCMSNSLANNPFTNPTALAERKKKSPVWSWNEWDHLEECVVGIPDNAVVPTMTPEVKACMSPDLWDFLDANGGKYWSDILPDGHWKQLQNEIEEFAKVLEGEGVKVVRPEAQDFGKIFTGLGFCSHGIYAAMPRDLVLVVGDELIESTMTWKSRYFEFVSYRKLLKGYYDKGAKWTVAPKPLMLDELLEKDYDFYGT---NKL----KRITTEKEICFDAADFFRCGQDIFGQRSQVTNSAAINWMRRHLAPQGIRVHELNFYDAFCMHVDATLVPVKPGVFLKNPKYPLVEMDNFTNCGWEFVDVPTPLLSEER-LYMSSNYLAMNTLMMDPGRVFIEKEETGTQKLFESIGV 1209
            +Q T+  + S  N+   +  A     K  PV S+NEWD LEE +VG  +NA VP  T EVKA      W F    GG Y     P  H K+   EIEE   +L+ EGV V RP+  D+   +    F S G+Y+AMPRD+++VVG+E+IE+ M W+SR+FE+ +YR ++K Y+ +GAKWT APKP M DEL  +DY  +     +KL    K +TTE E CFDAADF R G+DIF QRSQVTN   I WMRRHLAP   RVH ++F D   MH+DAT   + PG+ L NP  P  ++D F   GW  +  PTP++ ++  L+MSS +L+MN LM+D  RV ++  E   QK+FE +G+
Sbjct:   36 FQSTQAATASSRNSCAADDKATEPLPKDCPVSSYNEWDPLEEVIVGRAENACVPPFTIEVKANTYEKYWPFYQKQGGHY----FPKDHLKKAVAEIEEMCNILKTEGVTVRRPDPIDWSLKYKTPDFESTGLYSAMPRDILIVVGNEIIEAPMAWRSRFFEYRAYRSIIKDYFHRGAKWTTAPKPTMADELYNQDYPIHSVEDRHKLAAQGKFVTTEFEPCFDAADFIRAGRDIFAQRSQVTNYLGIEWMRRHLAPD-YRVHIISFKDPNPMHIDATFNIIGPGIVLSNPDRPCHQIDLFKKAGWTIITPPTPIIPDDHPLWMSSKWLSMNVLMLDEKRVMVDANEVPIQKMFEKLGM 388          
BLAST of Glycine amidinotransferase mitochondrial vs. Ensembl Human
Match: GATM (glycine amidinotransferase [Source:HGNC Symbol;Acc:HGNC:4175])

HSP 1 Score: 128.642 bits (322), Expect = 1.653e-34
Identity = 60/141 (42.55%), Postives = 86/141 (60.99%), Query Frame = 1
Query:  364 WDFLDANGGKYWSDILPDGHWKQLQNEIEEFAKVLEGEGVKVVRPEAQDFGKIFTGLGFCSHGIYAAMPRDLVLVVGDELIESTMTWKSRYFEFVSYRKLLKGYYDKGAKWTVAPKPLMLDELLEKDYDFYGTNKLKRITT 786
            W F    GG Y     P  H K+   EIEE   +L+ EGV V RP+  D+   +    F S G+Y+AMPRD+++VVG+E+IE+ M W+SR+FE+ +YR ++K Y+ +GAKWT APKP M DEL  +DY  +      ++  
Sbjct:   31 WPFYQKQGGHY----FPKDHLKKAVAEIEEMCNILKTEGVTVRRPDPIDWSLKYKTPDFESTGLYSAMPRDILIVVGNEIIEAPMAWRSRFFEYRAYRSIIKDYFHRGAKWTTAPKPTMADELYNQDYPIHSVEDRHKLAA 167          
BLAST of Glycine amidinotransferase mitochondrial vs. Ensembl Human
Match: GATM (glycine amidinotransferase [Source:HGNC Symbol;Acc:HGNC:4175])

HSP 1 Score: 48.1358 bits (113), Expect = 1.162e-6
Identity = 26/61 (42.62%), Postives = 34/61 (55.74%), Query Frame = 1
Query:  160 YQLTRCMSNSLANNPFTNPTALAERKKKSPVWSWNEWDHLEECVVGIPDNAVVPTMTPEVK 342
            +Q T+  + S  N+   +  A     K  PV S+NEWD LEE +VG  +NA VP  T EVK
Sbjct:   36 FQSTQAATASSRNSCAADDKATEPLPKDCPVSSYNEWDPLEEVIVGRAENACVPPFTIEVK 96          
BLAST of Glycine amidinotransferase mitochondrial vs. Ensembl Zebrafish
Match: gatm (glycine amidinotransferase (L-arginine:glycine amidinotransferase) [Source:NCBI gene;Acc:266799])

HSP 1 Score: 349.362 bits (895), Expect = 2.494e-116
Identity = 174/366 (47.54%), Postives = 240/366 (65.57%), Query Frame = 1
Query:  238 KKSPVWSWNEWDHLEECVVGIPDNAVVPTMTPEVKACMSPDLWDFLDANGGKYWSDILPDGHWKQLQNEIEEFAKVLEGEGVKVVRPEAQDFGKIFTGLGFCSHGIYAAMPRDLVLVVGDELIESTMTWKSRYFEFVSYRKLLKGYYDKGAKWTVAPKPLMLDELLEKDYDFYGT---NKL----KRITTEKEICFDAADFFRCGQDIFGQRSQVTNSAAINWMRRHLAPQGIRVHELNFYDAFCMHVDATLVPVKPGVFLKNPKYPLVEMDNFTNCGWEFVDVPTPLLSEER-LYMSSNYLAMNTLMMDPGRVFIEKEETGTQKLFESIGVKSIPVSMKHCFSIGGGFHCWTSDIKRRGTLENYF 1311
            ++ PV + NEWD LEE +VG  +NA VP  T EVKA      W F    GG+      P  H ++   EIEE   +L+ EGV V RPE  D+   +    F S G+YAAMPRD+++VVG+E+IE+ M W++R+FE+ +YR L+K Y+ +GA+WT APKP M D+L ++DY        +KL    K +TTE E CFDAADF R G DIF QRSQVTN   I WMRRHL+P   ++H ++F D   MH+DAT   + PG+ L NP  P  +++ F   GW  V  PTPL+ +   L+MSS +L+MN LM+D  RV ++  E+  QK+FES+G+K++ VS++H  S+GGGFHCWT+D++RRGTL++YF
Sbjct:   61 EECPVCAHNEWDPLEEVIVGRAENACVPPFTVEVKANTYEKYWPFYQQYGGQ----TFPKEHVQKAVAEIEEMCNILQHEGVTVRRPEPVDWSLEYRTPDFSSTGMYAAMPRDILMVVGNEIIEAPMAWRARFFEYRAYRPLIKEYFRRGARWTTAPKPTMADQLYDQDYPIRTVEDRHKLAAQGKFVTTEFEPCFDAADFIRAGTDIFVQRSQVTNYMGIEWMRRHLSPT-YKIHIISFKDPNPMHIDATFNIIGPGLVLSNPDRPCRQIEMFKKAGWTVVTPPTPLIPDNHPLWMSSKWLSMNVLMLDEKRVMVDANESTIQKMFESLGIKTVKVSIRHANSLGGGFHCWTTDVRRRGTLQSYF 421          
BLAST of Glycine amidinotransferase mitochondrial vs. Ensembl Zebrafish
Match: gatm (glycine amidinotransferase (L-arginine:glycine amidinotransferase) [Source:NCBI gene;Acc:266799])

HSP 1 Score: 201.83 bits (512), Expect = 4.228e-61
Identity = 107/229 (46.72%), Postives = 140/229 (61.14%), Query Frame = 1
Query:  238 KKSPVWSWNEWDHLEECVVGIPDNAVVPTMTPEVKACMSPDLWDFLDANGGKYWSDILPDGHWKQLQNEIEEFAKVLEGEGVKVVRPEAQDFGKIFTGLGFCSHGIYAAMPRDLVLVVGDELIESTMTWKSRYFEFVSYRKLLKGYYDKGAKWTVAPKPLMLDELLEKDYDFYGT---NKL----KRITTEKEICFDAADFFRCGQDIFGQRSQVTNSAAINWMRRHLA 903
            ++ PV + NEWD LEE +VG  +NA VP  T EVK                 Y     P  H ++   EIEE   +L+ EGV V RPE  D+   +    F S G+YAAMPRD+++VVG+E+IE+ M W++R+FE+ +YR L+K Y+ +GA+WT APKP M D+L ++DY        +KL    K +TTE E CFDAADF R G DIF QRSQVTN   I WMRRHL+
Sbjct:   61 EECPVCAHNEWDPLEEVIVGRAENACVPPFTVEVK-----------------YGGQTFPKEHVQKAVAEIEEMCNILQHEGVTVRRPEPVDWSLEYRTPDFSSTGMYAAMPRDILMVVGNEIIEAPMAWRARFFEYRAYRPLIKEYFRRGARWTTAPKPTMADQLYDQDYPIRTVEDRHKLAAQGKFVTTEFEPCFDAADFIRAGTDIFVQRSQVTNYMGIEWMRRHLS 272          
BLAST of Glycine amidinotransferase mitochondrial vs. Ensembl Zebrafish
Match: gatm (glycine amidinotransferase (L-arginine:glycine amidinotransferase) [Source:NCBI gene;Acc:266799])

HSP 1 Score: 181.415 bits (459), Expect = 2.013e-53
Identity = 97/214 (45.33%), Postives = 130/214 (60.75%), Query Frame = 1
Query:  238 KKSPVWSWNEWDHLEECVVGIPDNAVVPTMTPEVKACMSPDLWDFLDANGGKYWSDILPDGHWKQLQNEIEEFAKVLEGEGVKVVRPEAQDFGKIFTGLGFCSHGIYAAMPRDLVLVVGDELIESTMTWKSRYFEFVSYRKLLKGYYDKGAKWTVAPKPLMLDELLEKDYDFYGT---NKL----KRITTEKEICFDAADFFRCGQDIFGQRSQ 858
            ++ PV + NEWD LEE +VG  +NA VP  T EVK                +Y     P  H ++   EIEE   +L+ EGV V RPE  D+   +    F S G+YAAMPRD+++VVG+E+IE+ M W++R+FE+ +YR L+K Y+ +GA+WT APKP M D+L ++DY        +KL    K +TTE E CFDAADF R G DIF QRSQ
Sbjct:   61 EECPVCAHNEWDPLEEVIVGRAENACVPPFTVEVK----------------QYGGQTFPKEHVQKAVAEIEEMCNILQHEGVTVRRPEPVDWSLEYRTPDFSSTGMYAAMPRDILMVVGNEIIEAPMAWRARFFEYRAYRPLIKEYFRRGARWTTAPKPTMADQLYDQDYPIRTVEDRHKLAAQGKFVTTEFEPCFDAADFIRAGTDIFVQRSQ 258          
BLAST of Glycine amidinotransferase mitochondrial vs. Ensembl Xenopus
Match: tmem222 (transmembrane protein 222 [Source:Xenbase;Acc:XB-GENE-943282])

