dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B

Overview
Namedolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B
Smed IDSMED30019145
Length (bp)2340
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B (SMED30019145) t-SNE clustered cells

Violin plots show distribution of expression levels for dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B (SMED30019145) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B (SMED30019145) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B (SMED30019145) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019145

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymaSMED30019145SMESG000073595.1 dd_Smed_v4_39510_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B vs. Ensembl Human
Match: STT3B (STT3 oligosaccharyltransferase complex catalytic subunit B [Source:HGNC Symbol;Acc:HGNC:30611])

HSP 1 Score: 804.283 bits (2076), Expect = 0.000e+0
Identity = 391/725 (53.93%), Postives = 514/725 (70.90%), Query Frame = 3
Query:  135 DPWFNYRSTLELVERGFYKFLNWFDEKSWYPLGRIVGGTIFPGLMMTSGLFYNLLKQMSLHIEIRNVCVLLAPLYSCFTVIISFLLTKEIWNTNSGLICGCIMAIVPGYISRSSSGSYDNEGIAIFAMLLTFYFWIKATKTGTVFWSVLCSISYFYMVSAWGGYVYTLNLISLHVIILLLFQKYSNNLYVAFSVFYLFGLLFSMQIPFVGFQPLKSCEHASSACAFFVLQFYYYVIKLEDIKIKNGLKLYLYIG-PXXXXXXXXXXXXXTKLEILLPWSGRFYSLWDINYAAINIPIITSVSEHQPTAWQSTFFDLNVLMCFYPAGIWFCFKFLNNERIFLILYALTASYFSSIMVRLVLALTPAVAIGSSISFNMLLTYF----EKLHKPTKELDKTENFECVTIDSKGDGFCENKANEINYEIIH--KVIHNYFSTVVCIVILIH------FSIHSIFATSTSYSNPSIVMSSTLPDGNKVIIDDFREAYYWLKQNTKDEARIMSWWDYGYQITGMANRTTIVDNNTWNNSHIALVGKAMSMNETNAIKIIRLLDVDYVLVIFGGLIGFSGDDINKFLWMVRISEGEHPKEVYEYDYFTANGEYRIDKLAPKSMVDSLMYRLSYYRFGQIQIGKEFPTGYDRTRNAEIGLKYYKLKFFEEAFTSENWLVRIYKTKLRNFRISLKHARKKNKVFASQKRLRKMKGALKFPRIITRGIKKNSYPF 2270
            DPWFNYRST  L   GFY+FLNWFDE++WYPLGRIVGGT++PGLM+T+GL + +L  +++ + IR+VCV LAP +S  T I +FLLT+E+WN  +GL+  C +AIVPGYISRS +GS+DNEGIAIFA+  T+Y W+K+ KTG+VFW++ C +SYFYMVSAWGGYV+ +NLI LHV +LLL Q+YS  +Y+A+S FY+ GL+ SMQIPFVGFQP+++ EH ++A  F +LQ Y ++  L D   K   +   ++G  +A  +  L +  LT    + PWSGRFYSLWD  YA I+IPII SVSEHQPT W S FFDL++L+C +PAG+WFC K +N+ER+F+ LYA++A YF+ +MVRL+L LTP V + S+I+F+ +  ++     K   P  E    E+      D +  G   +KA ++        K        +  IV ++       F++H  + TS +YS+PS+V++S   DG + I+DDFREAY+WL+QNT + AR+MSWWDYGYQI GMANRTT+VDNNTWNNSHIALVGKAMS NET A KI+R LDVDYVLVIFGG+IG+SGDDINKFLWMVRI+EGEHPK++ E DYFT  GE+R+DK    ++++ LMY++SYYRFG++Q+    P G+DRTRNAEIG K  K K  EEAFTSE+WLVRIYK K  + R +L H  +   +F  QK L K     K      RG  KN   F
Sbjct:  103 DPWFNYRSTHHLASHGFYEFLNWFDERAWYPLGRIVGGTVYPGLMITAGLIHWILNTLNITVHIRDVCVFLAPTFSGLTSISTFLLTRELWNQGAGLLAACFIAIVPGYISRSVAGSFDNEGIAIFALQFTYYLWVKSVKTGSVFWTMCCCLSYFYMVSAWGGYVFIINLIPLHVFVLLLMQRYSKRVYIAYSTFYIVGLILSMQIPFVGFQPIRTSEHMAAAGVFALLQAYAFLQYLRDRLTKQEFQTLFFLGVSLAAGAVFLSVIYLTYTGYIAPWSGRFYSLWDTGYAKIHIPIIASVSEHQPTTWVSFFFDLHILVCTFPAGLWFCIKNINDERVFVALYAISAVYFAGVMVRLMLTLTPVVCMLSAIAFSNVFEHYLGDDMKRENPPVEDSSDED------DKRNQGNLYDKAGKVRKHATEQEKTEEGLGPNIKSIVTMLMLMLLMMFAVHCTWVTSNAYSSPSVVLASYNHDGTRNILDDFREAYFWLRQNTDEHARVMSWWDYGYQIAGMANRTTLVDNNTWNNSHIALVGKAMSSNETAAYKIMRTLDVDYVLVIFGGVIGYSGDDINKFLWMVRIAEGEHPKDIRESDYFTPQGEFRVDKAGSPTLLNCLMYKMSYYRFGEMQLDFRTPPGFDRTRNAEIGNKDIKFKHLEEAFTSEHWLVRIYKVKAPDNRETLDHKPRVTNIFPKQKYLSKKTTKRK------RGYIKNKLVF 815          
BLAST of dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B vs. Ensembl Human
Match: STT3A (STT3 oligosaccharyltransferase complex catalytic subunit A [Source:HGNC Symbol;Acc:HGNC:6172])

HSP 1 Score: 668.692 bits (1724), Expect = 0.000e+0
Identity = 334/669 (49.93%), Postives = 463/669 (69.21%), Query Frame = 3
Query:  135 DPWFNYRSTLELVERGFYKFLNWFDEKSWYPLGRIVGGTIFPGLMMTSGLFYNLLKQMSLHIEIRNVCVLLAPLYSCFTVIISFLLTKEIWNTNSGLICGCIMAIVPGYISRSSSGSYDNEGIAIFAMLLTFYFWIKATKTGTVFWSVLCSISYFYMVSAWGGYVYTLNLISLHVIILLLFQKYSNNLYVAFSVFYLFGLLFSMQIPFVGFQPLKSCEHASSACAFFVLQFYYYV----IKLEDIKIKNGLKLYLYIGPXXXXXXXXXXXXXTKLEILLPWSGRFYSLWDINYAAINIPIITSVSEHQPTAWQSTFFDLNVLMCFYPAGIWFCFKFLNNERIFLILYALTASYFSSIMVRLVLALTPAVAIGSSISFNMLLTYFEKLHKPTKELDKTENFECVTIDSKGDGFCENKANEINYEIIHKVIHNYFSTVVCIVILIHFSIHSIFATSTSYSNPSIVMSSTLPDGNKVIIDDFREAYYWLKQNTKDEARIMSWWDYGYQITGMANRTTIVDNNTWNNSHIALVGKAMSMNETNAIKIIRLLDVDYVLVIFGGLIGFSGDDINKFLWMVRI-SEGEHPKEVYEYDYFTANGEYRIDKLAPKSMVDSLMYRLSYYRFGQIQIGKEFPTGYDRTRNAEIGLKYYKLKFFEEAFTSENWLVRIYKTK 2126
            DP+FNYR+T  L E GFYKF NWFD+++WYPLGRI+GGTI+PGLM+TS   Y++L    + I+IRNVCV LAPL+S FT I+++ LTKE+ +  +GL+   ++A+VPGYISRS +GSYDNEGIAIF MLLT+Y WIKA KTG++ W+  C+++YFYMVS+WGGYV+ +NLI LHV++L+L  ++S+ +YVA+   Y  G + SMQI FVGFQP+ S EH ++   F + Q + +V     KL   + +   +  + +    L++   ++ L  K+    PW+GRFYSL D +YA  NIPII SVSEHQPT W S +FDL +L+  +P G+++CF  L++ RIF+I+Y +T+ YFS++MVRL+L L P + I S I  + +L+ + K            N +    D K       K  +  Y I ++V       +V    LI ++ HS + TS +YS+PSIV+S+   DG+++I DDFREAYYWL+ NT ++A++MSWWDYGYQIT MANRT +VDNNTWNN+HI+ VG+AM+  E  A +I+R LDV YVLVIFGGL G+S DDINKFLWMVRI    +  K + E DY+T  GE+R+D+     +++ LMY++ YYRFGQ+    + P G+DR RNAEIG K ++L   EEA+T+E+WLVRIYK K
Sbjct:   49 DPYFNYRTTRFLAEEGFYKFHNWFDDRAWYPLGRIIGGTIYPGLMITSAAIYHVLHFFHITIDIRNVCVFLAPLFSSFTTIVTYHLTKELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSICWAAKCALAYFYMVSSWGGYVFLINLIPLHVLVLMLTGRFSHRIYVAYCTVYCLGTILSMQISFVGFQPVLSSEHMAAFGVFGLCQIHAFVDYLRSKLNPQQFEVLFRSVISLVGFVLLTVGALLMLTGKIS---PWTGRFYSLLDPSYAKNNIPIIASVSEHQPTTWSSYYFDLQLLVFMFPVGLYYCFSNLSDARIFIIMYGVTSMYFSAVMVRLMLVLAPVMCILSGIGVSQVLSTYMK------------NLDISRPDKK-----SKKQQDSTYPIKNEVASGMI--LVMAFFLITYTFHSTWVTSEAYSSPSIVLSARGGDGSRIIFDDFREAYYWLRHNTPEDAKVMSWWDYGYQITAMANRTILVDNNTWNNTHISRVGQAMASTEEKAYEIMRELDVSYVLVIFGGLTGYSSDDINKFLWMVRIGGSTDTGKHIKENDYYTPTGEFRVDREGSPVLLNCLMYKMCYYRFGQVYTEAKRPPGFDRVRNAEIGNKDFELDVLEEAYTTEHWLVRIYKVK 695          
BLAST of dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B vs. Ensembl Human
Match: STT3A (STT3 oligosaccharyltransferase complex catalytic subunit A [Source:HGNC Symbol;Acc:HGNC:6172])

HSP 1 Score: 668.692 bits (1724), Expect = 0.000e+0
Identity = 334/669 (49.93%), Postives = 463/669 (69.21%), Query Frame = 3
Query:  135 DPWFNYRSTLELVERGFYKFLNWFDEKSWYPLGRIVGGTIFPGLMMTSGLFYNLLKQMSLHIEIRNVCVLLAPLYSCFTVIISFLLTKEIWNTNSGLICGCIMAIVPGYISRSSSGSYDNEGIAIFAMLLTFYFWIKATKTGTVFWSVLCSISYFYMVSAWGGYVYTLNLISLHVIILLLFQKYSNNLYVAFSVFYLFGLLFSMQIPFVGFQPLKSCEHASSACAFFVLQFYYYV----IKLEDIKIKNGLKLYLYIGPXXXXXXXXXXXXXTKLEILLPWSGRFYSLWDINYAAINIPIITSVSEHQPTAWQSTFFDLNVLMCFYPAGIWFCFKFLNNERIFLILYALTASYFSSIMVRLVLALTPAVAIGSSISFNMLLTYFEKLHKPTKELDKTENFECVTIDSKGDGFCENKANEINYEIIHKVIHNYFSTVVCIVILIHFSIHSIFATSTSYSNPSIVMSSTLPDGNKVIIDDFREAYYWLKQNTKDEARIMSWWDYGYQITGMANRTTIVDNNTWNNSHIALVGKAMSMNETNAIKIIRLLDVDYVLVIFGGLIGFSGDDINKFLWMVRI-SEGEHPKEVYEYDYFTANGEYRIDKLAPKSMVDSLMYRLSYYRFGQIQIGKEFPTGYDRTRNAEIGLKYYKLKFFEEAFTSENWLVRIYKTK 2126
            DP+FNYR+T  L E GFYKF NWFD+++WYPLGRI+GGTI+PGLM+TS   Y++L    + I+IRNVCV LAPL+S FT I+++ LTKE+ +  +GL+   ++A+VPGYISRS +GSYDNEGIAIF MLLT+Y WIKA KTG++ W+  C+++YFYMVS+WGGYV+ +NLI LHV++L+L  ++S+ +YVA+   Y  G + SMQI FVGFQP+ S EH ++   F + Q + +V     KL   + +   +  + +    L++   ++ L  K+    PW+GRFYSL D +YA  NIPII SVSEHQPT W S +FDL +L+  +P G+++CF  L++ RIF+I+Y +T+ YFS++MVRL+L L P + I S I  + +L+ + K            N +    D K       K  +  Y I ++V       +V    LI ++ HS + TS +YS+PSIV+S+   DG+++I DDFREAYYWL+ NT ++A++MSWWDYGYQIT MANRT +VDNNTWNN+HI+ VG+AM+  E  A +I+R LDV YVLVIFGGL G+S DDINKFLWMVRI    +  K + E DY+T  GE+R+D+     +++ LMY++ YYRFGQ+    + P G+DR RNAEIG K ++L   EEA+T+E+WLVRIYK K
Sbjct:   49 DPYFNYRTTRFLAEEGFYKFHNWFDDRAWYPLGRIIGGTIYPGLMITSAAIYHVLHFFHITIDIRNVCVFLAPLFSSFTTIVTYHLTKELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSICWAAKCALAYFYMVSSWGGYVFLINLIPLHVLVLMLTGRFSHRIYVAYCTVYCLGTILSMQISFVGFQPVLSSEHMAAFGVFGLCQIHAFVDYLRSKLNPQQFEVLFRSVISLVGFVLLTVGALLMLTGKIS---PWTGRFYSLLDPSYAKNNIPIIASVSEHQPTTWSSYYFDLQLLVFMFPVGLYYCFSNLSDARIFIIMYGVTSMYFSAVMVRLMLVLAPVMCILSGIGVSQVLSTYMK------------NLDISRPDKK-----SKKQQDSTYPIKNEVASGMI--LVMAFFLITYTFHSTWVTSEAYSSPSIVLSARGGDGSRIIFDDFREAYYWLRHNTPEDAKVMSWWDYGYQITAMANRTILVDNNTWNNTHISRVGQAMASTEEKAYEIMRELDVSYVLVIFGGLTGYSSDDINKFLWMVRIGGSTDTGKHIKENDYYTPTGEFRVDREGSPVLLNCLMYKMCYYRFGQVYTEAKRPPGFDRVRNAEIGNKDFELDVLEEAYTTEHWLVRIYKVK 695          
BLAST of dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B vs. Ensembl Human
Match: STT3A (STT3 oligosaccharyltransferase complex catalytic subunit A [Source:HGNC Symbol;Acc:HGNC:6172])

HSP 1 Score: 668.692 bits (1724), Expect = 0.000e+0
Identity = 334/669 (49.93%), Postives = 463/669 (69.21%), Query Frame = 3
Query:  135 DPWFNYRSTLELVERGFYKFLNWFDEKSWYPLGRIVGGTIFPGLMMTSGLFYNLLKQMSLHIEIRNVCVLLAPLYSCFTVIISFLLTKEIWNTNSGLICGCIMAIVPGYISRSSSGSYDNEGIAIFAMLLTFYFWIKATKTGTVFWSVLCSISYFYMVSAWGGYVYTLNLISLHVIILLLFQKYSNNLYVAFSVFYLFGLLFSMQIPFVGFQPLKSCEHASSACAFFVLQFYYYV----IKLEDIKIKNGLKLYLYIGPXXXXXXXXXXXXXTKLEILLPWSGRFYSLWDINYAAINIPIITSVSEHQPTAWQSTFFDLNVLMCFYPAGIWFCFKFLNNERIFLILYALTASYFSSIMVRLVLALTPAVAIGSSISFNMLLTYFEKLHKPTKELDKTENFECVTIDSKGDGFCENKANEINYEIIHKVIHNYFSTVVCIVILIHFSIHSIFATSTSYSNPSIVMSSTLPDGNKVIIDDFREAYYWLKQNTKDEARIMSWWDYGYQITGMANRTTIVDNNTWNNSHIALVGKAMSMNETNAIKIIRLLDVDYVLVIFGGLIGFSGDDINKFLWMVRI-SEGEHPKEVYEYDYFTANGEYRIDKLAPKSMVDSLMYRLSYYRFGQIQIGKEFPTGYDRTRNAEIGLKYYKLKFFEEAFTSENWLVRIYKTK 2126
            DP+FNYR+T  L E GFYKF NWFD+++WYPLGRI+GGTI+PGLM+TS   Y++L    + I+IRNVCV LAPL+S FT I+++ LTKE+ +  +GL+   ++A+VPGYISRS +GSYDNEGIAIF MLLT+Y WIKA KTG++ W+  C+++YFYMVS+WGGYV+ +NLI LHV++L+L  ++S+ +YVA+   Y  G + SMQI FVGFQP+ S EH ++   F + Q + +V     KL   + +   +  + +    L++   ++ L  K+    PW+GRFYSL D +YA  NIPII SVSEHQPT W S +FDL +L+  +P G+++CF  L++ RIF+I+Y +T+ YFS++MVRL+L L P + I S I  + +L+ + K            N +    D K       K  +  Y I ++V       +V    LI ++ HS + TS +YS+PSIV+S+   DG+++I DDFREAYYWL+ NT ++A++MSWWDYGYQIT MANRT +VDNNTWNN+HI+ VG+AM+  E  A +I+R LDV YVLVIFGGL G+S DDINKFLWMVRI    +  K + E DY+T  GE+R+D+     +++ LMY++ YYRFGQ+    + P G+DR RNAEIG K ++L   EEA+T+E+WLVRIYK K
Sbjct:   49 DPYFNYRTTRFLAEEGFYKFHNWFDDRAWYPLGRIIGGTIYPGLMITSAAIYHVLHFFHITIDIRNVCVFLAPLFSSFTTIVTYHLTKELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSICWAAKCALAYFYMVSSWGGYVFLINLIPLHVLVLMLTGRFSHRIYVAYCTVYCLGTILSMQISFVGFQPVLSSEHMAAFGVFGLCQIHAFVDYLRSKLNPQQFEVLFRSVISLVGFVLLTVGALLMLTGKIS---PWTGRFYSLLDPSYAKNNIPIIASVSEHQPTTWSSYYFDLQLLVFMFPVGLYYCFSNLSDARIFIIMYGVTSMYFSAVMVRLMLVLAPVMCILSGIGVSQVLSTYMK------------NLDISRPDKK-----SKKQQDSTYPIKNEVASGMI--LVMAFFLITYTFHSTWVTSEAYSSPSIVLSARGGDGSRIIFDDFREAYYWLRHNTPEDAKVMSWWDYGYQITAMANRTILVDNNTWNNTHISRVGQAMASTEEKAYEIMRELDVSYVLVIFGGLTGYSSDDINKFLWMVRIGGSTDTGKHIKENDYYTPTGEFRVDREGSPVLLNCLMYKMCYYRFGQVYTEAKRPPGFDRVRNAEIGNKDFELDVLEEAYTTEHWLVRIYKVK 695          
BLAST of dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B vs. Ensembl Human
Match: STT3A (STT3 oligosaccharyltransferase complex catalytic subunit A [Source:HGNC Symbol;Acc:HGNC:6172])

HSP 1 Score: 591.652 bits (1524), Expect = 0.000e+0
Identity = 302/625 (48.32%), Postives = 424/625 (67.84%), Query Frame = 3
Query:  267 MMTSGLFYNLLKQMSLHIEIRNVCVLLAPLYSCFTVIISFLLTKEIWNTNSGLICGCIMAIVPGYISRSSSGSYDNEGIAIFAMLLTFYFWIKATKTGTVFWSVLCSISYFYMVSAWGGYVYTLNLISLHVIILLLFQKYSNNLYVAFSVFYLFGLLFSMQIPFVGFQPLKSCEHASSACAFFVLQFYYYV----IKLEDIKIKNGLKLYLYIGPXXXXXXXXXXXXXTKLEILLPWSGRFYSLWDINYAAINIPIITSVSEHQPTAWQSTFFDLNVLMCFYPAGIWFCFKFLNNERIFLILYALTASYFSSIMVRLVLALTPAVAIGSSISFNMLLTYFEKLHKPTKELDKTENFECVTIDSKGDGFCENKANEINYEIIHKVIHNYFSTVVCIVILIHFSIHSIFATSTSYSNPSIVMSSTLPDGNKVIIDDFREAYYWLKQNTKDEARIMSWWDYGYQITGMANRTTIVDNNTWNNSHIALVGKAMSMNETNAIKIIRLLDVDYVLVIFGGLIGFSGDDINKFLWMVRI-SEGEHPKEVYEYDYFTANGEYRIDKLAPKSMVDSLMYRLSYYRFGQIQIGKEFPTGYDRTRNAEIGLKYYKLKFFEEAFTSENWLVRIYKTK 2126
            M+TS   Y++L    + I+IRNVCV LAPL+S FT I+++ LTKE+ +  +GL+   ++A+VPGYISRS +GSYDNEGIAIF MLLT+Y WIKA KTG++ W+  C+++YFYMVS+WGGYV+ +NLI LHV++L+L  ++S+ +YVA+   Y  G + SMQI FVGFQP+ S EH ++   F + Q + +V     KL   + +   +  + +    L++   ++ L  K+    PW+GRFYSL D +YA  NIPII SVSEHQPT W S +FDL +L+  +P G+++CF  L++ RIF+I+Y +T+ YFS++MVRL+L L P + I S I  + +L+ + K            N +    D K       K  +  Y I ++V       +V    LI ++ HS + TS +YS+PSIV+S+   DG+++I DDFREAYYWL+ NT ++A++MSWWDYGYQIT MANRT +VDNNTWNN+HI+ VG+AM+  E  A +I+R LDV YVLVIFGGL G+S DDINKFLWMVRI    +  K + E DY+T  GE+R+D+     +++ LMY++ YYRFGQ+    + P G+DR RNAEIG K ++L   EEA+T+E+WLVRIYK K
Sbjct:    1 MITSAAIYHVLHFFHITIDIRNVCVFLAPLFSSFTTIVTYHLTKELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSICWAAKCALAYFYMVSSWGGYVFLINLIPLHVLVLMLTGRFSHRIYVAYCTVYCLGTILSMQISFVGFQPVLSSEHMAAFGVFGLCQIHAFVDYLRSKLNPQQFEVLFRSVISLVGFVLLTVGALLMLTGKIS---PWTGRFYSLLDPSYAKNNIPIIASVSEHQPTTWSSYYFDLQLLVFMFPVGLYYCFSNLSDARIFIIMYGVTSMYFSAVMVRLMLVLAPVMCILSGIGVSQVLSTYMK------------NLDISRPDKK-----SKKQQDSTYPIKNEVASGMI--LVMAFFLITYTFHSTWVTSEAYSSPSIVLSARGGDGSRIIFDDFREAYYWLRHNTPEDAKVMSWWDYGYQITAMANRTILVDNNTWNNTHISRVGQAMASTEEKAYEIMRELDVSYVLVIFGGLTGYSSDDINKFLWMVRIGGSTDTGKHIKENDYYTPTGEFRVDREGSPVLLNCLMYKMCYYRFGQVYTEAKRPPGFDRVRNAEIGNKDFELDVLEEAYTTEHWLVRIYKVK 603          
BLAST of dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B vs. Ensembl Celegans
Match: stt-3 (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit stt-3 [Source:UniProtKB/Swiss-Prot;Acc:P46975])

HSP 1 Score: 743.036 bits (1917), Expect = 0.000e+0
Identity = 349/705 (49.50%), Postives = 493/705 (69.93%), Query Frame = 3
Query:  135 DPWFNYRSTLELVERGFYKFLNWFDEKSWYPLGRIVGGTIFPGLMMTSGLFYNLLKQMSLHIEIRNVCVLLAPLYSCFTVIISFLLTKEIWNTNSGLICGCIMAIVPGYISRSSSGSYDNEGIAIFAMLLTFYFWIKATKTGTVFWSVLCSISYFYMVSAWGGYVYTLNLISLHVIILLLFQKYSNNLYVAFSVFYLFGLLFSMQIPFVGFQPLKSCEHASSACAFFVLQFYYYVIKLEDIKIKNGLKLYLYIGPXXXXXXXXXXXXXTKL--EILLPWSGRFYSLWDINYAAINIPIITSVSEHQPTAWQSTFFDLNVLMCFYPAGIWFCFKFLNNERIFLILYALTASYFSSIMVRLVLALTPAVAIGSSISFNMLLTYFEKLHKPTKELDKTENFECVTIDSK-----GDGFCENKANEINYEIIHKVIHNYFSTVVCIVILIHFSIHSIFATSTSYSNPSIVMSSTLPDGNKVIIDDFREAYYWLKQNTKDEARIMSWWDYGYQITGMANRTTIVDNNTWNNSHIALVGKAMSMNETNAIKIIRLLDVDYVLVIFGGLIGFSGDDINKFLWMVRISEGEHPKEVYEYDYFTANGEYRIDKLAPKSMVDSLMYRLSYYRFGQIQIGKEFPTGYDRTRNAEIGLKYYKLKFFEEAFTSENWLVRIYKTKLRNFRISLKHARKKNKVFASQKRLRKMKGALKFP 2228
            DPWFNYR+T  +V+ GFYKFLNWFDE++WYPLGRIVGGT++PGLM+TSGL + +L  ++ H+ IR VCV LAP +S  T I ++LLTKE+W+  +GL   C +AI PGY SRS +GSYDNEGIAIFA+  T+Y W+K+ KTG++ W+ LC++SYFYMVSAWGGYV+ +NLI LH + L++  +YS+ L+V+++ FY    + SMQ+PFVGFQP+++ EH  +   F +LQ    ++     +I     + L++G + ++    ++     +    + P+SGRFYSLWD  YA I+IPII SVSEHQPT W S FFDL++    +P G+W+C K +N+ER+F+ILYA++A YF+ +MVRL+L LTPAV + + I F+     FEK  K  +  +++ +    T D K             AN+ +   +   +    S ++ ++ L+ F +H+ + TS +YS+PS+V+ S+  +G+++I+DDFREAY+WL++NT D+AR+MSWWDYGYQI GMANRTT+VDNNTWNNSHIALVGKAMS NE+ A +I+  LDVDY+LVIFGG+IG+SGDDINKFLWMVRI++GEHPK++ E +YFT+ GEY     A ++M++ LMY++SYYRFG+ ++G     G+DRTR   IG K   L++ EEA+T+ENWLVRIYK K    R ++K       +   +    K K  +  P
Sbjct:   51 DPWFNYRATHHMVQHGFYKFLNWFDERAWYPLGRIVGGTVYPGLMVTSGLIHWILDSLNFHVHIREVCVFLAPTFSGLTAIATYLLTKELWSPGAGLFAACFIAISPGYTSRSVAGSYDNEGIAIFALQFTYYLWVKSLKTGSIMWASLCALSYFYMVSAWGGYVFIINLIPLHALALIIMGRYSSRLFVSYTSFYCLATILSMQVPFVGFQPVRTSEHMPAFGVFGLLQIVA-LMHYARNRITRQQFMTLFVGGLTILGALSVVVYFALVWGGYVAPFSGRFYSLWDTGYAKIHIPIIASVSEHQPTTWVSFFFDLHITAAVFPVGLWYCIKKVNDERVFIILYAVSAVYFAGVMVRLMLTLTPAVCVLAGIGFSYT---FEKYLKDEETKERSSSQSGTTKDEKLYDKAAKNVKSRNANDGDESGVSSNVRTIIS-IILVIFLLMFVVHATYVTSNAYSHPSVVLQSSTNNGDRIIMDDFREAYHWLRENTADDARVMSWWDYGYQIAGMANRTTLVDNNTWNNSHIALVGKAMSSNESAAYEIMTELDVDYILVIFGGVIGYSGDDINKFLWMVRIAQGEHPKDIREENYFTSTGEYSTGAGASETMLNCLMYKMSYYRFGETRVGYNQAGGFDRTRGYVIGKKDITLEYIEEAYTTENWLVRIYKRKKLPNRPTVKSEEATIPIKGKKATQGKNKKGVIRP 750          
BLAST of dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B vs. Ensembl Celegans
Match: stt-3 (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit stt-3 [Source:UniProtKB/Swiss-Prot;Acc:P46975])

HSP 1 Score: 743.036 bits (1917), Expect = 0.000e+0
Identity = 349/705 (49.50%), Postives = 493/705 (69.93%), Query Frame = 3
Query:  135 DPWFNYRSTLELVERGFYKFLNWFDEKSWYPLGRIVGGTIFPGLMMTSGLFYNLLKQMSLHIEIRNVCVLLAPLYSCFTVIISFLLTKEIWNTNSGLICGCIMAIVPGYISRSSSGSYDNEGIAIFAMLLTFYFWIKATKTGTVFWSVLCSISYFYMVSAWGGYVYTLNLISLHVIILLLFQKYSNNLYVAFSVFYLFGLLFSMQIPFVGFQPLKSCEHASSACAFFVLQFYYYVIKLEDIKIKNGLKLYLYIGPXXXXXXXXXXXXXTKL--EILLPWSGRFYSLWDINYAAINIPIITSVSEHQPTAWQSTFFDLNVLMCFYPAGIWFCFKFLNNERIFLILYALTASYFSSIMVRLVLALTPAVAIGSSISFNMLLTYFEKLHKPTKELDKTENFECVTIDSK-----GDGFCENKANEINYEIIHKVIHNYFSTVVCIVILIHFSIHSIFATSTSYSNPSIVMSSTLPDGNKVIIDDFREAYYWLKQNTKDEARIMSWWDYGYQITGMANRTTIVDNNTWNNSHIALVGKAMSMNETNAIKIIRLLDVDYVLVIFGGLIGFSGDDINKFLWMVRISEGEHPKEVYEYDYFTANGEYRIDKLAPKSMVDSLMYRLSYYRFGQIQIGKEFPTGYDRTRNAEIGLKYYKLKFFEEAFTSENWLVRIYKTKLRNFRISLKHARKKNKVFASQKRLRKMKGALKFP 2228
            DPWFNYR+T  +V+ GFYKFLNWFDE++WYPLGRIVGGT++PGLM+TSGL + +L  ++ H+ IR VCV LAP +S  T I ++LLTKE+W+  +GL   C +AI PGY SRS +GSYDNEGIAIFA+  T+Y W+K+ KTG++ W+ LC++SYFYMVSAWGGYV+ +NLI LH + L++  +YS+ L+V+++ FY    + SMQ+PFVGFQP+++ EH  +   F +LQ    ++     +I     + L++G + ++    ++     +    + P+SGRFYSLWD  YA I+IPII SVSEHQPT W S FFDL++    +P G+W+C K +N+ER+F+ILYA++A YF+ +MVRL+L LTPAV + + I F+     FEK  K  +  +++ +    T D K             AN+ +   +   +    S ++ ++ L+ F +H+ + TS +YS+PS+V+ S+  +G+++I+DDFREAY+WL++NT D+AR+MSWWDYGYQI GMANRTT+VDNNTWNNSHIALVGKAMS NE+ A +I+  LDVDY+LVIFGG+IG+SGDDINKFLWMVRI++GEHPK++ E +YFT+ GEY     A ++M++ LMY++SYYRFG+ ++G     G+DRTR   IG K   L++ EEA+T+ENWLVRIYK K    R ++K       +   +    K K  +  P
Sbjct:   51 DPWFNYRATHHMVQHGFYKFLNWFDERAWYPLGRIVGGTVYPGLMVTSGLIHWILDSLNFHVHIREVCVFLAPTFSGLTAIATYLLTKELWSPGAGLFAACFIAISPGYTSRSVAGSYDNEGIAIFALQFTYYLWVKSLKTGSIMWASLCALSYFYMVSAWGGYVFIINLIPLHALALIIMGRYSSRLFVSYTSFYCLATILSMQVPFVGFQPVRTSEHMPAFGVFGLLQIVA-LMHYARNRITRQQFMTLFVGGLTILGALSVVVYFALVWGGYVAPFSGRFYSLWDTGYAKIHIPIIASVSEHQPTTWVSFFFDLHITAAVFPVGLWYCIKKVNDERVFIILYAVSAVYFAGVMVRLMLTLTPAVCVLAGIGFSYT---FEKYLKDEETKERSSSQSGTTKDEKLYDKAAKNVKSRNANDGDESGVSSNVRTIIS-IILVIFLLMFVVHATYVTSNAYSHPSVVLQSSTNNGDRIIMDDFREAYHWLRENTADDARVMSWWDYGYQIAGMANRTTLVDNNTWNNSHIALVGKAMSSNESAAYEIMTELDVDYILVIFGGVIGYSGDDINKFLWMVRIAQGEHPKDIREENYFTSTGEYSTGAGASETMLNCLMYKMSYYRFGETRVGYNQAGGFDRTRGYVIGKKDITLEYIEEAYTTENWLVRIYKRKKLPNRPTVKSEEATIPIKGKKATQGKNKKGVIRP 750          
BLAST of dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B vs. Ensembl Fly
Match: Stt3B (gene:FBgn0011336 transcript:FBtr0084786)

