33 kDa inner dynein arm light chain, axonemal

Overview
Name33 kDa inner dynein arm light chain, axonemal
Smed IDSMED30019136
Length (bp)1201
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 33 kDa inner dynein arm light chain, axonemal (SMED30019136) t-SNE clustered cells

Violin plots show distribution of expression levels for 33 kDa inner dynein arm light chain, axonemal (SMED30019136) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019136

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30019136SMESG000023184.1 SmedASXL_009603SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30019136SMESG000023186.1 dd_Smed_v4_5809_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30019136SMESG000023186.1 dd_Smed_v4_58108_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30019136SMESG000023184.1 SMESG000023186.1 dd_Smed_v6_22194_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
testis primordiumSMED30019136SMESG000023186.1 H_8_7a_3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 33 kDa inner dynein arm light chain, axonemal vs. Ensembl Human
Match: DNALI1 (dynein axonemal light intermediate chain 1 [Source:HGNC Symbol;Acc:HGNC:14353])

HSP 1 Score: 145.976 bits (367), Expect = 1.738e-40
Identity = 76/193 (39.38%), Postives = 121/193 (62.69%), Query Frame = 1
Query:  256 QEILNFLFPARKFNDNGKDWIQYVSKNTSSAFDLKGLEGELQRMLKMRCAKMNGLCLIRRQIYEQLFDELIRQCTIECIDRGLLLLKVKEYYQMLMDAYRTLLQSSEGFIARKNLEAKNQYNDRLIKINHLSAHKKNLEKQVYDLKIRVDQIDKRNQELTRKQEAKNSEQINFFKALIQQYKFYIDDVLAGSK 834
            +EILN + P R++ ++ + WIQ VS   S+  D+  L+ +L   L+ R A+  G+C +RR++Y Q FDELIR+ TI C +RGLLLL+V++  +M + AY+TL +SS  F  RK L+A+   +D   KI  L   K++LE+QV + K + +  +KR  E  + +E K++E+I F K   QQ K  ++ ++A  K
Sbjct:   66 EEILNAILPPREWVEDTQLWIQQVSSTPSTRMDVVHLQEQLDLKLQQRQARETGICPVRRELYSQCFDELIREVTINCAERGLLLLRVRDEIRMTIAAYQTLYESSVAFGMRKALQAEQGKSDMERKIAELETEKRDLERQVNEQKAKCEATEKRESERRQVEEKKHNEEIQFLKRTNQQLKAQLEGIIAPKK 258          
BLAST of 33 kDa inner dynein arm light chain, axonemal vs. Ensembl Human
Match: DNALI1 (dynein axonemal light intermediate chain 1 [Source:HGNC Symbol;Acc:HGNC:14353])

HSP 1 Score: 145.591 bits (366), Expect = 4.115e-40
Identity = 76/193 (39.38%), Postives = 121/193 (62.69%), Query Frame = 1
Query:  256 QEILNFLFPARKFNDNGKDWIQYVSKNTSSAFDLKGLEGELQRMLKMRCAKMNGLCLIRRQIYEQLFDELIRQCTIECIDRGLLLLKVKEYYQMLMDAYRTLLQSSEGFIARKNLEAKNQYNDRLIKINHLSAHKKNLEKQVYDLKIRVDQIDKRNQELTRKQEAKNSEQINFFKALIQQYKFYIDDVLAGSK 834
            +EILN + P R++ ++ + WIQ VS   S+  D+  L+ +L   L+ R A+  G+C +RR++Y Q FDELIR+ TI C +RGLLLL+V++  +M + AY+TL +SS  F  RK L+A+   +D   KI  L   K++LE+QV + K + +  +KR  E  + +E K++E+I F K   QQ K  ++ ++A  K
Sbjct:   88 EEILNAILPPREWVEDTQLWIQQVSSTPSTRMDVVHLQEQLDLKLQQRQARETGICPVRRELYSQCFDELIREVTINCAERGLLLLRVRDEIRMTIAAYQTLYESSVAFGMRKALQAEQGKSDMERKIAELETEKRDLERQVNEQKAKCEATEKRESERRQVEEKKHNEEIQFLKRTNQQLKAQLEGIIAPKK 280          
BLAST of 33 kDa inner dynein arm light chain, axonemal vs. Ensembl Celegans
Match: dyla-1 (DYnein Light chain, Axonemal p28 type [Source:UniProtKB/TrEMBL;Acc:Q95YA5])

HSP 1 Score: 103.219 bits (256), Expect = 5.071e-25
Identity = 51/124 (41.13%), Postives = 81/124 (65.32%), Query Frame = 1
Query:  244 DNRLQEILNFLFPARKFNDNGKDWIQYVSKNTSSAFDLKGLEGELQRMLKMRCAKMNGLCLIRRQIYEQLFDELIRQCTIECIDRGLLLLKVKEYYQMLMDAYRTLLQSSEGFIARKNLEAKNQ 615
            +++LQ IL+ + P R +  NGK W Q  S + ++  D+  LE +L+  LK R AK  G+C IRR +Y Q FDELIRQ ++ C++RGLLL++V++  +M   AY+ +L+S+  +  RK L  +N+
Sbjct:   63 EHQLQLILDCILPPRVYEQNGKLWKQQASLHPATRHDMINLEEKLESELKDRGAKPFGICPIRRDLYGQFFDELIRQVSVSCVERGLLLVRVRDEIRMTFAAYQNVLESAIAYGVRKALFIENE 186          
BLAST of 33 kDa inner dynein arm light chain, axonemal vs. Ensembl Fly
Match: Dnali1 (gene:FBgn0037962 transcript:FBtr0082514)

HSP 1 Score: 130.954 bits (328), Expect = 3.109e-35
Identity = 71/193 (36.79%), Postives = 113/193 (58.55%), Query Frame = 1
Query:  256 QEILNFLFPARKFNDNGKDWIQYVSKNTSSAFDLKGLEGELQRMLKMRCAKMNGLCLIRRQIYEQLFDELIRQCTIECIDRGLLLLKVKEYYQMLMDAYRTLLQSSEGFIARKNLEAKNQYNDRLIKINHLSAHKKNLEKQVYDLKIRVDQIDKRNQELTRKQEAKNSEQINFFKALIQQYKFYIDDVLAGSK 834
            +EILN + P R + ++G+ W Q VS   ++  D+  L+  L   L+   A+  G+C +RR++Y Q FDE+IRQ TI C +RGLLLL++++   M M+AY TL  SS  F  RK L+A  +      ++  L   K+ LE+ + D+K++ +Q ++RN EL   +E K +E+I F K    Q K  ++ + A  K
Sbjct:   58 EEILNSILPPRCWEEDGQLWQQSVSSTPATRQDVINLQEMLDTRLQQTQARETGICPVRRELYSQCFDEIIRQVTINCSERGLLLLRIRDEIAMSMEAYETLYCSSVAFGMRKALQAHEEKEMLRDRVKTLELDKEALEEIIADMKLKQEQAERRNAELRASEEKKFTEEITFLKKTNAQLKAQLEGITAPKK 250          
BLAST of 33 kDa inner dynein arm light chain, axonemal vs. Ensembl Zebrafish
Match: dnali1 (dynein, axonemal, light intermediate chain 1 [Source:ZFIN;Acc:ZDB-GENE-080204-7])