HSP 1 Score: 354.755 bits (909), Expect = 2.052e-118
Identity = 181/367 (49.32%), Postives = 240/367 (65.40%), Query Frame = 1
Query:  238 KKSPVWSWNEWDHLEECVVGIPDNAVVPTMTPEVKACMSPDLWDFLDANGGKYWSDILPDGHWKQLQNEIEEFAKVLEGEGVKVVRPEAQDFGKIFTGLGFCSHGIYAAMPRDLVLVVGDELIESTMTWKSRYFEFVSYRKLLKGYYDKGAKWTVAPKPLMLDELLEKDYDFYGT---NKL----KRITTEKEICFDAADFFRCGQDIFGQRSQVTNSAAINWMRRHLAPQGIRVHELNFYDAFCMHVDATLVPVKPGVFLKNPKYPLVEMDNFTNCGWEFVDVPTPLLSEER-LYMSSNYLAMNTLMMDPGRVFIEKEETGTQKLFESIGVKSIPVSMKHCFSIGGGFHCWTSDIKRRGTLENYFN 1314
            ++ PV S+NEWD LEE +VG P+NA VP  + EVKA      W F   +GG+      P  H K+   EIEE   VL  EGV V RPE  D+   +    F S G+YAAMPRD++LVVG+E+IE+ M W++R+FE+ +YR L+K Y+ +GAKWT APKP M DEL ++DY        +KL    K +TTE E CFDAADF R G+DIF QRSQVTN   I WMRRHLAP   +VH ++F D   MH+DAT   + PG+ L NP  P  +++ F   GW  V  P PL+ +   L+MSS +L+MN LM+D  RV ++  ET  QK+FE +G+ +I V+++H  S+GGGFHCWT DI+RRGTL++YF+
Sbjct:   49 QECPVCSYNEWDPLEEVIVGRPENANVPPFSVEVKANTYEKYWPFYQKHGGQS----FPVEHVKKATEEIEEMCNVLRHEGVVVQRPEVIDWSVKYKTPDFESTGMYAAMPRDILLVVGNEIIEAPMAWRARFFEYRAYRPLIKDYFRRGAKWTTAPKPTMADELYDQDYPIRTVEDRHKLAAMGKFVTTEFEPCFDAADFMRAGRDIFAQRSQVTNYLGIEWMRRHLAPD-YKVHIISFKDPNPMHIDATFNIIGPGLVLSNPDRPCHQIELFKKAGWTVVTPPIPLIPDNHPLWMSSKWLSMNVLMLDEKRVMVDANETSIQKMFEKLGISTIKVNIRHANSLGGGFHCWTCDIRRRGTLQSYFS 410          
BLAST of Glycine amidinotransferase mitochondrial vs. Ensembl Xenopus
Match: tmem222 (transmembrane protein 222 [Source:Xenbase;Acc:XB-GENE-943282])

HSP 1 Score: 354.369 bits (908), Expect = 3.838e-118
Identity = 181/367 (49.32%), Postives = 240/367 (65.40%), Query Frame = 1
Query:  238 KKSPVWSWNEWDHLEECVVGIPDNAVVPTMTPEVKACMSPDLWDFLDANGGKYWSDILPDGHWKQLQNEIEEFAKVLEGEGVKVVRPEAQDFGKIFTGLGFCSHGIYAAMPRDLVLVVGDELIESTMTWKSRYFEFVSYRKLLKGYYDKGAKWTVAPKPLMLDELLEKDYDFYGT---NKL----KRITTEKEICFDAADFFRCGQDIFGQRSQVTNSAAINWMRRHLAPQGIRVHELNFYDAFCMHVDATLVPVKPGVFLKNPKYPLVEMDNFTNCGWEFVDVPTPLLSEER-LYMSSNYLAMNTLMMDPGRVFIEKEETGTQKLFESIGVKSIPVSMKHCFSIGGGFHCWTSDIKRRGTLENYFN 1314
            ++ PV S+NEWD LEE +VG P+NA VP  + EVKA      W F   +GG+      P  H K+   EIEE   VL  EGV V RPE  D+   +    F S G+YAAMPRD++LVVG+E+IE+ M W++R+FE+ +YR L+K Y+ +GAKWT APKP M DEL ++DY        +KL    K +TTE E CFDAADF R G+DIF QRSQVTN   I WMRRHLAP   +VH ++F D   MH+DAT   + PG+ L NP  P  +++ F   GW  V  P PL+ +   L+MSS +L+MN LM+D  RV ++  ET  QK+FE +G+ +I V+++H  S+GGGFHCWT DI+RRGTL++YF+
Sbjct:   61 QECPVCSYNEWDPLEEVIVGRPENANVPPFSVEVKANTYEKYWPFYQKHGGQS----FPVEHVKKATEEIEEMCNVLRHEGVVVQRPEVIDWSVKYKTPDFESTGMYAAMPRDILLVVGNEIIEAPMAWRARFFEYRAYRPLIKDYFRRGAKWTTAPKPTMADELYDQDYPIRTVEDRHKLAAMGKFVTTEFEPCFDAADFMRAGRDIFAQRSQVTNYLGIEWMRRHLAPD-YKVHIISFKDPNPMHIDATFNIIGPGLVLSNPDRPCHQIELFKKAGWTVVTPPIPLIPDNHPLWMSSKWLSMNVLMLDEKRVMVDANETSIQKMFEKLGISTIKVNIRHANSLGGGFHCWTCDIRRRGTLQSYFS 422          
BLAST of Glycine amidinotransferase mitochondrial vs. Ensembl Mouse
Match: Gatm (glycine amidinotransferase (L-arginine:glycine amidinotransferase) [Source:MGI Symbol;Acc:MGI:1914342])

HSP 1 Score: 356.681 bits (914), Expect = 3.789e-119
Identity = 182/393 (46.31%), Postives = 249/393 (63.36%), Query Frame = 1
Query:  160 YQLTRCMSNSLANNPFTNPTALAERKKKSPVWSWNEWDHLEECVVGIPDNAVVPTMTPEVKACMSPDLWDFLDANGGKYWSDILPDGHWKQLQNEIEEFAKVLEGEGVKVVRPEAQDFGKIFTGLGFCSHGIYAAMPRDLVLVVGDELIESTMTWKSRYFEFVSYRKLLKGYYDKGAKWTVAPKPLMLDELLEKDYDFYGT---NKL----KRITTEKEICFDAADFFRCGQDIFGQRSQVTNSAAINWMRRHLAPQGIRVHELNFYDAFCMHVDATLVPVKPGVFLKNPKYPLVEMDNFTNCGWEFVDVPTPLLSEER-LYMSSNYLAMNTLMMDPGRVFIEKEETGTQKLFESIGVKSIPVSMKHCFSIGGGFHCWTSDIKRRGTLENYFN 1314
            +Q T+  + S  N+      A     K  PV S+NEWD LEE +VG  +NA VP  T EVKA      W F   NGG Y     P  H K+   E+EE   +L  EGV V RP+  D+   +    F S G+Y+AMPRD+++VVG+E+IE+ M W+SR+FE+ +YR ++K Y+ +GAKWT APKP M DEL +++Y  +     +KL    K +TTE E CFDAADF R G+DIF QRSQVTN   I WMRRHLAP   RVH ++F D   MH+DAT   + PG+ L NP  P  ++D F   GW  V  PTP++ ++  L+MSS +L+MN LM+D  RV ++  E   QK+FE +G+ +I V++++  S+GGGFHCWT D++RRGTL++YF+
Sbjct:   36 FQSTQAATASSRNSCAAEDKATHPLPKDCPVSSYNEWDPLEEVIVGRAENACVPPFTVEVKANTYEKYWPFYQKNGGLY----FPKDHLKKAVAEVEEMCNILSMEGVTVRRPDPIDWSLKYKTPDFESTGLYSAMPRDILMVVGNEIIEAPMAWRSRFFEYRAYRSIIKDYFHRGAKWTTAPKPTMADELYDQNYPIHSVEDRHKLAAQGKFVTTEFEPCFDAADFIRAGRDIFAQRSQVTNYLGIEWMRRHLAPD-YRVHIISFKDPNPMHIDATFNIIGPGLVLSNPDRPCHQIDLFKKAGWTIVTPPTPVIPDDHPLWMSSKWLSMNVLMLDEKRVMVDANEVPIQKMFEKLGISTIKVNIRNANSLGGGFHCWTCDVRRRGTLQSYFD 423          
BLAST of Glycine amidinotransferase mitochondrial vs. Ensembl Mouse
Match: Gatm (glycine amidinotransferase (L-arginine:glycine amidinotransferase) [Source:MGI Symbol;Acc:MGI:1914342])