HSP 1 Score: 763.837 bits (1971), Expect = 0.000e+0
Identity = 371/722 (51.39%), Postives = 515/722 (71.33%), Query Frame = 3
Query:  135 DPWFNYRSTLELVERGFYKFLNWFDEKSWYPLGRIVGGTIFPGLMMTSGLFYNLLKQMSLHIEIRNVCVLLAPLYSCFTVIISFLLTKEIWNTNSGLICGCIMAIVPGYISRSSSGSYDNEGIAIFAMLLTFYFWIKATKTGTVFWSVLCSISYFYMVSAWGGYVYTLNLISLHVIILLLFQKYSNNLYVAFSVFYLFGLLFSMQIPFVGFQPLKSCEHASSACAFFVLQFYYYVIKLEDIKIKNGL-KLYLYIGPXXXXXXXXXXXXXTKLEILLPWSGRFYSLWDINYAAINIPIITSVSEHQPTAWQSTFFDLNVLMCFYPAGIWFCFKFLNNERIFLILYALTASYFSSIMVRLVLALTPAVAIGSSISFNMLLTYFEKLHKPTKELDKTENFECVTIDSKGDGFCE----NKANEINYEIIHK------VIHNYFSTVVCIV--ILIHFSIHSIFATSTSYSNPSIVMS-STLPDGNKVIIDDFREAYYWLKQNTKDEARIMSWWDYGYQITGMANRTTIVDNNTWNNSHIALVGKAMSMNETNAIKIIRLLDVDYVLVIFGGLIGFSGDDINKFLWMVRISEGEHPKEVYEYDYFTANGEYRIDKLAPKSMVDSLMYRLSYYRFGQIQIGKEFPTGYDRTRNAEIGLKYYKLKFFEEAFTSENWLVRIYKTKLRNF--RISLKHARK--KNKVFASQKRLRKMKGALKFPRIITRG 2246
            DPWFNYR+T  +V+ G+Y FLNWFDE++WYPLGRIVGGT++PGLM+TSG  + LL  +++ + IR++CV LAP++S  T I ++LLTKE+W+  +GL     +AIVPGYISRS +GSYDNEGIAIFA+  T++ W+++ KTG+VFWS   ++SYFYMVSAWGGYV+ +NLI LHV +LL+  +YS  L  ++S FY+ GLLFSMQIPFVGFQP+++ EH ++   F +L     +  L+ +  +N   KL++  G +  +   + + +LT L ++ PWSGRFYSLWD  YA I+IPII SVSEHQPT W S FFDL++L+C +P G+W+C K +N+ER+F++LYA++A YF+ +MVRL+L LTP V + + ++F+ LL  F  L + + +   T       +D   D   +    +KA ++ +   H       V  N  S V+  V  +L+ F++H  + TS +YS+PSIV++     DG++ I+DDFREAYYWL QNT D+AR+MSWWDYGYQI GMANRTT+VDNNTWNNSHIALVGKAMS  E  + +I+  LDVDYVLVIFGG+IG+SGDDINKFLWMVRI+EGEHPK++ E DYFT  GE+R+D     ++++ LMY+LSYYRFG++++    P+GYDRTRNA IG K + L + EEA+T+E+WLVRIY+ K  +   R SLK   +      F S+K  ++ KG ++   ++ +G
Sbjct:   50 DPWFNYRATAYMVQNGWYNFLNWFDERAWYPLGRIVGGTVYPGLMITSGGIHWLLHVLNIPVHIRDICVFLAPIFSGLTSISTYLLTKELWSAGAGLFAASFIAIVPGYISRSVAGSYDNEGIAIFALQFTYFLWVRSVKTGSVFWSAAAALSYFYMVSAWGGYVFIINLIPLHVFVLLIMGRYSPRLLTSYSTFYILGLLFSMQIPFVGFQPIRTSEHMAALGVFVLLMAVATLRHLQSVLSRNEFRKLFIVGGLLVGVGVFVAVVVLTMLGVVAPWSGRFYSLWDTGYAKIHIPIIASVSEHQPTTWFSFFFDLHILVCAFPVGVWYCIKQINDERVFVVLYAISAVYFAGVMVRLMLTLTPVVCMLAGVAFSGLLDVF--LQEDSSKRMGTAISAATEVDEAEDSIEKKTLYDKAGKLKHRTKHDAQQDTGVSSNLKSIVILAVLMLLMMFAVHCTWVTSNAYSSPSIVLAFHNSQDGSRNILDDFREAYYWLSQNTADDARVMSWWDYGYQIAGMANRTTLVDNNTWNNSHIALVGKAMSSTEEKSYEIMTSLDVDYVLVIFGGVIGYSGDDINKFLWMVRIAEGEHPKDIKESDYFTDRGEFRVDAEGAPALLNCLMYKLSYYRFGELKLDYRGPSGYDRTRNAVIGNKDFDLTYLEEAYTTEHWLVRIYRVKKPHEFNRPSLKTKERTIPPANFISRKNSKRRKGYIRNRPVVVKG 769          
BLAST of dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B vs. Ensembl Fly
Match: Stt3A (gene:FBgn0031149 transcript:FBtr0077264)

HSP 1 Score: 686.026 bits (1769), Expect = 0.000e+0
Identity = 354/699 (50.64%), Postives = 487/699 (69.67%), Query Frame = 3
Query:   36 NLFPLVIIILSCVXXXXXXXXXXXXXXXXXXXXDPWFNYRSTLELVERGFYKFLNWFDEKSWYPLGRIVGGTIFPGLMMTSGLFYNLLKQMSLHIEIRNVCVLLAPLYSCFTVIISFLLTKEIWNTNSGLICGCIMAIVPGYISRSSSGSYDNEGIAIFAMLLTFYFWIKATKTGTVFWSVLCSISYFYMVSAWGGYVYTLNLISLHVIILLLFQKYSNNLYVAFSVFYLFGLLFSMQIPFVGFQPLKSCEHASSACAFFVLQFYYYVIKLEDIKIKNGLK-LYLYIGPXXXXXXXXXXXXXTKLEILLPWSGRFYSLWDINYAAINIPIITSVSEHQPTAWQSTFFDLNVLMCFYPAGIWFCFKFLNNERIFLILYALTASYFSSIMVRLVLALTPAVAIGSSISFNMLLTYFEKLHKPTKELDKTENFECVTIDSKGDGFCENKANEINYEIIHKVIHNYFSTVVCIVILIHFSIHSIFATSTSYSNPSIVMSSTLPDGNKVIIDDFREAYYWLKQNTKDEARIMSWWDYGYQITGMANRTTIVDNNTWNNSHIALVGKAMSMNETNAIKIIRLLDVDYVLVIFGGLIGFSGDDINKFLWMVRI-SEGEHPKEVYEYDYFTANGEYRIDKLAPKSMVDSLMYRLSYYRFGQIQIGKEFPTGYDRTRNAEIGLKYYKLKFFEEAFTSENWLVRIYKTK 2126
            +L  L I+IL+ VLSF  RLFS++ FES+IHEFDP+FNYR+T  L E+GFYKF NWFD+++WYPLGRI+GGTI+PGLM+TS   Y L+  +++ I+IRNVCV LAP +S  T ++++ LTKEI +T +GL+   +++IVPGYISRS +GSYDNEGIAIF ML T+Y WIKA KTGT+FWS + +++YFYMVS+WGGYV+ +NLI LHV+ L++  ++S+ +Y+A+S  Y  G + SMQI FVGFQP++S EH  +   F + Q + +V  L     K+    L+  +    L    ++  LLT    + PW+GRFYSL D +YA  +IPII SVSEHQPT+W S +FDL +L+  +PAG++FCF  L +  IF+ILY +T+ YF+ +MVRL+L L P + + S I+ + LL       K  K +D   + +      +     E +   +  E+    +       V  ++LI +++H  + TS +YS+PSIV+S+   DG ++I DDFREAYYWL+ NT ++ARIMSWWDYGYQIT MANRT +VDNNTWNN+HI+ VG+AM+ +E  A +I+R LDVDYVLVIFGGL G+S DDINKFLWMVRI    +    + E DY+ ANGE+R+DK    ++++ LMY++ YYRFGQ+        GYDR R AEIG K ++L   EEA+T+E+WLVRIYK K
Sbjct:   20 HLVKLAILILAAVLSFATRLFSVLRFESVIHEFDPYFNYRTTRFLAEQGFYKFHNWFDDRAWYPLGRIIGGTIYPGLMLTSAALYRLMWLLNVTIDIRNVCVFLAPFFSSLTTLVTYALTKEIHSTGAGLVAAALISIVPGYISRSVAGSYDNEGIAIFCMLFTYYLWIKAVKTGTIFWSAMSALAYFYMVSSWGGYVFLINLIPLHVLALMITGRFSHRIYIAYSTLYCVGTILSMQISFVGFQPIQSSEHMLALGTFGLCQIHAFVDYLRSRIPKDHFDLLFKTLVSSVLTVVFVVGTLLTLTGKVSPWTGRFYSLLDPSYAKNHIPIIASVSEHQPTSWSSFYFDLQILVFLFPAGLYFCFSKLTDSNIFIILYGVTSIYFAGVMVRLMLVLAPVMCVLSGIAISHLLA------KYIKSVDAGSSSKQGVESKRQHKKLEQQTGGVKSEVAIGFVG------VITLMLIVYTLHCTWVTSEAYSSPSIVLSARSHDGGRIIFDDFREAYYWLQMNTPEDARIMSWWDYGYQITAMANRTILVDNNTWNNTHISRVGQAMASSEEKAYEIMRELDVDYVLVIFGGLTGYSSDDINKFLWMVRIGGSTDRGAHIREKDYYAANGEFRVDKEGSPTLLNCLMYKMCYYRFGQMYTEGGKAQGYDRVRAAEIGNKDFELDVMEEAYTTEHWLVRIYKVK 706          
BLAST of dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B vs. Ensembl Fly
Match: Stt3A (gene:FBgn0031149 transcript:FBtr0345923)

HSP 1 Score: 686.026 bits (1769), Expect = 0.000e+0
Identity = 354/699 (50.64%), Postives = 487/699 (69.67%), Query Frame = 3
Query:   36 NLFPLVIIILSCVXXXXXXXXXXXXXXXXXXXXDPWFNYRSTLELVERGFYKFLNWFDEKSWYPLGRIVGGTIFPGLMMTSGLFYNLLKQMSLHIEIRNVCVLLAPLYSCFTVIISFLLTKEIWNTNSGLICGCIMAIVPGYISRSSSGSYDNEGIAIFAMLLTFYFWIKATKTGTVFWSVLCSISYFYMVSAWGGYVYTLNLISLHVIILLLFQKYSNNLYVAFSVFYLFGLLFSMQIPFVGFQPLKSCEHASSACAFFVLQFYYYVIKLEDIKIKNGLK-LYLYIGPXXXXXXXXXXXXXTKLEILLPWSGRFYSLWDINYAAINIPIITSVSEHQPTAWQSTFFDLNVLMCFYPAGIWFCFKFLNNERIFLILYALTASYFSSIMVRLVLALTPAVAIGSSISFNMLLTYFEKLHKPTKELDKTENFECVTIDSKGDGFCENKANEINYEIIHKVIHNYFSTVVCIVILIHFSIHSIFATSTSYSNPSIVMSSTLPDGNKVIIDDFREAYYWLKQNTKDEARIMSWWDYGYQITGMANRTTIVDNNTWNNSHIALVGKAMSMNETNAIKIIRLLDVDYVLVIFGGLIGFSGDDINKFLWMVRI-SEGEHPKEVYEYDYFTANGEYRIDKLAPKSMVDSLMYRLSYYRFGQIQIGKEFPTGYDRTRNAEIGLKYYKLKFFEEAFTSENWLVRIYKTK 2126
            +L  L I+IL+ VLSF  RLFS++ FES+IHEFDP+FNYR+T  L E+GFYKF NWFD+++WYPLGRI+GGTI+PGLM+TS   Y L+  +++ I+IRNVCV LAP +S  T ++++ LTKEI +T +GL+   +++IVPGYISRS +GSYDNEGIAIF ML T+Y WIKA KTGT+FWS + +++YFYMVS+WGGYV+ +NLI LHV+ L++  ++S+ +Y+A+S  Y  G + SMQI FVGFQP++S EH  +   F + Q + +V  L     K+    L+  +    L    ++  LLT    + PW+GRFYSL D +YA  +IPII SVSEHQPT+W S +FDL +L+  +PAG++FCF  L +  IF+ILY +T+ YF+ +MVRL+L L P + + S I+ + LL       K  K +D   + +      +     E +   +  E+    +       V  ++LI +++H  + TS +YS+PSIV+S+   DG ++I DDFREAYYWL+ NT ++ARIMSWWDYGYQIT MANRT +VDNNTWNN+HI+ VG+AM+ +E  A +I+R LDVDYVLVIFGGL G+S DDINKFLWMVRI    +    + E DY+ ANGE+R+DK    ++++ LMY++ YYRFGQ+        GYDR R AEIG K ++L   EEA+T+E+WLVRIYK K
Sbjct:   20 HLVKLAILILAAVLSFATRLFSVLRFESVIHEFDPYFNYRTTRFLAEQGFYKFHNWFDDRAWYPLGRIIGGTIYPGLMLTSAALYRLMWLLNVTIDIRNVCVFLAPFFSSLTTLVTYALTKEIHSTGAGLVAAALISIVPGYISRSVAGSYDNEGIAIFCMLFTYYLWIKAVKTGTIFWSAMSALAYFYMVSSWGGYVFLINLIPLHVLALMITGRFSHRIYIAYSTLYCVGTILSMQISFVGFQPIQSSEHMLALGTFGLCQIHAFVDYLRSRIPKDHFDLLFKTLVSSVLTVVFVVGTLLTLTGKVSPWTGRFYSLLDPSYAKNHIPIIASVSEHQPTSWSSFYFDLQILVFLFPAGLYFCFSKLTDSNIFIILYGVTSIYFAGVMVRLMLVLAPVMCVLSGIAISHLLA------KYIKSVDAGSSSKQGVESKRQHKKLEQQTGGVKSEVAIGFVG------VITLMLIVYTLHCTWVTSEAYSSPSIVLSARSHDGGRIIFDDFREAYYWLQMNTPEDARIMSWWDYGYQITAMANRTILVDNNTWNNTHISRVGQAMASSEEKAYEIMRELDVDYVLVIFGGLTGYSSDDINKFLWMVRIGGSTDRGAHIREKDYYAANGEFRVDKEGSPTLLNCLMYKMCYYRFGQMYTEGGKAQGYDRVRAAEIGNKDFELDVMEEAYTTEHWLVRIYKVK 706          
BLAST of dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B vs. Ensembl Zebrafish
Match: stt3b (STT3 oligosaccharyltransferase complex catalytic subunit B [Source:ZFIN;Acc:ZDB-GENE-030131-2638])

HSP 1 Score: 797.349 bits (2058), Expect = 0.000e+0
Identity = 380/711 (53.45%), Postives = 521/711 (73.28%), Query Frame = 3
Query:  135 DPWFNYRSTLELVERGFYKFLNWFDEKSWYPLGRIVGGTIFPGLMMTSGLFYNLLKQMSLHIEIRNVCVLLAPLYSCFTVIISFLLTKEIWNTNSGLICGCIMAIVPGYISRSSSGSYDNEGIAIFAMLLTFYFWIKATKTGTVFWSVLCSISYFYMVSAWGGYVYTLNLISLHVIILLLFQKYSNNLYVAFSVFYLFGLLFSMQIPFVGFQPLKSCEHASSACAFFVLQFYYYVIKLEDIKIKNGLKLYLYIG-PXXXXXXXXXXXXXTKLEILLPWSGRFYSLWDINYAAINIPIITSVSEHQPTAWQSTFFDLNVLMCFYPAGIWFCFKFLNNERIFLILYALTASYFSSIMVRLVLALTPAVAIGSSISFNMLLTYFE----KLHKPTKELDKTENFECVTIDSKGDGFCENKANEINYEIIHK------VIHNYFS--TVVCIVILIHFSIHSIFATSTSYSNPSIVMSSTLPDGNKVIIDDFREAYYWLKQNTKDEARIMSWWDYGYQITGMANRTTIVDNNTWNNSHIALVGKAMSMNETNAIKIIRLLDVDYVLVIFGGLIGFSGDDINKFLWMVRISEGEHPKEVYEYDYFTANGEYRIDKLAPKSMVDSLMYRLSYYRFGQIQIGKEFPTGYDRTRNAEIGLKYYKLKFFEEAFTSENWLVRIYKTKLRNFRISLKHARKK---NKVFASQKRLRKMKGAL 2219
            DPWFNYRST  L   GFY+FLNWFDE++WYPLGRIVGGT++PGLM+T+GL + +L  + + + IR+VCV LAP++S  T I +FLLT+E+WN  +GL+  C +AIVPGYISRS +GS+DNEGIAIFA+  T+Y W+K+ KTG+VFW++ C +SYFYMVSAWGGYV+ +NLI LHV +LLL Q+YS  LY+A+S FY+ GL+ SMQIPFVGFQP+++ EH ++A  F +LQ Y ++  L+D   +   +   ++G  +A     L +  LT    + PWSGRFYSLWD  YA I+IPII SVSEHQPT W S FFDL++L+C +PAG+WFC K +N+ER+F+ LYA++A YF+ +MVRL+L LTP V + S+I+F+ +  ++     K   P  E    E+      D +  G   +KA ++   +  +      +  N  S  T++ +++L+ F++H  + TS +YS+PS+V++S   DG++ I+DDFREAYYWL+QNT + AR+MSWWDYGYQI GMANRTT+VDNNTWNNSHIALVGKAMS NE+ A +I++ LDVDYVL+IFGG+IG+SGDDINKFLWMVRI+EGEHPK++ E DYFT  GE+R+DK    ++++ LMY++SYYRFG++Q+    P G+DRTRNAEIG K  +LK  EEAFTSE+WLVRIY+ K +  R +L H  +     + + S+K  ++ +G +
Sbjct:   84 DPWFNYRSTHHLTTNGFYEFLNWFDERAWYPLGRIVGGTVYPGLMVTAGLIHYVLNLLHVTVHIRDVCVFLAPVFSGLTAISTFLLTRELWNQGAGLLAACFIAIVPGYISRSVAGSFDNEGIAIFALQFTYYLWVKSVKTGSVFWAIGCCLSYFYMVSAWGGYVFIINLIPLHVFVLLLMQRYSRRLYIAYSTFYIVGLVLSMQIPFVGFQPIRTSEHMAAAGVFALLQAYAFLQYLKDRLTRQEFQTLFFLGVSLAAGVVFLTVIYLTYTGYIAPWSGRFYSLWDTGYAKIHIPIIASVSEHQPTTWVSFFFDLHILVCTFPAGLWFCIKNINDERVFVALYAISAVYFAGVMVRLMLTLTPVVCMLSAIAFSSVFEHYLGDDLKRENPPAEDSSDED------DKRNQGNLYDKAGKVRKHVSEQDRPEEGLGPNIRSIVTMLMLMLLMMFAVHCTWVTSNAYSSPSVVLASYNHDGSRNILDDFREAYYWLRQNTDEHARVMSWWDYGYQIAGMANRTTLVDNNTWNNSHIALVGKAMSSNESAAYEIMKSLDVDYVLIIFGGVIGYSGDDINKFLWMVRIAEGEHPKDIRESDYFTPQGEFRVDKAGSPTLLNCLMYKMSYYRFGEMQLDFRTPPGFDRTRNAEIGNKDIRLKHLEEAFTSEHWLVRIYRVKKQENRQTLDHKLRNIAAKQKYTSKKTAKRKRGHI 788          
BLAST of dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B vs. Ensembl Zebrafish
Match: stt3b (STT3 oligosaccharyltransferase complex catalytic subunit B [Source:ZFIN;Acc:ZDB-GENE-030131-2638])

HSP 1 Score: 795.808 bits (2054), Expect = 0.000e+0
Identity = 382/703 (54.34%), Postives = 516/703 (73.40%), Query Frame = 3
Query:  135 DPWFNYRSTLELVERGFYKFLNWFDEKSWYPLGRIVGGTIFPGLMMTSGLFYNLLKQMSLHIEIRNVCVLLAPLYSCFTVIISFLLTKEIWNTNSGLICGCIMAIVPGYISRSSSGSYDNEGIAIFAMLLTFYFWIKATKTGTVFWSVLCSISYFYMVSAWGGYVYTLNLISLHVIILLLFQKYSNNLYVAFSVFYLFGLLFSMQIPFVGFQPLKSCEHASSACAFFVLQFYYYVIKLEDIKIKNGLKLYLYIG-PXXXXXXXXXXXXXTKLEILLPWSGRFYSLWDINYAAINIPIITSVSEHQPTAWQSTFFDLNVLMCFYPAGIWFCFKFLNNERIFLILYALTASYFSSIMVRLVLALTPAVAIGSSISFNMLLTYFE----KLHKPTKELDKTENFECVTIDSKGDGFCENKANEINYEIIHK------VIHNYFS--TVVCIVILIHFSIHSIFATSTSYSNPSIVMSSTLPDGNKVIIDDFREAYYWLKQNTKDEARIMSWWDYGYQITGMANRTTIVDNNTWNNSHIALVGKAMSMNETNAIKIIRLLDVDYVLVIFGGLIGFSGDDINKFLWMVRISEGEHPKEVYEYDYFTANGEYRIDKLAPKSMVDSLMYRLSYYRFGQIQIGKEFPTGYDRTRNAEIGLKYYKLKFFEEAFTSENWLVRIYKTKLRNFRISLKHARKKNKVFASQKRLRK 2204
            DPWFNYRST  L   GFY+FLNWFDE++WYPLGRIVGGT++PGLM+T+GL + +L  + + + IR+VCV LAP++S  T I +FLLT+E+WN  +GL+  C +AIVPGYISRS +GS+DNEGIAIFA+  T+Y W+K+ KTG+VFW++ C +SYFYMVSAWGGYV+ +NLI LHV +LLL Q+YS  LY+A+S FY+ GL+ SMQIPFVGFQP+++ EH ++A  F +LQ Y ++  L+D   +   +   ++G  +A     L +  LT    + PWSGRFYSLWD  YA I+IPII SVSEHQPT W S FFDL++L+C +PAG+WFC K +N+ER+F+ LYA++A YF+ +MVRL+L LTP V + S+I+F+ +  ++     K   P  E    E+      D +  G   +KA ++   +  +      +  N  S  T++ +++L+ F++H  + TS +YS+PS+V++S   DG++ I+DDFREAYYWL+QNT + AR+MSWWDYGYQI GMANRTT+VDNNTWNNSHIALVGKAMS NE+ A +I++ LDVDYVL+IFGG+IG+SGDDINKFLWMVRI+EGEHPK++ E DYFT  GE+R+DK    ++++ LMY++SYYRFG++Q+    P G+DRTRNAEIG K  +LK  EEAFTSE+WLVRIY+ K +  R +L H  K   + A QK   K
Sbjct:   84 DPWFNYRSTHHLTTNGFYEFLNWFDERAWYPLGRIVGGTVYPGLMVTAGLIHYVLNLLHVTVHIRDVCVFLAPVFSGLTAISTFLLTRELWNQGAGLLAACFIAIVPGYISRSVAGSFDNEGIAIFALQFTYYLWVKSVKTGSVFWAIGCCLSYFYMVSAWGGYVFIINLIPLHVFVLLLMQRYSRRLYIAYSTFYIVGLVLSMQIPFVGFQPIRTSEHMAAAGVFALLQAYAFLQYLKDRLTRQEFQTLFFLGVSLAAGVVFLTVIYLTYTGYIAPWSGRFYSLWDTGYAKIHIPIIASVSEHQPTTWVSFFFDLHILVCTFPAGLWFCIKNINDERVFVALYAISAVYFAGVMVRLMLTLTPVVCMLSAIAFSSVFEHYLGDDLKRENPPAEDSSDED------DKRNQGNLYDKAGKVRKHVSEQDRPEEGLGPNIRSIVTMLMLMLLMMFAVHCTWVTSNAYSSPSVVLASYNHDGSRNILDDFREAYYWLRQNTDEHARVMSWWDYGYQIAGMANRTTLVDNNTWNNSHIALVGKAMSSNESAAYEIMKSLDVDYVLIIFGGVIGYSGDDINKFLWMVRIAEGEHPKDIRESDYFTPQGEFRVDKAGSPTLLNCLMYKMSYYRFGEMQLDFRTPPGFDRTRNAEIGNKDIRLKHLEEAFTSEHWLVRIYRVKKQENRQTLDH--KLRNIAAKQKYTSK 778          
BLAST of dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B vs. Ensembl Zebrafish
Match: stt3a (STT3 oligosaccharyltransferase complex catalytic subunit A [Source:ZFIN;Acc:ZDB-GENE-021015-3])

HSP 1 Score: 673.7 bits (1737), Expect = 0.000e+0
Identity = 334/669 (49.93%), Postives = 463/669 (69.21%), Query Frame = 3
Query:  135 DPWFNYRSTLELVERGFYKFLNWFDEKSWYPLGRIVGGTIFPGLMMTSGLFYNLLKQMSLHIEIRNVCVLLAPLYSCFTVIISFLLTKEIWNTNSGLICGCIMAIVPGYISRSSSGSYDNEGIAIFAMLLTFYFWIKATKTGTVFWSVLCSISYFYMVSAWGGYVYTLNLISLHVIILLLFQKYSNNLYVAFSVFYLFGLLFSMQIPFVGFQPLKSCEHASSACAFFVLQFYYYVIKLED-IKIKNGLKLYLYIGPXXXXXXXXXXXXXTKLEILLPWSGRFYSLWDINYAAINIPIITSVSEHQPTAWQSTFFDLNVLMCFYPAGIWFCFKFLNNERIFLILYALTASYFSSIMVRLVLALTPAVAIGSSISFNMLLTYFEKLHKPTKELDKTENFECVTIDSKGDGFCENKANEINYEIIHKVIHNYFSTVVCIVILIHFSIHSIFATSTSYSNPSIVMSSTLPDGNKVIIDDFREAYYWLKQNTKDEARIMSWWDYGYQITGMANRTTIVDNNTWNNSHIALVGKAMSMNETNAIKIIRLLDVDYVLVIFGGLIGFSGDDINKFLWMVRI-SEGEHPKEVYEYDYFTANGEYRIDKLAPKSMVDSLMYRLSYYRFGQIQIGKEFPTGYDRTRNAEIGLKYYKLKFFEEAFTSENWLVRIYKTKLRN 2135
            DP+FNYR+T  L E GFYKF NWFD+++WYPLGRI+GGTI+PGLM+TS   Y++L    + I+IRNVCV LAPL+S FT I+++  TKE+ +  +GL+   ++A+VPGYISRS +GSYDNEGIAIF MLLT+Y WIKA K+G+++WS +C+++YFYMVS+WGGYV+ +NLI LHV++L+L  ++S+ +YVA+   Y  G + SMQI FVGFQP++S EH ++   F + Q + +V  L   +  +    L+  +  +  I    +  LL     + PW+GRFYSL D +YA  NIPII SVSEHQPT W S +FDL +L+  +P G+++CF  L++  IF+I+Y +T+ YFS++MVRL+L L P + I S I  + +LT F K            N +    D K       K  +  Y I ++V       +V    LI ++ HS + TS +YS+PSIV+S+   DG+++I DDFREAYYWL+ NT ++A++MSWWDYGYQIT MANRT +VDNNTWNN+HI+ VG+AM+  E  A +I+R LDV YVLVIFGGL G+S DDINKFLWMVRI    +  + + E+DY+T  GE+R+D+     +++ LMY++ YYRFGQ+    + P GYDR RNAEIG K ++L   EEA+T+E+WLVRIYK  L +
Sbjct:   49 DPYFNYRTTRFLAEEGFYKFHNWFDDRAWYPLGRIIGGTIYPGLMITSAALYHVLHFFHITIDIRNVCVFLAPLFSSFTAIVTYHFTKELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKSGSIYWSSMCALAYFYMVSSWGGYVFLINLIPLHVLVLMLTGRFSHRIYVAYCTVYCLGTILSMQISFVGFQPVQSSEHMAAFGVFGLCQIHAFVDYLRSKLNAQQFEVLFRSVISLVGIILLSVGGLLMLTGKISPWTGRFYSLLDPSYAKNNIPIIASVSEHQPTTWSSYYFDLQLLVFMFPVGLYYCFNNLSDATIFIIMYGVTSMYFSAVMVRLMLVLAPVMCILSGIGVSQVLTTFMK------------NLDVSRPDKK-----TKKQQDSTYPIKNEVASGMI--LVMAFFLITYTFHSTWVTSEAYSSPSIVLSARGGDGSRIIFDDFREAYYWLRHNTPEDAKVMSWWDYGYQITAMANRTILVDNNTWNNTHISRVGQAMASTEEKAYEIMRELDVSYVLVIFGGLTGYSSDDINKFLWMVRIGGSTDTGRHIKEHDYYTPTGEFRVDREGSPVLLNCLMYKMCYYRFGQVYTEAKRPPGYDRVRNAEIGNKDFELDVLEEAYTTEHWLVRIYKVNLSS 698          
BLAST of dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B vs. Ensembl Zebrafish
Match: stt3a (STT3 oligosaccharyltransferase complex catalytic subunit A [Source:ZFIN;Acc:ZDB-GENE-021015-3])