HSP 1 Score: 135.191 bits (339), Expect = 1.239e-36
Identity = 74/197 (37.56%), Postives = 122/197 (61.93%), Query Frame = 1
Query:  241 EDNRLQ--EILNFLFPARKFNDNGKDWIQYVSKNTSSAFDLKGLEGELQRMLKMRCAKMNGLCLIRRQIYEQLFDELIRQCTIECIDRGLLLLKVKEYYQMLMDAYRTLLQSSEGFIARKNLEAKNQYNDRLIKINHLSAHKKNLEKQVYDLKIRVDQIDKRNQELTRKQEAKNSEQINFFKALIQQYKFYIDDVLA 825
            E NR Q  EILN + P +++ ++ + W+Q VS    +  D+  L+ +L + L+ R A+  G+C +RR++Y Q FDELIRQ TI C +RGLLLL+V++  +M + AY+TL +SS  F  RK L+ +   +D   KI+ L + K++LE+ V + K + D I++R  E    +E K++E++ F K   QQ K  ++ ++ 
Sbjct:   56 EANRQQTEEILNAILPPKEWMEDNQLWVQPVSSVPCTRVDVIHLQEQLDKKLQERQARETGICPVRRELYNQCFDELIRQVTINCAERGLLLLQVRDEIRMTIAAYQTLYESSVAFGMRKALQGEQGKSDFENKISELESEKRDLERLVNEQKAKCDAIERREAERRDIEEKKHAEEVQFLKRTNQQLKAQLESIIT 252          
BLAST of 33 kDa inner dynein arm light chain, axonemal vs. Ensembl Zebrafish
Match: dnali1 (dynein, axonemal, light intermediate chain 1 [Source:ZFIN;Acc:ZDB-GENE-080204-7])

HSP 1 Score: 134.806 bits (338), Expect = 1.328e-36
Identity = 74/197 (37.56%), Postives = 122/197 (61.93%), Query Frame = 1
Query:  241 EDNRLQ--EILNFLFPARKFNDNGKDWIQYVSKNTSSAFDLKGLEGELQRMLKMRCAKMNGLCLIRRQIYEQLFDELIRQCTIECIDRGLLLLKVKEYYQMLMDAYRTLLQSSEGFIARKNLEAKNQYNDRLIKINHLSAHKKNLEKQVYDLKIRVDQIDKRNQELTRKQEAKNSEQINFFKALIQQYKFYIDDVLA 825
            E NR Q  EILN + P +++ ++ + W+Q VS    +  D+  L+ +L + L+ R A+  G+C +RR++Y Q FDELIRQ TI C +RGLLLL+V++  +M + AY+TL +SS  F  RK L+ +   +D   KI+ L + K++LE+ V + K + D I++R  E    +E K++E++ F K   QQ K  ++ ++ 
Sbjct:   53 EANRQQTEEILNAILPPKEWMEDNQLWVQPVSSVPCTRVDVIHLQEQLDKKLQERQARETGICPVRRELYNQCFDELIRQVTINCAERGLLLLQVRDEIRMTIAAYQTLYESSVAFGMRKALQGEQGKSDFENKISELESEKRDLERLVNEQKAKCDAIERREAERRDIEEKKHAEEVQFLKRTNQQLKAQLESIIT 249          
BLAST of 33 kDa inner dynein arm light chain, axonemal vs. Ensembl Zebrafish
Match: dnali1 (dynein, axonemal, light intermediate chain 1 [Source:ZFIN;Acc:ZDB-GENE-080204-7])

HSP 1 Score: 103.99 bits (258), Expect = 1.187e-25
Identity = 54/130 (41.54%), Postives = 84/130 (64.62%), Query Frame = 1
Query:  241 EDNRLQ--EILNFLFPARKFNDNGKDWIQYVSKNTSSAFDLKGLEGELQRMLKMRCAKMNGLCLIRRQIYEQLFDELIRQCTIECIDRGLLLLKVKEYYQMLMDAYRTLLQSSEGFIARKNLEAKNQYND 624
            E NR Q  EILN + P +++ ++ + W+Q VS    +  D+  L+ +L + L+ R A+  G+C +RR++Y Q FDELIRQ TI C +RGLLLL+V++  +M + AY+TL +SS  F  RK L+ +   +D
Sbjct:   56 EANRQQTEEILNAILPPKEWMEDNQLWVQPVSSVPCTRVDVIHLQEQLDKKLQERQARETGICPVRRELYNQCFDELIRQVTINCAERGLLLLQVRDEIRMTIAAYQTLYESSVAFGMRKALQGEQGKSD 185          
BLAST of 33 kDa inner dynein arm light chain, axonemal vs. Ensembl Xenopus
Match: dnali1 (dynein axonemal light intermediate chain 1 [Source:NCBI gene;Acc:549441])

HSP 1 Score: 152.525 bits (384), Expect = 4.123e-43
Identity = 80/193 (41.45%), Postives = 121/193 (62.69%), Query Frame = 1
Query:  256 QEILNFLFPARKFNDNGKDWIQYVSKNTSSAFDLKGLEGELQRMLKMRCAKMNGLCLIRRQIYEQLFDELIRQCTIECIDRGLLLLKVKEYYQMLMDAYRTLLQSSEGFIARKNLEAKNQYNDRLIKINHLSAHKKNLEKQVYDLKIRVDQIDKRNQELTRKQEAKNSEQINFFKALIQQYKFYIDDVLAGSK 834
            +EILN + P R++ +N + WIQ VS   S+  D+  L+ EL   L+ R A+  G+C +RR++Y Q FDELIRQ TI C +RGLLLL+V++   M + AY+TL +SS  F  RK L+A+   +D   +I  L   KK+LE+QV + K + + I+KR  E  + +E K++E+I F K   QQ K  ++ ++A  K
Sbjct:   62 EEILNAILPPREWVENNQLWIQQVSSTPSTRMDVVHLQEELDMKLQQRQARETGICPVRRELYSQCFDELIRQVTINCAERGLLLLRVRDEIHMTISAYQTLYESSVAFGMRKALQAEQGKSDMEKRIAELEMEKKDLERQVNEQKAKCEAIEKREAERRQVEEKKHAEEIQFLKRTNQQLKAQLEGIIAPKK 254          
BLAST of 33 kDa inner dynein arm light chain, axonemal vs. Ensembl Xenopus
Match: dnali1 (dynein axonemal light intermediate chain 1 [Source:NCBI gene;Acc:549441])