HSP 1 Score: 356.681 bits (914), Expect = 3.789e-119
Identity = 182/393 (46.31%), Postives = 249/393 (63.36%), Query Frame = 1
Query:  160 YQLTRCMSNSLANNPFTNPTALAERKKKSPVWSWNEWDHLEECVVGIPDNAVVPTMTPEVKACMSPDLWDFLDANGGKYWSDILPDGHWKQLQNEIEEFAKVLEGEGVKVVRPEAQDFGKIFTGLGFCSHGIYAAMPRDLVLVVGDELIESTMTWKSRYFEFVSYRKLLKGYYDKGAKWTVAPKPLMLDELLEKDYDFYGT---NKL----KRITTEKEICFDAADFFRCGQDIFGQRSQVTNSAAINWMRRHLAPQGIRVHELNFYDAFCMHVDATLVPVKPGVFLKNPKYPLVEMDNFTNCGWEFVDVPTPLLSEER-LYMSSNYLAMNTLMMDPGRVFIEKEETGTQKLFESIGVKSIPVSMKHCFSIGGGFHCWTSDIKRRGTLENYFN 1314
            +Q T+  + S  N+      A     K  PV S+NEWD LEE +VG  +NA VP  T EVKA      W F   NGG Y     P  H K+   E+EE   +L  EGV V RP+  D+   +    F S G+Y+AMPRD+++VVG+E+IE+ M W+SR+FE+ +YR ++K Y+ +GAKWT APKP M DEL +++Y  +     +KL    K +TTE E CFDAADF R G+DIF QRSQVTN   I WMRRHLAP   RVH ++F D   MH+DAT   + PG+ L NP  P  ++D F   GW  V  PTP++ ++  L+MSS +L+MN LM+D  RV ++  E   QK+FE +G+ +I V++++  S+GGGFHCWT D++RRGTL++YF+
Sbjct:   36 FQSTQAATASSRNSCAAEDKATHPLPKDCPVSSYNEWDPLEEVIVGRAENACVPPFTVEVKANTYEKYWPFYQKNGGLY----FPKDHLKKAVAEVEEMCNILSMEGVTVRRPDPIDWSLKYKTPDFESTGLYSAMPRDILMVVGNEIIEAPMAWRSRFFEYRAYRSIIKDYFHRGAKWTTAPKPTMADELYDQNYPIHSVEDRHKLAAQGKFVTTEFEPCFDAADFIRAGRDIFAQRSQVTNYLGIEWMRRHLAPD-YRVHIISFKDPNPMHIDATFNIIGPGLVLSNPDRPCHQIDLFKKAGWTIVTPPTPVIPDDHPLWMSSKWLSMNVLMLDEKRVMVDANEVPIQKMFEKLGISTIKVNIRNANSLGGGFHCWTCDVRRRGTLQSYFD 423          
BLAST of Glycine amidinotransferase mitochondrial vs. UniProt/SwissProt
Match: sp|P50442|GATM_RAT (Glycine amidinotransferase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Gatm PE=1 SV=1)

HSP 1 Score: 358.607 bits (919), Expect = 5.388e-119
Identity = 183/393 (46.56%), Postives = 249/393 (63.36%), Query Frame = 1
Query:  160 YQLTRCMSNSLANNPFTNPTALAERKKKSPVWSWNEWDHLEECVVGIPDNAVVPTMTPEVKACMSPDLWDFLDANGGKYWSDILPDGHWKQLQNEIEEFAKVLEGEGVKVVRPEAQDFGKIFTGLGFCSHGIYAAMPRDLVLVVGDELIESTMTWKSRYFEFVSYRKLLKGYYDKGAKWTVAPKPLMLDELLEKDYDFYGT---NKL----KRITTEKEICFDAADFFRCGQDIFGQRSQVTNSAAINWMRRHLAPQGIRVHELNFYDAFCMHVDATLVPVKPGVFLKNPKYPLVEMDNFTNCGWEFVDVPTPLLSEER-LYMSSNYLAMNTLMMDPGRVFIEKEETGTQKLFESIGVKSIPVSMKHCFSIGGGFHCWTSDIKRRGTLENYFN 1314
            +Q T+  + S  N+      A     K  PV S+NEWD LEE +VG  +NA VP  T EVKA      W F   NGG Y     P  H K+   E+EE   +L  EGV V RP+  D+   +    F S G+Y+AMPRD+++VVG+E+IE+ M W+SR+FE+ +YR ++K Y+ +GAKWT APKP M DEL ++DY  +     +KL    K +TTE E CFDAADF R G+DIF QRSQVTN   I WMRRHLAP   RVH ++F D   MH+DAT   + PG+ L NP  P  ++D F   GW  V  PTP++ ++  L+MSS +L+MN LM+D  RV ++  E   QK+FE +G+ +I V++++  S+GGGFHCWT D++RRGTL++YF+
Sbjct:   36 FQSTQAATASSQNSCAAEDKATHPLPKDCPVSSYNEWDPLEEVIVGRAENACVPPFTVEVKANTYEKYWPFYQKNGGLY----FPKDHLKKAVAEVEEMCNILSMEGVTVKRPDPIDWSLKYKTPDFESTGLYSAMPRDILMVVGNEIIEAPMAWRSRFFEYRAYRSIIKDYFHRGAKWTTAPKPTMADELYDQDYPIHSVEDRHKLAAQGKFVTTEFEPCFDAADFIRAGRDIFAQRSQVTNYLGIEWMRRHLAPD-YRVHIISFKDPNPMHIDATFNIIGPGLVLSNPDRPCHQIDLFKKAGWTIVTPPTPVIPDDHPLWMSSKWLSMNVLMLDEKRVMVDANEVPIQKMFEKLGISTIKVNIRNANSLGGGFHCWTCDVRRRGTLQSYFD 423          
BLAST of Glycine amidinotransferase mitochondrial vs. UniProt/SwissProt
Match: sp|Q9D964|GATM_MOUSE (Glycine amidinotransferase, mitochondrial OS=Mus musculus OX=10090 GN=Gatm PE=1 SV=1)

HSP 1 Score: 356.681 bits (914), Expect = 2.650e-118
Identity = 182/393 (46.31%), Postives = 249/393 (63.36%), Query Frame = 1
Query:  160 YQLTRCMSNSLANNPFTNPTALAERKKKSPVWSWNEWDHLEECVVGIPDNAVVPTMTPEVKACMSPDLWDFLDANGGKYWSDILPDGHWKQLQNEIEEFAKVLEGEGVKVVRPEAQDFGKIFTGLGFCSHGIYAAMPRDLVLVVGDELIESTMTWKSRYFEFVSYRKLLKGYYDKGAKWTVAPKPLMLDELLEKDYDFYGT---NKL----KRITTEKEICFDAADFFRCGQDIFGQRSQVTNSAAINWMRRHLAPQGIRVHELNFYDAFCMHVDATLVPVKPGVFLKNPKYPLVEMDNFTNCGWEFVDVPTPLLSEER-LYMSSNYLAMNTLMMDPGRVFIEKEETGTQKLFESIGVKSIPVSMKHCFSIGGGFHCWTSDIKRRGTLENYFN 1314
            +Q T+  + S  N+      A     K  PV S+NEWD LEE +VG  +NA VP  T EVKA      W F   NGG Y     P  H K+   E+EE   +L  EGV V RP+  D+   +    F S G+Y+AMPRD+++VVG+E+IE+ M W+SR+FE+ +YR ++K Y+ +GAKWT APKP M DEL +++Y  +     +KL    K +TTE E CFDAADF R G+DIF QRSQVTN   I WMRRHLAP   RVH ++F D   MH+DAT   + PG+ L NP  P  ++D F   GW  V  PTP++ ++  L+MSS +L+MN LM+D  RV ++  E   QK+FE +G+ +I V++++  S+GGGFHCWT D++RRGTL++YF+
Sbjct:   36 FQSTQAATASSRNSCAAEDKATHPLPKDCPVSSYNEWDPLEEVIVGRAENACVPPFTVEVKANTYEKYWPFYQKNGGLY----FPKDHLKKAVAEVEEMCNILSMEGVTVRRPDPIDWSLKYKTPDFESTGLYSAMPRDILMVVGNEIIEAPMAWRSRFFEYRAYRSIIKDYFHRGAKWTTAPKPTMADELYDQNYPIHSVEDRHKLAAQGKFVTTEFEPCFDAADFIRAGRDIFAQRSQVTNYLGIEWMRRHLAPD-YRVHIISFKDPNPMHIDATFNIIGPGLVLSNPDRPCHQIDLFKKAGWTIVTPPTPVIPDDHPLWMSSKWLSMNVLMLDEKRVMVDANEVPIQKMFEKLGISTIKVNIRNANSLGGGFHCWTCDVRRRGTLQSYFD 423          
BLAST of Glycine amidinotransferase mitochondrial vs. UniProt/SwissProt
Match: sp|P50441|GATM_PIG (Glycine amidinotransferase, mitochondrial OS=Sus scrofa OX=9823 GN=GATM PE=1 SV=2)

HSP 1 Score: 356.295 bits (913), Expect = 4.133e-118
Identity = 181/393 (46.06%), Postives = 248/393 (63.10%), Query Frame = 1
Query:  160 YQLTRCMSNSLANNPFTNPTALAERKKKSPVWSWNEWDHLEECVVGIPDNAVVPTMTPEVKACMSPDLWDFLDANGGKYWSDILPDGHWKQLQNEIEEFAKVLEGEGVKVVRPEAQDFGKIFTGLGFCSHGIYAAMPRDLVLVVGDELIESTMTWKSRYFEFVSYRKLLKGYYDKGAKWTVAPKPLMLDELLEKDYDFYGT---NKL----KRITTEKEICFDAADFFRCGQDIFGQRSQVTNSAAINWMRRHLAPQGIRVHELNFYDAFCMHVDATLVPVKPGVFLKNPKYPLVEMDNFTNCGWEFVDVPTPLLSEER-LYMSSNYLAMNTLMMDPGRVFIEKEETGTQKLFESIGVKSIPVSMKHCFSIGGGFHCWTSDIKRRGTLENYFN 1314
            +Q T+  + S  N+   +  A     K  PV S+NEWD LEE +VG  +NA VP  T EVKA      W F    GG Y     P  H K+   EIEE   +L+ EGV V RP+  D+   +    F S G+Y AMPRD+++VVG+E+IE+ M W++R+FE+ +YR ++K Y+ +GAKWT APKP M DEL ++DY  Y     +KL    K +TTE E CFDAADF R G+DIF QRSQVTN   I WMR+HLAP   RVH ++F D   MH+DAT   + PG+ L NP  P  ++D F   GW  V  P P++ ++  L+MSS +L+MN LM+D  RV ++  E   QK+FE +G+ +I +S+++  S+GGGFHCWT D++RRGTL++YF+
Sbjct:   36 FQSTQAATASSGNSCAADDKATDPLPKDCPVSSYNEWDPLEEVIVGRAENACVPPFTVEVKANTYEKYWPFYQKYGGHY----FPKDHLKKAVAEIEEMCNILKMEGVTVRRPDPIDWSVKYKTPDFESTGLYGAMPRDILIVVGNEIIEAPMAWRARFFEYRAYRSIIKDYFRRGAKWTTAPKPTMADELYDQDYPIYSVEDRHKLAAQGKFVTTEFEPCFDAADFIRAGRDIFAQRSQVTNYMGIEWMRKHLAPD-YRVHIISFKDPNPMHIDATFNIIGPGLVLSNPDRPCHQIDLFKKAGWTIVTPPIPVIPDDHPLWMSSKWLSMNVLMLDEKRVMVDANEVPIQKMFEKLGISTIKISIRNANSLGGGFHCWTCDVRRRGTLQSYFD 423          
BLAST of Glycine amidinotransferase mitochondrial vs. UniProt/SwissProt
Match: sp|Q9IAJ6|GATM_XENLA (Glycine amidinotransferase, mitochondrial OS=Xenopus laevis OX=8355 GN=gatm PE=2 SV=2)