HSP 1 Score: 621.313 bits (1601), Expect = 0.000e+0
Identity = 308/621 (49.60%), Postives = 430/621 (69.24%), Query Frame = 3
Query:  135 DPWFNYRSTLELVERGFYKFLNWFDEKSWYPLGRIVGGTIFPGLMMTSGLFYNLLKQMSLHIEIRNVCVLLAPLYSCFTVIISFLLTKEIWNTNSGLICGCIMAIVPGYISRSSSGSYDNEGIAIFAMLLTFYFWIKATKTGTVFWSVLCSISYFYMVSAWGGYVYTLNLISLHVIILLLFQKYSNNLYVAFSVFYLFGLLFSMQIPFVGFQPLKSCEHASSACAFFVLQFYYYVIKLED-IKIKNGLKLYLYIGPXXXXXXXXXXXXXTKLEILLPWSGRFYSLWDINYAAINIPIITSVSEHQPTAWQSTFFDLNVLMCFYPAGIWFCFKFLNNERIFLILYALTASYFSSIMVRLVLALTPAVAIGSSISFNMLLTYFEKLHKPTKELDKTENFECVTIDSKGDGFCENKANEINYEIIHKVIHNYFSTVVCIVILIHFSIHSIFATSTSYSNPSIVMSSTLPDGNKVIIDDFREAYYWLKQNTKDEARIMSWWDYGYQITGMANRTTIVDNNTWNNSHIALVGKAMSMNETNAIKIIRLLDVDYVLVIFGGLIGFSGDDINKFLWMVRI-SEGEHPKEVYEYDYFTANGEYRIDKLAPKSMVDSLMYRLSYYRFGQI 1991
            DP+FNYR+T  L E GFYKF NWFD+++WYPLGRI+GGTI+PGLM+TS   Y++L    + I+IRNVCV LAPL+S FT I+++  TKE+ +  +GL+   ++A+VPGYISRS +GSYDNEGIAIF MLLT+Y WIKA K+G+++WS +C+++YFYMVS+WGGYV+ +NLI LHV++L+L  ++S+ +YVA+   Y  G + SMQI FVGFQP++S EH ++   F + Q + +V  L   +  +    L+  +  +  I    +  LL     + PW+GRFYSL D +YA  NIPII SVSEHQPT W S +FDL +L+  +P G+++CF  L++  IF+I+Y +T+ YFS++MVRL+L L P + I S I  + +LT F K            N +    D K       K  +  Y I ++V       +V    LI ++ HS + TS +YS+PSIV+S+   DG+++I DDFREAYYWL+ NT ++A++MSWWDYGYQIT MANRT +VDNNTWNN+HI+ VG+AM+  E  A +I+R LDV YVLVIFGGL G+S DDINKFLWMVRI    +  + + E+DY+T  GE+R+D+     +++ LMY++ YYRFGQ+
Sbjct:   49 DPYFNYRTTRFLAEEGFYKFHNWFDDRAWYPLGRIIGGTIYPGLMITSAALYHVLHFFHITIDIRNVCVFLAPLFSSFTAIVTYHFTKELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKSGSIYWSSMCALAYFYMVSSWGGYVFLINLIPLHVLVLMLTGRFSHRIYVAYCTVYCLGTILSMQISFVGFQPVQSSEHMAAFGVFGLCQIHAFVDYLRSKLNAQQFEVLFRSVISLVGIILLSVGGLLMLTGKISPWTGRFYSLLDPSYAKNNIPIIASVSEHQPTTWSSYYFDLQLLVFMFPVGLYYCFNNLSDATIFIIMYGVTSMYFSAVMVRLMLVLAPVMCILSGIGVSQVLTTFMK------------NLDVSRPDKK-----TKKQQDSTYPIKNEVASGMI--LVMAFFLITYTFHSTWVTSEAYSSPSIVLSARGGDGSRIIFDDFREAYYWLRHNTPEDAKVMSWWDYGYQITAMANRTILVDNNTWNNTHISRVGQAMASTEEKAYEIMRELDVSYVLVIFGGLTGYSSDDINKFLWMVRIGGSTDTGRHIKEHDYYTPTGEFRVDREGSPVLLNCLMYKMCYYRFGQV 650          
BLAST of dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B vs. Ensembl Xenopus
Match: arhgef25 (Rho guanine nucleotide exchange factor 25 [Source:Xenbase;Acc:XB-GENE-6084380])

HSP 1 Score: 799.275 bits (2063), Expect = 0.000e+0
Identity = 381/719 (52.99%), Postives = 518/719 (72.04%), Query Frame = 3
Query:  135 DPWFNYRSTLELVERGFYKFLNWFDEKSWYPLGRIVGGTIFPGLMMTSGLFYNLLKQMSLHIEIRNVCVLLAPLYSCFTVIISFLLTKEIWNTNSGLICGCIMAIVPGYISRSSSGSYDNEGIAIFAMLLTFYFWIKATKTGTVFWSVLCSISYFYMVSAWGGYVYTLNLISLHVIILLLFQKYSNNLYVAFSVFYLFGLLFSMQIPFVGFQPLKSCEHASSACAFFVLQFYYYVIKLEDIKIKNGLKLYLYIG-PXXXXXXXXXXXXXTKLEILLPWSGRFYSLWDINYAAINIPIITSVSEHQPTAWQSTFFDLNVLMCFYPAGIWFCFKFLNNERIFLILYALTASYFSSIMVRLVLALTPAVAIGSSISFNMLLTYF-----EKLHKPTKELDKTENFECVTIDSKGDGFCENKANEINYEIIHKVIHNYFSTVVCIVILIHFSIHSIFATSTSYSNPSIVMSSTLPDGNKVIIDDFREAYYWLKQNTKDEARIMSWWDYGYQITGMANRTTIVDNNTWNNSHIALVGKAMSMNETNAIKIIRLLDVDYVLVIFGGLIGFSGDDINKFLWMVRISEGEHPKEVYEYDYFTANGEYRIDKLAPKSMVDSLMYRLSYYRFGQIQIGKEFPTGYDRTRNAEIGLKYYKLKFFEEAFTSENWLVRIYKTKLRNFRISLKHARKKNKVFASQKRL-----RKMKGALKFPRIITRGIKKN 2258
            DPWFNYRST  L   GFY+FLNWFDE++WYPLGRIVGGT++PGLM+T+GL + +L  +++ + IR+VCV LAP++S  T I +FLLT+E+WN  +GL+  C +AIVPGYISRS +GS+DNEGIAIFA+  T+Y W+K+ KTG+VFW++ C +SYFYMVSAWGGYV+ +NLI LHV +LLL Q+YS  +Y+A+S FY+ GL+ SMQIPFVGFQP+++ EH ++A    +LQ Y ++  L D   K   +   ++G  +A     L +  LT    + PWSGRFYSLWD  YA I+IPII SVSEHQPT W S FFDL++L+C +PAG+WFC K +N+ER+F+ LYA++A YF+ +MVRL+L LTP V + S+I+F+ +  ++     ++ + P ++    E       D  G         E   E +   I +   T++ +++L+ F++H  + TS +YS+PS+V++S   DG + I+DDFREAYYWL+QNT + AR+MSWWDYGYQI GMANRTT+VDNNTWNNSHIALVGKAMS NET A +I++ LDVDYVL+IFGG+IG+SGDDINKFLWMVRI+EGEHPK++ E DYFT  GE+R+DK    ++++ LMY++SYYRFG++Q+    P G+DRTRNAEIG K  K K  EEAFTSE+WLVRIYK K    R +L H  +   +   QK L     ++ +G ++    + +G + N
Sbjct:  101 DPWFNYRSTHHLASHGFYEFLNWFDERAWYPLGRIVGGTVYPGLMVTAGLIHWILNMLNITVHIRDVCVFLAPVFSGLTSISTFLLTRELWNQGAGLLAACFIAIVPGYISRSVAGSFDNEGIAIFALQFTYYLWVKSVKTGSVFWTICCCLSYFYMVSAWGGYVFIINLIPLHVFVLLLMQRYSKRVYIAYSTFYIVGLILSMQIPFVGFQPIRTSEHMAAAGGHALLQAYAFLQYLRDKLSKQDFQTLFFLGVSLAAGVVFLTVIYLTYTGYIAPWSGRFYSLWDTGYAKIHIPIIASVSEHQPTTWVSFFFDLHILVCTFPAGLWFCIKNINDERVFVALYAISAVYFAGVMVRLMLTLTPVVCMLSAIAFSNVFEHYLGDDMKRENPPVEDSSDEERNSGTLYDKAGKVRKHVSEQEKAEEGLGPNIKS-IVTMLMLMLLMMFAVHCTWVTSNAYSSPSVVLASYNHDGTRNILDDFREAYYWLRQNTDEHARVMSWWDYGYQIAGMANRTTLVDNNTWNNSHIALVGKAMSSNETAAYEIMKSLDVDYVLIIFGGVIGYSGDDINKFLWMVRIAEGEHPKDIRESDYFTPQGEFRVDKAGSPTLLNCLMYKMSYYRFGEMQLDFRTPPGFDRTRNAEIGNKDIKFKHLEEAFTSEHWLVRIYKVKQLENREALDHKPRVTNIVPKQKYLSKKTSKRKRGYIRNKLTLKKGKRPN 818          
BLAST of dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B vs. Ensembl Xenopus
Match: arhgef25 (Rho guanine nucleotide exchange factor 25 [Source:Xenbase;Acc:XB-GENE-6084380])

HSP 1 Score: 789.645 bits (2038), Expect = 0.000e+0
Identity = 379/696 (54.45%), Postives = 507/696 (72.84%), Query Frame = 3
Query:  135 DPWFNYRSTLELVERGFYKFLNWFDEKSWYPLGRIVGGTIFPGLMMTSGLFYNLLKQMSLHIEIRNVCVLLAPLYSCFTVIISFLLTKEIWNTNSGLICGCIMAIVPGYISRSSSGSYDNEGIAIFAMLLTFYFWIKATKTGTVFWSVLCSISYFYMVSAWGGYVYTLNLISLHVIILLLFQKYSNNLYVAFSVFYLFGLLFSMQIPFVGFQPLKSCEHASSACAFFVLQFYYYVIKLEDIKIKNGLKLYLYIG-PXXXXXXXXXXXXXTKLEILLPWSGRFYSLWDINYAAINIPIITSVSEHQPTAWQSTFFDLNVLMCFYPAGIWFCFKFLNNERIFLILYALTASYFSSIMVRLVLALTPAVAIGSSISFNMLLTYF-----EKLHKPTKELDKTENFECVTIDSKGDGFCENKANEINYEIIHKVIHNYFSTVVCIVILIHFSIHSIFATSTSYSNPSIVMSSTLPDGNKVIIDDFREAYYWLKQNTKDEARIMSWWDYGYQITGMANRTTIVDNNTWNNSHIALVGKAMSMNETNAIKIIRLLDVDYVLVIFGGLIGFSGDDINKFLWMVRISEGEHPKEVYEYDYFTANGEYRIDKLAPKSMVDSLMYRLSYYRFGQIQIGKEFPTGYDRTRNAEIGLKYYKLKFFEEAFTSENWLVRIYKTKLRNFRISLKHARKKNKVFASQKRLRK 2204
            DPWFNYRST  L   GFY+FLNWFDE++WYPLGRIVGGT++PGLM+T+GL + +L  +++ + IR+VCV LAP++S  T I +FLLT+E+WN  +GL+  C +AIVPGYISRS +GS+DNEGIAIFA+  T+Y W+K+ KTG+VFW++ C +SYFYMVSAWGGYV+ +NLI LHV +LLL Q+YS  +Y+A+S FY+ GL+ SMQIPFVGFQP+++ EH ++A A+  LQ+      L D   K   +   ++G  +A     L +  LT    + PWSGRFYSLWD  YA I+IPII SVSEHQPT W S FFDL++L+C +PAG+WFC K +N+ER+F+ LYA++A YF+ +MVRL+L LTP V + S+I+F+ +  ++     ++ + P ++    E       D  G         E   E +   I +   T++ +++L+ F++H  + TS +YS+PS+V++S   DG + I+DDFREAYYWL+QNT + AR+MSWWDYGYQI GMANRTT+VDNNTWNNSHIALVGKAMS NET A +I++ LDVDYVL+IFGG+IG+SGDDINKFLWMVRI+EGEHPK++ E DYFT  GE+R+DK    ++++ LMY++SYYRFG++Q+    P G+DRTRNAEIG K  K K  EEAFTSE+WLVRIYK K    R +L H  +   +   QK L K
Sbjct:  101 DPWFNYRSTHHLASHGFYEFLNWFDERAWYPLGRIVGGTVYPGLMVTAGLIHWILNMLNITVHIRDVCVFLAPVFSGLTSISTFLLTRELWNQGAGLLAACFIAIVPGYISRSVAGSFDNEGIAIFALQFTYYLWVKSVKTGSVFWTICCCLSYFYMVSAWGGYVFIINLIPLHVFVLLLMQRYSKRVYIAYSTFYIVGLILSMQIPFVGFQPIRTSEHMAAA-AYAFLQY------LRDKLSKQDFQTLFFLGVSLAAGVVFLTVIYLTYTGYIAPWSGRFYSLWDTGYAKIHIPIIASVSEHQPTTWVSFFFDLHILVCTFPAGLWFCIKNINDERVFVALYAISAVYFAGVMVRLMLTLTPVVCMLSAIAFSNVFEHYLGDDMKRENPPVEDSSDEERNSGTLYDKAGKVRKHVSEQEKAEEGLGPNIKS-IVTMLMLMLLMMFAVHCTWVTSNAYSSPSVVLASYNHDGTRNILDDFREAYYWLRQNTDEHARVMSWWDYGYQIAGMANRTTLVDNNTWNNSHIALVGKAMSSNETAAYEIMKSLDVDYVLIIFGGVIGYSGDDINKFLWMVRIAEGEHPKDIRESDYFTPQGEFRVDKAGSPTLLNCLMYKMSYYRFGEMQLDFRTPPGFDRTRNAEIGNKDIKFKHLEEAFTSEHWLVRIYKVKQLENREALDHKPRVTNIVPKQKYLSK 788          
BLAST of dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B vs. Ensembl Xenopus
Match: arhgef25 (Rho guanine nucleotide exchange factor 25 [Source:Xenbase;Acc:XB-GENE-6084380])

HSP 1 Score: 789.645 bits (2038), Expect = 0.000e+0
Identity = 379/696 (54.45%), Postives = 507/696 (72.84%), Query Frame = 3
Query:  135 DPWFNYRSTLELVERGFYKFLNWFDEKSWYPLGRIVGGTIFPGLMMTSGLFYNLLKQMSLHIEIRNVCVLLAPLYSCFTVIISFLLTKEIWNTNSGLICGCIMAIVPGYISRSSSGSYDNEGIAIFAMLLTFYFWIKATKTGTVFWSVLCSISYFYMVSAWGGYVYTLNLISLHVIILLLFQKYSNNLYVAFSVFYLFGLLFSMQIPFVGFQPLKSCEHASSACAFFVLQFYYYVIKLEDIKIKNGLKLYLYIG-PXXXXXXXXXXXXXTKLEILLPWSGRFYSLWDINYAAINIPIITSVSEHQPTAWQSTFFDLNVLMCFYPAGIWFCFKFLNNERIFLILYALTASYFSSIMVRLVLALTPAVAIGSSISFNMLLTYF-----EKLHKPTKELDKTENFECVTIDSKGDGFCENKANEINYEIIHKVIHNYFSTVVCIVILIHFSIHSIFATSTSYSNPSIVMSSTLPDGNKVIIDDFREAYYWLKQNTKDEARIMSWWDYGYQITGMANRTTIVDNNTWNNSHIALVGKAMSMNETNAIKIIRLLDVDYVLVIFGGLIGFSGDDINKFLWMVRISEGEHPKEVYEYDYFTANGEYRIDKLAPKSMVDSLMYRLSYYRFGQIQIGKEFPTGYDRTRNAEIGLKYYKLKFFEEAFTSENWLVRIYKTKLRNFRISLKHARKKNKVFASQKRLRK 2204
            DPWFNYRST  L   GFY+FLNWFDE++WYPLGRIVGGT++PGLM+T+GL + +L  +++ + IR+VCV LAP++S  T I +FLLT+E+WN  +GL+  C +AIVPGYISRS +GS+DNEGIAIFA+  T+Y W+K+ KTG+VFW++ C +SYFYMVSAWGGYV+ +NLI LHV +LLL Q+YS  +Y+A+S FY+ GL+ SMQIPFVGFQP+++ EH ++A A+  LQ+      L D   K   +   ++G  +A     L +  LT    + PWSGRFYSLWD  YA I+IPII SVSEHQPT W S FFDL++L+C +PAG+WFC K +N+ER+F+ LYA++A YF+ +MVRL+L LTP V + S+I+F+ +  ++     ++ + P ++    E       D  G         E   E +   I +   T++ +++L+ F++H  + TS +YS+PS+V++S   DG + I+DDFREAYYWL+QNT + AR+MSWWDYGYQI GMANRTT+VDNNTWNNSHIALVGKAMS NET A +I++ LDVDYVL+IFGG+IG+SGDDINKFLWMVRI+EGEHPK++ E DYFT  GE+R+DK    ++++ LMY++SYYRFG++Q+    P G+DRTRNAEIG K  K K  EEAFTSE+WLVRIYK K    R +L H  +   +   QK L K
Sbjct:  101 DPWFNYRSTHHLASHGFYEFLNWFDERAWYPLGRIVGGTVYPGLMVTAGLIHWILNMLNITVHIRDVCVFLAPVFSGLTSISTFLLTRELWNQGAGLLAACFIAIVPGYISRSVAGSFDNEGIAIFALQFTYYLWVKSVKTGSVFWTICCCLSYFYMVSAWGGYVFIINLIPLHVFVLLLMQRYSKRVYIAYSTFYIVGLILSMQIPFVGFQPIRTSEHMAAA-AYAFLQY------LRDKLSKQDFQTLFFLGVSLAAGVVFLTVIYLTYTGYIAPWSGRFYSLWDTGYAKIHIPIIASVSEHQPTTWVSFFFDLHILVCTFPAGLWFCIKNINDERVFVALYAISAVYFAGVMVRLMLTLTPVVCMLSAIAFSNVFEHYLGDDMKRENPPVEDSSDEERNSGTLYDKAGKVRKHVSEQEKAEEGLGPNIKS-IVTMLMLMLLMMFAVHCTWVTSNAYSSPSVVLASYNHDGTRNILDDFREAYYWLRQNTDEHARVMSWWDYGYQIAGMANRTTLVDNNTWNNSHIALVGKAMSSNETAAYEIMKSLDVDYVLIIFGGVIGYSGDDINKFLWMVRIAEGEHPKDIRESDYFTPQGEFRVDKAGSPTLLNCLMYKMSYYRFGEMQLDFRTPPGFDRTRNAEIGNKDIKFKHLEEAFTSEHWLVRIYKVKQLENREALDHKPRVTNIVPKQKYLSK 788          
BLAST of dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B vs. Ensembl Xenopus
Match: arhgef25 (Rho guanine nucleotide exchange factor 25 [Source:Xenbase;Acc:XB-GENE-6084380])

HSP 1 Score: 776.548 bits (2004), Expect = 0.000e+0
Identity = 372/718 (51.81%), Postives = 500/718 (69.64%), Query Frame = 3
Query:  135 DPWFNYRSTLELVERGFYKFLNWFDEKSWYPLGRIVGGTIFPGLMMTSGLFYNLLKQMSLHIEIRNVCVLLAPLYSCFTVIISFLLTKEIWNTNSGLICGCIMAIVPGYISRSSSGSYDNEGIAIFAMLLTFYFWIKATKTGTVFWSVLCSISYFYMVSAWGGYVYTLNLISLHVIILLLFQKYSNNLYVAFSVFYLFGLLFSMQIPFVGFQPLKSCEHASSACAFFVLQFYYYVIKLEDIKIKNGLKLYLYIGPXXXXXXXXXXXXXTKLEILLPWSGRFYSLWDINYAAINIPIITSVSEHQPTAWQSTFFDLNVLMCFYPAGIWFCFKFLNNERIFLILYALTASYFSSIMVRLVLALTPAVAIGSSISFNMLLTYF-----EKLHKPTKELDKTENFECVTIDSKGDGFCENKANEINYEIIHKVIHNYFSTVVCIVILIHFSIHSIFATSTSYSNPSIVMSSTLPDGNKVIIDDFREAYYWLKQNTKDEARIMSWWDYGYQITGMANRTTIVDNNTWNNSHIALVGKAMSMNETNAIKIIRLLDVDYVLVIFGGLIGFSGDDINKFLWMVRISEGEHPKEVYEYDYFTANGEYRIDKLAPKSMVDSLMYRLSYYRFGQIQIGKEFPTGYDRTRNAEIGLKYYKLKFFEEAFTSENWLVRIYKTKLRNFRISLKHARKKNKVFASQKRL-----RKMKGALKFPRIITRGIKKN 2258
            DPWFNYRST  L   GFY+FLNWFDE++WYPLGRIVGGT++PGLM+T+GL + +L  +++ + IR+VCV LAP++S  T I +FLLT+E+WN  +GL+  C +AIVPGYISRS +GS+DNEGIAIFA+  T+Y W+K+ KTG+VFW++ C +SYFYMVSAWGGYV+ +NLI LHV +LLL Q+YS  +Y+A+S FY+ GL+ SMQIPFVGFQP+++ EH ++A                            YI P                     WSGRFYSLWD  YA I+IPII SVSEHQPT W S FFDL++L+C +PAG+WFC K +N+ER+F+ LYA++A YF+ +MVRL+L LTP V + S+I+F+ +  ++     ++ + P ++    E       D  G         E   E +   I +   T++ +++L+ F++H  + TS +YS+PS+V++S   DG + I+DDFREAYYWL+QNT + AR+MSWWDYGYQI GMANRTT+VDNNTWNNSHIALVGKAMS NET A +I++ LDVDYVL+IFGG+IG+SGDDINKFLWMVRI+EGEHPK++ E DYFT  GE+R+DK    ++++ LMY++SYYRFG++Q+    P G+DRTRNAEIG K  K K  EEAFTSE+WLVRIYK K    R +L H  +   +   QK L     ++ +G ++    + +G + N
Sbjct:  101 DPWFNYRSTHHLASHGFYEFLNWFDERAWYPLGRIVGGTVYPGLMVTAGLIHWILNMLNITVHIRDVCVFLAPVFSGLTSISTFLLTRELWNQGAGLLAACFIAIVPGYISRSVAGSFDNEGIAIFALQFTYYLWVKSVKTGSVFWTICCCLSYFYMVSAWGGYVFIINLIPLHVFVLLLMQRYSKRVYIAYSTFYIVGLILSMQIPFVGFQPIRTSEHMAAAG---------------------------YIAP---------------------WSGRFYSLWDTGYAKIHIPIIASVSEHQPTTWVSFFFDLHILVCTFPAGLWFCIKNINDERVFVALYAISAVYFAGVMVRLMLTLTPVVCMLSAIAFSNVFEHYLGDDMKRENPPVEDSSDEERNSGTLYDKAGKVRKHVSEQEKAEEGLGPNIKS-IVTMLMLMLLMMFAVHCTWVTSNAYSSPSVVLASYNHDGTRNILDDFREAYYWLRQNTDEHARVMSWWDYGYQIAGMANRTTLVDNNTWNNSHIALVGKAMSSNETAAYEIMKSLDVDYVLIIFGGVIGYSGDDINKFLWMVRIAEGEHPKDIRESDYFTPQGEFRVDKAGSPTLLNCLMYKMSYYRFGEMQLDFRTPPGFDRTRNAEIGNKDIKFKHLEEAFTSEHWLVRIYKVKQLENREALDHKPRVTNIVPKQKYLSKKTSKRKRGYIRNKLTLKKGKRPN 769          
BLAST of dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B vs. Ensembl Xenopus
Match: arhgef25 (Rho guanine nucleotide exchange factor 25 [Source:Xenbase;Acc:XB-GENE-6084380])

HSP 1 Score: 748.429 bits (1931), Expect = 0.000e+0
Identity = 366/704 (51.99%), Postives = 495/704 (70.31%), Query Frame = 3
Query:  135 DPWFNYRSTLELVERGFYKFLNWFDEKSWYPLGRIVGGTIFPGLMMTSGLFYNLLKQMSLHIEIRNVCVLLAPLYSCFTVIISFLLTKEIWNTNSGLICGCIMAIVPGYISRSSSGSYDNEGIAIFAMLLTFYFWIKATKTGTVFWSVLCSISYFYMVSAWGGYVYTLNLISLHVIILLLFQKYSNNLYVAFSVFYLFGLLFSMQIPFVGFQPLKSCEHASSA-------CAFFVLQFYYYVIKLEDIKIKNGLKLYLYIGPXXXXXXXXXXXXXTKLEILLPWSGRFYSLWDINYAAINIPIITSVSEHQPTAWQSTFFDLNVLMCFYPAGIWFCFKFLNNERIFLILYALTASYFSSIMVRLVLALTPAVAIGSSISFNMLLTYF----EKLHKPTKELDKTENFECVTIDSKGDGFCENKANEINYEIIHKVIHNYFSTVVCIVILIHFSIHSIFATSTSYSNPSIVMSSTLPDGNKVIIDDFREAYYWLKQNTKDEARIMSWWDYGYQITGMANRTTIVDNNTWNNSHIALVGKAMSMNETNAIKIIRLLDVDYVLVIFGGLIGFSGDDINKFLWMVRISEGEHPKEVYEYDYFTANGEYRIDKLAPKSMVDSLMYRLSYYRFGQIQIGKEFPTGYDRTRNAEIGLKYYKLKFFEEAFTSENWLVRIYKTKLRNFRISLKHARKKNKVFASQKRLRKMKG 2213
            DPWFNYRST  L   GFY+FLNWFDE++WYPLGRIVGGT++PGLM+T+GL + +L  +++ + IR+VCV LAP++S  T I +FLLT+E+WN  +GL+  C +AIVPGYISRS +GS+DNEGIAIFA+  T+Y W+K+ KTG+VFW++ C +SYFYMVSAWGGYV+ +NLI LHV +LLL Q+YS  +Y+A+S FY+ GL+ SMQIPFVGFQP+++ EH ++A        A+  LQ+    +  +D +    L + L  G   ++   +I    T + I  P++   +  +   YA I+IPII SVSEHQPT W S FFDL++L+C +PAG+WFC K +N+ER+F+ LYA++A YF+ +MVRL+L LTP V + S+I+F+ +  ++     K   P  E     N + +                               T++ +++L+ F++H  + TS +YS+PS+V++S   DG + I+DDFREAYYWL+QNT + AR+MSWWDYGYQI GMANRTT+VDNNTWNNSHIALVGKAMS NET A +I++ LDVDYVL+IFGG+IG+SGDDINKFLWMVRI+EGEHPK++ E DYFT  GE+R+DK    ++++ LMY++SYYRFG++Q+    P G+DRTRNAEIG K  K K  EEAFTSE+WLVRIYK K    R +L H  +   +   QK L K  G
Sbjct:   79 DPWFNYRSTHHLASHGFYEFLNWFDERAWYPLGRIVGGTVYPGLMVTAGLIHWILNMLNITVHIRDVCVFLAPVFSGLTSISTFLLTRELWNQGAGLLAACFIAIVPGYISRSVAGSFDNEGIAIFALQFTYYLWVKSVKTGSVFWTICCCLSYFYMVSAWGGYVFIINLIPLHVFVLLLMQRYSKRVYIAYSTFYIVGLILSMQIPFVGFQPIRTSEHMAAAGKVIKNFGAYAFLQYLRDKLSKQDFQTLFFLGVSLAAG---VVFLTVIYLTYTGICINDPFNFVLFFFFSNRYAKIHIPIIASVSEHQPTTWVSFFFDLHILVCTFPAGLWFCIKNINDERVFVALYAISAVYFAGVMVRLMLTLTPVVCMLSAIAFSNVFEHYLGDDMKRENPPVEDSLGPNIKSIV------------------------------TMLMLMLLMMFAVHCTWVTSNAYSSPSVVLASYNHDGTRNILDDFREAYYWLRQNTDEHARVMSWWDYGYQIAGMANRTTLVDNNTWNNSHIALVGKAMSSNETAAYEIMKSLDVDYVLIIFGGVIGYSGDDINKFLWMVRIAEGEHPKDIRESDYFTPQGEFRVDKAGSPTLLNCLMYKMSYYRFGEMQLDFRTPPGFDRTRNAEIGNKDIKFKHLEEAFTSEHWLVRIYKVKQLENREALDHKPRVTNIVPKQKYLSKKVG 749          
BLAST of dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B vs. Ensembl Mouse
Match: Stt3b (STT3, subunit of the oligosaccharyltransferase complex, homolog B (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:1915542])

HSP 1 Score: 800.816 bits (2067), Expect = 0.000e+0
Identity = 390/725 (53.79%), Postives = 514/725 (70.90%), Query Frame = 3
Query:  135 DPWFNYRSTLELVERGFYKFLNWFDEKSWYPLGRIVGGTIFPGLMMTSGLFYNLLKQMSLHIEIRNVCVLLAPLYSCFTVIISFLLTKEIWNTNSGLICGCIMAIVPGYISRSSSGSYDNEGIAIFAMLLTFYFWIKATKTGTVFWSVLCSISYFYMVSAWGGYVYTLNLISLHVIILLLFQKYSNNLYVAFSVFYLFGLLFSMQIPFVGFQPLKSCEHASSACAFFVLQFYYYVIKLEDIKIKNGLKLYLYIG-PXXXXXXXXXXXXXTKLEILLPWSGRFYSLWDINYAAINIPIITSVSEHQPTAWQSTFFDLNVLMCFYPAGIWFCFKFLNNERIFLILYALTASYFSSIMVRLVLALTPAVAIGSSISFNMLLTYF----EKLHKPTKELDKTENFECVTIDSKGDGFCENKANEINYEIIH--KVIHNYFSTVVCIVILIH------FSIHSIFATSTSYSNPSIVMSSTLPDGNKVIIDDFREAYYWLKQNTKDEARIMSWWDYGYQITGMANRTTIVDNNTWNNSHIALVGKAMSMNETNAIKIIRLLDVDYVLVIFGGLIGFSGDDINKFLWMVRISEGEHPKEVYEYDYFTANGEYRIDKLAPKSMVDSLMYRLSYYRFGQIQIGKEFPTGYDRTRNAEIGLKYYKLKFFEEAFTSENWLVRIYKTKLRNFRISLKHARKKNKVFASQKRLRKMKGALKFPRIITRGIKKNSYPF 2270
            DPWFNYRST  L   GFY+FLNWFDE++WYPLGRIVGGT++PGLM+T+GL + +L  +++ + IR+VCV LAP +S  T I +FLLT+E+WN  +GL+  C +AIVPGYISRS +GS+DNEGIAIFA+  T+Y W+K+ KTG+VFW++ C +SYFYMVSAWGGYV+ +NLI LHV +LLL Q+YS  +Y+A+S FY+ GL+ SMQIPFVGFQP+++ EH ++A  F +LQ Y ++  L D   K   +   ++G  +A  +  L +  LT    + PWSGRFYSLWD  YA I+IPII SVSEHQPT W S FFDL++L+C +PAG+WFC K +N+ER+F+ LYA++A YF+ +MVRL+L LTP V + S+I+F+ +  ++     K   P  E    E+      D +  G   +KA ++   +    K        +  IV ++       F++H  + TS +YS+PS+V++S   DG + I+DDFREAY+WL+QNT + AR+MSWWDYGYQI GMANRTT+VDNNTWNNSHIALVGKAMS NET A KI+R LDVDYVLVIFGG+IG+SGDDINKFLWMVRI+EGEHPK++ E DYFT  GE+R+DK    ++++ LMY++SYYRFG++Q+    P G+DRTRNAEIG K  K K  EEAFTSE+WLVRIYK K  + R +L H  +   +   QK L K     K      RG  KN   F
Sbjct:  100 DPWFNYRSTHHLASHGFYEFLNWFDERAWYPLGRIVGGTVYPGLMITAGLIHWILNTLNITVHIRDVCVFLAPTFSGLTSISTFLLTRELWNQGAGLLAACFIAIVPGYISRSVAGSFDNEGIAIFALQFTYYLWVKSVKTGSVFWTMCCCLSYFYMVSAWGGYVFIINLIPLHVFVLLLMQRYSKRVYIAYSTFYIVGLILSMQIPFVGFQPIRTSEHMAAAGVFALLQAYAFLQYLRDRLTKQEFQTLFFLGVSLAAGAVFLSVIYLTYTGYIAPWSGRFYSLWDTGYAKIHIPIIASVSEHQPTTWVSFFFDLHILVCTFPAGLWFCIKNINDERVFVALYAISAVYFAGVMVRLMLTLTPVVCMLSAIAFSNVFEHYLGDDMKRENPPVEDSSDED------DKRNPGNLYDKAGKVRKHVTEQEKPEEGLGPNIKSIVTMLMLMLLMMFAVHCTWVTSNAYSSPSVVLASYNHDGTRNILDDFREAYFWLRQNTDEHARVMSWWDYGYQIAGMANRTTLVDNNTWNNSHIALVGKAMSSNETAAYKIMRSLDVDYVLVIFGGVIGYSGDDINKFLWMVRIAEGEHPKDIREGDYFTQQGEFRVDKAGSPTLLNCLMYKMSYYRFGEMQLDFRTPPGFDRTRNAEIGNKDIKFKHLEEAFTSEHWLVRIYKVKAPDNRETLGHKPRVTNIVPKQKYLSKKTTKRK------RGYVKNKLVF 812          
BLAST of dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B vs. Ensembl Mouse
Match: Stt3a (STT3, subunit of the oligosaccharyltransferase complex, homolog A (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:105124])