HSP 1 Score: 151.369 bits (381), Expect = 1.156e-42
Identity = 81/190 (42.63%), Postives = 120/190 (63.16%), Query Frame = 1
Query:  256 QEILNFLFPARKFNDNGKDWIQYVSKNTSSAFDLKGLEGELQRMLKMRCAKMNGLCLIRRQIYEQLFDELIRQCTIECIDRGLLLLKVKEYYQMLMDAYRTLLQSSEGFIARKNLEAKNQYNDRLIKINHLSAHKKNLEKQVYDLKIRVDQIDKRNQELTRKQEAKNSEQINFFKALIQQYKFYIDDVLA 825
            +EILN + P R++ +N + WIQ VS   S+  D+  L+ EL   L+ R A+  G+C +RR++Y Q FDELIRQ TI C +RGLLLL+V++   M + AY+TL +SS  F  RK L+A+   +D   +I  L   KK+LE+QV + K + + I+KR  E  + +E K++E+I F K   QQ K  ID +L+
Sbjct:   62 EEILNAILPPREWVENNQLWIQQVSSTPSTRMDVVHLQEELDMKLQQRQARETGICPVRRELYSQCFDELIRQVTINCAERGLLLLRVRDEIHMTISAYQTLYESSVAFGMRKALQAEQGKSDMEKRIAELEMEKKDLERQVNEQKAKCEAIEKREAERRQVEEKKHAEEIQFLKRTNQQLKVRIDLMLS 251          
BLAST of 33 kDa inner dynein arm light chain, axonemal vs. Ensembl Mouse
Match: Dnali1 (dynein, axonemal, light intermediate polypeptide 1 [Source:MGI Symbol;Acc:MGI:1922813])

HSP 1 Score: 146.362 bits (368), Expect = 7.060e-41
Identity = 76/193 (39.38%), Postives = 120/193 (62.18%), Query Frame = 1
Query:  256 QEILNFLFPARKFNDNGKDWIQYVSKNTSSAFDLKGLEGELQRMLKMRCAKMNGLCLIRRQIYEQLFDELIRQCTIECIDRGLLLLKVKEYYQMLMDAYRTLLQSSEGFIARKNLEAKNQYNDRLIKINHLSAHKKNLEKQVYDLKIRVDQIDKRNQELTRKQEAKNSEQINFFKALIQQYKFYIDDVLAGSK 834
            +EILN + P R++ ++ + WIQ VS   S+  D+  L+ +L   L+ R A+  G+C +RR++Y Q FDELIR+ TI C +RGLLLL+V++   M + AY+TL +SS  F  RK L+A+   +D   KI  L   K++LE+QV + K + +  +KR  E  + +E K++E+I F K   QQ K  ++ ++A  K
Sbjct:   66 EEILNAILPPREWVEDTQLWIQQVSSTPSTRMDVVHLQEQLDLKLQQRQARETGICPVRRELYSQCFDELIREVTINCAERGLLLLRVRDEIHMTIAAYQTLYESSVAFGMRKALQAEQGKSDMERKITELETEKRDLERQVNEQKAKCEATEKRESERRQVEEKKHNEEIQFLKRTNQQLKAQLEGIIAPKK 258          
BLAST of 33 kDa inner dynein arm light chain, axonemal vs. UniProt/SwissProt
Match: sp|Q26630|IDLC_STRPU (33 kDa inner dynein arm light chain, axonemal OS=Strongylocentrotus purpuratus OX=7668 PE=1 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 2.894e-45
Identity = 85/220 (38.64%), Postives = 137/220 (62.27%), Query Frame = 1
Query:  175 VNVKPPQYFNKDLEIQSLEKEKEDNRLQEILNFLFPARKFNDNGKDWIQYVSKNTSSAFDLKGLEGELQRMLKMRCAKMNGLCLIRRQIYEQLFDELIRQCTIECIDRGLLLLKVKEYYQMLMDAYRTLLQSSEGFIARKNLEAKNQYNDRLIKINHLSAHKKNLEKQVYDLKIRVDQIDKRNQELTRKQEAKNSEQINFFKALIQQYKFYIDDVLAGSK 834
            V   PP+  +K   ++S + ++ D    EILN + P R++ ++G+ W+Q VS   ++  D+  L+ +L   L+ R A+  G+C +RR++Y Q FDELIRQ TIEC +RGLLLL+V++  +M + AY+TL +SS  F  RK L+A+   +D   KI  L   K+ LE+QV +LK + + I+KR  E  + +E K++E+I F K   QQ K  ++ ++A +K
Sbjct:   44 VPNPPPKGGSKLPPVESQKAQQTD----EILNSILPPREWTESGQLWVQQVSSTPATRLDVVNLQEQLDMRLQQRQARETGICPVRRELYSQCFDELIRQVTIECAERGLLLLRVRDEIRMTIAAYQTLYESSVAFGMRKALQAEQGKSDMEKKITDLGQEKRELERQVNELKAKCEAIEKREAERRQVEEKKHAEEIQFLKRTNQQLKTQLEGIIAPNK 259          
BLAST of 33 kDa inner dynein arm light chain, axonemal vs. UniProt/SwissProt
Match: sp|Q4FZV3|IDLC_RAT (Axonemal dynein light intermediate polypeptide 1 OS=Rattus norvegicus OX=10116 GN=Dnali1 PE=2 SV=1)

HSP 1 Score: 146.362 bits (368), Expect = 4.446e-40
Identity = 76/193 (39.38%), Postives = 121/193 (62.69%), Query Frame = 1
Query:  256 QEILNFLFPARKFNDNGKDWIQYVSKNTSSAFDLKGLEGELQRMLKMRCAKMNGLCLIRRQIYEQLFDELIRQCTIECIDRGLLLLKVKEYYQMLMDAYRTLLQSSEGFIARKNLEAKNQYNDRLIKINHLSAHKKNLEKQVYDLKIRVDQIDKRNQELTRKQEAKNSEQINFFKALIQQYKFYIDDVLAGSK 834
            +EILN + P R++ ++ + WIQ VS   S+  D+  L+ +L   L+ R A+  G+C +RR++Y Q FDELIR+ TI C +RGLLLL+V++  +M + AY+TL +SS  F  RK L+A+   +D   KI  L   K++LE+QV + K + +  +KR  E  + +E K++E+I F K   QQ K  ++ ++A  K
Sbjct:   66 EEILNAILPPREWVEDTQLWIQQVSSTPSTRMDVVHLQEQLDLKLQQRQARETGICPVRRELYSQCFDELIREVTINCAERGLLLLRVRDEIRMTIAAYQTLYESSVAFGMRKALQAEQGKSDMERKITELETEKRDLERQVNEQKAKCEATEKRESERRQVEEKKHNEEIQFLKRTNQQLKAQLEGIIAPKK 258          
BLAST of 33 kDa inner dynein arm light chain, axonemal vs. UniProt/SwissProt
Match: sp|Q8BVN8|IDLC_MOUSE (Axonemal dynein light intermediate polypeptide 1 OS=Mus musculus OX=10090 GN=Dnali1 PE=1 SV=1)

HSP 1 Score: 146.362 bits (368), Expect = 4.938e-40
Identity = 76/193 (39.38%), Postives = 120/193 (62.18%), Query Frame = 1
Query:  256 QEILNFLFPARKFNDNGKDWIQYVSKNTSSAFDLKGLEGELQRMLKMRCAKMNGLCLIRRQIYEQLFDELIRQCTIECIDRGLLLLKVKEYYQMLMDAYRTLLQSSEGFIARKNLEAKNQYNDRLIKINHLSAHKKNLEKQVYDLKIRVDQIDKRNQELTRKQEAKNSEQINFFKALIQQYKFYIDDVLAGSK 834
            +EILN + P R++ ++ + WIQ VS   S+  D+  L+ +L   L+ R A+  G+C +RR++Y Q FDELIR+ TI C +RGLLLL+V++   M + AY+TL +SS  F  RK L+A+   +D   KI  L   K++LE+QV + K + +  +KR  E  + +E K++E+I F K   QQ K  ++ ++A  K
Sbjct:   66 EEILNAILPPREWVEDTQLWIQQVSSTPSTRMDVVHLQEQLDLKLQQRQARETGICPVRRELYSQCFDELIREVTINCAERGLLLLRVRDEIHMTIAAYQTLYESSVAFGMRKALQAEQGKSDMERKITELETEKRDLERQVNEQKAKCEATEKRESERRQVEEKKHNEEIQFLKRTNQQLKAQLEGIIAPKK 258          
BLAST of 33 kDa inner dynein arm light chain, axonemal vs. UniProt/SwissProt
Match: sp|O14645|IDLC_HUMAN (Axonemal dynein light intermediate polypeptide 1 OS=Homo sapiens OX=9606 GN=DNALI1 PE=1 SV=2)