HSP 1 Score: 355.91 bits (912), Expect = 4.658e-118
Identity = 187/396 (47.22%), Postives = 250/396 (63.13%), Query Frame = 1
Query:  166 LTRCMSNSLANNPFTNPTALAERKKKS-----PVWSWNEWDHLEECVVGIPDNAVVPTMTPEVKACMSPDLWDFLDANGGKYWSDILPDGHWKQLQNEIEEFAKVLEGEGVKVVRPEAQDFGKIFTGLGFCSHGIYAAMPRDLVLVVGDELIESTMTWKSRYFEFVSYRKLLKGYYDKGAKWTVAPKPLMLDELLEKDYDFYGT---NKL----KRITTEKEICFDAADFFRCGQDIFGQRSQVTNSAAINWMRRHLAPQGIRVHELNFYDAFCMHVDATLVPVKPGVFLKNPKYPLVEMDNFTNCGWEFVDVPTPLLSEER-LYMSSNYLAMNTLMMDPGRVFIEKEETGTQKLFESIGVKSIPVSMKHCFSIGGGFHCWTSDIKRRGTLENYFN 1314
            + R   ++ A      P A  E+ + +     PV S+NEWD LEE +VG P+NA VP  + EVKA      W F   +GG+      P  H K+   EIEE  KVL+ EGV V RPE  D+   +    F S G+YAAMPRD++LVVG+E+IE+ M W++R+FE+ +YR L+K Y+ +GAKWT APKP M DEL ++DY        +KL    K +TTE E CFDAADF R G+DIF QRSQVTN   I WMRRHLAP   +VH ++F D   MH+DAT   + PG+ L NP  P  +++ F   GW  V  PTPL+ +   L+MSS +L+MN LM+D  RV ++  ET   K+FE +G+ +I V+++H  S+GGGFHCWT DI+RRGTL++YF 
Sbjct:   32 VQRSFQSTQAAAVSEKPCAADEKVRDTAAQECPVCSYNEWDPLEEVIVGRPENANVPPFSVEVKANTYEKYWPFYQKHGGQS----FPVDHVKKAIEEIEEMCKVLKHEGVIVQRPEVIDWSVKYKTPDFESTGMYAAMPRDILLVVGNEIIEAPMAWRARFFEYRAYRPLIKDYFRRGAKWTTAPKPTMADELYDQDYPIRTVEDRHKLAAMGKFVTTEFEPCFDAADFMRAGRDIFAQRSQVTNYLGIEWMRRHLAPD-YKVHIISFKDPNPMHIDATFNIIGPGLVLSNPDRPCHQIELFKKAGWTVVTPPTPLIPDNHPLWMSSKWLSMNVLMLDEKRVMVDANETSIHKMFEKLGISTIKVNIRHANSLGGGFHCWTCDIRRRGTLQSYFR 422          
BLAST of Glycine amidinotransferase mitochondrial vs. UniProt/SwissProt
Match: sp|Q6P832|GATM_XENTR (Glycine amidinotransferase, mitochondrial OS=Xenopus tropicalis OX=8364 GN=gatm PE=2 SV=1)

HSP 1 Score: 354.369 bits (908), Expect = 2.033e-117
Identity = 181/367 (49.32%), Postives = 240/367 (65.40%), Query Frame = 1
Query:  238 KKSPVWSWNEWDHLEECVVGIPDNAVVPTMTPEVKACMSPDLWDFLDANGGKYWSDILPDGHWKQLQNEIEEFAKVLEGEGVKVVRPEAQDFGKIFTGLGFCSHGIYAAMPRDLVLVVGDELIESTMTWKSRYFEFVSYRKLLKGYYDKGAKWTVAPKPLMLDELLEKDYDFYGT---NKL----KRITTEKEICFDAADFFRCGQDIFGQRSQVTNSAAINWMRRHLAPQGIRVHELNFYDAFCMHVDATLVPVKPGVFLKNPKYPLVEMDNFTNCGWEFVDVPTPLLSEER-LYMSSNYLAMNTLMMDPGRVFIEKEETGTQKLFESIGVKSIPVSMKHCFSIGGGFHCWTSDIKRRGTLENYFN 1314
            ++ PV S+NEWD LEE +VG P+NA VP  + EVKA      W F   +GG+      P  H K+   EIEE   VL  EGV V RPE  D+   +    F S G+YAAMPRD++LVVG+E+IE+ M W++R+FE+ +YR L+K Y+ +GAKWT APKP M DEL ++DY        +KL    K +TTE E CFDAADF R G+DIF QRSQVTN   I WMRRHLAP   +VH ++F D   MH+DAT   + PG+ L NP  P  +++ F   GW  V  P PL+ +   L+MSS +L+MN LM+D  RV ++  ET  QK+FE +G+ +I V+++H  S+GGGFHCWT DI+RRGTL++YF+
Sbjct:   61 QECPVCSYNEWDPLEEVIVGRPENANVPPFSVEVKANTYEKYWPFYQKHGGQS----FPVEHVKKATEEIEEMCNVLRHEGVVVQRPEVIDWSVKYKTPDFESTGMYAAMPRDILLVVGNEIIEAPMAWRARFFEYRAYRPLIKDYFRRGAKWTTAPKPTMADELYDQDYPIRTVEDRHKLAAMGKFVTTEFEPCFDAADFMRAGRDIFAQRSQVTNYLGIEWMRRHLAPD-YKVHIISFKDPNPMHIDATFNIIGPGLVLSNPDRPCHQIELFKKAGWTVVTPPIPLIPDNHPLWMSSKWLSMNVLMLDEKRVMVDANETSIQKMFEKLGISTIKVNIRHANSLGGGFHCWTCDIRRRGTLQSYFS 422          
BLAST of Glycine amidinotransferase mitochondrial vs. TrEMBL
Match: A0A183AH38 (Uncharacterized protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS6273 PE=4 SV=1)

HSP 1 Score: 428.328 bits (1100), Expect = 1.682e-144
Identity = 204/372 (54.84%), Postives = 261/372 (70.16%), Query Frame = 1
Query:  229 ERKKKSPVWSWNEWDHLEECVVGIPDNAVVPTMTPEVKACMSPDLWDFLDANGGKYWSDILPDGHWKQLQNEIEEFAKVLEGEGVKVVRPEAQDFGKIFTGLGFCSHGIYAAMPRDLVLVVGDELIESTMTWKSRYFEFVSYRKLLKGYYDKGAKWTVAPKPLMLDELLEKDYDFYGTNKLK------RITTEKEICFDAADFFRCGQDIFGQRSQVTNSAAINWMRRHLAPQGIRVHELNFYDAFCMHVDATLVPVKPGVFLKNPKYPLVEMDNFTNCGWEFVDVPTPLLSEER-LYMSSNYLAMNTLMMDPGRVFIEKEETGTQKLFESIGVKSIPVSMKHCFSIGGGFHCWTSDIKRRGTLENYFNWSK 1323
            + K   PV SWNEWD LEE +VGIPD A VP + PEVK C++   W F + N GKYW+D +P  HW  L  +I EF + LE EGVKV+RPE  D  K ++ LGF S G Y+AMPRD +LVVGDELIE+TMTW++RYFE+VSYR ++  Y+ +GAKWTVAPKP    +L+ ++   +  N +        ITTE E CFDAADF R G+DIF QRSQVTN A I W+RRHL P+GIRVH L F D   MH+DAT   VKPGV L+NP     E+D F   GW+ VDVP PL+S+   L++ SN+L+MN LM+DP RV +E+EE G Q+++  IGV  +PV ++H  SIGGGFHCWT D++RRG L++YF+WS+
Sbjct:    8 QTKPVCPVNSWNEWDPLEEIIVGIPDYATVPHLVPEVKICVAESNWAFFEKNAGKYWADAMPRDHWDLLCRQINEFVRKLELEGVKVIRPEPVDHRKSYSLLGFQSQGFYSAMPRDFLLVVGDELIEATMTWRARYFEYVSYRPIIMDYWKRGAKWTVAPKPTDYQKLINQETAKHLENHVSDKSNIGHITTESEPCFDAADFIRAGRDIFVQRSQVTNLAGIEWVRRHLEPRGIRVHRLTFEDPRPMHIDATFSLVKPGVALQNPDRQCHEIDLFKAAGWDVVDVPRPLISKSHPLWLGSNWLSMNVLMLDPTRVMVEEEEVGIQEMYRKIGVTPVPVKIRHANSIGGGFHCWTCDVRRRGGLQSYFDWSR 379          
BLAST of Glycine amidinotransferase mitochondrial vs. TrEMBL
Match: H2KUH6 (Glycine amidinotransferase mitochondrial OS=Clonorchis sinensis OX=79923 GN=CLF_109091 PE=4 SV=1)