HSP 1 Score: 670.618 bits (1729), Expect = 0.000e+0
Identity = 334/669 (49.93%), Postives = 464/669 (69.36%), Query Frame = 3
Query:  135 DPWFNYRSTLELVERGFYKFLNWFDEKSWYPLGRIVGGTIFPGLMMTSGLFYNLLKQMSLHIEIRNVCVLLAPLYSCFTVIISFLLTKEIWNTNSGLICGCIMAIVPGYISRSSSGSYDNEGIAIFAMLLTFYFWIKATKTGTVFWSVLCSISYFYMVSAWGGYVYTLNLISLHVIILLLFQKYSNNLYVAFSVFYLFGLLFSMQIPFVGFQPLKSCEHASSACAFFVLQFYYYV----IKLEDIKIKNGLKLYLYIGPXXXXXXXXXXXXXTKLEILLPWSGRFYSLWDINYAAINIPIITSVSEHQPTAWQSTFFDLNVLMCFYPAGIWFCFKFLNNERIFLILYALTASYFSSIMVRLVLALTPAVAIGSSISFNMLLTYFEKLHKPTKELDKTENFECVTIDSKGDGFCENKANEINYEIIHKVIHNYFSTVVCIVILIHFSIHSIFATSTSYSNPSIVMSSTLPDGNKVIIDDFREAYYWLKQNTKDEARIMSWWDYGYQITGMANRTTIVDNNTWNNSHIALVGKAMSMNETNAIKIIRLLDVDYVLVIFGGLIGFSGDDINKFLWMVRI-SEGEHPKEVYEYDYFTANGEYRIDKLAPKSMVDSLMYRLSYYRFGQIQIGKEFPTGYDRTRNAEIGLKYYKLKFFEEAFTSENWLVRIYKTK 2126
            DP+FNYR+T  L E GFYKF NWFD+++WYPLGRI+GGTI+PGLM+TS   Y++L    + I+IRNVCV LAPL+S FT I+++ LTKE+ +  +GL+   ++A+VPGYISRS +GSYDNEGIAIF MLLT+Y WIKA KTG+++W+  C+++YFYMVS+WGGYV+ +NLI LHV++L+L  ++S+ +YVA+   Y  G + SMQI FVGFQP+ S EH ++   F + Q + +V     KL   + +   +  + +    L++   ++ L  K+    PW+GRFYSL D +YA  NIPII SVSEHQPT W S +FDL +L+  +P G+++CF  L++ RIF+I+Y +T+ YFS++MVRL+L L P + I S I  + +L+ + K            N +    D K       K  +  Y I ++V       +V    LI ++ HS + TS +YS+PSIV+S+   DG+++I DDFREAYYWL+ NT ++A++MSWWDYGYQIT MANRT +VDNNTWNN+HI+ VG+AM+  E  A +I+R LDV YVLVIFGGL G+S DDINKFLWMVRI    E  + + E DY+T  GE+R+D+     +++ LMY++ YYRFGQ+    + P G+DR RNAEIG K ++L   EEA+T+E+WLVRIYK K
Sbjct:   49 DPYFNYRTTRFLAEEGFYKFHNWFDDRAWYPLGRIIGGTIYPGLMITSAAIYHVLHFFHITIDIRNVCVFLAPLFSSFTTIVTYHLTKELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSIYWAAKCALAYFYMVSSWGGYVFLINLIPLHVLVLMLTGRFSHRIYVAYCTVYCLGTILSMQISFVGFQPVLSSEHMAAFGVFGLCQIHAFVDYLRSKLNPQQFEVLFRSVISLVGFVLLTVGALLMLTGKIS---PWTGRFYSLLDPSYAKNNIPIIASVSEHQPTTWSSYYFDLQLLVFMFPVGLYYCFSNLSDARIFIIMYGVTSMYFSAVMVRLMLVLAPVMCILSGIGVSQVLSTYMK------------NLDISRPDKK-----SKKQQDSTYPIKNEVASGMI--LVMAFFLITYTFHSTWVTSEAYSSPSIVLSARGGDGSRIIFDDFREAYYWLRHNTPEDAKVMSWWDYGYQITAMANRTILVDNNTWNNTHISRVGQAMASTEEKAYEIMRELDVSYVLVIFGGLTGYSSDDINKFLWMVRIGGSTETGRHIKENDYYTPTGEFRVDREGSPVLLNCLMYKMCYYRFGQVYTEAKRPPGFDRVRNAEIGNKDFELDVLEEAYTTEHWLVRIYKVK 695          
BLAST of dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B vs. Ensembl Mouse
Match: Stt3a (STT3, subunit of the oligosaccharyltransferase complex, homolog A (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:105124])

HSP 1 Score: 153.295 bits (386), Expect = 2.926e-43
Identity = 68/111 (61.26%), Postives = 92/111 (82.88%), Query Frame = 3
Query:  438 IMAIVPGYISRSSSGSYDNEGIAIFAMLLTFYFWIKATKTGTVFWSVLCSISYFYMVSAWGGYVYTLNLISLHVIILLLFQKYSNNLYVAFSVFYLFGLLFSMQIPFVGFQ 770
            ++A+VPGYISRS +GSYDNEGIAIF MLLT+Y WIKA KTG+++W+  C+++YFYMVS+WGGYV+ +NLI LHV++L+L  ++S+ +YVA+   Y  G + SMQI FVGFQ
Sbjct:    2 MIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSIYWAAKCALAYFYMVSSWGGYVFLINLIPLHVLVLMLTGRFSHRIYVAYCTVYCLGTILSMQISFVGFQ 112          
BLAST of dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B vs. Ensembl Mouse
Match: Stt3a (STT3, subunit of the oligosaccharyltransferase complex, homolog A (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:105124])

HSP 1 Score: 78.1814 bits (191), Expect = 3.650e-17
Identity = 48/79 (60.76%), Postives = 64/79 (81.01%), Query Frame = 3
Query:   24 KKILNLFPLVIIILSCVXXXXXXXXXXXXXXXXXXXXDPWFNYRSTLELVERGFYKFLNWFDEKSWYPLGRIVGGTIFP 260
            +K   L  L+I+ ++ VLSF  RLF+++ FES+IHEFDP+FNYR+T  L E GFYKF NWFD+++WYPLGRI+GGTI+P
Sbjct:   12 EKQDTLLKLLILSMAAVLSFSTRLFAVLRFESVIHEFDPYFNYRTTRFLAEEGFYKFHNWFDDRAWYPLGRIIGGTIYP 90          
BLAST of dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B vs. UniProt/SwissProt
Match: sp|Q8TCJ2|STT3B_HUMAN (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Homo sapiens OX=9606 GN=STT3B PE=1 SV=1)

HSP 1 Score: 804.283 bits (2076), Expect = 0.000e+0
Identity = 391/725 (53.93%), Postives = 514/725 (70.90%), Query Frame = 3
Query:  135 DPWFNYRSTLELVERGFYKFLNWFDEKSWYPLGRIVGGTIFPGLMMTSGLFYNLLKQMSLHIEIRNVCVLLAPLYSCFTVIISFLLTKEIWNTNSGLICGCIMAIVPGYISRSSSGSYDNEGIAIFAMLLTFYFWIKATKTGTVFWSVLCSISYFYMVSAWGGYVYTLNLISLHVIILLLFQKYSNNLYVAFSVFYLFGLLFSMQIPFVGFQPLKSCEHASSACAFFVLQFYYYVIKLEDIKIKNGLKLYLYIG-PXXXXXXXXXXXXXTKLEILLPWSGRFYSLWDINYAAINIPIITSVSEHQPTAWQSTFFDLNVLMCFYPAGIWFCFKFLNNERIFLILYALTASYFSSIMVRLVLALTPAVAIGSSISFNMLLTYF----EKLHKPTKELDKTENFECVTIDSKGDGFCENKANEINYEIIH--KVIHNYFSTVVCIVILIH------FSIHSIFATSTSYSNPSIVMSSTLPDGNKVIIDDFREAYYWLKQNTKDEARIMSWWDYGYQITGMANRTTIVDNNTWNNSHIALVGKAMSMNETNAIKIIRLLDVDYVLVIFGGLIGFSGDDINKFLWMVRISEGEHPKEVYEYDYFTANGEYRIDKLAPKSMVDSLMYRLSYYRFGQIQIGKEFPTGYDRTRNAEIGLKYYKLKFFEEAFTSENWLVRIYKTKLRNFRISLKHARKKNKVFASQKRLRKMKGALKFPRIITRGIKKNSYPF 2270
            DPWFNYRST  L   GFY+FLNWFDE++WYPLGRIVGGT++PGLM+T+GL + +L  +++ + IR+VCV LAP +S  T I +FLLT+E+WN  +GL+  C +AIVPGYISRS +GS+DNEGIAIFA+  T+Y W+K+ KTG+VFW++ C +SYFYMVSAWGGYV+ +NLI LHV +LLL Q+YS  +Y+A+S FY+ GL+ SMQIPFVGFQP+++ EH ++A  F +LQ Y ++  L D   K   +   ++G  +A  +  L +  LT    + PWSGRFYSLWD  YA I+IPII SVSEHQPT W S FFDL++L+C +PAG+WFC K +N+ER+F+ LYA++A YF+ +MVRL+L LTP V + S+I+F+ +  ++     K   P  E    E+      D +  G   +KA ++        K        +  IV ++       F++H  + TS +YS+PS+V++S   DG + I+DDFREAY+WL+QNT + AR+MSWWDYGYQI GMANRTT+VDNNTWNNSHIALVGKAMS NET A KI+R LDVDYVLVIFGG+IG+SGDDINKFLWMVRI+EGEHPK++ E DYFT  GE+R+DK    ++++ LMY++SYYRFG++Q+    P G+DRTRNAEIG K  K K  EEAFTSE+WLVRIYK K  + R +L H  +   +F  QK L K     K      RG  KN   F
Sbjct:  103 DPWFNYRSTHHLASHGFYEFLNWFDERAWYPLGRIVGGTVYPGLMITAGLIHWILNTLNITVHIRDVCVFLAPTFSGLTSISTFLLTRELWNQGAGLLAACFIAIVPGYISRSVAGSFDNEGIAIFALQFTYYLWVKSVKTGSVFWTMCCCLSYFYMVSAWGGYVFIINLIPLHVFVLLLMQRYSKRVYIAYSTFYIVGLILSMQIPFVGFQPIRTSEHMAAAGVFALLQAYAFLQYLRDRLTKQEFQTLFFLGVSLAAGAVFLSVIYLTYTGYIAPWSGRFYSLWDTGYAKIHIPIIASVSEHQPTTWVSFFFDLHILVCTFPAGLWFCIKNINDERVFVALYAISAVYFAGVMVRLMLTLTPVVCMLSAIAFSNVFEHYLGDDMKRENPPVEDSSDED------DKRNQGNLYDKAGKVRKHATEQEKTEEGLGPNIKSIVTMLMLMLLMMFAVHCTWVTSNAYSSPSVVLASYNHDGTRNILDDFREAYFWLRQNTDEHARVMSWWDYGYQIAGMANRTTLVDNNTWNNSHIALVGKAMSSNETAAYKIMRTLDVDYVLVIFGGVIGYSGDDINKFLWMVRIAEGEHPKDIRESDYFTPQGEFRVDKAGSPTLLNCLMYKMSYYRFGEMQLDFRTPPGFDRTRNAEIGNKDIKFKHLEEAFTSEHWLVRIYKVKAPDNRETLDHKPRVTNIFPKQKYLSKKTTKRK------RGYIKNKLVF 815          
BLAST of dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B vs. UniProt/SwissProt
Match: sp|E2RG47|STT3B_CANLF (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Canis lupus familiaris OX=9615 GN=STT3B PE=1 SV=1)

HSP 1 Score: 803.512 bits (2074), Expect = 0.000e+0
Identity = 390/725 (53.79%), Postives = 515/725 (71.03%), Query Frame = 3
Query:  135 DPWFNYRSTLELVERGFYKFLNWFDEKSWYPLGRIVGGTIFPGLMMTSGLFYNLLKQMSLHIEIRNVCVLLAPLYSCFTVIISFLLTKEIWNTNSGLICGCIMAIVPGYISRSSSGSYDNEGIAIFAMLLTFYFWIKATKTGTVFWSVLCSISYFYMVSAWGGYVYTLNLISLHVIILLLFQKYSNNLYVAFSVFYLFGLLFSMQIPFVGFQPLKSCEHASSACAFFVLQFYYYVIKLEDIKIKNGLKLYLYIG-PXXXXXXXXXXXXXTKLEILLPWSGRFYSLWDINYAAINIPIITSVSEHQPTAWQSTFFDLNVLMCFYPAGIWFCFKFLNNERIFLILYALTASYFSSIMVRLVLALTPAVAIGSSISFNMLLTYF----EKLHKPTKELDKTENFECVTIDSKGDGFCENKANEINYEIIH--KVIHNYFSTVVCIVILIH------FSIHSIFATSTSYSNPSIVMSSTLPDGNKVIIDDFREAYYWLKQNTKDEARIMSWWDYGYQITGMANRTTIVDNNTWNNSHIALVGKAMSMNETNAIKIIRLLDVDYVLVIFGGLIGFSGDDINKFLWMVRISEGEHPKEVYEYDYFTANGEYRIDKLAPKSMVDSLMYRLSYYRFGQIQIGKEFPTGYDRTRNAEIGLKYYKLKFFEEAFTSENWLVRIYKTKLRNFRISLKHARKKNKVFASQKRLRKMKGALKFPRIITRGIKKNSYPF 2270
            DPWFNYRST  L   GFY+FLNWFDE++WYPLGRIVGGT++PGLM+T+GL + +L  +++ + IR+VCV LAP +S  T I +FLLT+E+WN  +GL+  C +AIVPGYISRS +GS+DNEGIAIFA+  T+Y W+K+ KTG+VFW++ C +SYFYMVSAWGGYV+ +NLI LHV +LLL Q+YS  +Y+A+S FY+ GL+ SMQIPFVGFQP+++ EH ++A  F +LQ Y ++  L D   K   +   ++G  +A  +  L +  LT    + PWSGRFYSLWD  YA I+IPII SVSEHQPT W S FFDL++L+C +PAG+WFC K +N+ER+F+ LYA++A YF+ +MVRL+L LTP V + S+I+F+ +  ++     K   P  E    E+      D +  G   +KA ++   +    K        +  IV ++       F++H  + TS +YS+PS+V++S   DG + I+DDFREAY+WL+QNT + AR+MSWWDYGYQI GMANRTT+VDNNTWNNSHIALVGKAMS NE+ A KI+R LDVDYVLVIFGG+IG+SGDDINKFLWMVRI+EGEHPK++ E DYFT  GE+R+DK    ++++ LMY++SYYRFG++Q+    P G+DRTRNAEIG K  K K  EEAFTSE+WLVRIYK K  + R +L H  +   +F  QK L K     K      RG  KN   F
Sbjct:  103 DPWFNYRSTHHLASHGFYEFLNWFDERAWYPLGRIVGGTVYPGLMITAGLIHWILNTLNITVHIRDVCVFLAPTFSGLTSISTFLLTRELWNQGAGLLAACFIAIVPGYISRSVAGSFDNEGIAIFALQFTYYLWVKSVKTGSVFWTMCCCLSYFYMVSAWGGYVFIINLIPLHVFVLLLMQRYSKRVYIAYSTFYIVGLILSMQIPFVGFQPIRTSEHMAAAGVFALLQAYAFLQYLRDRLTKQEFQTLFFLGVSLAAGAVFLSVIYLTYTGYIAPWSGRFYSLWDTGYAKIHIPIIASVSEHQPTTWVSFFFDLHILVCTFPAGLWFCIKNINDERVFVALYAISAVYFAGVMVRLMLTLTPVVCMLSAIAFSNVFEHYLGDDMKRENPPVEDSSDED------DKRNPGNLYDKAGKVRKHVTEQEKTEEGLGPNIKSIVTMLMLMLLMMFAVHCTWVTSNAYSSPSVVLASYNHDGTRNILDDFREAYFWLRQNTDEHARVMSWWDYGYQIAGMANRTTLVDNNTWNNSHIALVGKAMSSNESAAYKIMRSLDVDYVLVIFGGVIGYSGDDINKFLWMVRIAEGEHPKDIRESDYFTPQGEFRVDKAGSPTLLNCLMYKMSYYRFGEMQLDFRTPPGFDRTRNAEIGNKDIKFKHLEEAFTSEHWLVRIYKVKAPDNRETLDHKPRVTNIFPKQKYLSKKTTKRK------RGYIKNKLVF 815          
BLAST of dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B vs. UniProt/SwissProt
Match: sp|Q3TDQ1|STT3B_MOUSE (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Mus musculus OX=10090 GN=Stt3b PE=1 SV=2)

HSP 1 Score: 800.816 bits (2067), Expect = 0.000e+0
Identity = 390/725 (53.79%), Postives = 514/725 (70.90%), Query Frame = 3
Query:  135 DPWFNYRSTLELVERGFYKFLNWFDEKSWYPLGRIVGGTIFPGLMMTSGLFYNLLKQMSLHIEIRNVCVLLAPLYSCFTVIISFLLTKEIWNTNSGLICGCIMAIVPGYISRSSSGSYDNEGIAIFAMLLTFYFWIKATKTGTVFWSVLCSISYFYMVSAWGGYVYTLNLISLHVIILLLFQKYSNNLYVAFSVFYLFGLLFSMQIPFVGFQPLKSCEHASSACAFFVLQFYYYVIKLEDIKIKNGLKLYLYIG-PXXXXXXXXXXXXXTKLEILLPWSGRFYSLWDINYAAINIPIITSVSEHQPTAWQSTFFDLNVLMCFYPAGIWFCFKFLNNERIFLILYALTASYFSSIMVRLVLALTPAVAIGSSISFNMLLTYF----EKLHKPTKELDKTENFECVTIDSKGDGFCENKANEINYEIIH--KVIHNYFSTVVCIVILIH------FSIHSIFATSTSYSNPSIVMSSTLPDGNKVIIDDFREAYYWLKQNTKDEARIMSWWDYGYQITGMANRTTIVDNNTWNNSHIALVGKAMSMNETNAIKIIRLLDVDYVLVIFGGLIGFSGDDINKFLWMVRISEGEHPKEVYEYDYFTANGEYRIDKLAPKSMVDSLMYRLSYYRFGQIQIGKEFPTGYDRTRNAEIGLKYYKLKFFEEAFTSENWLVRIYKTKLRNFRISLKHARKKNKVFASQKRLRKMKGALKFPRIITRGIKKNSYPF 2270
            DPWFNYRST  L   GFY+FLNWFDE++WYPLGRIVGGT++PGLM+T+GL + +L  +++ + IR+VCV LAP +S  T I +FLLT+E+WN  +GL+  C +AIVPGYISRS +GS+DNEGIAIFA+  T+Y W+K+ KTG+VFW++ C +SYFYMVSAWGGYV+ +NLI LHV +LLL Q+YS  +Y+A+S FY+ GL+ SMQIPFVGFQP+++ EH ++A  F +LQ Y ++  L D   K   +   ++G  +A  +  L +  LT    + PWSGRFYSLWD  YA I+IPII SVSEHQPT W S FFDL++L+C +PAG+WFC K +N+ER+F+ LYA++A YF+ +MVRL+L LTP V + S+I+F+ +  ++     K   P  E    E+      D +  G   +KA ++   +    K        +  IV ++       F++H  + TS +YS+PS+V++S   DG + I+DDFREAY+WL+QNT + AR+MSWWDYGYQI GMANRTT+VDNNTWNNSHIALVGKAMS NET A KI+R LDVDYVLVIFGG+IG+SGDDINKFLWMVRI+EGEHPK++ E DYFT  GE+R+DK    ++++ LMY++SYYRFG++Q+    P G+DRTRNAEIG K  K K  EEAFTSE+WLVRIYK K  + R +L H  +   +   QK L K     K      RG  KN   F
Sbjct:  100 DPWFNYRSTHHLASHGFYEFLNWFDERAWYPLGRIVGGTVYPGLMITAGLIHWILNTLNITVHIRDVCVFLAPTFSGLTSISTFLLTRELWNQGAGLLAACFIAIVPGYISRSVAGSFDNEGIAIFALQFTYYLWVKSVKTGSVFWTMCCCLSYFYMVSAWGGYVFIINLIPLHVFVLLLMQRYSKRVYIAYSTFYIVGLILSMQIPFVGFQPIRTSEHMAAAGVFALLQAYAFLQYLRDRLTKQEFQTLFFLGVSLAAGAVFLSVIYLTYTGYIAPWSGRFYSLWDTGYAKIHIPIIASVSEHQPTTWVSFFFDLHILVCTFPAGLWFCIKNINDERVFVALYAISAVYFAGVMVRLMLTLTPVVCMLSAIAFSNVFEHYLGDDMKRENPPVEDSSDED------DKRNPGNLYDKAGKVRKHVTEQEKPEEGLGPNIKSIVTMLMLMLLMMFAVHCTWVTSNAYSSPSVVLASYNHDGTRNILDDFREAYFWLRQNTDEHARVMSWWDYGYQIAGMANRTTLVDNNTWNNSHIALVGKAMSSNETAAYKIMRSLDVDYVLVIFGGVIGYSGDDINKFLWMVRIAEGEHPKDIREGDYFTQQGEFRVDKAGSPTLLNCLMYKMSYYRFGEMQLDFRTPPGFDRTRNAEIGNKDIKFKHLEEAFTSEHWLVRIYKVKAPDNRETLGHKPRVTNIVPKQKYLSKKTTKRK------RGYVKNKLVF 812          
BLAST of dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B vs. UniProt/SwissProt
Match: sp|P46975|STT3_CAEEL (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit stt-3 OS=Caenorhabditis elegans OX=6239 GN=stt-3 PE=1 SV=1)

HSP 1 Score: 743.036 bits (1917), Expect = 0.000e+0
Identity = 349/705 (49.50%), Postives = 493/705 (69.93%), Query Frame = 3
Query:  135 DPWFNYRSTLELVERGFYKFLNWFDEKSWYPLGRIVGGTIFPGLMMTSGLFYNLLKQMSLHIEIRNVCVLLAPLYSCFTVIISFLLTKEIWNTNSGLICGCIMAIVPGYISRSSSGSYDNEGIAIFAMLLTFYFWIKATKTGTVFWSVLCSISYFYMVSAWGGYVYTLNLISLHVIILLLFQKYSNNLYVAFSVFYLFGLLFSMQIPFVGFQPLKSCEHASSACAFFVLQFYYYVIKLEDIKIKNGLKLYLYIGPXXXXXXXXXXXXXTKL--EILLPWSGRFYSLWDINYAAINIPIITSVSEHQPTAWQSTFFDLNVLMCFYPAGIWFCFKFLNNERIFLILYALTASYFSSIMVRLVLALTPAVAIGSSISFNMLLTYFEKLHKPTKELDKTENFECVTIDSK-----GDGFCENKANEINYEIIHKVIHNYFSTVVCIVILIHFSIHSIFATSTSYSNPSIVMSSTLPDGNKVIIDDFREAYYWLKQNTKDEARIMSWWDYGYQITGMANRTTIVDNNTWNNSHIALVGKAMSMNETNAIKIIRLLDVDYVLVIFGGLIGFSGDDINKFLWMVRISEGEHPKEVYEYDYFTANGEYRIDKLAPKSMVDSLMYRLSYYRFGQIQIGKEFPTGYDRTRNAEIGLKYYKLKFFEEAFTSENWLVRIYKTKLRNFRISLKHARKKNKVFASQKRLRKMKGALKFP 2228
            DPWFNYR+T  +V+ GFYKFLNWFDE++WYPLGRIVGGT++PGLM+TSGL + +L  ++ H+ IR VCV LAP +S  T I ++LLTKE+W+  +GL   C +AI PGY SRS +GSYDNEGIAIFA+  T+Y W+K+ KTG++ W+ LC++SYFYMVSAWGGYV+ +NLI LH + L++  +YS+ L+V+++ FY    + SMQ+PFVGFQP+++ EH  +   F +LQ    ++     +I     + L++G + ++    ++     +    + P+SGRFYSLWD  YA I+IPII SVSEHQPT W S FFDL++    +P G+W+C K +N+ER+F+ILYA++A YF+ +MVRL+L LTPAV + + I F+     FEK  K  +  +++ +    T D K             AN+ +   +   +    S ++ ++ L+ F +H+ + TS +YS+PS+V+ S+  +G+++I+DDFREAY+WL++NT D+AR+MSWWDYGYQI GMANRTT+VDNNTWNNSHIALVGKAMS NE+ A +I+  LDVDY+LVIFGG+IG+SGDDINKFLWMVRI++GEHPK++ E +YFT+ GEY     A ++M++ LMY++SYYRFG+ ++G     G+DRTR   IG K   L++ EEA+T+ENWLVRIYK K    R ++K       +   +    K K  +  P
Sbjct:   51 DPWFNYRATHHMVQHGFYKFLNWFDERAWYPLGRIVGGTVYPGLMVTSGLIHWILDSLNFHVHIREVCVFLAPTFSGLTAIATYLLTKELWSPGAGLFAACFIAISPGYTSRSVAGSYDNEGIAIFALQFTYYLWVKSLKTGSIMWASLCALSYFYMVSAWGGYVFIINLIPLHALALIIMGRYSSRLFVSYTSFYCLATILSMQVPFVGFQPVRTSEHMPAFGVFGLLQIVA-LMHYARNRITRQQFMTLFVGGLTILGALSVVVYFALVWGGYVAPFSGRFYSLWDTGYAKIHIPIIASVSEHQPTTWVSFFFDLHITAAVFPVGLWYCIKKVNDERVFIILYAVSAVYFAGVMVRLMLTLTPAVCVLAGIGFSYT---FEKYLKDEETKERSSSQSGTTKDEKLYDKAAKNVKSRNANDGDESGVSSNVRTIIS-IILVIFLLMFVVHATYVTSNAYSHPSVVLQSSTNNGDRIIMDDFREAYHWLRENTADDARVMSWWDYGYQIAGMANRTTLVDNNTWNNSHIALVGKAMSSNESAAYEIMTELDVDYILVIFGGVIGYSGDDINKFLWMVRIAQGEHPKDIREENYFTSTGEYSTGAGASETMLNCLMYKMSYYRFGETRVGYNQAGGFDRTRGYVIGKKDITLEYIEEAYTTENWLVRIYKRKKLPNRPTVKSEEATIPIKGKKATQGKNKKGVIRP 750          
BLAST of dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B vs. UniProt/SwissProt
Match: sp|Q2KJI2|STT3A_BOVIN (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A OS=Bos taurus OX=9913 GN=STT3A PE=2 SV=1)

HSP 1 Score: 674.085 bits (1738), Expect = 0.000e+0
Identity = 335/669 (50.07%), Postives = 465/669 (69.51%), Query Frame = 3
Query:  135 DPWFNYRSTLELVERGFYKFLNWFDEKSWYPLGRIVGGTIFPGLMMTSGLFYNLLKQMSLHIEIRNVCVLLAPLYSCFTVIISFLLTKEIWNTNSGLICGCIMAIVPGYISRSSSGSYDNEGIAIFAMLLTFYFWIKATKTGTVFWSVLCSISYFYMVSAWGGYVYTLNLISLHVIILLLFQKYSNNLYVAFSVFYLFGLLFSMQIPFVGFQPLKSCEHASSACAFFVLQFYYYV----IKLEDIKIKNGLKLYLYIGPXXXXXXXXXXXXXTKLEILLPWSGRFYSLWDINYAAINIPIITSVSEHQPTAWQSTFFDLNVLMCFYPAGIWFCFKFLNNERIFLILYALTASYFSSIMVRLVLALTPAVAIGSSISFNMLLTYFEKLHKPTKELDKTENFECVTIDSKGDGFCENKANEINYEIIHKVIHNYFSTVVCIVILIHFSIHSIFATSTSYSNPSIVMSSTLPDGNKVIIDDFREAYYWLKQNTKDEARIMSWWDYGYQITGMANRTTIVDNNTWNNSHIALVGKAMSMNETNAIKIIRLLDVDYVLVIFGGLIGFSGDDINKFLWMVRI-SEGEHPKEVYEYDYFTANGEYRIDKLAPKSMVDSLMYRLSYYRFGQIQIGKEFPTGYDRTRNAEIGLKYYKLKFFEEAFTSENWLVRIYKTK 2126
            DP+FNYR+T  L E GFYKF NWFD+++WYPLGRI+GGTI+PGLM+TS   Y++L    + I+IRNVCV LAPL+S FT I+++ LTKE+ +  +GL+   ++A+VPGYISRS +GSYDNEGIAIF MLLT+Y WIKA KTG+++W+  C+++YFYMVS+WGGYV+ +NLI LHV++L+L  ++S+ +YVA+   Y  G + SMQI FVGFQP+ S EH ++   F + Q + +V     KL   + +   +  + +    L++   ++ L  K+    PW+GRFYSL D +YA  NIPII SVSEHQPT W S +FDL +L+  +P G+++CF  L++ RIF+I+Y +T+ YFS++MVRL+L L P + I S I  + +L+ + K            N +    D K       K  +  Y I ++V       +V    LI ++ HS + TS +YS+PSIV+S+   DG+++I DDFREAYYWL+ NT ++A++MSWWDYGYQIT MANRT +VDNNTWNN+HI+ VG+AM+  E  A +I+R LDV YVLVIFGGL G+S DDINKFLWMVRI    +  K + E+DY+T  GE+R+D+     +++ LMY++ YYRFGQ+    + P GYDR RNAEIG K ++L   EEA+T+E+WLVRIYK K
Sbjct:   49 DPYFNYRTTRFLAEEGFYKFHNWFDDRAWYPLGRIIGGTIYPGLMITSAAIYHVLHFFHITIDIRNVCVFLAPLFSSFTTIVTYHLTKELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSIYWAAKCALAYFYMVSSWGGYVFLINLIPLHVLVLMLTGRFSHRIYVAYCTVYCLGTILSMQISFVGFQPVLSSEHMAAFGVFGLCQIHAFVDYLRSKLNPQQFEVLFRSVISLVGFVLLTIGALLMLTGKIS---PWTGRFYSLLDPSYAKNNIPIIASVSEHQPTTWSSYYFDLQLLVFMFPVGLYYCFSNLSDARIFIIMYGVTSMYFSAVMVRLMLVLAPVMCILSGIGVSQVLSTYMK------------NLDISRQDKK-----SKKQQDSTYPIKNEVASGMI--LVMAFFLITYTFHSTWVTSEAYSSPSIVLSARGGDGSRIIFDDFREAYYWLRHNTPEDAKVMSWWDYGYQITAMANRTILVDNNTWNNTHISRVGQAMASTEEKAYEIMRELDVSYVLVIFGGLTGYSSDDINKFLWMVRIGGSTDTGKHIKEHDYYTPTGEFRVDREGSPVLLNCLMYKMCYYRFGQVYTEAKRPLGYDRVRNAEIGNKDFELDVLEEAYTTEHWLVRIYKVK 695          
BLAST of dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B vs. TrEMBL
Match: K9IN16 (Putative dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit stt3b OS=Desmodus rotundus OX=9430 PE=2 SV=1)