HSP 1 Score: 145.976 bits (367), Expect = 8.347e-40
Identity = 76/193 (39.38%), Postives = 121/193 (62.69%), Query Frame = 1
Query:  256 QEILNFLFPARKFNDNGKDWIQYVSKNTSSAFDLKGLEGELQRMLKMRCAKMNGLCLIRRQIYEQLFDELIRQCTIECIDRGLLLLKVKEYYQMLMDAYRTLLQSSEGFIARKNLEAKNQYNDRLIKINHLSAHKKNLEKQVYDLKIRVDQIDKRNQELTRKQEAKNSEQINFFKALIQQYKFYIDDVLAGSK 834
            +EILN + P R++ ++ + WIQ VS   S+  D+  L+ +L   L+ R A+  G+C +RR++Y Q FDELIR+ TI C +RGLLLL+V++  +M + AY+TL +SS  F  RK L+A+   +D   KI  L   K++LE+QV + K + +  +KR  E  + +E K++E+I F K   QQ K  ++ ++A  K
Sbjct:   66 EEILNAILPPREWVEDTQLWIQQVSSTPSTRMDVVHLQEQLDLKLQQRQARETGICPVRRELYSQCFDELIREVTINCAERGLLLLRVRDEIRMTIAAYQTLYESSVAFGMRKALQAEQGKSDMERKIAELETEKRDLERQVNEQKAKCEATEKRESERRQVEEKKHNEEIQFLKRTNQQLKAQLEGIIAPKK 258          
BLAST of 33 kDa inner dynein arm light chain, axonemal vs. UniProt/SwissProt
Match: sp|Q4R3K5|IDLC_MACFA (Axonemal dynein light intermediate polypeptide 1 OS=Macaca fascicularis OX=9541 GN=DNALI1 PE=2 SV=1)

HSP 1 Score: 145.591 bits (366), Expect = 8.984e-40
Identity = 76/193 (39.38%), Postives = 121/193 (62.69%), Query Frame = 1
Query:  256 QEILNFLFPARKFNDNGKDWIQYVSKNTSSAFDLKGLEGELQRMLKMRCAKMNGLCLIRRQIYEQLFDELIRQCTIECIDRGLLLLKVKEYYQMLMDAYRTLLQSSEGFIARKNLEAKNQYNDRLIKINHLSAHKKNLEKQVYDLKIRVDQIDKRNQELTRKQEAKNSEQINFFKALIQQYKFYIDDVLAGSK 834
            +EILN + P R++ ++ + WIQ VS   S+  D+  L+ +L   L+ R A+  G+C +RR++Y Q FDELIR+ TI C +RGLLLL+V++  +M + AY+TL +SS  F  RK L+A+   +D   KI  L   K++LE+QV + K + +  +KR  E  + +E K++E+I F K   QQ K  ++ ++A  K
Sbjct:   66 EEILNAILPPREWVEDTQLWIQQVSSTPSTRMDVVHLQEQLDLKLQQRQARETGICPVRRELYSQCFDELIREVTINCAERGLLLLRVRDEIRMTIAAYQTLYESSVAFGMRKALQAEQGKSDMERKIAELETEKRDLERQVNEQKAKCEATEKRESERRQVEEKKHNEEIQFLKRTNQQLKAQLEGIIAPKK 258          
BLAST of 33 kDa inner dynein arm light chain, axonemal vs. TrEMBL
Match: A0A433SWV2 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_018508 PE=4 SV=1)

HSP 1 Score: 162.925 bits (411), Expect = 6.794e-44
Identity = 81/192 (42.19%), Postives = 125/192 (65.10%), Query Frame = 1
Query:  259 EILNFLFPARKFNDNGKDWIQYVSKNTSSAFDLKGLEGELQRMLKMRCAKMNGLCLIRRQIYEQLFDELIRQCTIECIDRGLLLLKVKEYYQMLMDAYRTLLQSSEGFIARKNLEAKNQYNDRLIKINHLSAHKKNLEKQVYDLKIRVDQIDKRNQELTRKQEAKNSEQINFFKALIQQYKFYIDDVLAGSK 834
            EILN + P R++ ++G+ W+Q VS   ++  D+  L+ EL R L+ R A+  G+C +RR++Y Q FDELIRQ TI C +RGLLLL+V++  +M + AY+TL +SS  F  RK L+A+    D   KI  L + K++LE+QV +LK + +Q +KR  EL + +E K++E+I F K   QQ K  ++ ++A  K
Sbjct:   65 EILNSILPPREWTESGQLWVQQVSSTPATRLDVVNLQEELDRRLQQRQARETGICPVRRELYSQCFDELIRQVTINCAERGLLLLRVRDEIRMTIAAYQTLYESSVAFGMRKALQAEQGKADMEKKITELESEKRDLERQVNELKAKCEQTEKRAAELRQVEEKKHTEEIQFLKRTNQQLKTQLEGIIAPKK 256          
BLAST of 33 kDa inner dynein arm light chain, axonemal vs. TrEMBL
Match: A0A0B7AHM1 (Uncharacterized protein OS=Arion vulgaris OX=1028688 GN=ORF115283 PE=4 SV=1)