HSP 1 Score: 420.239 bits (1079), Expect = 6.675e-141
Identity = 196/367 (53.41%), Postives = 254/367 (69.21%), Query Frame = 1
Query:  244 SPVWSWNEWDHLEECVVGIPDNAVVPTMTPEVKACMSPDLWDFLDANGGKYWSDILPDGHWKQLQNEIEEFAKVLEGEGVKVVRPEAQDFGKIFTGLGFCSHGIYAAMPRDLVLVVGDELIESTMTWKSRYFEFVSYRKLLKGYYDKGAKWTVAPKPLMLDELLEK------DYDFYGTNKLKRITTEKEICFDAADFFRCGQDIFGQRSQVTNSAAINWMRRHLAPQGIRVHELNFYDAFCMHVDATLVPVKPGVFLKNPKYPLVEMDNFTNCGWEFVDVPTPLLSEERLY-MSSNYLAMNTLMMDPGRVFIEKEETGTQKLFESIGVKSIPVSMKHCFSIGGGFHCWTSDIKRRGTLENYFNWSK 1323
            SPVWSWNEWD LEE +VG P+ AVVP   PEVK C   D W+F + N G+YW+D +P  HW+++  E+EE+ +VL+ EGVKV+RP   D    F  LGF S G YAAMPRD +LV+G+ELIE+TMTW+SRYFE+++YR L+  Y+ +GAKWTVAPKP   D ++ K      D      + +  ITTE E CFDAADF R G+DIF QRSQVTN A I W+RRH+ P GIRVH+L F D   MH+DAT V  KPG+ ++NP  P  + +     GW+ +D PTP + +   Y + S +L+MN LM+DP RV +EK ET   +++  IG+  IPV+++H  SIGG FHCWTSDIKRRG LE+YF+WSK
Sbjct:   43 SPVWSWNEWDPLEEIIVGTPEGAVVPRPLPEVKMCTPMDTWEFYEKNAGRYWADCIPKEHWEKVVKEVEEYVRVLQMEGVKVLRPSKVDHSSTFKLLGFESQGFYAAMPRDFLLVIGNELIEATMTWRSRYFEYLAYRPLILEYWKQGAKWTVAPKPTDFDAIINKEVTKKLDSGVSDKSNIGFITTESEPCFDAADFTRAGRDIFCQRSQVTNLAGIEWVRRHVEPLGIRVHQLTFTDPRPMHIDATFVFAKPGIAIQNPDRPCDQTELIKAAGWDVIDAPTPNVPKSHPYWLGSPWLSMNVLMLDPERVLVEKGETAIHEMYRRIGITPIPVALRHANSIGGSFHCWTSDIKRRGNLESYFDWSK 409          
BLAST of Glycine amidinotransferase mitochondrial vs. TrEMBL
Match: Q5DBC6 (SJCHGC09313 protein OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 419.083 bits (1076), Expect = 1.231e-140
Identity = 192/366 (52.46%), Postives = 259/366 (70.77%), Query Frame = 1
Query:  241 KSPVWSWNEWDHLEECVVGIPDNAVVPTMTPEVKACMSPDLWDFLDANGGKYWSDILPDGHWKQLQNEIEEFAKVLEGEGVKVVRPEAQDFGKIFTGLGFCSHGIYAAMPRDLVLVVGDELIESTMTWKSRYFEFVSYRKLLKGYYDKGAKWTVAPKP-----LMLDELLEKDYDFYGTNKLKRITTEKEICFDAADFFRCGQDIFGQRSQVTNSAAINWMRRHLAPQGIRVHELNFYDAFCMHVDATLVPVKPGVFLKNPKYPLVEMDNFTNCGWEFVDVPTPLLSEER-LYMSSNYLAMNTLMMDPGRVFIEKEETGTQKLFESIGVKSIPVSMKHCFSIGGGFHCWTSDIKRRGTLENYFNWS 1320
            KSPV SWNEWD LEE +VG P+ +VVP + PEVK C++    +F   NGGKYW+D++P  HW+ L  ++E+F K+LE EG+KVVRP   D    +  L F + G YAAMPRD +L+VGDE+IE+TMTW+SRYFEF++YR L   Y+  GAKWT+APKP     L+ D  +  D     ++   ++TTE E CFDAADF R G+DIF QRSQVTN + I W+RRHL P+GI+VH L F D   MH+DAT   VKPG+ ++NP+ P  + D     GW+ +D P PL+ ++  +++ SN+L+MN LM+DP RV +E EETG Q+L++S+G++ IPV ++H  SIGGGFHCWT DI+RR  LE+YF+WS
Sbjct:   27 KSPVNSWNEWDSLEEIIVGTPEYSVVPHLLPEVKPCVASAKHNFYIQNGGKYWADVIPKEHWQLLCKQVEDFVKILELEGIKVVRPVPIDHKNSYKILDFETQGFYAAMPRDFLLIVGDEMIEATMTWRSRYFEFLAYRPLTLNYWRHGAKWTIAPKPTNFSKLIKDNPINGDIANKSSSYYGKVTTESEPCFDAADFIRAGRDIFAQRSQVTNLSGIEWVRRHLEPRGIKVHRLTFTDPRPMHIDATFTLVKPGIAIQNPERPCHQADILRKAGWKIIDAPEPLIKKDHEMWLGSNWLSMNVLMLDPNRVIVESEETGMQELYKSLGIQPIPVKLRHANSIGGGFHCWTCDIRRRSKLESYFDWS 392          
BLAST of Glycine amidinotransferase mitochondrial vs. TrEMBL
Match: A0A074ZTV3 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_04080 PE=4 SV=1)

HSP 1 Score: 418.313 bits (1074), Expect = 5.786e-140
Identity = 195/367 (53.13%), Postives = 255/367 (69.48%), Query Frame = 1
Query:  244 SPVWSWNEWDHLEECVVGIPDNAVVPTMTPEVKACMSPDLWDFLDANGGKYWSDILPDGHWKQLQNEIEEFAKVLEGEGVKVVRPEAQDFGKIFTGLGFCSHGIYAAMPRDLVLVVGDELIESTMTWKSRYFEFVSYRKLLKGYYDKGAKWTVAPKPLMLDELLEK------DYDFYGTNKLKRITTEKEICFDAADFFRCGQDIFGQRSQVTNSAAINWMRRHLAPQGIRVHELNFYDAFCMHVDATLVPVKPGVFLKNPKYPLVEMDNFTNCGWEFVDVPTPLLSEERLY-MSSNYLAMNTLMMDPGRVFIEKEETGTQKLFESIGVKSIPVSMKHCFSIGGGFHCWTSDIKRRGTLENYFNWSK 1323
            SPVWSWNEWD LEE +VG P+ AVVP + PEVK C   D WDF + N G+YW+D +P  HW+++  E+EE+ +VL+ EGVKV+RP   +    F  LGF S G YAAMPRD +LV+G+ELIE+TMTW+SRYFE+++YR LL  Y+ +GAKWTVAPKP   D ++ K      D      + +  ITTE E CFDAADF R G+DIF QRSQVTN A I W+RRH+ P GIRVH+L F D   MH+DAT V  KPG+ ++NP  P  + +     GW+ ++ PTP + +   Y + S +L+MN LM+DP RV +EK ET   +++  IG+  IPV+++H  SIGG FHCWTSDI+RRG LE+YF+WSK
Sbjct:   57 SPVWSWNEWDPLEEIIVGTPEGAVVPRLLPEVKMCTPMDKWDFYEKNAGRYWADCIPKEHWEKVVKEVEEYVRVLQMEGVKVLRPSKVNHLSTFKLLGFESQGFYAAMPRDFLLVIGNELIEATMTWRSRYFEYLAYRPLLLEYWKQGAKWTVAPKPTDFDAIINKEVVKKLDSGVSDKSNIGFITTESEPCFDAADFTRAGRDIFCQRSQVTNLAGIEWVRRHVEPLGIRVHQLTFTDPRPMHIDATFVFAKPGIAIQNPDRPCDQTELIKAAGWDVINAPTPNVPKTHPYWLGSPWLSMNVLMLDPERVLVEKGETAIHEMYRRIGITPIPVALRHANSIGGSFHCWTSDIRRRGKLESYFDWSK 423          
BLAST of Glycine amidinotransferase mitochondrial vs. TrEMBL
Match: A0A430QEY0 (Glycine amidinotransferase (Fragment) OS=Schistosoma bovis OX=6184 GN=DC041_0008220 PE=4 SV=1)

HSP 1 Score: 413.69 bits (1062), Expect = 2.878e-138
Identity = 195/399 (48.87%), Postives = 269/399 (67.42%), Query Frame = 1
Query:  163 QLTRCMSN------SLANNPFTNPTALAERKKKSPVWSWNEWDHLEECVVGIPDNAVVPTMTPEVKACMSPDLWDFLDANGGKYWSDILPDGHWKQLQNEIEEFAKVLEGEGVKVVRPEAQDFGKIFTGLGFCSHGIYAAMPRDLVLVVGDELIESTMTWKSRYFEFVSYRKLLKGYYDKGAKWTVAPKPLMLDELLEKDYDFYGTN-----KLKRITTEKEICFDAADFFRCGQDIFGQRSQVTNSAAINWMRRHLAPQGIRVHELNFYDAFCMHVDATLVPVKPGVFLKNPKYPLVEMDNFTNCGWEFVDVPTPLLSEER-LYMSSNYLAMNTLMMDPGRVFIEKEETGTQKLFESIGVKSIPVSMKHCFSIGGGFHCWTSDIKRRGTLENYFNWSK 1323
            Q  RC+ N         ++ ++    L + K KSPV SWNEWD LEE +VG P+ A VP + PEVK C +    +F   NGGKYW+D++P  HW+ L  ++E+F K+LE EG+KVVRP+  D  K +  L F + G YAAMPRD +L+VGDE+IE+TMTW+SRYFE+++YR L   Y+ +GAKWT+ PKP    +L+  +    G +        ++TTE E CFDAADF R G+DIF QRSQVTN + I W+RRHL P+GI+VH L+F D   MH+DAT   VKPG+ ++NP  P  ++D     GW+ +D P PL+ ++  +++ SN+L+MN LM+D  RV +E EETG Q++++SIG+K I V  K+  SIGGGFHCWT DI+R+  LE+YF+WSK
Sbjct:   14 QQIRCIQNVTSVPIKTVSSLYSTDVELKQNKLKSPVNSWNEWDPLEEIIVGTPEYATVPHLLPEVKTCAASAKHNFYIQNGGKYWADVIPKEHWQLLCKQVEDFVKMLELEGIKVVRPDPVDHRKSYKLLDFETQGFYAAMPRDFLLIVGDEIIEATMTWRSRYFEYLAYRPLALNYWRQGAKWTIGPKPTNFSKLIRDEPINVGLSDEHNPDYGKVTTESEPCFDAADFIRAGRDIFAQRSQVTNLSGIEWVRRHLEPRGIKVHRLSFVDPRPMHIDATFTLVKPGIAIQNPDRPCHQVDFIRKAGWQVIDAPQPLMKKDHEMWLGSNWLSMNVLMLDQNRVIVESEETGIQEMYKSIGIKPINVKFKYANSIGGGFHCWTCDIRRQSKLESYFDWSK 412          
BLAST of Glycine amidinotransferase mitochondrial vs. Ensembl Cavefish
Match: gatm (glycine amidinotransferase [Source:NCBI gene;Acc:103044592])