HSP 1 Score: 807.364 bits (2084), Expect = 0.000e+0
Identity = 388/724 (53.59%), Postives = 519/724 (71.69%), Query Frame = 3
Query:  135 DPWFNYRSTLELVERGFYKFLNWFDEKSWYPLGRIVGGTIFPGLMMTSGLFYNLLKQMSLHIEIRNVCVLLAPLYSCFTVIISFLLTKEIWNTNSGLICGCIMAIVPGYISRSSSGSYDNEGIAIFAMLLTFYFWIKATKTGTVFWSVLCSISYFYMVSAWGGYVYTLNLISLHVIILLLFQKYSNNLYVAFSVFYLFGLLFSMQIPFVGFQPLKSCEHASSACAFFVLQFYYYVIKLEDIKIKNGLKLYLYIG-PXXXXXXXXXXXXXTKLEILLPWSGRFYSLWDINYAAINIPIITSVSEHQPTAWQSTFFDLNVLMCFYPAGIWFCFKFLNNERIFLILYALTASYFSSIMVRLVLALTPAVAIGSSISFNMLLTYF----EKLHKPTKELDKTENFECVTIDSKGDGFCENKANEINYEIIH--KVIHNYFSTVVCIVILIH------FSIHSIFATSTSYSNPSIVMSSTLPDGNKVIIDDFREAYYWLKQNTKDEARIMSWWDYGYQITGMANRTTIVDNNTWNNSHIALVGKAMSMNETNAIKIIRLLDVDYVLVIFGGLIGFSGDDINKFLWMVRISEGEHPKEVYEYDYFTANGEYRIDKLAPKSMVDSLMYRLSYYRFGQIQIGKEFPTGYDRTRNAEIGLKYYKLKFFEEAFTSENWLVRIYKTKLRNFRISLKHARKKNKVFASQKRL-----RKMKGALKFPRIITRGIK 2252
            DPWFNYRST  L   GFY+FLNWFDE++WYPLGRIVGGT++PGLM+T+GL + +L  +++ + IR+VCV LAP +S  T I +FLLT+E+WN  +GL+  C +AIVPGYISRS +GS+DNEGIAIFA+  T+Y W+K+ KTG+VFW+V C +SYFYMVSAWGGYV+ +NLI LHV +LLL Q+YS  +Y+A+S FY+ GL+ SMQIPFVGFQP+++ EH ++A  F +LQ Y ++  L D   K   +   ++G  +A  +  L +  LT    + PWSGRFYSLWD  YA I+IPII SVSEHQPT W S FFDL++L+C +PAG+WFC K +N+ER+F+ LYA++A YF+ +MVRL+L LTP V + S+I+F+ +  ++     K   P  E    E+      D +  G   +KA ++   +    K        +  IV ++       F++H  + TS +YS+PS+V++S   DG + I+DDFREAY+WL+QNT + AR+MSWWDYGYQI GMANRTT+VDNNTWNNSHIALVGKAMS NET A KI+R LDVDYVLVIFGG+IG+SGDDINKFLWMVRI+EGEHPK++ E DYFT  GE+R+DK    ++++ LMY++SYYRFG++Q+    P G+DRTRNAEIG K  K K  EEAFTSE+WLVRIYK K  + R +L H  +   +F  QK L     ++ +G +K   ++ +G +
Sbjct:  103 DPWFNYRSTHHLASHGFYEFLNWFDERAWYPLGRIVGGTVYPGLMITAGLIHWILNTLNITVHIRDVCVFLAPTFSGLTSISTFLLTRELWNQGAGLLAACFIAIVPGYISRSVAGSFDNEGIAIFALQFTYYLWVKSVKTGSVFWTVCCCLSYFYMVSAWGGYVFIINLIPLHVFVLLLMQRYSKRVYIAYSTFYIVGLILSMQIPFVGFQPIRTSEHMAAAGVFALLQAYAFLQYLRDRLTKQEFQTLFFLGVSVAAGAVFLSVIYLTYTGYIAPWSGRFYSLWDTGYAKIHIPIIASVSEHQPTTWVSFFFDLHILVCTFPAGLWFCIKNINDERVFVALYAISAVYFAGVMVRLMLTLTPVVCMLSAIAFSNVFEHYLGDDMKRENPPVEDSSDED------DKRNPGNLYDKAGKVRKHVTEQEKTEEGLGPNIKSIVTMLMLMLLMMFAVHCTWVTSNAYSSPSVVLASYNHDGTRNILDDFREAYFWLRQNTDEHARVMSWWDYGYQIAGMANRTTLVDNNTWNNSHIALVGKAMSSNETAAYKIMRSLDVDYVLVIFGGVIGYSGDDINKFLWMVRIAEGEHPKDIRESDYFTPQGEFRVDKAGSPTLLNCLMYKMSYYRFGEMQLDFRTPPGFDRTRNAEIGNKDIKFKHLEEAFTSEHWLVRIYKVKAPDNRETLDHKPRVTNIFPKQKYLSKKTTKRKRGYIKNKLVLKKGKR 820          
BLAST of dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B vs. TrEMBL
Match: A0A3P9LK95 (STT3 oligosaccharyltransferase complex catalytic subunit B OS=Oryzias latipes OX=8090 PE=4 SV=1)

HSP 1 Score: 806.594 bits (2082), Expect = 0.000e+0
Identity = 384/726 (52.89%), Postives = 523/726 (72.04%), Query Frame = 3
Query:  135 DPWFNYRSTLELVERGFYKFLNWFDEKSWYPLGRIVGGTIFPGLMMTSGLFYNLLKQMSLHIEIRNVCVLLAPLYSCFTVIISFLLTKEIWNTNSGLICGCIMAIVPGYISRSSSGSYDNEGIAIFAMLLTFYFWIKATKTGTVFWSVLCSISYFYMVSAWGGYVYTLNLISLHVIILLLFQKYSNNLYVAFSVFYLFGLLFSMQIPFVGFQPLKSCEHASSACAFFVLQFYYYVIKLEDIKIKNGLKLYLYIG-PXXXXXXXXXXXXXTKLEILLPWSGRFYSLWDINYAAINIPIITSVSEHQPTAWQSTFFDLNVLMCFYPAGIWFCFKFLNNERIFLILYALTASYFSSIMVRLVLALTPAVAIGSSISFNMLLTYF----EKLHKPTKELDKTENFECVTIDSKGDGFCENKANEINYEIIHKVIHNYFSTVVCIVILIH------FSIHSIFATSTSYSNPSIVMSSTLPDGNKVIIDDFREAYYWLKQNTKDEARIMSWWDYGYQITGMANRTTIVDNNTWNNSHIALVGKAMSMNETNAIKIIRLLDVDYVLVIFGGLIGFSGDDINKFLWMVRISEGEHPKEVYEYDYFTANGEYRIDKLAPKSMVDSLMYRLSYYRFGQIQIGKEFPTGYDRTRNAEIGLKYYKLKFFEEAFTSENWLVRIYKTK-------LRNFRISLKHARKKNKVFASQKRLRKMKGALKFPRIITRGIKKN 2258
            DPWFNYRST  L   GFY+FLNWFDE++WYPLGRIVGGT++PGLM+T+GL + +L  + + + IR+VCV LAP++S  T I +FLLT+E+WN  +GL+  C +AIVPGYISRS +GS+DNEGIAIFA+  T+Y W+K+ KTG++FW++ C +SYFYMVSAWGGYV+ +NLI LHV +LLL Q++S  +Y+A+S FY+ GL+ SMQIPFVGFQP+++ EH ++A  F +LQ Y ++  L+D   +   +   ++G  +A     L +  LT    + PWSGRFYSLWD  YA I+IPII SVSEHQPT W S FFDL++L+C +PAG+WFC K +N+ER+F+ LYA++A YF+ +MVRL+L LTP V + S+++F+ +  ++     K   P  E    E+      D K  G   +KA ++   +  +        +  IV ++       F++H  + TS +YS+PS+V++S   DG++ I+DDFREAYYWL+QNT + AR+MSWWDYGYQI GMANRTT+VDNNTWNNSHIALVGKAMS NE+ A KI+R LDVDYVL+IFGG+IG+SGDDINKFLWMVRI+EGEHPK++ E DYFT  GE+R+DK    ++++ LMY++SYYRFG++Q+    P G+DRTRNAEIG K  KLK  EEAFTSE+WLVRIYK K       + N   S+  +R+K   F S+K  ++ +G +K   ++ +G  K+
Sbjct:   89 DPWFNYRSTHHLTTNGFYEFLNWFDERAWYPLGRIVGGTVYPGLMLTAGLIHYVLNLLHITVHIRDVCVFLAPVFSGLTSISTFLLTRELWNQGAGLLAACFIAIVPGYISRSVAGSFDNEGIAIFALQFTYYLWVKSVKTGSIFWAIGCCLSYFYMVSAWGGYVFIINLIPLHVFVLLLMQRFSKRVYIAYSTFYIIGLILSMQIPFVGFQPIRTSEHMAAAGVFVLLQVYAFLQYLKDRLTRQEFQTLFFLGVSLAAGVVFLSVIYLTYTGYIAPWSGRFYSLWDTGYAKIHIPIIASVSEHQPTTWVSFFFDLHILVCTFPAGLWFCIKSINDERVFVALYAISAVYFAGVMVRLMLTLTPVVCMLSAVAFSSVFEHYLGDDAKRQSPPAEDSSDED------DRKNPGNLYDKAGKVRKHVSEQAEDGLGPNIKSIVTMLMLMLLMMFAVHCTWVTSNAYSSPSVVLASYNHDGSRNILDDFREAYYWLRQNTDEHARVMSWWDYGYQIAGMANRTTLVDNNTWNNSHIALVGKAMSSNESAAYKIMRSLDVDYVLIIFGGVIGYSGDDINKFLWMVRIAEGEHPKDIRESDYFTPQGEFRVDKAGSPTLLNCLMYKMSYYRFGEMQLDFRTPPGFDRTRNAEIGNKDIKLKHLEEAFTSEHWLVRIYKVKELENRDRMENRLRSMDSSRQK---FTSKKTAKRKRGYVKNKLVLRKGKTKS 805          
BLAST of dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B vs. TrEMBL
Match: A0A3B4ZUH3 (STT3 oligosaccharyltransferase complex catalytic subunit B OS=Stegastes partitus OX=144197 GN=STT3B (1 of many) PE=4 SV=1)

HSP 1 Score: 806.209 bits (2081), Expect = 0.000e+0
Identity = 401/755 (53.11%), Postives = 542/755 (71.79%), Query Frame = 3
Query:   36 NLFPLVIIILSCVXXXXXXXXXXXXXXXXXXXXDPWFNYRSTLELVERGFYKFLNWFDEKSWYPLGRIVGGTIFPGLMMTSGLFYNLLKQMSLHIEIRNVCVLLAPLYSCFTVIISFLLTKEIWNTNSGLICGCIMAIVPGYISRSSSGSYDNEGIAIFAMLLTFYFWIKATKTGTVFWSVLCSISYFYMVSAWGGYVYTLNLISLHVIILLLFQKYSNNLYVAFSVFYLFGLLFSMQIPFVGFQPLKSCEHASSACAFFVLQFYYYVIKLEDIKIKNGLKLYLYIG-PXXXXXXXXXXXXXTKLEILLPWSGRFYSLWDINYAAINIPIITSVSEHQPTAWQSTFFDLNVLMCFYPAGIWFCFKFLNNERIFLILYALTASYFSSIMVRLVLALTPAVAIGSSISFNMLLTYF----EKLHKPTKELDKTENFECVTIDSKGDGFCENKANEINYEIIH--KVIHNYFSTVVCIVILIH------FSIHSIFATSTSYSNPSIVMSSTLPDGNKVIIDDFREAYYWLKQNTKDEARIMSWWDYGYQITGMANRTTIVDNNTWNNSHIALVGKAMSMNETNAIKIIRLLDVDYVLVIFGGLIGFSGDDINKFLWMVRISEGEHPKEVYEYDYFTANGEYRIDKLAPKSMVDSLMYRLSYYRFGQIQIGKEFPTGYDRTRNAEIGLKYYKLKFFEEAFTSENWLVRIYKTKLRNFRISLKHARKK---NKVFASQKRLRKMKGALKFPRIITRGIK 2252
            +L    I+ L+C+  F  RLF++I FESIIHEFDPWFNYRST  L   GFY+FLNWFDE++WYPLGRIVGGT++PGLM+T+GL + +L  + + + IR+VCV LAP++S  T I +FLLT+E+WN  +GL+  C +AIVPGYISRS +GS+DNEGIAIFA+  T+Y W+K+ KTG+VFW++ C +SYFYMVSAWGGYV+ +NLI LHV +LLL Q+YS  +Y+A+S FY+ GL+ SMQIPFVGFQP+++ EH ++A  F +LQ Y ++  L+D   +   +   ++G  +A     L +  LT    + PWSGRFYSLWD  YA I+IPII SVSEHQPT W S FFDL++L+C +PAG+WFC K +N+ER+F+ LYA++A YF+ +MVRL+L LTP V + S+++F+ +  ++     K  KP  E    E+      D +  G   +KA ++   +    K        +  IV ++       F++H  + TS +YS+PS+V++S   DG + I+DDFREAYYWL+QNT + AR+MSWWDYGYQI GMANRTT+VDNNTWNNSHIALVGKAMS NE+ A KI+R LDVDYVL+IFGG+IG+SGDDINKFLWMVRI+EGEHPK++ E DYFT  GE+R+DK    ++++ LMY++SYYRFG++Q+    P G+DRTRNAEIG K  K K  EEAFTSE+WLVRIYK K  + R  L H  +     + + S+K  ++ +G +K   ++ +G K
Sbjct:   55 SLLSFSILFLACLAGFSSRLFAVIRFESIIHEFDPWFNYRSTHHLTTNGFYEFLNWFDERAWYPLGRIVGGTVYPGLMVTAGLIHYVLNLLHITVHIRDVCVFLAPVFSGLTAISTFLLTRELWNQGAGLLAACFIAIVPGYISRSVAGSFDNEGIAIFALQFTYYLWVKSVKTGSVFWTIGCCLSYFYMVSAWGGYVFIINLIPLHVFVLLLMQRYSRRVYIAYSTFYIVGLILSMQIPFVGFQPIRTSEHMAAAGVFALLQAYAFLQYLKDRLTRQEFQTLFFLGVSLAACVVFLTVIYLTYTGYIAPWSGRFYSLWDTGYAKIHIPIIASVSEHQPTTWVSFFFDLHILVCTFPAGLWFCIKNINDERVFVALYAISAVYFAGVMVRLMLTLTPVVCMLSAVAFSSVFEHYMGDDTKREKPPAEDSSDED------DKRNSGNLYDKAGKVRKHVSEQEKAEEGLGPNIKSIVTMLMLMLLMMFAVHCTWVTSNAYSSPSVVLASYNHDGTRNILDDFREAYYWLRQNTDEHARVMSWWDYGYQIAGMANRTTLVDNNTWNNSHIALVGKAMSSNESAAYKIMRSLDVDYVLIIFGGVIGYSGDDINKFLWMVRIAEGEHPKDIRESDYFTPQGEFRVDKAGSPTLLNCLMYKMSYYRFGEMQLDFRTPPGFDRTRNAEIGNKDIKFKHLEEAFTSEHWLVRIYKVKNLDNREPLDHKLRSVVPKQKYTSKKTAKRKRGHIKNKLVLKKGRK 803          
BLAST of dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B vs. TrEMBL
Match: G1QVW3 (STT3 oligosaccharyltransferase complex catalytic subunit B OS=Nomascus leucogenys OX=61853 GN=STT3B PE=4 SV=2)

HSP 1 Score: 806.209 bits (2081), Expect = 0.000e+0
Identity = 388/718 (54.04%), Postives = 520/718 (72.42%), Query Frame = 3
Query:  135 DPWFNYRSTLELVERGFYKFLNWFDEKSWYPLGRIVGGTIFPGLMMTSGLFYNLLKQMSLHIEIRNVCVLLAPLYSCFTVIISFLLTKEIWNTNSGLICGCIMAIVPGYISRSSSGSYDNEGIAIFAMLLTFYFWIKATKTGTVFWSVLCSISYFYMVSAWGGYVYTLNLISLHVIILLLFQKYSNNLYVAFSVFYLFGLLFSMQIPFVGFQPLKSCEHASSACAFFVLQFYYYVIKLEDIKIKNGLKLYLYIG-PXXXXXXXXXXXXXTKLEILLPWSGRFYSLWDINYAAINIPIITSVSEHQPTAWQSTFFDLNVLMCFYPAGIWFCFKFLNNERIFLILYALTASYFSSIMVRLVLALTPAVAIGSSISFNMLLTYF-----EKLHKPTKELDKTENFECVTIDSKGDGFCENKANEINYEIIHKVIHNYFSTVVCIVILIHFSIHSIFATSTSYSNPSIVMSSTLPDGNKVIIDDFREAYYWLKQNTKDEARIMSWWDYGYQITGMANRTTIVDNNTWNNSHIALVGKAMSMNETNAIKIIRLLDVDYVLVIFGGLIGFSGDDINKFLWMVRISEGEHPKEVYEYDYFTANGEYRIDKLAPKSMVDSLMYRLSYYRFGQIQIGKEFPTGYDRTRNAEIGLKYYKLKFFEEAFTSENWLVRIYKTKLRNFRISLKHARKKNKVFASQKRLRKMKGALKFPRIITRGIKKNSYPF 2270
            DPWFNYRST  L   GFY+FLNWFDE++WYPLGRIVGGT++PGLM+T+GL + +L  +++ + IR+VCV LAP +S  T I +FLLT+E+WN  +GL+  C +AIVPGYISRS +GS+DNEGIAIFA+  T+Y W+K+ KTG+VFW++ C +SYFYMVSAWGGYV+ +NLI LHV +LLL Q+YS  +Y+A+S FY+ GL+ SMQIPFVGFQP+++ EH ++A  F +LQ Y ++  L D   K   +   ++G  +A  +  L +  LT    + PWSGRFYSLWD  YA I+IPII SVSEHQPT W S FFDL++L+C +PAG+WFC K +N+ER+F+ LYA++A YF+ +MVRL+L LTP V + S+I+F+ +  ++     ++ + P ++    ++ E   +  K     + K  E     I  ++     T++ +++L+ F++H  + TS +YS+PS+V++S   DG + I+DDFREAY+WL+QNT + AR+MSWWDYGYQI GMANRTT+VDNNTWNNSHIALVGKAMS NET A KI+R LDVDYVLVIFGG+IG+SGDDINKFLWMVRI+EGEHPK++ E DYFT  GE+R+DK    ++++ LMY++SYYRFG++Q+    P G+DRTRNAEIG K  K K  EEAFTSE+WLVRIYK K  + R +L H  +   +F  QK L K     K      RG  KN   F
Sbjct:  103 DPWFNYRSTHHLASHGFYEFLNWFDERAWYPLGRIVGGTVYPGLMITAGLIHWILNTLNITVHIRDVCVFLAPTFSGLTSISTFLLTRELWNQGAGLLAACFIAIVPGYISRSVAGSFDNEGIAIFALQFTYYLWVKSVKTGSVFWTMCCCLSYFYMVSAWGGYVFIINLIPLHVFVLLLMQRYSKRVYIAYSTFYIVGLILSMQIPFVGFQPIRTSEHMAAAGVFALLQAYAFLQYLRDRLTKQEFQTLFFLGVSLAAGAVFLSVIYLTYTGYIAPWSGRFYSLWDTGYAKIHIPIIASVSEHQPTTWVSFFFDLHILVCTFPAGLWFCIKNINDERVFVALYAISAVYFAGVMVRLMLTLTPVVCMLSAIAFSNVFEHYLGDDMKRENPPVEDSSDEDDKEPRNLYDKKHATEQEKTEEGLGPNIKSIV-----TMLMLMLLMMFAVHCTWVTSNAYSSPSVVLASYNHDGTRNILDDFREAYFWLRQNTDEHARVMSWWDYGYQIAGMANRTTLVDNNTWNNSHIALVGKAMSSNETAAYKIMRTLDVDYVLVIFGGVIGYSGDDINKFLWMVRIAEGEHPKDIRESDYFTPQGEFRVDKAGSPTLLNCLMYKMSYYRFGEMQLDFRTPPGFDRTRNAEIGNKDIKFKHLEEAFTSEHWLVRIYKVKAPDNRETLDHKPRVTNIFPKQKYLSKKTTKRK------RGYIKNKLVF 809          
BLAST of dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B vs. TrEMBL
Match: A0A3Q3KQD0 (STT3 oligosaccharyltransferase complex catalytic subunit B OS=Mastacembelus armatus OX=205130 GN=STT3B (1 of many) PE=4 SV=1)

HSP 1 Score: 805.823 bits (2080), Expect = 0.000e+0
Identity = 401/755 (53.11%), Postives = 542/755 (71.79%), Query Frame = 3
Query:   36 NLFPLVIIILSCVXXXXXXXXXXXXXXXXXXXXDPWFNYRSTLELVERGFYKFLNWFDEKSWYPLGRIVGGTIFPGLMMTSGLFYNLLKQMSLHIEIRNVCVLLAPLYSCFTVIISFLLTKEIWNTNSGLICGCIMAIVPGYISRSSSGSYDNEGIAIFAMLLTFYFWIKATKTGTVFWSVLCSISYFYMVSAWGGYVYTLNLISLHVIILLLFQKYSNNLYVAFSVFYLFGLLFSMQIPFVGFQPLKSCEHASSACAFFVLQFYYYVIKLEDIKIKNGLKLYLYIG-PXXXXXXXXXXXXXTKLEILLPWSGRFYSLWDINYAAINIPIITSVSEHQPTAWQSTFFDLNVLMCFYPAGIWFCFKFLNNERIFLILYALTASYFSSIMVRLVLALTPAVAIGSSISFNMLLTYF----EKLHKPTKELDKTENFECVTIDSKGDGFCENKANEINYEIIH--KVIHNYFSTVVCIVILIH------FSIHSIFATSTSYSNPSIVMSSTLPDGNKVIIDDFREAYYWLKQNTKDEARIMSWWDYGYQITGMANRTTIVDNNTWNNSHIALVGKAMSMNETNAIKIIRLLDVDYVLVIFGGLIGFSGDDINKFLWMVRISEGEHPKEVYEYDYFTANGEYRIDKLAPKSMVDSLMYRLSYYRFGQIQIGKEFPTGYDRTRNAEIGLKYYKLKFFEEAFTSENWLVRIYKTKLRNFRISLKHARKK---NKVFASQKRLRKMKGALKFPRIITRGIK 2252
            +L    I+ L+C+  F  RLF++I FESIIHEFDPWFNYRST  L   GFY+FLNWFDE++WYPLGRIVGGT++PGLM+T+GL + +L  + + + IR+VCV LAP++S  T I +FLLT+E+WN  +GL+  C +AIVPGYISRS +GS+DNEGIAIFA+  T+Y W+K+ KTG+VFW++ C +SYFYMVSAWGGYV+ +NLI LHV +LLL Q+YS  +Y+A+S FY+ GL+ SMQIPFVGFQP+++ EH ++A  F +LQ Y ++  L+D   +   +   ++G  +A     L +  LT    + PWSGRFYSLWD  YA I+IPII SVSEHQPT W S FFDL++L+C +PAG+WFC K +N+ER+F+ LYA++A YF+ +MVRL+L LTP V + S+++F+ +  ++     K  KP  E    E+      D +  G   +KA ++   +    K        +  IV ++       F++H  + TS +YS+PS+V++S   DG + I+DDFREAYYWL+QNT + AR+MSWWDYGYQI GMANRTT+VDNNTWNNSHIALVGKAMS NE+ A KI+R LDVDYVL+IFGG+IG+SGDDINKFLWMVRI+EGEHPK++ E DYFT  GE+R+DK    ++++ LMY++SYYRFG++Q+    P G+DRTRNAEIG K  K K  EEAFTSE+WLVRIYK K  + R  L H  +     + + S+K  ++ +G +K   ++ +G K
Sbjct:   52 SLLSFCILFLACLAGFSSRLFAVIRFESIIHEFDPWFNYRSTHHLTTNGFYEFLNWFDERAWYPLGRIVGGTVYPGLMVTAGLIHYVLNLLHITVHIRDVCVFLAPVFSGLTAISTFLLTRELWNQGAGLLAACFIAIVPGYISRSVAGSFDNEGIAIFALQFTYYLWVKSVKTGSVFWTIGCCLSYFYMVSAWGGYVFIINLIPLHVFVLLLMQRYSRRVYIAYSTFYIVGLILSMQIPFVGFQPIRTSEHMAAAGVFALLQAYAFLQYLKDRLTRQEFQTLFFLGVSLAAGVVFLTVIYLTYTGYIAPWSGRFYSLWDTGYAKIHIPIIASVSEHQPTTWVSFFFDLHILVCTFPAGLWFCIKNINDERVFVALYAISAVYFAGVMVRLMLTLTPVVCMLSAVAFSSVFEHYMGDDTKREKPPAEDSSDED------DKRNSGNLYDKAGKVRKHVSEQEKAEEGLGPNIKSIVTMLMLMLLMMFAVHCTWVTSNAYSSPSVVLASYNHDGTRNILDDFREAYYWLRQNTDEHARVMSWWDYGYQIAGMANRTTLVDNNTWNNSHIALVGKAMSSNESAAYKIMRSLDVDYVLIIFGGVIGYSGDDINKFLWMVRIAEGEHPKDIRESDYFTPQGEFRVDKAGSPTLLNCLMYKMSYYRFGEMQLDFRTPPGFDRTRNAEIGNKDIKFKHLEEAFTSEHWLVRIYKVKNLDNREPLGHKLRSVVPKQKYTSKKTAKRKRGHIKNKLVLRKGKK 800          
BLAST of dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B vs. Ensembl Cavefish
Match: stt3b (dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B [Source:NCBI gene;Acc:103035958])

HSP 1 Score: 797.349 bits (2058), Expect = 0.000e+0
Identity = 382/709 (53.88%), Postives = 519/709 (73.20%), Query Frame = 3
Query:  135 DPWFNYRSTLELVERGFYKFLNWFDEKSWYPLGRIVGGTIFPGLMMTSGLFYNLLKQMSLHIEIRNVCVLLAPLYSCFTVIISFLLTKEIWNTNSGLICGCIMAIVPGYISRSSSGSYDNEGIAIFAMLLTFYFWIKATKTGTVFWSVLCSISYFYMVSAWGGYVYTLNLISLHVIILLLFQKYSNNLYVAFSVFYLFGLLFSMQIPFVGFQPLKSCEHASSACAFFVLQFYYYVIKLEDIKIKNGLKLYLYIG-PXXXXXXXXXXXXXTKLEILLPWSGRFYSLWDINYAAINIPIITSVSEHQPTAWQSTFFDLNVLMCFYPAGIWFCFKFLNNERIFLILYALTASYFSSIMVRLVLALTPAVAIGSSISFNMLLTYF----EKLHKPTKELDKTENFECVTIDSKGDGFCENKANEINYEIIHK------VIHNYFS--TVVCIVILIHFSIHSIFATSTSYSNPSIVMSSTLPDGNKVIIDDFREAYYWLKQNTKDEARIMSWWDYGYQITGMANRTTIVDNNTWNNSHIALVGKAMSMNETNAIKIIRLLDVDYVLVIFGGLIGFSGDDINKFLWMVRISEGEHPKEVYEYDYFTANGEYRIDKLAPKSMVDSLMYRLSYYRFGQIQIGKEFPTGYDRTRNAEIGLKYYKLKFFEEAFTSENWLVRIYKTKLRNFRISLKHARKK---NKVFASQKRLRKMKG 2213
            DPWFNYRST  L   GFY+FLNWFDE++WYPLGRIVGGT++PGLM+T+GL + LL  + + + IR+VCV LAP++S  T I +FLLT+E+WN  +GL+  C +AIVPGYISRS +GS+DNEGIAIFA+  T+Y W+K+ KTG+VFW++ C +SYFYMVSAWGGYV+ +NLI LHV  LLL Q+YS  LY+A+S FY+ GL+ SMQIPFVGFQP+++ EH ++A  F +LQ Y ++  L+D   K   +   ++G  +A     L +  LT    + PWSGRFYSLWD  YA I+IPII SVSEHQPT W S FFDL++L+C +PAG+WFC K +N+ER+F+ LYA++A YF+ +MVRL+L LTP V + S+I+F+ +  ++     K   P  E    E+      D +  G   +KA ++   +  +      +  N  S  T++ +++L+ F++H  + TS +YS+PS+V++S   DG++ I+DDFREAYYWL+QNT + AR+MSWWDYGYQI GMANRTT+VDNNTWNNSHIALVGKAMS NE+ A +I++ LDVDYVL+IFGG+IG+SGDDINKFLWMVRI+EGEHPK++ E DYFT  GE+R+DK    ++++ LMY++SYYRFG++Q+    P G+DRTRNAEIG K  +LK  EEAFTSE+WLVRIY+ K +  R +L H  +     + + S+K  ++ +G
Sbjct:   86 DPWFNYRSTHHLSTNGFYEFLNWFDERAWYPLGRIVGGTVYPGLMVTAGLIHYLLNLLHVTVHIRDVCVFLAPIFSGLTAISTFLLTRELWNQGAGLLAACFIAIVPGYISRSVAGSFDNEGIAIFALQFTYYLWVKSVKTGSVFWTIGCCLSYFYMVSAWGGYVFIINLIPLHVFALLLMQRYSRRLYIAYSTFYIVGLVLSMQIPFVGFQPIRTSEHMAAAGVFALLQAYAFLQYLKDRLTKQEFQTLFFLGVSLAAGVVFLTVIYLTYTGYIAPWSGRFYSLWDTGYAKIHIPIIASVSEHQPTTWVSFFFDLHILVCTFPAGLWFCIKNINDERVFVALYAISAVYFAGVMVRLMLTLTPVVCMLSAIAFSSVFEHYLGDDMKRENPPAEDSSDED------DKRNSGNLYDKAGKVRKHVSEQDRPEEGLGPNIKSIVTMLMLMLLMMFAVHCTWVTSNAYSSPSVVLASYNHDGSRNILDDFREAYYWLRQNTDEHARVMSWWDYGYQIAGMANRTTLVDNNTWNNSHIALVGKAMSSNESAAYEIMKSLDVDYVLIIFGGVIGYSGDDINKFLWMVRIAEGEHPKDIRESDYFTPQGEFRVDKAGSPTLLNCLMYKMSYYRFGEMQLDFRTPPGFDRTRNAEIGNKDIRLKHLEEAFTSEHWLVRIYRVKKQENRQALDHKLRNVAAKQKYTSKKTAKRKRG 788          
BLAST of dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B vs. Ensembl Cavefish
Match: ENSAMXT00000021004.2 (dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B-like [Source:NCBI gene;Acc:103022397])