HSP 1 Score: 162.925 bits (411), Expect = 7.604e-44
Identity = 81/192 (42.19%), Postives = 127/192 (66.15%), Query Frame = 1
Query:  259 EILNFLFPARKFNDNGKDWIQYVSKNTSSAFDLKGLEGELQRMLKMRCAKMNGLCLIRRQIYEQLFDELIRQCTIECIDRGLLLLKVKEYYQMLMDAYRTLLQSSEGFIARKNLEAKNQYNDRLIKINHLSAHKKNLEKQVYDLKIRVDQIDKRNQELTRKQEAKNSEQINFFKALIQQYKFYIDDVLAGSK 834
            EILN + P R++ ++G+ W+Q VS   ++  D+  L+ EL R L+ R A+  G+C +RR++Y Q FDELIRQ TI C +RGLLLL+V++  +M + AY+TL +SS  F  RK L+A+   +D   KI+ L + K++LE+QV +LK + +QI+KR  E  + +E K++E+I F K   QQ K  ++ ++A  K
Sbjct:   66 EILNSILPPREWTESGQLWVQQVSSTPATRLDVVNLQEELDRRLQQRQARETGICPVRRELYSQCFDELIRQVTINCAERGLLLLRVRDEIRMTVAAYQTLYESSVAFGMRKALQAEQGKSDMEKKISDLESEKRDLERQVNELKAKCEQIEKRASEQRQVEEKKHTEEIQFLKRTNQQLKTQLEGIIAPKK 257          
BLAST of 33 kDa inner dynein arm light chain, axonemal vs. TrEMBL
Match: A0A2C9JTV2 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106068078 PE=4 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 8.592e-43
Identity = 81/192 (42.19%), Postives = 125/192 (65.10%), Query Frame = 1
Query:  259 EILNFLFPARKFNDNGKDWIQYVSKNTSSAFDLKGLEGELQRMLKMRCAKMNGLCLIRRQIYEQLFDELIRQCTIECIDRGLLLLKVKEYYQMLMDAYRTLLQSSEGFIARKNLEAKNQYNDRLIKINHLSAHKKNLEKQVYDLKIRVDQIDKRNQELTRKQEAKNSEQINFFKALIQQYKFYIDDVLAGSK 834
            EILN + P R++ ++G+ W+Q VS   ++  D+  L+ EL R L+ R A+  G+C +RR++Y Q FDELIRQ TI C +RGLLLL+V++  +M + AY+TL +SS  F  RK L+A+    D   KI  L + K++LE+QV +LK + +QI+KR  E  + +E K++E+I F K   QQ K  ++ ++A  K
Sbjct:   66 EILNSILPPREWTESGQLWVQQVSSTPATRLDVVNLQEELDRRLQQRQARETGICPVRRELYSQCFDELIRQVTINCAERGLLLLRVRDEIRMTIAAYQTLYESSVAFGMRKALQAEQGKADMEKKILELESEKRDLERQVNELKAKCEQIEKRAAEQRQVEEKKHTEEIQFLKRTNQQLKTQLEGIIAPKK 257          
BLAST of 33 kDa inner dynein arm light chain, axonemal vs. TrEMBL
Match: A0A2T7PF54 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_07483 PE=4 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 1.409e-42
Identity = 82/184 (44.57%), Postives = 120/184 (65.22%), Query Frame = 1
Query:  259 EILNFLFPARKFNDNGKDWIQYVSKNTSSAFDLKGLEGELQRMLKMRCAKMNGLCLIRRQIYEQLFDELIRQCTIECIDRGLLLLKVKEYYQMLMDAYRTLLQSSEGFIARKNLEAKNQYNDRLIKINHLSAHKKNLEKQVYDLKIRVDQIDKRNQELTRKQEAKNSEQINFFKALIQQYKFYI 810
            EILN + P R++ +NG+ W+Q VS   ++  D+  L+ EL R L+ R A+  G+C +RR++Y Q FDELIRQ TI C +RGLLLL+V++  +M + AY+TL +SS  F  RK L+A+    D   K++ L   K++LEKQV +LK + DQI+KR  E  + +E K++E+I F K   QQ K  I
Sbjct:   66 EILNSILPPREWTENGQLWVQQVSSTPATRLDVVNLQEELDRRLQQRQARETGICPVRRELYSQCFDELIRQVTINCAERGLLLLRVRDEIRMTIAAYQTLYESSVAFGMRKALQAEQGKTDMEKKVDQLENEKRDLEKQVNELKAKCDQIEKRAAEQRQVEEKKHTEEIQFLKRTNQQLKKVI 249          
BLAST of 33 kDa inner dynein arm light chain, axonemal vs. TrEMBL
Match: A0A1S3K7C8 (33 kDa inner dynein arm light chain, axonemal OS=Lingula unguis OX=7574 GN=LOC106179321 PE=4 SV=1)

HSP 1 Score: 159.458 bits (402), Expect = 1.916e-42
Identity = 81/189 (42.86%), Postives = 122/189 (64.55%), Query Frame = 1
Query:  259 EILNFLFPARKFNDNGKDWIQYVSKNTSSAFDLKGLEGELQRMLKMRCAKMNGLCLIRRQIYEQLFDELIRQCTIECIDRGLLLLKVKEYYQMLMDAYRTLLQSSEGFIARKNLEAKNQYNDRLIKINHLSAHKKNLEKQVYDLKIRVDQIDKRNQELTRKQEAKNSEQINFFKALIQQYKFYIDDVLA 825
            EILN + P R++ +NG+ W+Q VS   ++  D+  L+ EL R L+ R A+  G+C +RR++Y Q FDELIRQ TI C +RGLLLL+V++  +M + AY+TL +SS  F  RK L+A+    D   KI  L   K++LE+QV +LK + +QI+KR  E    +E K++E+I F K   QQ K  ++ ++A
Sbjct:   68 EILNSILPPREWTENGQLWVQQVSSTPATRLDVVNLQEELDRRLQQRQARETGICPVRRELYSQCFDELIRQVTINCAERGLLLLRVRDEIRMTIAAYQTLYESSVAFGMRKALQAEQGKADMEKKIAELENDKRDLERQVNELKAKCEQIEKRAAEQRAVEEKKHTEEIQFLKRTNQQLKTQLEGIIA 256          
BLAST of 33 kDa inner dynein arm light chain, axonemal vs. Ensembl Cavefish
Match: ENSAMXT00000055205.1 (pep primary_assembly:Astyanax_mexicanus-2.0:10:28288381:28291728:-1 gene:ENSAMXG00000033147.1 transcript:ENSAMXT00000055205.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 137.887 bits (346), Expect = 7.857e-38
Identity = 78/183 (42.62%), Postives = 114/183 (62.30%), Query Frame = 1
Query:  256 QEILNFLFPARKFNDNGKDWIQYVSKNTSSAFDLKGLEGELQRMLKMRCAKMNGLCLIRRQIYEQLFDELIRQCTIECIDRGLLLLKVKEYYQMLMDAYRTLLQSSEGFIARKNLEAKNQYNDRLIKINHLSAHKKNLEKQVYDLKIRVDQIDKRNQELTRKQEAKNSEQINFFKALIQQYKF 804
            QEILN + P R + +N + W+Q VS       D+  L+ +L   L+ R AK  GLC +RR++Y Q FDELIRQ TI C +RGLLLLKV++  ++  DAYRTL +SS  F  RK L A+++ +D   K++ L    K+LEKQ+ +L  + + I+K+  E  +  E K +++I FFK + QQ K 
Sbjct:   58 QEILNVILPPRVWLENNQCWVQQVSSAPCRGRDVVRLQEQLDLKLQQRQAKETGLCPVRRELYSQCFDELIRQVTINCSERGLLLLKVRDESRITEDAYRTLYKSSLAFGLRKILLAEHEKSDMDKKVSDLENENKDLEKQLNELMAKREAIEKQAAERQKADEKKRTQEIQFFKRMNQQLKV 240          
BLAST of 33 kDa inner dynein arm light chain, axonemal vs. Ensembl Cavefish
Match: dnali1 (dynein axonemal light intermediate chain 1 [Source:NCBI gene;Acc:103022880])