HSP 1 Score: 355.91 bits (912), Expect = 4.451e-119
Identity = 182/389 (46.79%), Postives = 250/389 (64.27%), Query Frame = 1
Query:  172 RCMSNSLANNPFTNPTALAERKKKSPVWSWNEWDHLEECVVGIPDNAVVPTMTPEVKACMSPDLWDFLDANGGKYWSDILPDGHWKQLQNEIEEFAKVLEGEGVKVVRPEAQDFGKIFTGLGFCSHGIYAAMPRDLVLVVGDELIESTMTWKSRYFEFVSYRKLLKGYYDKGAKWTVAPKPLMLDELLEKDYDFYGT---NKL----KRITTEKEICFDAADFFRCGQDIFGQRSQVTNSAAINWMRRHLAPQGIRVHELNFYDAFCMHVDATLVPVKPGVFLKNPKYPLVEMDNFTNCGWEFVDVPTPLLSEER-LYMSSNYLAMNTLMMDPGRVFIEKEETGTQKLFESIGVKSIPVSMKHCFSIGGGFHCWTSDIKRRGTLENYFN 1314
            R  S++ A  P        E  ++ PV ++NEWD LEE +VG  +NA VP  T EVKA      W F    GG+      P+ H K+   EIEE   +L  EGV V RPE  D+   +    F S G+YAAMPRD+++VVG+E+IE+ M W++R+FE+ +YR L+K Y+ +GAKWT APKP M DEL +++Y        +KL    K +TTE E CFDAADF R G D+F QRSQVTN   I WMRRHLAP   +VH ++F D   MH+DAT   + PG+ L NP  P  +++ F   GW  V  PTPL+ ++  L+MSS +L+MN LM+D  RV ++  E+  QK+FE++G+K+I VS++H  S+GGGFHCWT+D++RRGTL++YF+
Sbjct:   37 RSSSSAAAVQPHPQ-----EEVEECPVCAYNEWDPLEEVIVGRAENARVPPFTVEVKANTYEKYWPFYQKYGGQ----TFPEEHLKKAIAEIEEMCNILRHEGVTVQRPEPIDWSVEYKTPDFTSTGMYAAMPRDILMVVGNEIIEAPMAWRARFFEYRAYRPLIKEYFRRGAKWTTAPKPTMADELYDQEYPIRTVEDRHKLAAEGKFVTTEHEPCFDAADFIRAGTDLFVQRSQVTNFLGIEWMRRHLAPH-YKVHIISFKDPNPMHIDATFNIIGPGLVLSNPDRPCRQIEMFKKAGWTVVKPPTPLIPDDHPLWMSSKWLSMNVLMLDEKRVMVDANESTIQKMFENLGIKTIKVSIRHANSLGGGFHCWTTDVRRRGTLQSYFH 415          
BLAST of Glycine amidinotransferase mitochondrial vs. Ensembl Nematostella
Match: EDO35968 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SK04])

HSP 1 Score: 356.681 bits (914), Expect = 1.235e-119
Identity = 183/363 (50.41%), Postives = 234/363 (64.46%), Query Frame = 1
Query:  247 PVWSWNEWDHLEECVVGIPDNAVVPTMTPEVKACMSPDLWDFLDANGGKYWSDILPDGHWKQLQNEIEEFAKVLEGEGVKVVRPEAQDFGKIFTGLGFCSHGIYAAMPRDLVLVVGDELIESTMTWKSRYFEFVSYRKLLKGYYDKGAKWTVAPKPLMLDELLEKDYDFYG-------TNKLKRITTEKEICFDAADFFRCGQDIFGQRSQVTNSAAINWMRRHLAPQGIRVHELNFYDAFCMHVDATLVPVKPGVFLKNPKYPLVEMDNFTNCGWEFVDVPTPLLSEER-LYMSSNYLAMNTLMMDPGRVFIEKEETGTQKLFESIGVKSIPVSMKHCFSIGGGFHCWTSDIKRRGTLENYF 1311
            PV S NEWD LEE +VG  + A VP  TPEVKA  S   W F +  GG+      P  H K+   EIEEF  +L  EGV V RPE  DF ++     F S G+Y+AMPRD++LVVGDE+IES M W+SR+FE+ +YR L+K Y+ +GA+WT APKP M DEL + DY           +++ K +TTE E CFDAADF R G+DIF QRSQVTN   I WM+RHL  Q  R+H L+F D   MH+DAT   + PG+ L NP  P  ++D F   GW  V  P PL+ +   L+MSS +L+MN LM+DP RV  +K ET T K+FE +G+  IPVS++   S+GGGFHCWT D++RRG LE+Y 
Sbjct:   71 PVGSHNEWDLLEEVIVGNVEGATVPKFTPEVKANTSHKNWKFFELYGGR----PFPAEHLKKAATEIEEFCNILHHEGVTVRRPEPIDFSEVCKTPDFESSGLYSAMPRDILLVVGDEIIESPMAWRSRFFEYRAYRPLIKEYFRRGARWTTAPKPQMSDELYDLDYPIRSVEDRHKLSSEGKFVTTEFEPCFDAADFMRAGRDIFVQRSQVTNYMGIEWMKRHLGNQ-YRIHTLSFDDPNPMHIDATFNIIGPGLVLSNPDRPCHQIDMFKKAGWTVVQPPEPLIPDSHPLWMSSKWLSMNVLMLDPTRVVCDKNETTTIKMFEKLGITPIPVSIRFANSLGGGFHCWTCDVRRRGKLESYL 428          
BLAST of Glycine amidinotransferase mitochondrial vs. Ensembl Medaka
Match: gatm (glycine amidinotransferase [Source:NCBI gene;Acc:101156236])

HSP 1 Score: 358.221 bits (918), Expect = 8.503e-120
Identity = 180/367 (49.05%), Postives = 244/367 (66.49%), Query Frame = 1
Query:  238 KKSPVWSWNEWDHLEECVVGIPDNAVVPTMTPEVKACMSPDLWDFLDANGGKYWSDILPDGHWKQLQNEIEEFAKVLEGEGVKVVRPEAQDFGKIFTGLGFCSHGIYAAMPRDLVLVVGDELIESTMTWKSRYFEFVSYRKLLKGYYDKGAKWTVAPKPLMLDELLEKDYDFYGT---NKL----KRITTEKEICFDAADFFRCGQDIFGQRSQVTNSAAINWMRRHLAPQGIRVHELNFYDAFCMHVDATLVPVKPGVFLKNPKYPLVEMDNFTNCGWEFVDVPTPLLSEER-LYMSSNYLAMNTLMMDPGRVFIEKEETGTQKLFESIGVKSIPVSMKHCFSIGGGFHCWTSDIKRRGTLENYFN 1314
            ++ PV S+NEWD LEE +VG  +NA VP  T EVKA      W F   +GG+      P  H K+   EIEE   +L  EGV V RPE  D+   +    F S G+YAAMPRD+++VVG+E+IE+ M W++R+FE+ +YR L+K Y+ KGAKWT APKP M DEL ++DY        +KL    K +TTE E CFDAADF R G+D+F QRSQVTN   I WMRRHLAP   +VH ++F D   MH+DAT   + PG+ L NP  P  ++D F   GW  V  PTPL+ ++  L+MSS +L+MN LM+D  RV ++  E+  QK+FES+G+++I V+++H  S+GGGFHCWT+D++RRGTL++YF+
Sbjct:   62 QECPVCSYNEWDPLEEVIVGRAENAHVPPFTVEVKANTYEKYWPFYQKHGGQS----FPADHLKKAVAEIEEMCNILRHEGVVVRRPEPIDWSLEYKTPDFSSTGMYAAMPRDILIVVGNEIIEAPMAWRARFFEYRAYRPLIKEYFRKGAKWTTAPKPTMADELYDQDYPIRTVEDRHKLAAQGKFVTTEHEPCFDAADFIRAGRDLFVQRSQVTNYMGIEWMRRHLAPD-YKVHIISFKDPNPMHIDATFNIIGPGLVLSNPDRPCRQVDMFKKAGWTVVKPPTPLIPDDHPLWMSSKWLSMNVLMLDEKRVMVDANESTIQKMFESLGIQTIKVNIRHANSLGGGFHCWTTDVRRRGTLQSYFH 423          
BLAST of Glycine amidinotransferase mitochondrial vs. Planmine SMEST
Match: SMESG000068402.1 (SMESG000068402.1)

HSP 1 Score: 880.552 bits (2274), Expect = 0.000e+0
Identity = 420/421 (99.76%), Postives = 420/421 (99.76%), Query Frame = 1
Query:   97 MKNAKCLFVNCFSLLKSKPNEYQLTRCMSNSLANNPFTNPTALAERKKKSPVWSWNEWDHLEECVVGIPDNAVVPTMTPEVKACMSPDLWDFLDANGGKYWSDILPDGHWKQLQNEIEEFAKVLEGEGVKVVRPEAQDFGKIFTGLGFCSHGIYAAMPRDLVLVVGDELIESTMTWKSRYFEFVSYRKLLKGYYDKGAKWTVAPKPLMLDELLEKDYDFYGTNKLKRITTEKEICFDAADFFRCGQDIFGQRSQVTNSAAINWMRRHLAPQGIRVHELNFYDAFCMHVDATLVPVKPGVFLKNPKYPLVEMDNFTNCGWEFVDVPTPLLSEERLYMSSNYLAMNTLMMDPGRVFIEKEETGTQKLFESIGVKSIPVSMKHCFSIGGGFHCWTSDIKRRGTLENYFNWSKPFLDKYTEKYEQ 1359
            MKNAKCLFVNCFSLLKSKPN YQLTRCMSNSLANNPFTNPTALAERKKKSPVWSWNEWDHLEECVVGIPDNAVVPTMTPEVKACMSPDLWDFLDANGGKYWSDILPDGHWKQLQNEIEEFAKVLEGEGVKVVRPEAQDFGKIFTGLGFCSHGIYAAMPRDLVLVVGDELIESTMTWKSRYFEFVSYRKLLKGYYDKGAKWTVAPKPLMLDELLEKDYDFYGTNKLKRITTEKEICFDAADFFRCGQDIFGQRSQVTNSAAINWMRRHLAPQGIRVHELNFYDAFCMHVDATLVPVKPGVFLKNPKYPLVEMDNFTNCGWEFVDVPTPLLSEERLYMSSNYLAMNTLMMDPGRVFIEKEETGTQKLFESIGVKSIPVSMKHCFSIGGGFHCWTSDIKRRGTLENYFNWSKPFLDKYTEKYEQ
Sbjct:    1 MKNAKCLFVNCFSLLKSKPNGYQLTRCMSNSLANNPFTNPTALAERKKKSPVWSWNEWDHLEECVVGIPDNAVVPTMTPEVKACMSPDLWDFLDANGGKYWSDILPDGHWKQLQNEIEEFAKVLEGEGVKVVRPEAQDFGKIFTGLGFCSHGIYAAMPRDLVLVVGDELIESTMTWKSRYFEFVSYRKLLKGYYDKGAKWTVAPKPLMLDELLEKDYDFYGTNKLKRITTEKEICFDAADFFRCGQDIFGQRSQVTNSAAINWMRRHLAPQGIRVHELNFYDAFCMHVDATLVPVKPGVFLKNPKYPLVEMDNFTNCGWEFVDVPTPLLSEERLYMSSNYLAMNTLMMDPGRVFIEKEETGTQKLFESIGVKSIPVSMKHCFSIGGGFHCWTSDIKRRGTLENYFNWSKPFLDKYTEKYEQ 421          
BLAST of Glycine amidinotransferase mitochondrial vs. Planmine SMEST
Match: SMESG000051964.1 (SMESG000051964.1)