HSP 1 Score: 787.334 bits (2032), Expect = 0.000e+0
Identity = 380/718 (52.92%), Postives = 513/718 (71.45%), Query Frame = 3
Query:  135 DPWFNYRSTLELVERGFYKFLNWFDEKSWYPLGRIVGGTIFPGLMMTSGLFYNLLKQMSLHIEIRNVCVLLAPLYSCFTVIISFLLTKEIWNTNSGLICGCIMAIVPGYISRSSSGSYDNEGIAIFAMLLTFYFWIKATKTGTVFWSVLCSISYFYMVSAWGGYVYTLNLISLHVIILLLFQKYSNNLYVAFSVFYLFGLLFSMQIPFVGFQPLKSCEHASSACAFFVLQFYYYVIKLEDIKIKNGLKLYLYIG-PXXXXXXXXXXXXXTKLEILLPWSGRFYSLWDINYAAINIPIITSVSEHQPTAWQSTFFDLNVLMCFYPAGIWFCFKFLNNERIFLILYALTASYFSSIMVRLVLALTPAVAIGSSISFNMLLTYFEK-LHKPTKELDKTENFECVTIDSKGDGFCENKANEINYEII--HKVIHNYFSTVVCIVILIH------FSIHSIFATSTSYSNPSIVMSSTLPDGNKVIIDDFREAYYWLKQNTKDEARIMSWWDYGYQITGMANRTTIVDNNTWNNSHIALVGKAMSMNETNAIKIIRLLDVDYVLVIFGGLIGFSGDDINKFLWMVRISEGEHPKEVYEYDYFTANGEYRIDKLAPKSMVDSLMYRLSYYRFGQIQIGKEFPTGYDRTRNAEIGLKYYKLKFFEEAFTSENWLVRIYKTKLRNFRISLKHARKKNKVFASQKRLRKMKGALKFPRIITRGIKKN 2258
            DPWFNYRST  L   GFY+FLNWFDE++WYPLGRIVGGT++PGLM+T+GL +  L  + + + IR+VCV LAP++S  T I +FLLT E+W+  + L+  C +AIVPGYISRS +GS+DNEGIAIFA+  T+Y W+K+ KTG+VFW++ C +SYFYMVSAWGGYV+ +NLI LHV +LLL Q++S  +Y+A+S FY+ GL+ SMQIPFVGFQP+++ EH ++A  F +LQ Y ++  + D   +   +    +G  ++ +   L +  L+ +  + PWSGRFYSLWD  YA I+IPII SVSEHQPT W S FFDL++L+C +PAG+WFC K +N+ER+F+ LYA++A YF+ +MVRL+L LTP V + S+I+F+ +   FE+ L   TK  +    +     D +  G   +KA ++   +    K+       V  IV ++       F++H  + TS +YS+PS+V++S   DG++ I+DDFREAYYWL+QNT + AR+MSWWDYGYQI GMANRTT+VDNNTWNNSHIALVGKAMS NE+ A +I+R+LDVDYVL+IFGG+IG+SGDDINKFLWMVRI+EGEHPK++ E D+FT  GE+R+DK    ++++ LMY++SYYRFG++Q+    P G+DRTRNAEIG K    +  EEAFTSE+WLVRIYK K    R  L H  +   +   QK   K KGA +      RG  KN
Sbjct:   64 DPWFNYRSTHHLTTNGFYEFLNWFDERAWYPLGRIVGGTVYPGLMVTAGLIHYTLSLLHITVHIRDVCVFLAPVFSGLTAISTFLLTGELWSQGAALLAACFIAIVPGYISRSVAGSFDNEGIAIFALQFTYYLWVKSIKTGSVFWTICCCLSYFYMVSAWGGYVFIINLIPLHVFVLLLMQRFSKRVYIAYSTFYIVGLILSMQIPFVGFQPIRTSEHMAAAGVFALLQVYGFLQYVRDKLTRQERQTLFSVGVSVSALLVFLTVLYLSCIGCIAPWSGRFYSLWDTGYAKIHIPIIASVSEHQPTTWVSFFFDLHILVCTFPAGLWFCIKNINDERVFVALYAISAVYFAGVMVRLMLTLTPVVCMLSAIAFSSI---FERYLGDDTKRENPPTEYSSDEDDRRNSGNLYDKAGKVRKHVSDQEKMEEGLGPNVKSIVTMLMLMLLLMFAVHCTWVTSNAYSSPSVVLASYNHDGSRNILDDFREAYYWLRQNTNEHARVMSWWDYGYQIAGMANRTTLVDNNTWNNSHIALVGKAMSSNESVAYEIMRMLDVDYVLIIFGGVIGYSGDDINKFLWMVRIAEGEHPKDIRESDFFTPQGEFRVDKAGSPTLLNCLMYKMSYYRFGEMQLDFRTPPGFDRTRNAEIGNKDITFQHLEEAFTSEHWLVRIYKVKKLENREPLSHKLRVTNIIPKQKYTSK-KGAKR-----KRGYVKN 772          
BLAST of dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B vs. Ensembl Cavefish
Match: stt3a (STT3 oligosaccharyltransferase complex catalytic subunit A [Source:NCBI gene;Acc:103035415])

HSP 1 Score: 677.937 bits (1748), Expect = 0.000e+0
Identity = 338/669 (50.52%), Postives = 466/669 (69.66%), Query Frame = 3
Query:  135 DPWFNYRSTLELVERGFYKFLNWFDEKSWYPLGRIVGGTIFPGLMMTSGLFYNLLKQMSLHIEIRNVCVLLAPLYSCFTVIISFLLTKEIWNTNSGLICGCIMAIVPGYISRSSSGSYDNEGIAIFAMLLTFYFWIKATKTGTVFWSVLCSISYFYMVSAWGGYVYTLNLISLHVIILLLFQKYSNNLYVAFSVFYLFGLLFSMQIPFVGFQPLKSCEHASSACAFFVLQFYYYV----IKLEDIKIKNGLKLYLYIGPXXXXXXXXXXXXXTKLEILLPWSGRFYSLWDINYAAINIPIITSVSEHQPTAWQSTFFDLNVLMCFYPAGIWFCFKFLNNERIFLILYALTASYFSSIMVRLVLALTPAVAIGSSISFNMLLTYFEKLHKPTKELDKTENFECVTIDSKGDGFCENKANEINYEIIHKVIHNYFSTVVCIVILIHFSIHSIFATSTSYSNPSIVMSSTLPDGNKVIIDDFREAYYWLKQNTKDEARIMSWWDYGYQITGMANRTTIVDNNTWNNSHIALVGKAMSMNETNAIKIIRLLDVDYVLVIFGGLIGFSGDDINKFLWMVRI-SEGEHPKEVYEYDYFTANGEYRIDKLAPKSMVDSLMYRLSYYRFGQIQIGKEFPTGYDRTRNAEIGLKYYKLKFFEEAFTSENWLVRIYKTK 2126
            DP+FNYR+T  L E GFYKF NWFD+++WYPLGRI+GGTI+PGLM+TS   Y++L    + I+IRNVCV LAPL+S FT I+++  TKE+ +  +GL+   ++A+VPGYISRS +GSYDNEGIAIF MLLT+Y WIKA KTG+++WS +C+++YFYMVS+WGGYV+ +NLI LHV++L+L  ++S+ +YVA+   Y  G + SMQI FVGFQP++S EH ++   F + Q + +V     KL   + +   K  + +    L+S   ++ L  K+    PW+GRFYSL D +YA  NIPII SVSEHQPT W S +FDL +L+  +P G+++CF  L++ RIF+I+Y +T+ YFS++MVRL+L L P + I S I  + +LT + K            N +    D K       K  +  Y I ++V       +V    LI ++ HS + TS +YS+PSIV+S+   DG+++I DDFREAYYWL+ NT ++A++MSWWDYGYQIT MANRT +VDNNTWNN+HI+ VG+AM+  E  A +I+R LDV YVLVIFGGL G+S DDINKFLWMVRI    +  K + E+DY+T  GE+R+D+     +++ LMY++ YYRFGQ+    + P GYDR RNAEIG K ++L   EEA+T+E+WLVRIYK K
Sbjct:   49 DPYFNYRTTRFLAEEGFYKFHNWFDDRAWYPLGRIIGGTIYPGLMITSAALYHVLHFFHITIDIRNVCVFLAPLFSSFTAIVTYHFTKELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSIYWSSMCALAYFYMVSSWGGYVFLINLIPLHVLVLMLTGRFSHRIYVAYCTVYCLGTILSMQISFVGFQPVQSSEHMAAFGVFGLCQIHAFVDYLRSKLNAQQFEILFKSVISLVGFVLLSVGAVLMLTGKIS---PWTGRFYSLLDPSYAKNNIPIIASVSEHQPTTWSSYYFDLQLLVFMFPVGLYYCFNNLSDARIFIIMYGVTSMYFSAVMVRLMLVLAPVMCILSGIGVSQVLTTYMK------------NLDVSRPDKK-----TKKQQDSTYPIKNEVASGMI--LVMAFFLITYTFHSTWVTSEAYSSPSIVLSARGGDGSRIIFDDFREAYYWLRHNTPEDAKVMSWWDYGYQITAMANRTILVDNNTWNNTHISRVGQAMASTEEKAYEIMRELDVSYVLVIFGGLTGYSSDDINKFLWMVRIGGSTDTGKHIKEHDYYTPTGEFRVDREGSPVLLNCLMYKMCYYRFGQVYTEAKRPPGYDRVRNAEIGNKDFELDVLEEAYTTEHWLVRIYKVK 695          
BLAST of dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B vs. Ensembl Sea Lamprey
Match: stt3b (STT3 oligosaccharyltransferase complex catalytic subunit B [Source:ZFIN;Acc:ZDB-GENE-030131-2638])

HSP 1 Score: 783.482 bits (2022), Expect = 0.000e+0
Identity = 393/757 (51.92%), Postives = 533/757 (70.41%), Query Frame = 3
Query:   36 NLFPLVIIILSCVXXXXXXXXXXXXXXXXXXXXDPWFNYRSTLELVERGFYKFLNWFDEKSWYPLGRIVGGTIFPGLMMTSGLFYNLLKQMSLHIEIRNVCVLLAPLYSCFTVIISFLLTKEIWNTNSGLICGCIMAIVPGYISRSSSGSYDNEGIAIFAMLLTFYFWIKATKTGTVFWSVLCSISYFYMVSAWGGYVYTLNLISLHVIILLLFQKYSNNLYVAFSVFYLFGLLFSMQIPFVGFQPLKSCEHASSACAFFVLQFYYYVIKLEDIKIKNGLK-LYLYIGPXXXXXXXXXXXXXTKLEILLPWSGRFYSLWDINYAAINIPIITSVSEHQPTAWQSTFFDLNVLMCFYPAGIWFCFKFLNNERIFLILYALTASYFSSIMVRLVLALTPAVAIGSSISF-NMLLTYFEKLHKPTKELDKTENFECVTIDSKGDGFCENKANEIN-YEIIHKVIHNYFSTVVCIV-------ILIHFSIHSIFATSTSYSNPSIVMSSTLPDGNKVIIDDFREAYYWLKQNTKDEARIMSWWDYGYQITGMANRTTIVDNNTWNNSHIALVGKAMSMNETNAIKIIRLLDVDYVLVIFGGLIGFSGDDINKFLWMVRISEGEHPKEVYEYDYFTANGEYRIDKLAPKSMVDSLMYRLSYYRFGQIQIGKEFPTGYDRTRNAEIGLKYYKLKFFEEAFTSENWLVRIYKTKLRNFRISL-KHARKKNKV----FASQKRLRKMKGALKFPRIITRGIKKNS 2261
            +L    ++ L+C+  F  RLF++I FESIIHEFDPWFNYR+T  L   GFY+FLNWFDE++WYPLGRIVGGT++PGLM+T+G  + LL  + + + IR+VCV LAP++S FT I ++LLT+++W+  +GL   C +AIVPGYISRS +GSYDNEG+AIFA+  T+Y W+K+ KTG+VFWS  C +SYFYMVSAWGGYV+ +NLI LHV +LLL Q++S  LY+A+S F++ GL+ SMQIPFVGFQP+++ EH ++A  F +LQ Y ++  L +   +   K L+     +A     L +  LT    + PWSGRFYSLWD  YA I+IPII SVSEHQPT W S FFDL++L+C +PAG+WFC K +N+ER+F+ LYA+TA+YF+ +MVRL+L LTP V + + I+F +    Y     +P +      + +            + KA ++  Y    +         V  +       +L+ F++H  + TS +YS+PS+V++S   DG + I+DDFREAYYWL++NT + AR+MSWWDYGYQI GMANRTT+VDNNTWNNSHIALVGKAMS NE+ A +I+R LDVDYVL+IFGG+IG+SGDDINKFLWMVRI+EGEHP+++ E DYFT  GE+R+D+     +++ LMY++SYYRFG++Q+    P G+DRTRNAEIG K    K  EEAFTSE+WLVRI++ K    R SL + AR  N V    + S+K  ++ +G +K   +I RG K  S
Sbjct:    8 SLLTFTVLALACLAGFSSRLFAVIRFESIIHEFDPWFNYRATHHLSSHGFYEFLNWFDERAWYPLGRIVGGTVYPGLMVTAGAIHWLLNSLHVTVHIRDVCVFLAPVFSGFTAIATYLLTRQLWSGGAGLFAACFIAIVPGYISRSVAGSYDNEGVAIFALQFTYYLWVKSVKTGSVFWSTCCCLSYFYMVSAWGGYVFIINLIPLHVFVLLLMQRFSRRLYIAYSTFFILGLILSMQIPFVGFQPVRTSEHMAAAGVFVLLQAYAFLQYLRERLTRQEFKTLFFVAVALAAGVVFLTVVYLTYAGYIAPWSGRFYSLWDTGYAKIHIPIIASVSEHQPTTWVSFFFDLHILVCVFPAGLWFCIKDINDERVFIALYAITATYFAGVMVRLMLTLTPVVCVLAGIAFSDTFRQYLADERQPERRTGGDSSDDEDEGKRSTPNLYDKKAGKVRKYPSEQEKSEEGLGPNVKSIVVMVVLMLLMMFAVHCTWVTSNAYSSPSVVLASYNHDGTRNILDDFREAYYWLRRNTDEHARVMSWWDYGYQIAGMANRTTLVDNNTWNNSHIALVGKAMSSNESAAYEIMRSLDVDYVLIIFGGVIGYSGDDINKFLWMVRIAEGEHPRDIRESDYFTPQGEFRVDRGGSPVLLNCLMYKMSYYRFGEMQLDFRTPPGFDRTRNAEIGNKDISFKHLEEAFTSEHWLVRIFRVKQLENRESLGRKARSTNTVPKQRYVSKKTSKRKRGHIKNKMVIKRGKKSTS 764          
BLAST of dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004958.1 (pep scaffold:Pmarinus_7.0:GL478327:30718:48810:-1 gene:ENSPMAG00000004387.1 transcript:ENSPMAT00000004958.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 689.108 bits (1777), Expect = 0.000e+0
Identity = 336/666 (50.45%), Postives = 465/666 (69.82%), Query Frame = 3
Query:  135 DPWFNYRSTLELVERGFYKFLNWFDEKSWYPLGRIVGGTIFPGLMMTSGLFYNLLKQMSLHIEIRNVCVLLAPLYSCFTVIISFLLTKEIWNTNSGLICGCIMAIVPGYISRSSSGSYDNEGIAIFAMLLTFYFWIKATKTGTVFWSVLCSISYFYMVSAWGGYVYTLNLISLHVIILLLFQKYSNNLYVAFSVFYLFGLLFSMQIPFVGFQPLKSCEHASSACAFFVLQFYYYVIKLED-IKIKNGLKLYLYIGPXXXXXXXXXXXXXTKLEILLPWSGRFYSLWDINYAAINIPIITSVSEHQPTAWQSTFFDLNVLMCFYPAGIWFCFKFLNNERIFLILYALTASYFSSIMVRLVLALTPAVAIGSSISFNMLLTYFEKLHKPTKELDKTENFECVTIDSKGDGFCENKANEINYEIIHKVIHNYFSTVVCIVILIHFSIHSIFATSTSYSNPSIVMSSTLPDGNKVIIDDFREAYYWLKQNTKDEARIMSWWDYGYQITGMANRTTIVDNNTWNNSHIALVGKAMSMNETNAIKIIRLLDVDYVLVIFGGLIGFSGDDINKFLWMVRI-SEGEHPKEVYEYDYFTANGEYRIDKLAPKSMVDSLMYRLSYYRFGQIQIGKEFPTGYDRTRNAEIGLKYYKLKFFEEAFTSENWLVRIYKTK 2126
            DP+FNYR+T  L E GFY+F NWFD+++WYPLGRI+GGTI+PGLM+TS L Y++L  M++ I+IRNVCV LAPL+S FT ++++ LTKE+ +  +GL+   ++AIVPGYISRS +GSYDNEGIA+F ML  +Y WIKA KTG ++WS +C+++YFYMVS+WGGYV+ +NLI LHV+ L++  ++S+ +YVA+S  Y  G + SMQI FVGFQP++S EH ++   F + Q Y +V  L   +  +N   L+  +  +      +   LL     + PW+GRFYSL D +YA  NIPII SVSEHQPT W S +FDL +L+  +P G+++CF  LN+ RIF+ILY +T+ YFS++MVRL+L L P + I S I  + +LT + +            N +    D K       K ++ +Y I ++V       ++    LI ++ HS + TS +YS+PSIV+S+   DG+++I DDFREAYYWL+ NT ++A++MSWWDYGYQIT MANRT +VDNNTWNN+HI+ VG+AMS  E  A +I+R LDV YVLVIFGGL G+S DDINKFLWMVRI    +  K + E+DY+T  GE+R+D+     +++ LMY++ YYRFGQ+    + P GYDR RN EIG K ++L   EEA+T+E+WLVRIYK K
Sbjct:   50 DPYFNYRTTRFLTEEGFYQFHNWFDDRAWYPLGRIIGGTIYPGLMVTSALLYHVLHFMNVTIDIRNVCVFLAPLFSSFTTLLTYHLTKELKDAGAGLVAAAMIAIVPGYISRSVAGSYDNEGIALFCMLFAYYMWIKAVKTGLLYWSAMCALAYFYMVSSWGGYVFLINLIPLHVLALMITGRFSHRIYVAYSTVYCLGTILSMQISFVGFQPVQSSEHMAALGVFGLCQIYSFVDYLRSKLSTQNFEILFKSMISLVGAVVGVAATLLMLTGKISPWTGRFYSLLDPSYAKNNIPIIASVSEHQPTTWSSYYFDLQLLVFMFPVGLYYCFCNLNDARIFIILYGVTSMYFSAVMVRLMLVLAPVMCILSGIGVSHVLTTYMR------------NLDISRPDKK-----SKKTHDASYPIKNEVASGM--VLLMSFFLITYTFHSTWVTSEAYSSPSIVLSARGGDGSRIIFDDFREAYYWLRHNTPEDAKVMSWWDYGYQITAMANRTILVDNNTWNNTHISRVGQAMSSTEEKAYEIMRELDVGYVLVIFGGLTGYSSDDINKFLWMVRIGGSTDTGKHIKEHDYYTPAGEFRVDREGSPVLLNCLMYKMCYYRFGQVYTEAKRPPGYDRVRNVEIGNKDFELDVLEEAYTTEHWLVRIYKVK 696          
BLAST of dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B vs. Ensembl Yeast
Match: STT3 (Subunit of the oligosaccharyltransferase complex of the ER lumen; complex catalyzes asparagine-linked glycosylation of newly synthesized proteins; forms a subcomplex with Ost3p and Ost4p and is directly involved in catalysis [Source:SGD;Acc:S000002990])

HSP 1 Score: 599.742 bits (1545), Expect = 0.000e+0
Identity = 323/701 (46.08%), Postives = 453/701 (64.62%), Query Frame = 3
Query:  135 DPWFNYRSTLELVERGFYKFLNWFDEKSWYPLGRIVGGTIFPGLMMTSGLFYNLLKQ-MSLHIEIRNVCVLLAPLYSCFTVIISFLLTKEIWNTNSGLICGCIMAIVPGYISRSSSGSYDNEGIAIFAMLLTFYFWIKATKTGTVFWSVLCSISYFYMVSAWGGYVYTLNLISLHVIILLLFQKYSNNLYVAFSVFYLFGLLFSMQIPFVGFQPLKSCEHASSACAFFVLQ------FYYYVIKLEDIKIKNGLKLYLYIGPXXXXXXXXXXXXXTKLEILLPWSGRFYSLWDINYAAINIPIITSVSEHQPTAWQSTFFDLNVLMCFYPAGIWFCFKFLNNERIFLILYALTASYFSSIMVRLVLALTPAVAIGSSISFNMLLTYFEKLHKPTKELDKTENFECVTIDSKGDGFCENKANEINYEI-IHKVIHNYFSTVVCIVILIHFSIHSIFATSTSYSNPSIVMSSTLPDGNKVIIDDFREAYYWLKQNTKDEARIMSWWDYGYQITGMANRTTIVDNNTWNNSHIALVGKAMSMNETNAIKIIRLLDVDYVLVIFGGLIGFSGDDINKFLWMVRISEGEHPKEVYEYDYFTANGEYRIDKLAPKSMVDSLMYRLSYYRFGQIQIGKEFPTGYDRTRNAEIG-LKYYKLKFFEEAFTSENWLVRIYKTKL-----RNFRISLKHARKKNKVFASQKR 2195
            DPWFNYR+T  LV   FYKFLNWFD+++WYPLGR+ GGT++PGLM TS   ++ L+  + L I+IRNVCVL APL+S  T   ++  TKEI + ++GL+    +AIVPGYISRS +GSYDNE IAI  +++TF FWIKA KTG++  +   ++ YFYMVSAWGGYV+  NLI LHV +L+L  +YS+ LY A++ +Y  G + SMQIPFVGF P++S +H ++   F ++Q      F    I     K+   + L+L +     +   + ++ LT + ++ PW+GRFYSLWD NYA I+IPII SVSEHQP +W + FFD + L+  +PAG++  F  L +E +F+I Y++  SYF+ +MVRL+L LTP + + ++++ + +                             D + + K ++  Y I    ++     +   I  L  F  HS + T T+YS+PS+V+ S  PDG   +IDDFREAYYWL+ N+ +++++ +WWDYGYQI GMA+RTT+VDNNTWNN+HIA+VGKAM+  E  + +I++  DVDYVLVIFGGLIGF GDDINKFLWM+RISEG  P+E+ E D++TA GEYR+D  A ++M +SL+Y++SY  F Q+  G +     DR R   I  L    L +F+E FTSENW+VRIY+ K      R  R   +  R   K   S KR
Sbjct:   47 DPWFNYRATKYLVNNSFYKFLNWFDDRTWYPLGRVTGGTLYPGLMTTSAFIWHALRNWLGLPIDIRNVCVLFAPLFSGVTAWATYEFTKEIKDASAGLLAAGFIAIVPGYISRSVAGSYDNEAIAITLLMVTFMFWIKAQKTGSIMHATCAALFYFYMVSAWGGYVFITNLIPLHVFLLILMGRYSSKLYSAYTTWYAIGTVASMQIPFVGFLPIRSNDHMAALGVFGLIQIVAFGDFVKGQISTAKFKVIMMVSLFLIL-----VLGVVGLSALTYMGLIAPWTGRFYSLWDTNYAKIHIPIIASVSEHQPVSWPAFFFDTHFLIWLFPAGVFLLFLDLKDEHVFVIAYSVLCSYFAGVMVRLMLTLTPVICVSAAVALSKIF----------------------------DIYLDFKTSDRKYAIKPAALLAKLIVSGSFIFYLYLFVFHSTWVTRTAYSSPSVVLPSQTPDGKLALIDDFREAYYWLRMNSDEDSKVAAWWDYGYQIGGMADRTTLVDNNTWNNTHIAIVGKAMASPEEKSYEILKEHDVDYVLVIFGGLIGFGGDDINKFLWMIRISEGIWPEEIKERDFYTAEGEYRVDARASETMRNSLLYKMSYKDFPQLFNGGQ---ATDRVRQQMITPLDVPPLDYFDEVFTSENWMVRIYQLKKDDAQGRTLRDVGELTRSSTKTRRSIKR 711          
BLAST of dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B vs. Ensembl Nematostella
Match: EDO49026 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHR8])

HSP 1 Score: 770 bits (1987), Expect = 0.000e+0
Identity = 376/736 (51.09%), Postives = 510/736 (69.29%), Query Frame = 3
Query:  135 DPWFNYRSTLELVERGFYKFLNWFDEKSWYPLGRIVGGTIFPGLMMTSGLFYNLLKQMSLHIEIRNVCVLLAPLYSCFTVIISFLLTKEIWNTNSGLICGCIMAIVPGYISRSSSGSYDNEGIAIFAMLLTFYFWIKATKTGTVFWSVLCSISYFYMVSAWGGYVYTLNLISLHVIILLLFQKYSNNLYVAFSVFYLFGLLFSMQIPFVGFQPLKSCEHASSACAFFVLQFYYYVIKL-EDIKIKNGLKLYLYIGPXXXXXXXXXXXXXTKLEILLPWSGRFYSLWDINYAAINIPIITSVSEHQPTAWQSTFFDLNVLMCFYPAGIWFCFKFLNNERIFLILYALTASYFSSIMVRLVLALTPAVAIGSSISFNMLLTYF--------------------EKLHKPTKELDKTENFECVTIDSKGDGFCENKANEINYEIIHKVIHNYFSTVVCIVI-LIHFSIHSIFATSTSYSNPSIVMSSTLPDGNKVIIDDFREAYYWLKQNTKDEARIMSWWDYGYQITGMANRTTIVDNNTWNNSHIALVGKAMSMNETNAIKIIRLLDVDYVLVIFGGLIGFSGDDINKFLWMVRISEGEHPKEVYEYDYFTANGEYRIDKLAPKSMVDSLMYRLSYYRFGQIQIGKEFPTGYDRTRNAEIGLKYYKLKFFEEAFTSENWLVRIYKTKLRNFRISLKHARKKNKVFASQKRLRKMKGALKFPRIITR-GIKKNSYPFT 2273
            DPWFNYR+T  L   GFY FLNWFDE++WYPLGRIVGGT++PGLM+TS   + +L  +++ + IR+ CV LAP++S  T I ++LLTKE+WN  +GL   C +AIVPGYISRS +GSYDNEGIAIFA+  T+Y W+K+ KTG++FW++  S+SYFYMVSAWGGYV+ +NLI LHV  LLL  +++  +YV++S FY+  L+ SMQ+PFVGFQP+++ EH ++A  F +LQ Y +++ + E +   +   L ++            +  LT + ++ PWSGRFYSL+D  YA I+IPII SVSEHQPT W S FFDL++L+C +PAG+WF  K +N+ER+F++LYA+TA YF+ +MVRL+L LTP V I ++I+F++ L  +                    +   +  K   K E ++            E+     +   I   +      V+CIV+ L+ F++H  + TS +YS+PS+V++ST  DG++ I+DDFREAY+WL+QNT D ARIMSWWDYGYQI GMANRTT+VDNNTWNNSHIALVGKAMS NET A KI+R+LDVDY+LVIFGG+IG+SGDDINKFLWMVRI+EGEHP+E+ E DYFT  GE+R+D      +++ LMY++ YYRFG++Q+    P+G+DRTRN EIG K +KL+  EEAFTSE+WLVRIYK K       L +  K  K     KR+  +K +   PR  +R G  KN   F+
Sbjct:   64 DPWFNYRATHHLANNGFYNFLNWFDERAWYPLGRIVGGTVYPGLMVTSAAIHWVLNTLNITVHIRDTCVFLAPVFSGLTAIATYLLTKELWNDRAGLFAACFIAIVPGYISRSVAGSYDNEGIAIFALQFTYYLWVKSVKTGSIFWAICTSLSYFYMVSAWGGYVFIINLIPLHVFFLLLMGRFNMKIYVSYSTFYITALIMSMQVPFVGFQPIRTSEHMAAAGTFALLQAYAFLMYVKEKVSWSDIKNLVVFGAVACAGLVFACVVALTYMGVIAPWSGRFYSLYDTGYAKIHIPIIASVSEHQPTTWVSFFFDLHILVCTFPAGLWFVIKKINDERVFVVLYAVTAVYFAGVMVRLMLTLTPVVCILAAIAFSVTLDNYLVDDKVPAVKEGEQEEEKKGDSEEEADKGKKKKELYDKAGKQKGKTKKQESVEEGEDANTIGTNLKGL--VVMCIVMMLMMFAVHCTWVTSNAYSSPSVVLASTNYDGSRNILDDFREAYFWLRQNTDDNARIMSWWDYGYQIAGMANRTTLVDNNTWNNSHIALVGKAMSSNETAAYKIMRMLDVDYILVIFGGVIGYSGDDINKFLWMVRIAEGEHPQEIKESDYFTPQGEFRVDSAGSPILLNCLMYKMCYYRFGEMQLDFRTPSGFDRTRNVEIGNKNFKLEHIEEAFTSEHWLVRIYKVK------DLVNREKSTK----PKRITNIKPSRYIPRKTSRKGYIKNKLAFS 787          
BLAST of dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B vs. Ensembl Nematostella
Match: EDO46343 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQD2])

HSP 1 Score: 687.567 bits (1773), Expect = 0.000e+0
Identity = 335/667 (50.22%), Postives = 468/667 (70.16%), Query Frame = 3
Query:  135 DPWFNYRSTLELVERGFYKFLNWFDEKSWYPLGRIVGGTIFPGLMMTSGLFYNLLKQMSLHIEIRNVCVLLAPLYSCFTVIISFLLTKEIWNTNSGLICGCIMAIVPGYISRSSSGSYDNEGIAIFAMLLTFYFWIKATKTGTVFWSVLCSISYFYMVSAWGGYVYTLNLISLHVIILLLFQKYSNNLYVAFSVFYLFGLLFSMQIPFVGFQPLKSCEHASSACAFFVLQFYYYVIKLEDIKIKNGLK-LYLYIGPXXXXXXXXXXXXXTKLEILLPWSGRFYSLWDINYAAINIPIITSVSEHQPTAWQSTFFDLNVLMCFYPAGIWFCFKFLNNERIFLILYALTASYFSSIMVRLVLALTPAVAIGSSISFNMLL-TYFEKLHKPTKELDKTENFECVTIDSKGDGFCENKANEINYEIIHKVIHNYFSTVVCIVILIHFSIHSIFATSTSYSNPSIVMSSTLPDGNKVIIDDFREAYYWLKQNTKDEARIMSWWDYGYQITGMANRTTIVDNNTWNNSHIALVGKAMSMNETNAIKIIRLLDVDYVLVIFGGLIGFSGDDINKFLWMVRI-SEGEHPKEVYEYDYFTANGEYRIDKLAPKSMVDSLMYRLSYYRFGQIQIGKEFPTGYDRTRNAEIGLKYYKLKFFEEAFTSENWLVRIYKTK 2126
            DP+FNYR+T  LVE GFY F NWFD+++WYPLGRI+GGTI+PGLM+TS + Y+++    + I+IRNVCV LAPL+S  T +++F  TKE+ +  +GL+   ++AIVPGYISRS +GSYDNEGIAIF MLLT+  W+K+ KTG+VFWS +C+++YFYMVS+WGGYV+ +NLI LHV++L++  ++S+ +YVA+S  Y  G + SMQI FVGFQP++S EH ++   F + Q + +V  +     +   + L+  +  IA +   ++  +LT    + PW+GRFYSL D +YA  NIPII SVSEHQPT W S +FDL +L+  +P G+++CF  L +  IF+I+Y +T+ YF+ +MVRL+L L P   I S IS + +L TY + L    +  +KT          KGD     K NE+   +I           +  + LI ++ H  + TS +YS+PSIV+S+   DG++VI DDFREAYYWL+QNT + +++MSWWDYGYQIT MANRT +VDNNTWNN+HI+ VG+AM+  E  A +I+R LDVDYVLVIFGGL G++ DDINKFLWMVRI    E  + + E+DY+T  GE+R+D+   +++++ LMY++ YYRFG +   +  PTGYDR RNAEIG K ++L   EEA+T+E+WLVRIYK K
Sbjct:   58 DPYFNYRTTRFLVEEGFYSFHNWFDDRAWYPLGRIIGGTIYPGLMVTSAVLYHVMNFFHITIDIRNVCVFLAPLFSSLTALVTFYFTKELKDVGAGLVAASMIAIVPGYISRSVAGSYDNEGIAIFCMLLTYALWVKSVKTGSVFWSTMCALAYFYMVSSWGGYVFLINLIPLHVLVLMITGRFSHRIYVAYSSVYCLGTILSMQISFVGFQPVQSSEHMAAFGVFGLCQIHAFVDYVRARMSREHFQFLFKVVVTIASLVVFVVGGVLTATGKISPWTGRFYSLLDPSYAKNNIPIIASVSEHQPTTWSSFYFDLQILVFMFPVGLYYCFSKLTDANIFIIMYGITSIYFAGVMVRLMLVLAPVACILSGISVSSILTTYMKNLETSKRSSNKTAK--------KGDPSYPIK-NEVATVMIG----------MMTLFLITYTFHCTWVTSEAYSSPSIVLSAKQHDGSRVIFDDFREAYYWLRQNTPENSKVMSWWDYGYQITAMANRTILVDNNTWNNTHISRVGQAMASPEDKAYEIMRELDVDYVLVIFGGLTGYASDDINKFLWMVRIGGSTEKGQHIKEHDYYTPTGEFRVDREGSQTLLNCLMYKMCYYRFGSVYTEQGKPTGYDRVRNAEIGNKEFELDVLEEAYTTEHWLVRIYKVK 705          
BLAST of dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B vs. Ensembl Medaka
Match: STT3B (dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B [Source:NCBI gene;Acc:101170442])