HSP 1 Score: 129.028 bits (323), Expect = 2.168e-34
Identity = 66/194 (34.02%), Postives = 118/194 (60.82%), Query Frame = 1
Query:  256 QEILNFLFPARKFNDNGKDWIQYVSKNTSSAFDLKGLEGELQRMLKMRCAKMNGLCLIRRQIYEQLFDELIRQCTIECIDRGLLLLKVKEYYQMLMDAYRTLLQSSEGFIARKNLEAKNQYNDRLIKINHLSAHKKNLEKQVYDLKIRVDQIDKRNQELTRKQEAKNSEQINFFKALIQQYKFYIDDVLAGSKG 837
            +EILN + P R++ +N   WIQ VS   ++  D+  L+ +L+  L+ R A+  G+C +R ++Y Q FDELIRQ +I C +RGLLLL+V++  +M    Y+TL  S   F  +K L+A+ + + +  +I  L    K+LE+QV + K + ++I+++  E  + +E +++ Q+   K   QQ K ++++++   KG
Sbjct:   58 EEILNAILPPREWKENNTRWIQQVSSTPATRMDVVHLQEQLELKLQQRQAREKGICPVRSELYSQCFDELIRQISINCPERGLLLLRVRDEIRMTNTVYQTLHASGMTFGIKKALQAEQEPSGKQ-RIADLENKNKDLERQVNEQKAKCEEIERQEAERRQVEEKQHTAQVQLLKRTNQQLKAHLEEIITPKKG 250          
BLAST of 33 kDa inner dynein arm light chain, axonemal vs. Ensembl Cavefish
Match: dnali1 (dynein axonemal light intermediate chain 1 [Source:NCBI gene;Acc:103022880])

HSP 1 Score: 120.939 bits (302), Expect = 1.304e-31
Identity = 64/184 (34.78%), Postives = 111/184 (60.33%), Query Frame = 1
Query:  256 QEILNFLFPARKFNDNGKDWIQYVSKNTSSAFDLKGLEGELQRMLKMRCAKMNGLCLIRRQIYEQLFDELIRQCTIECIDRGLLLLKVKEYYQMLMDAYRTLLQSSEGFIARKNLEAKNQYNDRLIKINHLSAHKKNLEKQVYDLKIRVDQIDKRNQELTRKQEAKNSEQINFFKALIQQYKFY 807
            +EILN + P R++ +N   WIQ VS   ++  D+  L+ +L+  L+ R A+  G+C +R ++Y Q FDELIRQ +I C +RGLLLL+V++  +M    Y+TL  S   F  +K L+A+ + + +  +I  L    K+LE+QV + K + ++I+++  E  + +E +++ Q+   K   QQ K +
Sbjct:   58 EEILNAILPPREWKENNTRWIQQVSSTPATRMDVVHLQEQLELKLQQRQAREKGICPVRSELYSQCFDELIRQISINCPERGLLLLRVRDEIRMTNTVYQTLHASGMTFGIKKALQAEQEPSGKQ-RIADLENKNKDLERQVNEQKAKCEEIERQEAERRQVEEKQHTAQVQLLKRTNQQLKVH 240          
BLAST of 33 kDa inner dynein arm light chain, axonemal vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006405.1 (pep scaffold:Pmarinus_7.0:GL476558:11892:22842:-1 gene:ENSPMAG00000005775.1 transcript:ENSPMAT00000006405.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 131.339 bits (329), Expect = 4.855e-36
Identity = 74/192 (38.54%), Postives = 116/192 (60.42%), Query Frame = 1
Query:  259 EILNFLFPARKFNDNGKDWIQYVSKNTSSAFDLKGLEGELQRMLKMRCAKMNGLCLIRRQIYEQLFDELIRQCTIECIDRGLLLLKVKEYYQMLMDAYRTLLQSSEGFIARKNLEAKNQYNDRLIKINHLSAHKKNLEKQVYDLKIRVDQIDKRNQELTRKQEAKNSEQINFFKALIQQYKFYIDDVLAGSK 834
            EILN + P R+  ++G+ W+Q VS   ++  D+  L+ +L   L+ R A+  G+C +RR++Y Q FDELIRQ TI C +RGLLLL+V++  +M + A++TL +SS  F  RK L+A+    D   KI  L   K+ LE+ V + K + + I+KR  E  +  E K++E+I F K   QQ K  ++ ++   K
Sbjct:   65 EILNAILPPREITEDGQLWVQQVSSTPATRLDVVKLQEQLDVRLQQRQARETGICPVRRELYSQCFDELIRQVTINCAERGLLLLRVRDEIRMTIAAFQTLYESSVAFGMRKALQAEQGKADMEKKIAELEEEKRELERAVNEQKAKCEAIEKREAERRQVDEKKHAEEIQFLKRTNQQLKTQLEGIVTPKK 256          
BLAST of 33 kDa inner dynein arm light chain, axonemal vs. Ensembl Nematostella
Match: EDO46256 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQ98])

HSP 1 Score: 157.147 bits (396), Expect = 1.516e-45
Identity = 80/192 (41.67%), Postives = 122/192 (63.54%), Query Frame = 1
Query:  259 EILNFLFPARKFNDNGKDWIQYVSKNTSSAFDLKGLEGELQRMLKMRCAKMNGLCLIRRQIYEQLFDELIRQCTIECIDRGLLLLKVKEYYQMLMDAYRTLLQSSEGFIARKNLEAKNQYNDRLIKINHLSAHKKNLEKQVYDLKIRVDQIDKRNQELTRKQEAKNSEQINFFKALIQQYKFYIDDVLAGSK 834
            EILN + P R++ +NG+ W+Q VS   ++  D+  L+ +L   L+ R A+  G+C +RR++Y Q FDELIRQ TI C +RGLLLL+V++  +M + AY+TL +SS  F  RK L+A+   +D   KI  L   K+ LE+QV +LK + D I+KR  E    +E K++E+I F K   QQ K  ++ ++A +K
Sbjct:   68 EILNAILPPREWTENGQLWVQQVSSTPATRLDVVNLQEQLDMRLQQRQARETGICPVRRELYSQCFDELIRQVTINCAERGLLLLRVRDEIRMTIAAYQTLYESSVAFGMRKALQAEQGKSDMERKITELENDKRELERQVNELKAKCDAIEKREAERRAVEEKKHAEEIQFLKRTNQQLKTQLEGIIAPTK 259          
BLAST of 33 kDa inner dynein arm light chain, axonemal vs. Planmine SMEST
Match: SMESG000023186.1 (SMESG000023186.1)

HSP 1 Score: 461.455 bits (1186), Expect = 7.916e-165
Identity = 227/227 (100.00%), Postives = 227/227 (100.00%), Query Frame = 1
Query:  163 MCKGVNVKPPQYFNKDLEIQSLEKEKEDNRLQEILNFLFPARKFNDNGKDWIQYVSKNTSSAFDLKGLEGELQRMLKMRCAKMNGLCLIRRQIYEQLFDELIRQCTIECIDRGLLLLKVKEYYQMLMDAYRTLLQSSEGFIARKNLEAKNQYNDRLIKINHLSAHKKNLEKQVYDLKIRVDQIDKRNQELTRKQEAKNSEQINFFKALIQQYKFYIDDVLAGSKGLN 843
            MCKGVNVKPPQYFNKDLEIQSLEKEKEDNRLQEILNFLFPARKFNDNGKDWIQYVSKNTSSAFDLKGLEGELQRMLKMRCAKMNGLCLIRRQIYEQLFDELIRQCTIECIDRGLLLLKVKEYYQMLMDAYRTLLQSSEGFIARKNLEAKNQYNDRLIKINHLSAHKKNLEKQVYDLKIRVDQIDKRNQELTRKQEAKNSEQINFFKALIQQYKFYIDDVLAGSKGLN
Sbjct:    1 MCKGVNVKPPQYFNKDLEIQSLEKEKEDNRLQEILNFLFPARKFNDNGKDWIQYVSKNTSSAFDLKGLEGELQRMLKMRCAKMNGLCLIRRQIYEQLFDELIRQCTIECIDRGLLLLKVKEYYQMLMDAYRTLLQSSEGFIARKNLEAKNQYNDRLIKINHLSAHKKNLEKQVYDLKIRVDQIDKRNQELTRKQEAKNSEQINFFKALIQQYKFYIDDVLAGSKGLN 227          
BLAST of 33 kDa inner dynein arm light chain, axonemal vs. Planmine SMEST
Match: SMESG000067639.1 (SMESG000067639.1)