HSP 1 Score: 407.527 bits (1046), Expect = 1.827e-139
Identity = 191/375 (50.93%), Postives = 262/375 (69.87%), Query Frame = 1
Query:  235 KKKSPVWSWNEWDHLEECVVGIPDNAVVPTMTPEVKACMSPDLWDFLDANGGKYWSDILPDGHWKQLQNEIEEFAKVLEGEGVKVVRPEAQDFGKIFTGLGFCSHGIYAAMPRDLVLVVGDELIESTMTWKSRYFEFVSYRKLLKGYYDKGAKWTVAPKPLMLDELLEKDY--DFYGT---NKLKRITTEKEICFDAADFFRCGQDIFGQRSQVTNSAAINWMRRHLAPQGIRVHELNFYDAFCMHVDATLVPVKPGVFLKNPKYPLVEMDNFTNCGWEFVDVPTPLLSEE-RLYMSSNYLAMNTLMMDPGRVFIEKEETGTQKLFESIGVKSIPVSMKHCFSIGGGFHCWTSDIKRRGTLENYFNWSKPFLDKY 1341
            KK SPVW+WNEWD LEE V+G+PD A  P + PE KAC+S + +DFL  + GKYW D++   H+K + +E + F K+L+GEGVKVV PE  DF K      F +HG+  AMPRD +L+VG+E+IESTMTW+SRYFEF+ Y+KL+K Y+ +GAKWT APKP+  + L +++Y  D   T   ++   I TE+E  FDAADF RCG+DIF   SQV+N+A I W+RRHLAP+GIRVH +NF D   MH+D TL   +PG+ +  P+ P +++      GW+ V  P P +++    Y+SS +L++N +M+D  RV +EK+E G QKLFE  G+  + V  KHCFSIGGG HCWTSD++RRG L+NYF+W +  L+K+
Sbjct:   33 KKHSPVWAWNEWDPLEEIVLGLPDMACCPEILPEAKACISENKFDFLLKHKGKYWKDVIEPEHYKLMLDEHKNFIKILQGEGVKVVHPEPIDFAKTLCTPNFTAHGVDCAMPRDFLLIVGNEMIESTMTWRSRYFEFMCYKKLIKDYWSRGAKWTAAPKPMCKETLFKENYRADEDSTAFFDEKTSILTEEEPVFDAADFIRCGRDIFAHVSQVSNNAGIEWVRRHLAPKGIRVHSMNFVDPKPMHIDTTLFTPRPGLAITCPERPCLQIGMLKKAGWDVVVAPYPDIAKNFPYYISSQWLSLNVVMLDEKRVLVEKDEIGIQKLFEKCGITPVKVPFKHCFSIGGGIHCWTSDVRRRGDLQNYFDWPQEILEKF 407          
BLAST of Glycine amidinotransferase mitochondrial vs. Planmine SMEST
Match: SMESG000051953.1 (SMESG000051953.1)

HSP 1 Score: 380.563 bits (976), Expect = 7.569e-129
Identity = 193/416 (46.39%), Postives = 262/416 (62.98%), Query Frame = 1
Query:  109 KCLFVNCFSLLKSKPNEYQLTRCMSNSLANNPFTNPTALAERKKKSPVWSWNEWDHLEECVVGIPDNAVVPTMTPEVKACMSPDLWD-FLDANGGKYWSDILPDGHWKQLQNEIEEFAKVLEGEGVKVVRPEAQDFGKIFTGLGFCSHGIYAAMPRDLVLVVGDELIESTMTWKSRYFEFVSYRKLLKGYYDKGAKWTVAPKPLMLDELLEKDYDFYGT--NKLKRITTEKEICFDAADFFRCGQDIFGQRSQVTNSAAINWMRRHLAPQGIRVHELNFYDAFCMHVDATLVPVKPGVFLKNPKYPLVEMDNFTNCGWEFVDVPTPL-LSEERLYMSSNYLAMNTLMMDPGRVFIEKEETGTQKLFESIGVKSIPVSMKHCFSIGGGFHCWTSDIKRRGTLENYFNWSKPFLDKYT 1344
            + L +N    + +     +   C S S  + P TN       K+ SPVWSWNEWD LEE +VG+PD+ VVP   PE  AC    L + F+   GGKYWSDI+P   W  +  E +EF  +L+GEGV VV P   D  K +    F S G+  A PRD++LVVGDE++E+TMTW+SR++E++ YR L+  Y+ +GA +  APKP+  +E  +KD+D  G   ++L  +TTE E  FDAADF R G+DIF Q+S VTN+  I WMRRHLA +GIR+H LNF D + MH+DAT   VKPG  ++NP+      D     GW+ V  P P   S+    MS  +L+MN L++D  RV +EK E G  K+FESIG++ I V   HCF++GGG HCWTSD++R+GTLENYF+W +  L+K +
Sbjct:    7 RILPLNSLYKISAPAANIKYRNCCSKSSTDKP-TN-------KRNSPVWSWNEWDPLEEVIVGVPDHGVVPYPYPETAACFGERLTENFMKKYGGKYWSDIMPKEVWNNVLKEHKEFCNILKGEGVTVVHPTPMDMKKEYETPYFKSVGLDVAFPRDIILVVGDEIMETTMTWRSRFWEYLCYRPLMLDYWKRGANFQSAPKPVCSEESFKKDFDISGNKFDELGYVTTEFEPMFDAADFMRAGRDIFVQQSHVTNATGIEWMRRHLAEKGIRLHLLNFNDPYAMHIDATFFTVKPGYLIENPEVINPYADYLKKAGWKIVKGPKPADRSDMYEGMSYKWLSMNVLVLDQKRVLVEKREVGMHKMFESIGMQPIKVDFGHCFAVGGGLHCWTSDVRRKGTLENYFDWPQEVLEKVS 414          
BLAST of Glycine amidinotransferase mitochondrial vs. Planmine SMEST
Match: SMESG000043142.1 (SMESG000043142.1)

HSP 1 Score: 370.933 bits (951), Expect = 3.401e-125
Identity = 180/373 (48.26%), Postives = 243/373 (65.15%), Query Frame = 1
Query:  229 ERKKKSPVWSWNEWDHLEECVVGIPDNAVVPTMTPEVKACMSPDLWDFLDANGGKYWSDILPDGHWKQLQNEIEEFAKVLEGEGVKVVRPEAQDFGKIFTGLGFCSHGIYAAMPRDLVLVVGDELIESTMTWKSRYFEFVSYRKLLKGYYDKGAKWTVAPKPLMLDELLEKDYDFYGTNKLKRITTEKEICFDAADFFRCGQDIFGQRSQVTNSAAINWMRRHLAPQGIRVHELNFYDAFCMHVDATLVPVKPGVFLKNPKYPLVEMDNFTNCGWEFVDVPT-PLLSEERLYMSSNYLAMNTLMMDPGRVFIEKEETGTQKLFESIGVKSIPVSMKHCFSIGGGFHCWTSDIKRRGTLENYFNWSKPFLDKYT 1344
            E+K+ SPVW+WNEWD LEE VVG+P+NA +P  + EV A   P    F   +GGK +S+++    W +++NEI+E  +VLEGEGVKVV+PEA D+ + +T   F S G+YAAMPRD +L+VGDE+IES M W+ RYFE+ +YR L++ Y+++GA+WT APK  M D L + ++D         +TTE E CFDAADF R G+DIFGQRS VTN  AI W+RRHLAP G+RVH++ F   + MH+D    PVKPG+FL          D      W+ V +P  P   E   +M+ + L  N L +D  RV +EK E    K  + IG K IPVS+K   ++GGGFHCWT+DI+R+G LE+YF W    L++ T
Sbjct:   36 EKKQTSPVWAWNEWDPLEEVVVGVPNNATLPFPSQEVAATFGPPRLPFFQKHGGKKFSEVMGQEMWMKIENEIKELVRVLEGEGVKVVQPEAIDYDQKWTTPKFSSTGLYAAMPRDFLLIVGDEIIESPMAWRCRYFEYEAYRPLIRKYFNEGARWTSAPKCTMEDALYDMEFDVAQEKPYVYVTTELEPCFDAADFTRIGRDIFGQRSHVTNKKAIQWLRRHLAPSGVRVHDIEFDSLYSMHIDTNFFPVKPGMFLLKDGLNCKTPDLLKKSKWDIVIMPKGPHRDEHYKWMNYHGLPNNMLSIDTERVLVEKTEEYMIKFMQEIGFKPIPVSLKFANNLGGGFHCWTADIRRQGKLESYFEWPDEILERLT 408          
BLAST of Glycine amidinotransferase mitochondrial vs. Planmine SMEST
Match: SMESG000051929.1 (SMESG000051929.1)