HSP 1 Score: 801.201 bits (2068), Expect = 0.000e+0
Identity = 396/753 (52.59%), Postives = 541/753 (71.85%), Query Frame = 3
Query:   36 NLFPLVIIILSCVXXXXXXXXXXXXXXXXXXXXDPWFNYRSTLELVERGFYKFLNWFDEKSWYPLGRIVGGTIFPGLMMTSGLFYNLLKQMSLHIEIRNVCVLLAPLYSCFTVIISFLLTKEIWNTNSGLICGCIMAIVPGYISRSSSGSYDNEGIAIFAMLLTFYFWIKATKTGTVFWSVLCSISYFYMVSAWGGYVYTLNLISLHVIILLLFQKYSNNLYVAFSVFYLFGLLFSMQIPFVGFQPLKSCEHASSACAFFVLQFYYYVIKLEDIKIKNGLKLYLYIG-PXXXXXXXXXXXXXTKLEILLPWSGRFYSLWDINYAAINIPIITSVSEHQPTAWQSTFFDLNVLMCFYPAGIWFCFKFLNNERIFLILYALTASYFSSIMVRLVLALTPAVAIGSSISFNMLLTYF----EKLHKPTKELDKTENFECVTIDSKGDGFCENKANEINYEIIH--KVIHNYFSTVVCIVILIH------FSIHSIFATSTSYSNPSIVMSSTLPDGNKVIIDDFREAYYWLKQNTKDEARIMSWWDYGYQITGMANRTTIVDNNTWNNSHIALVGKAMSMNETNAIKIIRLLDVDYVLVIFGGLIGFSGDDINKFLWMVRISEGEHPKEVYEYDYFTANGEYRIDKLAPKSMVDSLMYRLSYYRFGQIQIGKEFPTGYDRTRNAEIGLKYYKLKFFEEAFTSENWLVRIYKTKLRNFRISLKHARKK---NKVFASQKRLRKMKGALKFPRIITRG 2246
            +L    I+ L+C+  F  RLF++I FESIIHEFDPWFNYRST  L   GFY+FLNWFDE++WYPLGRIVGGT++PGLM+T+GL + +L  + + + IR+VCV LAP++S  T I +FLLT+E+WN  +GL+  C +AIVPGYISRS +GS+DNEGIAIFA+  T+Y W+K+ KTG+VFW++ C +SYFYMVSAWGGYV+ +NLI LHV +LLL Q+YS  +Y+A+S FY+ GL+ SMQ+PFVGFQP+++ EH ++A  F +LQ Y ++  L+D   +   +   ++G  +A     L +  LT    + PWSGRFYSLWD  YA I+IPII SVSEHQPT W S FFDL++L+C +PAG+WFC K +N+ER+F+ LYA++A YF+ +MVRL+L LTP V + S+++F+ +  ++     K  KP  E    E+      D +  G   +KA ++   +    K        +  IV ++       F++H  + TS +YS+PS+V++S   DG++ I+DDFREAYYWL+QNT + AR+MSWWDYGYQI GMANRTT+VDNNTWNNSHIALVGKAMS NE+ A +I++ LDVDYVL+IFGG+IG+SGDDINKFLWMVRI+EGEHPKE+ E DYFT  GE+R+DK    ++++ LMY++SYYRFG++Q+    P G+DRTRNAEIG K  K K  EEAFTSE+WLVRIYK K  + R  L    +     + + S+K  ++ +G ++   ++ +G
Sbjct:   52 SLLSFSILFLACLAGFSSRLFAVIRFESIIHEFDPWFNYRSTHHLASNGFYEFLNWFDERAWYPLGRIVGGTVYPGLMVTAGLIHYMLNFLHITVHIRDVCVFLAPVFSGLTAISTFLLTRELWNQGAGLLAACFIAIVPGYISRSVAGSFDNEGIAIFALQFTYYLWVKSVKTGSVFWTIGCCLSYFYMVSAWGGYVFIINLIPLHVFVLLLMQRYSRRVYIAYSTFYIVGLILSMQVPFVGFQPIRTSEHMAAAGVFALLQAYAFLQYLKDRLTRQEFQTLFFLGVSLAACVVFLTVIYLTYTGYIAPWSGRFYSLWDTGYAKIHIPIIASVSEHQPTTWVSFFFDLHILVCTFPAGLWFCIKNINDERVFVALYAISAVYFAGVMVRLMLTLTPVVCMLSAVAFSSVFEHYMGDDTKREKPPAEDSSDED------DKRNSGNLYDKAGKVRKHVSEQEKAEEGLGPNIKSIVTMLMLMLLMMFAVHCTWVTSNAYSSPSVVLASYNHDGSRNILDDFREAYYWLRQNTDEHARVMSWWDYGYQIAGMANRTTLVDNNTWNNSHIALVGKAMSSNESAAYRIMQSLDVDYVLIIFGGVIGYSGDDINKFLWMVRIAEGEHPKEIRESDYFTPQGEFRVDKAGSPTLLNCLMYKMSYYRFGEMQLDFRTPPGFDRTRNAEIGNKDIKFKHLEEAFTSEHWLVRIYKVKDLDNREPLDRKLRSVTPRQKYTSKKTAKRKRGQIRNKLVLKKG 798          
BLAST of dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B vs. Ensembl Medaka
Match: stt3b (dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B-like [Source:NCBI gene;Acc:101173575])

HSP 1 Score: 800.816 bits (2067), Expect = 0.000e+0
Identity = 384/728 (52.75%), Postives = 525/728 (72.12%), Query Frame = 3
Query:  135 DPWFNYRSTLELVERGFYKFLNWFDEKSWYPLGRIVGGTIFPGLMMTSGLFYNLLKQMSLHIEIRNVCVLLAPLYSCFTVIISFLLTKEIWNTNSGLICGCIMAIVPGYISRSSSGSYDNEGIAIFAMLLTFYFWIKATKTGTVFWSVLCSISYFYMVSAWGGYVYTLNLISLHVIILLLFQKYSNNLYVAFSVFYLFGLLFSMQIPFVGFQPLKSCEHASSACAFFVLQFYYYVIKLEDIKIKNGLKLYLYIG-PXXXXXXXXXXXXXTKLEILLPWSGRFYSLWDINYAAINIPIITSVSEHQPTAWQSTFFDLNVLMCFYPAGIWFCFKFLNNERIFLILYALTASYFSSIMVRLVLALTPAVAIGSSISFNMLLTYF----EKLHKPTKELDKTENFECVTIDSKGDGFCENKANEINYEIIHKVIHN--------YFSTVVCIVILIHFSIHSIFATSTSYSNPSIVMSSTLPDGNKVIIDDFREAYYWLKQNTKDEARIMSWWDYGYQITGMANRTTIVDNNTWNNSHIALVGKAMSMNETNAIKIIRLLDVDYVLVIFGGLIGFSGDDINKFLWMVRISEGEHPKEVYEYDYFTANGEYRIDKLAPKSMVDSLMYRLSYYRFGQIQIGKEFPTGYDRTRNAEIGLKYYKLKFFEEAFTSENWLVRIYKTK-------LRNFRISLKHARKKNKVFASQKRLRKMKGALKFPRIITRGIKKN 2258
            DPWFNYRST  L   GFY+FLNWFDE++WYPLGRIVGGT++PGLM+T+GL + +L  + + + IR+VCV LAP++S  T I +FLLT+E+WN  +GL+  C +AIVPGYISRS +GS+DNEGIAIFA+  T+Y W+K+ KTG++FW++ C +SYFYMVSAWGGYV+ +NLI LHV +LLL Q++S  +Y+A+S FY+ GL+ SMQIPFVGFQP+++ EH ++A  F +LQ Y ++  L+D   +   +   ++G  +A     L +  LT    + PWSGRFYSLWD  YA I+IPII SVSEHQPT W S FFDL++L+C +PAG+WFC K +N+ER+F+ LYA++A YF+ +MVRL+L LTP V + S+++F+ +  ++     K   P  E    E+      D K  G   +KA ++   +  +               T++ +++L+ F++H  + TS +YS+PS+V++S   DG++ I+DDFREAYYWL+QNT + AR+MSWWDYGYQI GMANRTT+VDNNTWNNSHIALVGKAMS NE+ A KI+R LDVDYVL+IFGG+IG+SGDDINKFLWMVRI+EGEHPK++ E DYFT  GE+R+DK    ++++ LMY++SYYRFG++Q+    P G+DRTRNAEIG K  KLK  EEAFTSE+WLVRIYK K       + N   S   +R+K   F S+K  ++ +G +K   ++ +G  K+
Sbjct:   89 DPWFNYRSTHHLTTNGFYEFLNWFDERAWYPLGRIVGGTVYPGLMLTAGLIHYVLNLLHITVHIRDVCVFLAPVFSGLTSISTFLLTRELWNQGAGLLAACFIAIVPGYISRSVAGSFDNEGIAIFALQFTYYLWVKSVKTGSIFWAIGCCLSYFYMVSAWGGYVFIINLIPLHVFVLLLMQRFSKRVYIAYSTFYIIGLILSMQIPFVGFQPIRTSEHMAAAGVFVLLQVYAFLQYLKDRLTRQEFQTLFFLGVSLAAGVVFLSVIYLTYTGYIAPWSGRFYSLWDTGYAKIHIPIIASVSEHQPTTWVSFFFDLHILVCTFPAGLWFCIKSINDERVFVALYAISAVYFAGVMVRLMLTLTPVVCMLSAVAFSSVFEHYLGDDAKRQSPPAEDSSDED------DRKNPGNLYDKAGKVRKHVSEQEQAEDGLGPNIKSIVTMLMLMLLMMFAVHCTWVTSNAYSSPSVVLASYNHDGSRNILDDFREAYYWLRQNTDEHARVMSWWDYGYQIAGMANRTTLVDNNTWNNSHIALVGKAMSSNESAAYKIMRSLDVDYVLIIFGGVIGYSGDDINKFLWMVRIAEGEHPKDIRESDYFTPQGEFRVDKAGSPTLLNCLMYKMSYYRFGEMQLDFRTPPGFDRTRNAEIGNKDIKLKHLEEAFTSEHWLVRIYKVKKLENRDRMENRLRSTDSSRQK---FTSKKTAKRKRGYVKNKLVLRKGKTKS 807          
BLAST of dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B vs. Ensembl Medaka
Match: STT3B (dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B [Source:NCBI gene;Acc:101170442])

HSP 1 Score: 800.431 bits (2066), Expect = 0.000e+0
Identity = 396/755 (52.45%), Postives = 542/755 (71.79%), Query Frame = 3
Query:   36 NLFPLVIIILSCVXXXXXXXXXXXXXXXXXXXXDPWFNYRSTLELVERGFYKFLNWFDEKSWYPLGRIVGGTIFPGLMMTSGLFYNLLKQMSLHIEIRNVCVLLAPLYSCFTVIISFLLTKEIWNTNSGLICGCIMAIVPGYISRSSSGSYDNEGIAIFAMLLTFYFWIKATKTGTVFWSVLCSISYFYMVSAWGGYVYTLNLISLHVIILLLFQKYSNNLYVAFSVFYLFGLLFSMQIPFVGFQPLKSCEHASSACAFFVLQFYYYVIKLEDIKIKNGLKLYLYIG-PXXXXXXXXXXXXXTKLEILLPWSGRFYSLWDINYAAINIPIITSVSEHQPTAWQSTFFDLNVLMCFYPAGIWFCFKFLNNERIFLILYALTASYFSSIMVRLVLALTPAVAIGSSISFNMLLTYF----EKLHKPTKELDKTENFECVTIDSKGDGFCENKANEINYEIIH--KVIHNYFSTVVCIVILIH------FSIHSIFATSTSYSNPSIVMSSTLPDGNKVIIDDFREAYYWLKQNTKDEARIMSWWDYGYQITGMANRTTIVDNNTWNNSHIALVGKAMSMNETNAIKIIRLLDVDYVLVIFGGLIGFSGDDINKFLWMVRISEGEHPKEVYEYDYFTANGEYRIDKLAPKSMVDSLMYRLSYYRFGQIQIGKEFPTGYDRTRNAEIGLKYYKLKFFEEAFTSENWLVRIYKTKLRNFRISLKHARKK---NKVFASQKRLRKMKGALKFPRIITRGIK 2252
            +L    I+ L+C+  F  RLF++I FESIIHEFDPWFNYRST  L   GFY+FLNWFDE++WYPLGRIVGGT++PGLM+T+GL + +L  + + + IR+VCV LAP++S  T I +FLLT+E+WN  +GL+  C +AIVPGYISRS +GS+DNEGIAIFA+  T+Y W+K+ KTG+VFW++ C +SYFYMVSAWGGYV+ +NLI LHV +LLL Q+YS  +Y+A+S FY+ GL+ SMQ+PFVGFQP+++ EH ++A  F +LQ Y ++  L+D   +   +   ++G  +A     L +  LT    + PWSGRFYSLWD  YA I+IPII SVSEHQPT W S FFDL++L+C +PAG+WFC K +N+ER+F+ LYA++A YF+ +MVRL+L LTP V + S+++F+ +  ++     K  KP  E    E+      D +  G   +KA ++   +    K        +  IV ++       F++H  + TS +YS+PS+V++S   DG++ I+DDFREAYYWL+QNT + AR+MSWWDYGYQI GMANRTT+VDNNTWNNSHIALVGKAMS NE+ A +I++ LDVDYVL+IFGG+IG+SGDDINKFLWMVRI+EGEHPKE+ E DYFT  GE+R+DK    ++++ LMY++SYYRFG++Q+    P G+DRTRNAEIG K  K K  EEAFTSE+WLVRIYK K  + R  L    +     + + S+K  ++ +G ++   ++ +G +
Sbjct:   52 SLLSFSILFLACLAGFSSRLFAVIRFESIIHEFDPWFNYRSTHHLASNGFYEFLNWFDERAWYPLGRIVGGTVYPGLMVTAGLIHYMLNFLHITVHIRDVCVFLAPVFSGLTAISTFLLTRELWNQGAGLLAACFIAIVPGYISRSVAGSFDNEGIAIFALQFTYYLWVKSVKTGSVFWTIGCCLSYFYMVSAWGGYVFIINLIPLHVFVLLLMQRYSRRVYIAYSTFYIVGLILSMQVPFVGFQPIRTSEHMAAAGVFALLQAYAFLQYLKDRLTRQEFQTLFFLGVSLAACVVFLTVIYLTYTGYIAPWSGRFYSLWDTGYAKIHIPIIASVSEHQPTTWVSFFFDLHILVCTFPAGLWFCIKNINDERVFVALYAISAVYFAGVMVRLMLTLTPVVCMLSAVAFSSVFEHYMGDDTKREKPPAEDSSDED------DKRNSGNLYDKAGKVRKHVSEQEKAEEGLGPNIKSIVTMLMLMLLMMFAVHCTWVTSNAYSSPSVVLASYNHDGSRNILDDFREAYYWLRQNTDEHARVMSWWDYGYQIAGMANRTTLVDNNTWNNSHIALVGKAMSSNESAAYRIMQSLDVDYVLIIFGGVIGYSGDDINKFLWMVRIAEGEHPKEIRESDYFTPQGEFRVDKAGSPTLLNCLMYKMSYYRFGEMQLDFRTPPGFDRTRNAEIGNKDIKFKHLEEAFTSEHWLVRIYKVKDLDNREPLDRKLRSVTPRQKYTSKKTAKRKRGQIRNKLVLKKGKR 800          
BLAST of dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B vs. Ensembl Medaka
Match: stt3a (STT3 oligosaccharyltransferase complex catalytic subunit A [Source:NCBI gene;Acc:101163628])

HSP 1 Score: 680.248 bits (1754), Expect = 0.000e+0
Identity = 341/669 (50.97%), Postives = 467/669 (69.81%), Query Frame = 3
Query:  135 DPWFNYRSTLELVERGFYKFLNWFDEKSWYPLGRIVGGTIFPGLMMTSGLFYNLLKQMSLHIEIRNVCVLLAPLYSCFTVIISFLLTKEIWNTNSGLICGCIMAIVPGYISRSSSGSYDNEGIAIFAMLLTFYFWIKATKTGTVFWSVLCSISYFYMVSAWGGYVYTLNLISLHVIILLLFQKYSNNLYVAFSVFYLFGLLFSMQIPFVGFQPLKSCEHASSACAFFVLQFYYYV----IKLEDIKIKNGLKLYLYIGPXXXXXXXXXXXXXTKLEILLPWSGRFYSLWDINYAAINIPIITSVSEHQPTAWQSTFFDLNVLMCFYPAGIWFCFKFLNNERIFLILYALTASYFSSIMVRLVLALTPAVAIGSSISFNMLLTYFEKLHKPTKELDKTENFECVTIDSKGDGFCENKANEINYEIIHKVIHNYFSTVVCIVILIHFSIHSIFATSTSYSNPSIVMSSTLPDGNKVIIDDFREAYYWLKQNTKDEARIMSWWDYGYQITGMANRTTIVDNNTWNNSHIALVGKAMSMNETNAIKIIRLLDVDYVLVIFGGLIGFSGDDINKFLWMVRI-SEGEHPKEVYEYDYFTANGEYRIDKLAPKSMVDSLMYRLSYYRFGQIQIGKEFPTGYDRTRNAEIGLKYYKLKFFEEAFTSENWLVRIYKTK 2126
            DP+FNYR+T  L E GFYKF NWFD+++WYPLGRI+GGTI+PGLM+TS   Y++L    + I IRNVCV LAPL+S FTV++++ LTKE+ +  +GL+   ++A+VPGYISRS +GSYDNEGIAIF MLLT+Y WIKA KTG+V+WS +C ++YFYMVS+WGGYV+ +NLI LHV++L+L  ++S+ +YVA+   Y  G + SMQI FVGFQP++S EH ++   F + Q + +V     KL   + +   K  + +  I L+S   ++ +  K+    PW+GRFYSL D +YA  NIPII SVSEHQPT W S +FDL +L+  +P G+++CF  L++ RIF+I+Y +T+ YFS++MVRL+L L P + I S I  + +LT + K            N +    D K       K  +  Y I ++V       +V    LI ++ HS + TS +YS+PSIV+S+   DG+++I DDFREAYYWL+ NT ++A++MSWWDYGYQIT MANRT +VDNNTWNN+HI+ VG+AM+  E  A +I+R LDV YVLVIFGGL G+S DDINKFLWMVRI    E  K + E+DY+T  GE+R+D+     +++ LMY++ YYRFGQ+    + P GYDR RNAEIG K ++L   EEA+T+E+WLVRIYK K
Sbjct:   49 DPYFNYRTTRFLAEEGFYKFHNWFDDRAWYPLGRIIGGTIYPGLMVTSAALYHILHFFHITINIRNVCVFLAPLFSSFTVVVTYHLTKELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSVYWSSMCGLAYFYMVSSWGGYVFLINLIPLHVLVLMLTGRFSHRIYVAYCTVYCLGTILSMQISFVGFQPVQSSEHMAAFGVFGLCQIHAFVDYLRSKLNTHQFEVLFKSVISLVGIVLLSVGAVLMVTGKIS---PWTGRFYSLLDPSYAKNNIPIIASVSEHQPTTWSSYYFDLQLLVFMFPVGLYYCFNNLSDARIFIIMYGVTSMYFSAVMVRLMLVLAPVMCILSGIGVSQVLTTYMK------------NLDVSRPDRK-----TKKQLDSTYPIKNEVASGMI--LVMAFFLITYTFHSTWVTSEAYSSPSIVLSARGGDGSRIIFDDFREAYYWLRHNTPEDAKVMSWWDYGYQITAMANRTILVDNNTWNNTHISRVGQAMASTEERAYEIMRELDVSYVLVIFGGLTGYSSDDINKFLWMVRIGGSTETGKHIKEHDYYTPTGEFRVDREGSPVLLNCLMYKMCYYRFGQVYTEGKRPPGYDRVRNAEIGNKDFELDVLEEAYTTEHWLVRIYKVK 695          
BLAST of dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B vs. Ensembl Medaka
Match: stt3a (STT3 oligosaccharyltransferase complex catalytic subunit A [Source:NCBI gene;Acc:101163628])

HSP 1 Score: 402.134 bits (1032), Expect = 5.464e-130
Identity = 204/404 (50.50%), Postives = 285/404 (70.54%), Query Frame = 3
Query:  135 DPWFNYRSTLELVERGFYKFLNWFDEKSWYPLGRIVGGTIFPGLMMTSGLFYNLLKQMSLHIEIRNVCVLLAPLYSCFTVIISFLLTKEIWNTNSGLICGCIMAIVPGYISRSSSGSYDNEGIAIFAMLLTFYFWIKATKTGTVFWSVLCSISYFYMVSAWGGYVYTLNLISLHVIILLLFQKYSNNLYVAFSVFYLFGLLFSMQIPFVGFQPLKSCEHASSACAFFVLQFYYYV----IKLEDIKIKNGLKLYLYIGPXXXXXXXXXXXXXTKLEILLPWSGRFYSLWDINYAAINIPIITSVSEHQPTAWQSTFFDLNVLMCFYPAGIWFCFKFLNNERIFLILYALTASYFSSIMVRLVLALTPAVAIGSSISFNMLLTYFEK-------LHKPTKELDKT 1313
            DP+FNYR+T  L E GFYKF NWFD+++WYPLGRI+GGTI+PGLM+TS   Y++L    + I IRNVCV LAPL+S FTV++++ LTKE+ +  +GL+   ++A+VPGYISRS +GSYDNEGIAIF MLLT+Y WIKA KTG+V+WS +C ++YFYMVS+WGGYV+ +NLI LHV++L+L  ++S+ +YVA+   Y  G + SMQI FVGFQP++S EH ++   F + Q + +V     KL   + +   K  + +  I L+S   ++ +  K+    PW+GRFYSL D +YA  NIPII SVSEHQPT W S +FDL +L+  +P G+++CF  L++ RIF+I+Y +T+ YFS++MVRL+L L P + I S I  + +LT + K         K  K+LD T
Sbjct:   49 DPYFNYRTTRFLAEEGFYKFHNWFDDRAWYPLGRIIGGTIYPGLMVTSAALYHILHFFHITINIRNVCVFLAPLFSSFTVVVTYHLTKELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSVYWSSMCGLAYFYMVSSWGGYVFLINLIPLHVLVLMLTGRFSHRIYVAYCTVYCLGTILSMQISFVGFQPVQSSEHMAAFGVFGLCQIHAFVDYLRSKLNTHQFEVLFKSVISLVGIVLLSVGAVLMVTGKIS---PWTGRFYSLLDPSYAKNNIPIIASVSEHQPTTWSSYYFDLQLLVFMFPVGLYYCFNNLSDARIFIIMYGVTSMYFSAVMVRLMLVLAPVMCILSGIGVSQVLTTYMKNLDVSRPDRKTKKQLDST 449          

HSP 2 Score: 234.187 bits (596), Expect = 8.847e-67
Identity = 106/178 (59.55%), Postives = 136/178 (76.40%), Query Frame = 3
Query: 1596 DEARIMSWWDYGYQITGMANRTTIVDNNTWNNSHIALVGKAMSMNETNAIKIIRLLDVDYVLVIFGGLIGFSGDDINKFLWMVRI-SEGEHPKEVYEYDYFTANGEYRIDKLAPKSMVDSLMYRLSYYRFGQIQIGKEFPTGYDRTRNAEIGLKYYKLKFFEEAFTSENWLVRIYKTK 2126
            ++A++MSWWDYGYQIT MANRT +VDNNTWNN+HI+ VG+AM+  E  A +I+R LDV YVLVIFGGL G+S DDINKFLWMVRI    E  K + E+DY+T  GE+R+D+     +++ LMY++ YYRFGQ+    + P GYDR RNAEIG K ++L   EEA+T+E+WLVRIYK K
Sbjct:  455 EDAKVMSWWDYGYQITAMANRTILVDNNTWNNTHISRVGQAMASTEERAYEIMRELDVSYVLVIFGGLTGYSSDDINKFLWMVRIGGSTETGKHIKEHDYYTPTGEFRVDREGSPVLLNCLMYKMCYYRFGQVYTEGKRPPGYDRVRNAEIGNKDFELDVLEEAYTTEHWLVRIYKVK 632          
BLAST of dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B vs. Planmine SMEST
Match: SMESG000073595.1 (SMESG000073595.1)

HSP 1 Score: 1476.46 bits (3821), Expect = 0.000e+0
Identity = 757/757 (100.00%), Postives = 757/757 (100.00%), Query Frame = 3
Query:    3 KVFAMLNKKILNLFPLVIIILSCVXXXXXXXXXXXXXXXXXXXXDPWFNYRSTLELVERGFYKFLNWFDEKSWYPLGRIVGGTIFPGLMMTSGLFYNLLKQMSLHIEIRNVCVLLAPLYSCFTVIISFLLTKEIWNTNSGLICGCIMAIVPGYISRSSSGSYDNEGIAIFAMLLTFYFWIKATKTGTVFWSVLCSISYFYMVSAWGGYVYTLNLISLHVIILLLFQKYSNNLYVAFSVFYLFGLLFSMQIPFVGFQPLKSCEHASSACAFFVLQFYYYVIKLEDIKIKNGLKLYLYIGPXXXXXXXXXXXXXTKLEILLPWSGRFYSLWDINYAAINIPIITSVSEHQPTAWQSTFFDLNVLMCFYPAGIWFCFKFLNNERIFLILYALTASYFSSIMVRLVLALTPAVAIGSSISFNMLLTYFEKLHKPTKELDKTENFECVTIDSKGDGFCENKANEINYEIIHKVIHNYFSTVVCIVILIHFSIHSIFATSTSYSNPSIVMSSTLPDGNKVIIDDFREAYYWLKQNTKDEARIMSWWDYGYQITGMANRTTIVDNNTWNNSHIALVGKAMSMNETNAIKIIRLLDVDYVLVIFGGLIGFSGDDINKFLWMVRISEGEHPKEVYEYDYFTANGEYRIDKLAPKSMVDSLMYRLSYYRFGQIQIGKEFPTGYDRTRNAEIGLKYYKLKFFEEAFTSENWLVRIYKTKLRNFRISLKHARKKNKVFASQKRLRKMKGALKFPRIITRGIKKNSYPFT 2273
            KVFAMLNKKILNLFPLVIIILSCVLSFIIRLFSIISFESIIHEFDPWFNYRSTLELVERGFYKFLNWFDEKSWYPLGRIVGGTIFPGLMMTSGLFYNLLKQMSLHIEIRNVCVLLAPLYSCFTVIISFLLTKEIWNTNSGLICGCIMAIVPGYISRSSSGSYDNEGIAIFAMLLTFYFWIKATKTGTVFWSVLCSISYFYMVSAWGGYVYTLNLISLHVIILLLFQKYSNNLYVAFSVFYLFGLLFSMQIPFVGFQPLKSCEHASSACAFFVLQFYYYVIKLEDIKIKNGLKLYLYIGPIALISCALIIALLTKLEILLPWSGRFYSLWDINYAAINIPIITSVSEHQPTAWQSTFFDLNVLMCFYPAGIWFCFKFLNNERIFLILYALTASYFSSIMVRLVLALTPAVAIGSSISFNMLLTYFEKLHKPTKELDKTENFECVTIDSKGDGFCENKANEINYEIIHKVIHNYFSTVVCIVILIHFSIHSIFATSTSYSNPSIVMSSTLPDGNKVIIDDFREAYYWLKQNTKDEARIMSWWDYGYQITGMANRTTIVDNNTWNNSHIALVGKAMSMNETNAIKIIRLLDVDYVLVIFGGLIGFSGDDINKFLWMVRISEGEHPKEVYEYDYFTANGEYRIDKLAPKSMVDSLMYRLSYYRFGQIQIGKEFPTGYDRTRNAEIGLKYYKLKFFEEAFTSENWLVRIYKTKLRNFRISLKHARKKNKVFASQKRLRKMKGALKFPRIITRGIKKNSYPFT
Sbjct:    7 KVFAMLNKKILNLFPLVIIILSCVLSFIIRLFSIISFESIIHEFDPWFNYRSTLELVERGFYKFLNWFDEKSWYPLGRIVGGTIFPGLMMTSGLFYNLLKQMSLHIEIRNVCVLLAPLYSCFTVIISFLLTKEIWNTNSGLICGCIMAIVPGYISRSSSGSYDNEGIAIFAMLLTFYFWIKATKTGTVFWSVLCSISYFYMVSAWGGYVYTLNLISLHVIILLLFQKYSNNLYVAFSVFYLFGLLFSMQIPFVGFQPLKSCEHASSACAFFVLQFYYYVIKLEDIKIKNGLKLYLYIGPIALISCALIIALLTKLEILLPWSGRFYSLWDINYAAINIPIITSVSEHQPTAWQSTFFDLNVLMCFYPAGIWFCFKFLNNERIFLILYALTASYFSSIMVRLVLALTPAVAIGSSISFNMLLTYFEKLHKPTKELDKTENFECVTIDSKGDGFCENKANEINYEIIHKVIHNYFSTVVCIVILIHFSIHSIFATSTSYSNPSIVMSSTLPDGNKVIIDDFREAYYWLKQNTKDEARIMSWWDYGYQITGMANRTTIVDNNTWNNSHIALVGKAMSMNETNAIKIIRLLDVDYVLVIFGGLIGFSGDDINKFLWMVRISEGEHPKEVYEYDYFTANGEYRIDKLAPKSMVDSLMYRLSYYRFGQIQIGKEFPTGYDRTRNAEIGLKYYKLKFFEEAFTSENWLVRIYKTKLRNFRISLKHARKKNKVFASQKRLRKMKGALKFPRIITRGIKKNSYPFT 763          
BLAST of dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B vs. Planmine SMEST
Match: SMESG000073595.1 (SMESG000073595.1)