HSP 1 Score: 149.828 bits (377), Expect = 8.557e-43
Identity = 78/200 (39.00%), Postives = 122/200 (61.00%), Query Frame = 1
Query:  235 EKEDNRLQEILNFLFPARKFNDNGKDWIQYVSKNTSSAFDLKGLEGELQRMLKMRCAKMNGLCLIRRQIYEQLFDELIRQCTIECIDRGLLLLKVKEYYQMLMDAYRTLLQSSEGFIARKNLEAKNQYNDRLIKINHLSAHKKNLEKQVYDLKIRVDQIDKRNQELTRKQEAKNSEQINFFKALIQQYKFYIDDVLAGSK 834
            E  + + +EILN + P R++ +  + W+Q VS   ++  D+  ++ EL R L+ R A+  G+C +RR++Y Q+FDELIRQ TI C +RGLLLL+V++  +M + AY+TL +SS  F  RK L+A+    D   K   L   K +LE+QV +LK + +QI+KR  E  + +E K+ E+I F K    Q K  +D ++   K
Sbjct:   32 ESANQQTEEILNSILPPREWTEKDQLWVQQVSATPATRLDVVNIQEELDRRLQQRQARETGICPVRRELYSQVFDELIRQVTINCAERGLLLLRVRDEIRMTISAYQTLYESSVAFGMRKALQAEQGKEDMKRKKEELEQDKTDLERQVNELKAKCEQIEKRAAERRQVEEKKHQEEIQFLKKTNTQLKTQLDGIIGPKK 231          
BLAST of 33 kDa inner dynein arm light chain, axonemal vs. Planmine SMEST
Match: SMESG000067639.1 (SMESG000067639.1)

HSP 1 Score: 150.599 bits (379), Expect = 1.030e-42
Identity = 78/200 (39.00%), Postives = 122/200 (61.00%), Query Frame = 1
Query:  235 EKEDNRLQEILNFLFPARKFNDNGKDWIQYVSKNTSSAFDLKGLEGELQRMLKMRCAKMNGLCLIRRQIYEQLFDELIRQCTIECIDRGLLLLKVKEYYQMLMDAYRTLLQSSEGFIARKNLEAKNQYNDRLIKINHLSAHKKNLEKQVYDLKIRVDQIDKRNQELTRKQEAKNSEQINFFKALIQQYKFYIDDVLAGSK 834
            E  + + +EILN + P R++ +  + W+Q VS   ++  D+  ++ EL R L+ R A+  G+C +RR++Y Q+FDELIRQ TI C +RGLLLL+V++  +M + AY+TL +SS  F  RK L+A+    D   K   L   K +LE+QV +LK + +QI+KR  E  + +E K+ E+I F K    Q K  +D ++   K
Sbjct:   56 ESANQQTEEILNSILPPREWTEKDQLWVQQVSATPATRLDVVNIQEELDRRLQQRQARETGICPVRRELYSQVFDELIRQVTINCAERGLLLLRVRDEIRMTISAYQTLYESSVAFGMRKALQAEQGKEDMKRKKEELEQDKTDLERQVNELKAKCEQIEKRAAERRQVEEKKHQEEIQFLKKTNTQLKTQLDGIIGPKK 255          
BLAST of 33 kDa inner dynein arm light chain, axonemal vs. Planmine SMEST
Match: SMESG000067639.1 (SMESG000067639.1)

HSP 1 Score: 149.828 bits (377), Expect = 1.407e-42
Identity = 78/200 (39.00%), Postives = 122/200 (61.00%), Query Frame = 1
Query:  235 EKEDNRLQEILNFLFPARKFNDNGKDWIQYVSKNTSSAFDLKGLEGELQRMLKMRCAKMNGLCLIRRQIYEQLFDELIRQCTIECIDRGLLLLKVKEYYQMLMDAYRTLLQSSEGFIARKNLEAKNQYNDRLIKINHLSAHKKNLEKQVYDLKIRVDQIDKRNQELTRKQEAKNSEQINFFKALIQQYKFYIDDVLAGSK 834
            E  + + +EILN + P R++ +  + W+Q VS   ++  D+  ++ EL R L+ R A+  G+C +RR++Y Q+FDELIRQ TI C +RGLLLL+V++  +M + AY+TL +SS  F  RK L+A+    D   K   L   K +LE+QV +LK + +QI+KR  E  + +E K+ E+I F K    Q K  +D ++   K
Sbjct:   50 ESANQQTEEILNSILPPREWTEKDQLWVQQVSATPATRLDVVNIQEELDRRLQQRQARETGICPVRRELYSQVFDELIRQVTINCAERGLLLLRVRDEIRMTISAYQTLYESSVAFGMRKALQAEQGKEDMKRKKEELEQDKTDLERQVNELKAKCEQIEKRAAERRQVEEKKHQEEIQFLKKTNTQLKTQLDGIIGPKK 249          
BLAST of 33 kDa inner dynein arm light chain, axonemal vs. Planmine SMEST
Match: SMESG000017224.1 (SMESG000017224.1)