HSP 1 Score: 356.681 bits (914), Expect = 7.704e-120
Identity = 167/373 (44.77%), Postives = 236/373 (63.27%), Query Frame = 1
Query:  241 KSPVWSWNEWDHLEECVVGIPDNAVVPTMTPEVKACMSPDLWDFLDANGGKYWSDILPDGHWKQLQNEIEEFAKVLEGEGVKVVRPEAQDFGKIFTGLGFCSHGIYAAMPRDLVLVVGDELIESTMTWKSRYFEFVSYRKLLKGYYDKGAKWTVAPKPLMLDELLEKDYDFYGTNKLKRITTEKEICFDAADFFRCGQDIFGQRSQVTNSAAINWMRRHLAPQGIRVHELNFYDAFCMHVDATLVPVKPGVFLKNPKYPLVEMDNFTNCGWEFV-DVPTPLLSEERLYMSSNYLAMNTLMMDPGRVFIEKEETGTQKLFESIGVKSIPVSMKHCFSIGGGFHCWTSDIKRRGTLENYFNWSKPFLDKYTEKYE 1356
            +  V  WNEWD LEE VVGIPDNAV+P +T E K C+   +W F   N GKYWSD+L    W  L  E + F+  L+ EGVKVV PE Q+F   +      + G+Y AMPRD++L +G+E+IE+ MTW+SRYFE  SYRKL+  Y+ +GA W  APKP   +   E +     ++ +  +T+E E  FDAADF R G DIF QRSQVTN+  I W+R H+  + IRV  L+F D   MH+DAT +P+KPG+ L NP     ++ NF + GW+ +  +P    +    Y+SS ++ MN LM++  +V ++ ++   Q LF ++ ++ IPV  +HC SIGGGFHCW+ DI+R+G L++YFNW    +D Y + Y+
Sbjct:   19 RQAVQVWNEWDPLEEIVVGIPDNAVIPPITIETKPCIHNSMWPFFKENSGKYWSDVLGQRFWSALLKEHKSFSDALKNEGVKVVNPETQNFENKYKIRDHETTGMYCAMPRDILLPIGNEIIEAPMTWRSRYFEINSYRKLIIDYWKRGASWVAAPKPTYNNLFEESN----KSDLISFVTSEAEPTFDAADFVRAGTDIFAQRSQVTNNLGIQWVRNHVKSKNIRVWTLSFDDPRPMHIDATFMPLKPGIILSNPDRKCHQIQNFLDAGWKVIYGIPRTNNNGHPYYLSSPWITMNVLMVNENKVIVDADDLEMQNLFRTLNIEVIPVKFRHCNSIGGGFHCWSVDIRRKGDLQSYFNWKSSVIDNYNKSYQ 387          
The following BLAST results are available for this feature:
BLAST of Glycine amidinotransferase mitochondrial vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
GATM5.011e-11446.06glycine amidinotransferase [Source:HGNC Symbol;Acc... [more]
GATM2.262e-9645.53glycine amidinotransferase [Source:HGNC Symbol;Acc... [more]
GATM1.653e-3442.55glycine amidinotransferase [Source:HGNC Symbol;Acc... [more]
GATM1.162e-642.62glycine amidinotransferase [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of Glycine amidinotransferase mitochondrial vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glycine amidinotransferase mitochondrial vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glycine amidinotransferase mitochondrial vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
gatm2.494e-11647.54glycine amidinotransferase (L-arginine:glycine ami... [more]
gatm4.228e-6146.72glycine amidinotransferase (L-arginine:glycine ami... [more]
gatm2.013e-5345.33glycine amidinotransferase (L-arginine:glycine ami... [more]
back to top
BLAST of Glycine amidinotransferase mitochondrial vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tmem2222.052e-11849.32transmembrane protein 222 [Source:Xenbase;Acc:XB-G... [more]
tmem2223.838e-11849.32transmembrane protein 222 [Source:Xenbase;Acc:XB-G... [more]
back to top
BLAST of Glycine amidinotransferase mitochondrial vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Gatm3.789e-11946.31glycine amidinotransferase (L-arginine:glycine ami... [more]
Gatm3.789e-11946.31glycine amidinotransferase (L-arginine:glycine ami... [more]
back to top
BLAST of Glycine amidinotransferase mitochondrial vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P50442|GATM_RAT5.388e-11946.56Glycine amidinotransferase, mitochondrial OS=Rattu... [more]
sp|Q9D964|GATM_MOUSE2.650e-11846.31Glycine amidinotransferase, mitochondrial OS=Mus m... [more]
sp|P50441|GATM_PIG4.133e-11846.06Glycine amidinotransferase, mitochondrial OS=Sus s... [more]
sp|Q9IAJ6|GATM_XENLA4.658e-11847.22Glycine amidinotransferase, mitochondrial OS=Xenop... [more]
sp|Q6P832|GATM_XENTR2.033e-11749.32Glycine amidinotransferase, mitochondrial OS=Xenop... [more]
back to top
BLAST of Glycine amidinotransferase mitochondrial vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183AH381.682e-14454.84Uncharacterized protein OS=Echinostoma caproni OX=... [more]
H2KUH66.675e-14153.41Glycine amidinotransferase mitochondrial OS=Clonor... [more]
Q5DBC61.231e-14052.46SJCHGC09313 protein OS=Schistosoma japonicum OX=61... [more]
A0A074ZTV35.786e-14053.13Uncharacterized protein OS=Opisthorchis viverrini ... [more]
A0A430QEY02.878e-13848.87Glycine amidinotransferase (Fragment) OS=Schistoso... [more]
back to top
BLAST of Glycine amidinotransferase mitochondrial vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
gatm4.451e-11946.79glycine amidinotransferase [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Glycine amidinotransferase mitochondrial vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glycine amidinotransferase mitochondrial vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glycine amidinotransferase mitochondrial vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO359681.235e-11950.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Glycine amidinotransferase mitochondrial vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
gatm8.503e-12049.05glycine amidinotransferase [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Glycine amidinotransferase mitochondrial vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000068402.10.000e+099.76SMESG000068402.1[more]
SMESG000051964.11.827e-13950.93SMESG000051964.1[more]
SMESG000051953.17.569e-12946.39SMESG000051953.1[more]
SMESG000043142.13.401e-12548.26SMESG000043142.1[more]
SMESG000051929.17.704e-12044.77SMESG000051929.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019154 ID=SMED30019154|Name=Glycine amidinotransferase mitochondrial|organism=Schmidtea mediterranea sexual|type=transcript|length=1444bp
ATTGACTACCACGCATAAACCTATAAAACATATGATAAATGAAACTTGTG
ATATCAAAATTTGGTTATTTTTAAGAATATTTTTGTCATTTTAAAAATGA
AAAACGCAAAGTGCTTATTTGTGAATTGCTTTTCACTTTTGAAGTCCAAG
CCGAATGAATACCAATTGACTCGATGTATGTCGAATAGTCTTGCGAATAA
TCCTTTCACAAATCCAACTGCTTTGGCAGAACGAAAGAAAAAAAGTCCTG
TTTGGTCGTGGAATGAATGGGATCATTTGGAAGAATGTGTAGTAGGAATT
CCGGACAATGCCGTAGTTCCAACAATGACACCTGAAGTCAAGGCTTGTAT
GAGTCCAGATTTATGGGATTTCTTGGATGCTAATGGAGGGAAATATTGGT
CAGATATTCTGCCTGATGGGCATTGGAAACAGCTTCAAAACGAAATAGAA
GAATTTGCAAAAGTGCTTGAAGGCGAAGGAGTTAAAGTTGTGAGACCTGA
AGCTCAAGATTTTGGGAAGATTTTCACTGGACTTGGGTTTTGTTCTCACG
GTATTTATGCGGCTATGCCTCGGGATTTGGTTCTTGTGGTAGGAGACGAA
TTAATAGAATCGACTATGACTTGGAAAAGTCGTTATTTTGAATTCGTTTC
ATACCGAAAACTTTTAAAAGGCTACTATGACAAAGGTGCAAAATGGACTG
TTGCACCTAAGCCTTTAATGTTGGATGAACTCTTGGAAAAAGATTATGAT
TTCTATGGAACAAATAAATTGAAAAGAATTACAACCGAAAAAGAAATCTG
TTTTGATGCTGCTGATTTTTTCAGATGTGGCCAAGACATTTTTGGACAGC
GTAGTCAAGTAACAAATTCTGCGGCAATAAATTGGATGAGAAGACATTTG
GCTCCTCAAGGAATTCGAGTTCATGAATTGAATTTTTATGATGCCTTTTG
CATGCATGTTGATGCAACCTTAGTTCCTGTGAAGCCAGGAGTATTTCTGA
AAAATCCAAAATATCCTCTAGTGGAAATGGATAATTTTACCAATTGCGGC
TGGGAATTTGTGGATGTTCCTACTCCACTGCTAAGTGAAGAACGACTATA
CATGAGTTCAAATTATCTGGCAATGAATACTTTAATGATGGATCCGGGTC
GAGTGTTTATAGAGAAAGAAGAAACCGGAACTCAAAAGTTGTTTGAATCA
ATCGGTGTCAAGTCAATTCCTGTAAGTATGAAGCATTGCTTCTCAATAGG
AGGGGGATTTCATTGCTGGACAAGCGACATTAAACGCAGAGGAACATTAG
AAAATTATTTCAATTGGTCTAAGCCTTTTCTTGACAAATATACAGAAAAA
TATGAGCAATAAGACGGTGACAATTGGCAATTATTTTTTATTCCCTAAAT
CAGTGTTTTTGTGACTTTTATTAATAATAAGTTTTAATTTAAAA
back to top

protein sequence of SMED30019154-orf-1

>SMED30019154-orf-1 ID=SMED30019154-orf-1|Name=SMED30019154-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=422bp
MKNAKCLFVNCFSLLKSKPNEYQLTRCMSNSLANNPFTNPTALAERKKKS
PVWSWNEWDHLEECVVGIPDNAVVPTMTPEVKACMSPDLWDFLDANGGKY
WSDILPDGHWKQLQNEIEEFAKVLEGEGVKVVRPEAQDFGKIFTGLGFCS
HGIYAAMPRDLVLVVGDELIESTMTWKSRYFEFVSYRKLLKGYYDKGAKW
TVAPKPLMLDELLEKDYDFYGTNKLKRITTEKEICFDAADFFRCGQDIFG
QRSQVTNSAAINWMRRHLAPQGIRVHELNFYDAFCMHVDATLVPVKPGVF
LKNPKYPLVEMDNFTNCGWEFVDVPTPLLSEERLYMSSNYLAMNTLMMDP
GRVFIEKEETGTQKLFESIGVKSIPVSMKHCFSIGGGFHCWTSDIKRRGT
LENYFNWSKPFLDKYTEKYEQ*
back to top
Aliases
The feature 'Glycine amidinotransferase mitochondrial' has the following synonyms
Synonym
NB.2.5d
AGAT-3
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000035Category 3 cell
PLANA:0002032epidermal cell
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR033195AmidinoTrfase
Vocabulary: molecular function
TermDefinition
GO:0015067amidinotransferase activity
GO:0016740transferase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.75.10.10coord: 50..406
e-value: 1.3E-101
score: 342.3
NoneNo IPR availableSUPERFAMILYSSF55909Penteincoord: 50..405
IPR033195Glycine/inosamine-phosphate amidinotransferasePANTHERPTHR10488GLYCINE AMIDINOTRANSFERASE, MITOCHONDRIALcoord: 45..406