HSP 1 Score: 1468.37 bits (3800), Expect = 0.000e+0
Identity = 753/753 (100.00%), Postives = 753/753 (100.00%), Query Frame = 3
Query:   15 MLNKKILNLFPLVIIILSCVXXXXXXXXXXXXXXXXXXXXDPWFNYRSTLELVERGFYKFLNWFDEKSWYPLGRIVGGTIFPGLMMTSGLFYNLLKQMSLHIEIRNVCVLLAPLYSCFTVIISFLLTKEIWNTNSGLICGCIMAIVPGYISRSSSGSYDNEGIAIFAMLLTFYFWIKATKTGTVFWSVLCSISYFYMVSAWGGYVYTLNLISLHVIILLLFQKYSNNLYVAFSVFYLFGLLFSMQIPFVGFQPLKSCEHASSACAFFVLQFYYYVIKLEDIKIKNGLKLYLYIGPXXXXXXXXXXXXXTKLEILLPWSGRFYSLWDINYAAINIPIITSVSEHQPTAWQSTFFDLNVLMCFYPAGIWFCFKFLNNERIFLILYALTASYFSSIMVRLVLALTPAVAIGSSISFNMLLTYFEKLHKPTKELDKTENFECVTIDSKGDGFCENKANEINYEIIHKVIHNYFSTVVCIVILIHFSIHSIFATSTSYSNPSIVMSSTLPDGNKVIIDDFREAYYWLKQNTKDEARIMSWWDYGYQITGMANRTTIVDNNTWNNSHIALVGKAMSMNETNAIKIIRLLDVDYVLVIFGGLIGFSGDDINKFLWMVRISEGEHPKEVYEYDYFTANGEYRIDKLAPKSMVDSLMYRLSYYRFGQIQIGKEFPTGYDRTRNAEIGLKYYKLKFFEEAFTSENWLVRIYKTKLRNFRISLKHARKKNKVFASQKRLRKMKGALKFPRIITRGIKKNSYPFT 2273
            MLNKKILNLFPLVIIILSCVLSFIIRLFSIISFESIIHEFDPWFNYRSTLELVERGFYKFLNWFDEKSWYPLGRIVGGTIFPGLMMTSGLFYNLLKQMSLHIEIRNVCVLLAPLYSCFTVIISFLLTKEIWNTNSGLICGCIMAIVPGYISRSSSGSYDNEGIAIFAMLLTFYFWIKATKTGTVFWSVLCSISYFYMVSAWGGYVYTLNLISLHVIILLLFQKYSNNLYVAFSVFYLFGLLFSMQIPFVGFQPLKSCEHASSACAFFVLQFYYYVIKLEDIKIKNGLKLYLYIGPIALISCALIIALLTKLEILLPWSGRFYSLWDINYAAINIPIITSVSEHQPTAWQSTFFDLNVLMCFYPAGIWFCFKFLNNERIFLILYALTASYFSSIMVRLVLALTPAVAIGSSISFNMLLTYFEKLHKPTKELDKTENFECVTIDSKGDGFCENKANEINYEIIHKVIHNYFSTVVCIVILIHFSIHSIFATSTSYSNPSIVMSSTLPDGNKVIIDDFREAYYWLKQNTKDEARIMSWWDYGYQITGMANRTTIVDNNTWNNSHIALVGKAMSMNETNAIKIIRLLDVDYVLVIFGGLIGFSGDDINKFLWMVRISEGEHPKEVYEYDYFTANGEYRIDKLAPKSMVDSLMYRLSYYRFGQIQIGKEFPTGYDRTRNAEIGLKYYKLKFFEEAFTSENWLVRIYKTKLRNFRISLKHARKKNKVFASQKRLRKMKGALKFPRIITRGIKKNSYPFT
Sbjct:    1 MLNKKILNLFPLVIIILSCVLSFIIRLFSIISFESIIHEFDPWFNYRSTLELVERGFYKFLNWFDEKSWYPLGRIVGGTIFPGLMMTSGLFYNLLKQMSLHIEIRNVCVLLAPLYSCFTVIISFLLTKEIWNTNSGLICGCIMAIVPGYISRSSSGSYDNEGIAIFAMLLTFYFWIKATKTGTVFWSVLCSISYFYMVSAWGGYVYTLNLISLHVIILLLFQKYSNNLYVAFSVFYLFGLLFSMQIPFVGFQPLKSCEHASSACAFFVLQFYYYVIKLEDIKIKNGLKLYLYIGPIALISCALIIALLTKLEILLPWSGRFYSLWDINYAAINIPIITSVSEHQPTAWQSTFFDLNVLMCFYPAGIWFCFKFLNNERIFLILYALTASYFSSIMVRLVLALTPAVAIGSSISFNMLLTYFEKLHKPTKELDKTENFECVTIDSKGDGFCENKANEINYEIIHKVIHNYFSTVVCIVILIHFSIHSIFATSTSYSNPSIVMSSTLPDGNKVIIDDFREAYYWLKQNTKDEARIMSWWDYGYQITGMANRTTIVDNNTWNNSHIALVGKAMSMNETNAIKIIRLLDVDYVLVIFGGLIGFSGDDINKFLWMVRISEGEHPKEVYEYDYFTANGEYRIDKLAPKSMVDSLMYRLSYYRFGQIQIGKEFPTGYDRTRNAEIGLKYYKLKFFEEAFTSENWLVRIYKTKLRNFRISLKHARKKNKVFASQKRLRKMKGALKFPRIITRGIKKNSYPFT 753          
BLAST of dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B vs. Planmine SMEST
Match: SMESG000073595.1 (SMESG000073595.1)

HSP 1 Score: 1344.72 bits (3479), Expect = 0.000e+0
Identity = 669/669 (100.00%), Postives = 669/669 (100.00%), Query Frame = 3
Query:  267 MMTSGLFYNLLKQMSLHIEIRNVCVLLAPLYSCFTVIISFLLTKEIWNTNSGLICGCIMAIVPGYISRSSSGSYDNEGIAIFAMLLTFYFWIKATKTGTVFWSVLCSISYFYMVSAWGGYVYTLNLISLHVIILLLFQKYSNNLYVAFSVFYLFGLLFSMQIPFVGFQPLKSCEHASSACAFFVLQFYYYVIKLEDIKIKNGLKLYLYIGPXXXXXXXXXXXXXTKLEILLPWSGRFYSLWDINYAAINIPIITSVSEHQPTAWQSTFFDLNVLMCFYPAGIWFCFKFLNNERIFLILYALTASYFSSIMVRLVLALTPAVAIGSSISFNMLLTYFEKLHKPTKELDKTENFECVTIDSKGDGFCENKANEINYEIIHKVIHNYFSTVVCIVILIHFSIHSIFATSTSYSNPSIVMSSTLPDGNKVIIDDFREAYYWLKQNTKDEARIMSWWDYGYQITGMANRTTIVDNNTWNNSHIALVGKAMSMNETNAIKIIRLLDVDYVLVIFGGLIGFSGDDINKFLWMVRISEGEHPKEVYEYDYFTANGEYRIDKLAPKSMVDSLMYRLSYYRFGQIQIGKEFPTGYDRTRNAEIGLKYYKLKFFEEAFTSENWLVRIYKTKLRNFRISLKHARKKNKVFASQKRLRKMKGALKFPRIITRGIKKNSYPFT 2273
            MMTSGLFYNLLKQMSLHIEIRNVCVLLAPLYSCFTVIISFLLTKEIWNTNSGLICGCIMAIVPGYISRSSSGSYDNEGIAIFAMLLTFYFWIKATKTGTVFWSVLCSISYFYMVSAWGGYVYTLNLISLHVIILLLFQKYSNNLYVAFSVFYLFGLLFSMQIPFVGFQPLKSCEHASSACAFFVLQFYYYVIKLEDIKIKNGLKLYLYIGPIALISCALIIALLTKLEILLPWSGRFYSLWDINYAAINIPIITSVSEHQPTAWQSTFFDLNVLMCFYPAGIWFCFKFLNNERIFLILYALTASYFSSIMVRLVLALTPAVAIGSSISFNMLLTYFEKLHKPTKELDKTENFECVTIDSKGDGFCENKANEINYEIIHKVIHNYFSTVVCIVILIHFSIHSIFATSTSYSNPSIVMSSTLPDGNKVIIDDFREAYYWLKQNTKDEARIMSWWDYGYQITGMANRTTIVDNNTWNNSHIALVGKAMSMNETNAIKIIRLLDVDYVLVIFGGLIGFSGDDINKFLWMVRISEGEHPKEVYEYDYFTANGEYRIDKLAPKSMVDSLMYRLSYYRFGQIQIGKEFPTGYDRTRNAEIGLKYYKLKFFEEAFTSENWLVRIYKTKLRNFRISLKHARKKNKVFASQKRLRKMKGALKFPRIITRGIKKNSYPFT
Sbjct:    1 MMTSGLFYNLLKQMSLHIEIRNVCVLLAPLYSCFTVIISFLLTKEIWNTNSGLICGCIMAIVPGYISRSSSGSYDNEGIAIFAMLLTFYFWIKATKTGTVFWSVLCSISYFYMVSAWGGYVYTLNLISLHVIILLLFQKYSNNLYVAFSVFYLFGLLFSMQIPFVGFQPLKSCEHASSACAFFVLQFYYYVIKLEDIKIKNGLKLYLYIGPIALISCALIIALLTKLEILLPWSGRFYSLWDINYAAINIPIITSVSEHQPTAWQSTFFDLNVLMCFYPAGIWFCFKFLNNERIFLILYALTASYFSSIMVRLVLALTPAVAIGSSISFNMLLTYFEKLHKPTKELDKTENFECVTIDSKGDGFCENKANEINYEIIHKVIHNYFSTVVCIVILIHFSIHSIFATSTSYSNPSIVMSSTLPDGNKVIIDDFREAYYWLKQNTKDEARIMSWWDYGYQITGMANRTTIVDNNTWNNSHIALVGKAMSMNETNAIKIIRLLDVDYVLVIFGGLIGFSGDDINKFLWMVRISEGEHPKEVYEYDYFTANGEYRIDKLAPKSMVDSLMYRLSYYRFGQIQIGKEFPTGYDRTRNAEIGLKYYKLKFFEEAFTSENWLVRIYKTKLRNFRISLKHARKKNKVFASQKRLRKMKGALKFPRIITRGIKKNSYPFT 669          
BLAST of dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B vs. Planmine SMEST
Match: SMESG000073595.1 (SMESG000073595.1)

HSP 1 Score: 1342.41 bits (3473), Expect = 0.000e+0
Identity = 668/668 (100.00%), Postives = 668/668 (100.00%), Query Frame = 3
Query:  270 MTSGLFYNLLKQMSLHIEIRNVCVLLAPLYSCFTVIISFLLTKEIWNTNSGLICGCIMAIVPGYISRSSSGSYDNEGIAIFAMLLTFYFWIKATKTGTVFWSVLCSISYFYMVSAWGGYVYTLNLISLHVIILLLFQKYSNNLYVAFSVFYLFGLLFSMQIPFVGFQPLKSCEHASSACAFFVLQFYYYVIKLEDIKIKNGLKLYLYIGPXXXXXXXXXXXXXTKLEILLPWSGRFYSLWDINYAAINIPIITSVSEHQPTAWQSTFFDLNVLMCFYPAGIWFCFKFLNNERIFLILYALTASYFSSIMVRLVLALTPAVAIGSSISFNMLLTYFEKLHKPTKELDKTENFECVTIDSKGDGFCENKANEINYEIIHKVIHNYFSTVVCIVILIHFSIHSIFATSTSYSNPSIVMSSTLPDGNKVIIDDFREAYYWLKQNTKDEARIMSWWDYGYQITGMANRTTIVDNNTWNNSHIALVGKAMSMNETNAIKIIRLLDVDYVLVIFGGLIGFSGDDINKFLWMVRISEGEHPKEVYEYDYFTANGEYRIDKLAPKSMVDSLMYRLSYYRFGQIQIGKEFPTGYDRTRNAEIGLKYYKLKFFEEAFTSENWLVRIYKTKLRNFRISLKHARKKNKVFASQKRLRKMKGALKFPRIITRGIKKNSYPFT 2273
            MTSGLFYNLLKQMSLHIEIRNVCVLLAPLYSCFTVIISFLLTKEIWNTNSGLICGCIMAIVPGYISRSSSGSYDNEGIAIFAMLLTFYFWIKATKTGTVFWSVLCSISYFYMVSAWGGYVYTLNLISLHVIILLLFQKYSNNLYVAFSVFYLFGLLFSMQIPFVGFQPLKSCEHASSACAFFVLQFYYYVIKLEDIKIKNGLKLYLYIGPIALISCALIIALLTKLEILLPWSGRFYSLWDINYAAINIPIITSVSEHQPTAWQSTFFDLNVLMCFYPAGIWFCFKFLNNERIFLILYALTASYFSSIMVRLVLALTPAVAIGSSISFNMLLTYFEKLHKPTKELDKTENFECVTIDSKGDGFCENKANEINYEIIHKVIHNYFSTVVCIVILIHFSIHSIFATSTSYSNPSIVMSSTLPDGNKVIIDDFREAYYWLKQNTKDEARIMSWWDYGYQITGMANRTTIVDNNTWNNSHIALVGKAMSMNETNAIKIIRLLDVDYVLVIFGGLIGFSGDDINKFLWMVRISEGEHPKEVYEYDYFTANGEYRIDKLAPKSMVDSLMYRLSYYRFGQIQIGKEFPTGYDRTRNAEIGLKYYKLKFFEEAFTSENWLVRIYKTKLRNFRISLKHARKKNKVFASQKRLRKMKGALKFPRIITRGIKKNSYPFT
Sbjct:    1 MTSGLFYNLLKQMSLHIEIRNVCVLLAPLYSCFTVIISFLLTKEIWNTNSGLICGCIMAIVPGYISRSSSGSYDNEGIAIFAMLLTFYFWIKATKTGTVFWSVLCSISYFYMVSAWGGYVYTLNLISLHVIILLLFQKYSNNLYVAFSVFYLFGLLFSMQIPFVGFQPLKSCEHASSACAFFVLQFYYYVIKLEDIKIKNGLKLYLYIGPIALISCALIIALLTKLEILLPWSGRFYSLWDINYAAINIPIITSVSEHQPTAWQSTFFDLNVLMCFYPAGIWFCFKFLNNERIFLILYALTASYFSSIMVRLVLALTPAVAIGSSISFNMLLTYFEKLHKPTKELDKTENFECVTIDSKGDGFCENKANEINYEIIHKVIHNYFSTVVCIVILIHFSIHSIFATSTSYSNPSIVMSSTLPDGNKVIIDDFREAYYWLKQNTKDEARIMSWWDYGYQITGMANRTTIVDNNTWNNSHIALVGKAMSMNETNAIKIIRLLDVDYVLVIFGGLIGFSGDDINKFLWMVRISEGEHPKEVYEYDYFTANGEYRIDKLAPKSMVDSLMYRLSYYRFGQIQIGKEFPTGYDRTRNAEIGLKYYKLKFFEEAFTSENWLVRIYKTKLRNFRISLKHARKKNKVFASQKRLRKMKGALKFPRIITRGIKKNSYPFT 668          
BLAST of dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B vs. Planmine SMEST
Match: SMESG000013115.1 (SMESG000013115.1)

HSP 1 Score: 686.026 bits (1769), Expect = 0.000e+0
Identity = 338/678 (49.85%), Postives = 472/678 (69.62%), Query Frame = 3
Query:  135 DPWFNYRSTLELVERGFYKFLNWFDEKSWYPLGRIVGGTIFPGLMMTSGLFYNLLKQMSLHIEIRNVCVLLAPLYSCFTVIISFLLTKEIWNTNSGLICGCIMAIVPGYISRSSSGSYDNEGIAIFAMLLTFYFWIKATKTGTVFWSVLCSISYFYMVSAWGGYVYTLNLISLHVIILLLFQKYSNNLYVAFSVFYLFGLLFSMQIPFVGFQPLKSCEHASSACAFFVLQFYYYV----IKLEDIKIKNGLKLYLYIGPXXXXXXXXXXXXXTKLEILLPWSGRFYSLWDINYAAINIPIITSVSEHQPTAWQSTFFDLNVLMCFYPAGIWFCFKFLNNERIFLILYALTASYFSSIMVRLVLALTPAVAIGSSISFNMLLTYFEKLHKPTKE------LDKTENFECVTIDSKGDGFCENKANEINYEIIHKVIHNYFSTVVCIVILIHFSIHSIFATSTSYSNPSIVMSSTLPDGNKVIIDDFREAYYWLKQNTKDEARIMSWWDYGYQITGMANRTTIVDNNTWNNSHIALVGKAMSMNETNAIKIIRLLDVDYVLVIFGGLIGFSGDDINKFLWMVRIS----EGEHPKEVYEYDYFTANGEYRIDKLAPKSMVDSLMYRLSYYRFGQIQIGKEFPTGYDRTRNAEIGLKYYKLKFFEEAFTSENWLVRIYKTK 2126
            DP+FNYR+T  L E GFY+F NWFD+ +WYPLGRI+GGTI+PGLM+TS LFYN+L   ++ ++IRN+CV LAPL+S FT II++ LT E+ ++ +GLI   ++++VPGYISRS +GSYDNEGIAIF M+LTFY W+K+ KTG++FWS LCS++YFYMVS+WGGYV+ +N+I +HV++L++  ++++ +YVA+S  Y  G + SMQI FVGF P++S EH  +   F + Q + +V     ++ +   K   K  + I  I + +  ++++L  K+    PW+GRFYSL D +YA  NIPII SVSEHQPTAW S +FDL  L   +P G+++CFK LNNE IF+I Y + + YF+ +MVRL+L L P + I + I+ + +L  + K     +       L+   N +  +  +K      +    +  E+   V+      V+  V L  +S H I+ TS +YS+PSIV+S+   D +++I DDFREAYYWL+QNT + A+IMSWWDYGYQIT MANRT +VDNNTWNN+HI+ VG+AM+ NE  A  I+R LDVDYVLVIFGG+ G+S DDINKFLWMVRI     EG H KE    DY+T  GE+R+DK+  +++++ LMY++SYY F ++      P GYDR RNAEIG K ++L+  EEA+T+E+WLVRIYK K
Sbjct:   50 DPYFNYRTTKYLTEEGFYQFHNWFDDSAWYPLGRIIGGTIYPGLMVTSALFYNVLHIFNITVDIRNICVFLAPLFSSFTTIITYKLTTELKDSGAGLIAAALISVVPGYISRSVAGSYDNEGIAIFCMILTFYLWVKSIKTGSIFWSSLCSVAYFYMVSSWGGYVFLINVIPIHVLVLMITGRFNHQVYVAYSTLYCVGTVLSMQISFVGFLPVQSSEHMGALGVFGLCQIHAFVDYVRSRMSNDNFKRLFKAIVLITGIIVSAIGVVLSLSGKVA---PWTGRFYSLLDPSYAKNNIPIIASVSEHQPTAWSSFYFDLQFLTIMFPVGLYYCFKNLNNENIFIISYGVFSIYFAGVMVRLMLVLAPVMCILTGIAVSCILKTYIKNANLGQNVSLPHLLNPLSNGDSASKTTKSKKSVYDATYPMKTEVATGVV------VIITVFLCLYSQHCIWVTSEAYSSPSIVLSARGSDNSRIIFDDFREAYYWLRQNTPENAKIMSWWDYGYQITAMANRTILVDNNTWNNTHISRVGQAMASNEDRAYPIMRQLDVDYVLVIFGGVTGYSSDDINKFLWMVRIGGSTPEGHHIKES---DYYTPQGEFRVDKMGSETLLNCLMYKMSYYNFDKMYTEGGKPPGYDRVRNAEIGNKNFELETLEEAYTTEHWLVRIYKVK 715          
The following BLAST results are available for this feature:
BLAST of dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
STT3B0.000e+053.93STT3 oligosaccharyltransferase complex catalytic s... [more]
STT3A0.000e+049.93STT3 oligosaccharyltransferase complex catalytic s... [more]
STT3A0.000e+049.93STT3 oligosaccharyltransferase complex catalytic s... [more]
STT3A0.000e+049.93STT3 oligosaccharyltransferase complex catalytic s... [more]
STT3A0.000e+048.32STT3 oligosaccharyltransferase complex catalytic s... [more]
back to top
BLAST of dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
stt-30.000e+049.50Dolichyl-diphosphooligosaccharide--protein glycosy... [more]
stt-30.000e+049.50Dolichyl-diphosphooligosaccharide--protein glycosy... [more]
back to top
BLAST of dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Stt3B0.000e+051.39gene:FBgn0011336 transcript:FBtr0084786[more]
Stt3A0.000e+050.64gene:FBgn0031149 transcript:FBtr0077264[more]
Stt3A0.000e+050.64gene:FBgn0031149 transcript:FBtr0345923[more]
back to top
BLAST of dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
stt3b0.000e+053.45STT3 oligosaccharyltransferase complex catalytic s... [more]
stt3b0.000e+054.34STT3 oligosaccharyltransferase complex catalytic s... [more]
stt3a0.000e+049.93STT3 oligosaccharyltransferase complex catalytic s... [more]
stt3a0.000e+049.60STT3 oligosaccharyltransferase complex catalytic s... [more]
back to top
BLAST of dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arhgef250.000e+052.99Rho guanine nucleotide exchange factor 25 [Source:... [more]
arhgef250.000e+054.45Rho guanine nucleotide exchange factor 25 [Source:... [more]
arhgef250.000e+054.45Rho guanine nucleotide exchange factor 25 [Source:... [more]
arhgef250.000e+051.81Rho guanine nucleotide exchange factor 25 [Source:... [more]
arhgef250.000e+051.99Rho guanine nucleotide exchange factor 25 [Source:... [more]
back to top
BLAST of dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Stt3b0.000e+053.79STT3, subunit of the oligosaccharyltransferase com... [more]
Stt3a0.000e+049.93STT3, subunit of the oligosaccharyltransferase com... [more]
Stt3a2.926e-4361.26STT3, subunit of the oligosaccharyltransferase com... [more]
Stt3a3.650e-1760.76STT3, subunit of the oligosaccharyltransferase com... [more]
back to top
BLAST of dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8TCJ2|STT3B_HUMAN0.000e+053.93Dolichyl-diphosphooligosaccharide--protein glycosy... [more]
sp|E2RG47|STT3B_CANLF0.000e+053.79Dolichyl-diphosphooligosaccharide--protein glycosy... [more]
sp|Q3TDQ1|STT3B_MOUSE0.000e+053.79Dolichyl-diphosphooligosaccharide--protein glycosy... [more]
sp|P46975|STT3_CAEEL0.000e+049.50Dolichyl-diphosphooligosaccharide--protein glycosy... [more]
sp|Q2KJI2|STT3A_BOVIN0.000e+050.07Dolichyl-diphosphooligosaccharide--protein glycosy... [more]
back to top
BLAST of dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K9IN160.000e+053.59Putative dolichyl-diphosphooligosaccharide--protei... [more]
A0A3P9LK950.000e+052.89STT3 oligosaccharyltransferase complex catalytic s... [more]
A0A3B4ZUH30.000e+053.11STT3 oligosaccharyltransferase complex catalytic s... [more]
G1QVW30.000e+054.04STT3 oligosaccharyltransferase complex catalytic s... [more]
A0A3Q3KQD00.000e+053.11STT3 oligosaccharyltransferase complex catalytic s... [more]
back to top
BLAST of dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
stt3b0.000e+053.88dolichyl-diphosphooligosaccharide--protein glycosy... [more]
ENSAMXT00000021004.20.000e+052.92dolichyl-diphosphooligosaccharide--protein glycosy... [more]
stt3a0.000e+050.52STT3 oligosaccharyltransferase complex catalytic s... [more]
back to top
BLAST of dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
stt3b0.000e+051.92STT3 oligosaccharyltransferase complex catalytic s... [more]
ENSPMAT00000004958.10.000e+050.45pep scaffold:Pmarinus_7.0:GL478327:30718:48810:-1 ... [more]
back to top
BLAST of dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
STT30.000e+046.08Subunit of the oligosaccharyltransferase complex o... [more]
back to top
BLAST of dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO490260.000e+051.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO463430.000e+050.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
STT3B0.000e+052.59dolichyl-diphosphooligosaccharide--protein glycosy... [more]
stt3b0.000e+052.75dolichyl-diphosphooligosaccharide--protein glycosy... [more]
STT3B0.000e+052.45dolichyl-diphosphooligosaccharide--protein glycosy... [more]
stt3a0.000e+050.97STT3 oligosaccharyltransferase complex catalytic s... [more]
stt3a5.464e-13050.50STT3 oligosaccharyltransferase complex catalytic s... [more]
back to top
BLAST of dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000073595.10.000e+0100.00SMESG000073595.1[more]
SMESG000073595.10.000e+0100.00SMESG000073595.1[more]
SMESG000073595.10.000e+0100.00SMESG000073595.1[more]
SMESG000073595.10.000e+0100.00SMESG000073595.1[more]
SMESG000013115.10.000e+049.85SMESG000013115.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019145 ID=SMED30019145|Name=dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B|organism=Schmidtea mediterranea sexual|type=transcript|length=2340bp
TCAAAGTTTTCGCGATGTTGAATAAAAAGATATTAAATTTATTTCCTTTA
GTTATTATAATACTTTCATGTGTTTTAAGCTTTATTATAAGACTTTTTTC
GATAATAAGTTTTGAAAGCATTATACATGAATTTGATCCTTGGTTTAATT
ACCGTTCTACTCTGGAACTTGTTGAACGTGGATTTTACAAATTTTTAAAT
TGGTTTGATGAAAAATCTTGGTATCCACTGGGCAGAATAGTTGGTGGAAC
AATTTTTCCTGGATTAATGATGACATCAGGATTATTTTACAATTTATTGA
AACAGATGTCATTACACATAGAAATCAGAAATGTTTGTGTTTTATTAGCT
CCTTTGTATAGTTGTTTTACTGTAATTATTTCTTTTCTTTTAACGAAAGA
AATATGGAATACAAATTCCGGTTTAATATGCGGTTGTATTATGGCTATCG
TTCCTGGTTACATTAGTAGAAGTTCTTCCGGGAGTTATGATAACGAAGGG
ATTGCAATTTTTGCAATGCTTTTAACATTTTACTTTTGGATTAAGGCTAC
TAAAACCGGAACTGTATTTTGGAGTGTTTTGTGTTCCATAAGTTATTTTT
ATATGGTTTCCGCATGGGGAGGATACGTTTATACATTAAACTTGATTTCA
TTGCATGTCATCATTCTTCTATTATTTCAAAAGTATTCAAATAATTTATA
TGTAGCATTTTCGGTGTTTTACTTATTTGGTTTATTGTTTTCAATGCAAA
TACCGTTTGTTGGCTTTCAACCTCTGAAATCTTGTGAACATGCATCATCT
GCATGTGCGTTTTTCGTACTTCAATTTTATTATTATGTGATCAAATTGGA
GGATATTAAAATAAAAAATGGATTAAAATTATATTTGTATATTGGTCCAA
TAGCTTTGATTTCATGTGCTTTAATAATAGCTCTTCTCACTAAATTAGAA
ATTTTGTTACCATGGAGTGGAAGATTTTATTCATTATGGGATATCAATTA
TGCTGCTATAAATATACCTATTATAACTTCAGTATCGGAACATCAACCTA
CGGCATGGCAATCTACTTTTTTTGATTTGAATGTATTGATGTGTTTCTAT
CCCGCCGGAATATGGTTTTGTTTTAAATTTTTAAACAACGAAAGAATATT
TTTGATTCTTTACGCTCTAACTGCTTCATATTTTTCAAGTATTATGGTGA
GACTTGTATTGGCACTCACTCCAGCAGTGGCAATTGGCAGTTCAATAAGC
TTTAATATGCTTTTAACTTATTTTGAAAAGTTGCATAAACCAACAAAGGA
ATTGGATAAAACTGAAAATTTTGAATGTGTTACAATTGACAGTAAAGGAG
ATGGATTTTGTGAAAATAAAGCTAATGAAATAAATTATGAAATAATCCAC
AAAGTGATTCATAATTATTTCTCCACTGTAGTTTGTATTGTGATTCTAAT
ACATTTTTCAATCCATTCAATATTTGCCACCTCAACGTCTTATTCAAATC
CTTCTATTGTTATGTCTTCAACCTTACCAGATGGTAATAAAGTAATAATT
GATGACTTTAGGGAAGCATATTATTGGCTAAAACAAAATACAAAAGATGA
AGCACGAATTATGTCATGGTGGGATTATGGGTATCAAATAACCGGTATGG
CAAATAGGACAACTATTGTTGATAATAATACATGGAATAATTCGCATATT
GCTTTGGTAGGTAAAGCCATGTCAATGAATGAAACAAATGCTATTAAAAT
AATCCGACTTCTCGACGTTGATTATGTTTTAGTGATTTTTGGTGGACTAA
TCGGGTTTTCTGGAGATGATATTAATAAATTTCTTTGGATGGTCAGAATT
TCTGAAGGAGAACATCCTAAAGAGGTTTATGAATATGATTATTTTACTGC
AAACGGAGAATATCGAATTGATAAACTTGCTCCAAAGTCAATGGTTGATA
GTCTGATGTACAGATTGAGTTACTACAGATTTGGACAAATACAAATTGGA
AAAGAATTTCCAACTGGATATGATAGAACAAGAAATGCTGAAATAGGTTT
AAAATATTATAAATTAAAGTTCTTCGAAGAGGCTTTTACTTCTGAAAACT
GGCTAGTTCGGATATATAAAACAAAGTTGAGGAATTTCCGCATATCATTA
AAGCATGCCAGGAAAAAAAATAAAGTTTTTGCTTCACAAAAACGTCTAAG
AAAAATGAAAGGCGCTTTAAAATTTCCTAGAATTATCACAAGAGGTATTA
AAAAAAACTCTTACCCATTTACTTAACAATAAAAATTTAATGTTTTAAAG
TTTTAAAAGCTAAAATATATGTATTCGTTTTAAAAAAAAA
back to top

protein sequence of SMED30019145-orf-1

>SMED30019145-orf-1 ID=SMED30019145-orf-1|Name=SMED30019145-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=758bp
KVFAMLNKKILNLFPLVIIILSCVLSFIIRLFSIISFESIIHEFDPWFNY
RSTLELVERGFYKFLNWFDEKSWYPLGRIVGGTIFPGLMMTSGLFYNLLK
QMSLHIEIRNVCVLLAPLYSCFTVIISFLLTKEIWNTNSGLICGCIMAIV
PGYISRSSSGSYDNEGIAIFAMLLTFYFWIKATKTGTVFWSVLCSISYFY
MVSAWGGYVYTLNLISLHVIILLLFQKYSNNLYVAFSVFYLFGLLFSMQI
PFVGFQPLKSCEHASSACAFFVLQFYYYVIKLEDIKIKNGLKLYLYIGPI
ALISCALIIALLTKLEILLPWSGRFYSLWDINYAAINIPIITSVSEHQPT
AWQSTFFDLNVLMCFYPAGIWFCFKFLNNERIFLILYALTASYFSSIMVR
LVLALTPAVAIGSSISFNMLLTYFEKLHKPTKELDKTENFECVTIDSKGD
GFCENKANEINYEIIHKVIHNYFSTVVCIVILIHFSIHSIFATSTSYSNP
SIVMSSTLPDGNKVIIDDFREAYYWLKQNTKDEARIMSWWDYGYQITGMA
NRTTIVDNNTWNNSHIALVGKAMSMNETNAIKIIRLLDVDYVLVIFGGLI
GFSGDDINKFLWMVRISEGEHPKEVYEYDYFTANGEYRIDKLAPKSMVDS
LMYRLSYYRFGQIQIGKEFPTGYDRTRNAEIGLKYYKLKFFEEAFTSENW
LVRIYKTKLRNFRISLKHARKKNKVFASQKRLRKMKGALKFPRIITRGIK
KNSYPFT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR003674Oligo_trans_STT3
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005783endoplasmic reticulum
GO:0005789endoplasmic reticulum membrane
GO:0008250oligosaccharyltransferase complex
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0004576oligosaccharyl transferase activity
GO:0004579dolichyl-diphosphooligosaccharide-protein glycotransferase activity
GO:0016740transferase activity
GO:0016757transferase activity, transferring glycosyl groups
Vocabulary: biological process
TermDefinition
GO:0006486protein glycosylation
GO:0006516glycoprotein catabolic process
GO:0006986response to unfolded protein
GO:0018279protein N-linked glycosylation via asparagine
GO:0030433ubiquitin-dependent ERAD pathway
GO:0043686co-translational protein modification
GO:0043687post-translational protein modification
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.40.50.12610coord: 513..688
e-value: 6.5E-33
score: 116.4
NoneNo IPR availablePANTHERPTHR1387260S RIBOSOMAL PROTEIN L35coord: 8..725
NoneNo IPR availableTMHMMTMhelixcoord: 134..154
NoneNo IPR availableTMHMMTMhelixcoord: 13..35
NoneNo IPR availableTMHMMTMhelixcoord: 468..490
NoneNo IPR availableTMHMMTMhelixcoord: 76..98
NoneNo IPR availableTMHMMTMhelixcoord: 231..253
NoneNo IPR availableTMHMMTMhelixcoord: 402..424
NoneNo IPR availableTMHMMTMhelixcoord: 381..398
NoneNo IPR availableTMHMMTMhelixcoord: 167..189
NoneNo IPR availableTMHMMTMhelixcoord: 293..312
NoneNo IPR availableTMHMMTMhelixcoord: 204..226
NoneNo IPR availableTMHMMTMhelixcoord: 111..130
NoneNo IPR availableTMHMMTMhelixcoord: 263..280
NoneNo IPR availableTMHMMTMhelixcoord: 352..374
IPR003674Oligosaccharyl transferase, STT3 subunitPFAMPF02516STT3coord: 16..557
e-value: 3.4E-100
score: 336.3