HSP 1 Score: 148.673 bits (374), Expect = 4.849e-42
Identity = 77/199 (38.69%), Postives = 125/199 (62.81%), Query Frame = 1
Query:  226 LEKEKEDNRLQEILNFLFPARKFNDNGKDWIQYVSKNTSSAFDLKGLEGELQRMLKMRCAKMNGLCLIRRQIYEQLFDELIRQCTIECIDRGLLLLKVKEYYQMLMDAYRTLLQSSEGFIARKNLEAKNQYNDRLIKINHLSAHKKNLEKQVYDLKIRVDQIDKRNQELTRKQEAKNSEQINFFKALIQQYKFYIDDVL 822
            LE  +   +  EILN + P R++ +NG+ W+Q +S   ++  D+  L+ EL R L+ + A+  G+C IRR++Y Q+FDELIRQ TI C +RGLLLL+V++  +M + AY++L +SS  F  RK L+++    +   +I  L   K++LE+QV DL ++ +QI+ R  E  + +E K+ E+I F K   QQ K  ++ +L
Sbjct:   56 LEPAQISQQTAEILNSILPPREWTENGQLWVQQISSVPATRLDVINLQEELDRQLQQKQARETGICPIRRELYSQVFDELIRQVTINCAERGLLLLRVRDEIRMTIAAYQSLYESSVAFGMRKALQSEQGNAEMDKRIAQLEGEKRDLERQVNDLILKAEQIELRAAEQRQNEEKKHHEEIQFLKKTNQQLKAQLEGIL 254          
The following BLAST results are available for this feature:
BLAST of 33 kDa inner dynein arm light chain, axonemal vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
DNALI11.738e-4039.38dynein axonemal light intermediate chain 1 [Source... [more]
DNALI14.115e-4039.38dynein axonemal light intermediate chain 1 [Source... [more]
back to top
BLAST of 33 kDa inner dynein arm light chain, axonemal vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
dyla-15.071e-2541.13DYnein Light chain, Axonemal p28 type [Source:Uni... [more]
back to top
BLAST of 33 kDa inner dynein arm light chain, axonemal vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Dnali13.109e-3536.79gene:FBgn0037962 transcript:FBtr0082514[more]
back to top
BLAST of 33 kDa inner dynein arm light chain, axonemal vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
dnali11.239e-3637.56dynein, axonemal, light intermediate chain 1 [Sour... [more]
dnali11.328e-3637.56dynein, axonemal, light intermediate chain 1 [Sour... [more]
dnali11.187e-2541.54dynein, axonemal, light intermediate chain 1 [Sour... [more]
back to top
BLAST of 33 kDa inner dynein arm light chain, axonemal vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
dnali14.123e-4341.45dynein axonemal light intermediate chain 1 [Source... [more]
dnali11.156e-4242.63dynein axonemal light intermediate chain 1 [Source... [more]
back to top
BLAST of 33 kDa inner dynein arm light chain, axonemal vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Dnali17.060e-4139.38dynein, axonemal, light intermediate polypeptide 1... [more]
back to top
BLAST of 33 kDa inner dynein arm light chain, axonemal vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q26630|IDLC_STRPU2.894e-4538.6433 kDa inner dynein arm light chain, axonemal OS=S... [more]
sp|Q4FZV3|IDLC_RAT4.446e-4039.38Axonemal dynein light intermediate polypeptide 1 O... [more]
sp|Q8BVN8|IDLC_MOUSE4.938e-4039.38Axonemal dynein light intermediate polypeptide 1 O... [more]
sp|O14645|IDLC_HUMAN8.347e-4039.38Axonemal dynein light intermediate polypeptide 1 O... [more]
sp|Q4R3K5|IDLC_MACFA8.984e-4039.38Axonemal dynein light intermediate polypeptide 1 O... [more]
back to top
BLAST of 33 kDa inner dynein arm light chain, axonemal vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A433SWV26.794e-4442.19Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
A0A0B7AHM17.604e-4442.19Uncharacterized protein OS=Arion vulgaris OX=10286... [more]
A0A2C9JTV28.592e-4342.19Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A2T7PF541.409e-4244.57Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A1S3K7C81.916e-4242.8633 kDa inner dynein arm light chain, axonemal OS=L... [more]
back to top
BLAST of 33 kDa inner dynein arm light chain, axonemal vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSAMXT00000055205.17.857e-3842.62pep primary_assembly:Astyanax_mexicanus-2.0:10:282... [more]
dnali12.168e-3434.02dynein axonemal light intermediate chain 1 [Source... [more]
dnali11.304e-3134.78dynein axonemal light intermediate chain 1 [Source... [more]
back to top
BLAST of 33 kDa inner dynein arm light chain, axonemal vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000006405.14.855e-3638.54pep scaffold:Pmarinus_7.0:GL476558:11892:22842:-1 ... [more]
back to top
BLAST of 33 kDa inner dynein arm light chain, axonemal vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 33 kDa inner dynein arm light chain, axonemal vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO462561.516e-4541.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of 33 kDa inner dynein arm light chain, axonemal vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 33 kDa inner dynein arm light chain, axonemal vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000023186.17.916e-165100.00SMESG000023186.1[more]
SMESG000067639.18.557e-4339.00SMESG000067639.1[more]
SMESG000067639.11.030e-4239.00SMESG000067639.1[more]
SMESG000067639.11.407e-4239.00SMESG000067639.1[more]
SMESG000017224.14.849e-4238.69SMESG000017224.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019136 ID=SMED30019136|Name=33 kDa inner dynein arm light chain, axonemal|organism=Schmidtea mediterranea sexual|type=transcript|length=1201bp
GATTAAATTTAAATCTGAAATTTTATTGAATTTATCTTGCTATCAAAAAT
GTCTTTTATGCCAACATTATTAAAGTATGAGTTCGCTGTTGAAGAAACCG
CTCATCCATTAGATAAATACCAAGAAGATCACGAGGGAAAAGATTTTGAA
AACGCTTTTCAAATGTGTAAAGGAGTCAACGTAAAACCACCGCAGTATTT
CAACAAAGATTTAGAAATTCAATCATTAGAAAAAGAAAAGGAGGATAACA
GACTACAGGAAATATTGAATTTCTTATTTCCAGCAAGAAAGTTTAATGAT
AACGGAAAGGATTGGATTCAATACGTGTCAAAGAATACAAGTTCCGCTTT
TGACTTAAAAGGACTTGAAGGAGAACTGCAAAGAATGCTAAAAATGAGGT
GTGCGAAAATGAATGGATTGTGCTTAATAAGGCGTCAGATATATGAACAA
TTGTTTGATGAATTAATTCGTCAATGTACAATAGAGTGCATAGACAGAGG
TCTGTTGCTGTTAAAAGTCAAAGAATATTACCAGATGCTAATGGACGCCT
ACAGAACCTTATTACAGTCCTCTGAAGGTTTCATAGCGAGAAAAAACTTA
GAAGCCAAAAATCAATACAATGATCGACTAATAAAAATTAACCATTTGTC
AGCGCACAAGAAAAATTTAGAAAAACAAGTATACGATTTAAAAATTCGAG
TCGATCAAATAGACAAACGAAATCAAGAACTAACTAGGAAACAGGAAGCG
AAAAATTCGGAACAAATAAATTTTTTCAAAGCACTCATCCAACAATACAA
ATTTTACATCGACGACGTGCTGGCAGGCTCAAAGGGTCTCAATTGAGAGC
GGCGGCGGCGGCGGCGGCTTCATCGGGAATTTTCCATTAAAACACTTTTG
TCGTTATTTATTGTAAAGTTAACAATAAAAAACTTTATTTCTGAAAAGCC
AAACAGAAAAATCTAGTCAATCTGTTTTCGGATTTTAGTTTTAATCTGAA
ATAGAAACACAAATTAAATTGATTTAATAAGCATCAAATCAAAATTATTC
AACTAATCAATCAACCAATCATTTTCAATGTATAGTCGCATAATTATAGA
AGTTGCAATAAAAATGCCTTTGTTGGGTTATAATTATTATTCTAGTCATT
ATTACTGACTCTGACTGCTCGTGCTCTTTGTTTCAATTAATTAAATAAGA
C
back to top

protein sequence of SMED30019136-orf-1

>SMED30019136-orf-1 ID=SMED30019136-orf-1|Name=SMED30019136-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=266bp
MSFMPTLLKYEFAVEETAHPLDKYQEDHEGKDFENAFQMCKGVNVKPPQY
FNKDLEIQSLEKEKEDNRLQEILNFLFPARKFNDNGKDWIQYVSKNTSSA
FDLKGLEGELQRMLKMRCAKMNGLCLIRRQIYEQLFDELIRQCTIECIDR
GLLLLKVKEYYQMLMDAYRTLLQSSEGFIARKNLEAKNQYNDRLIKINHL
SAHKKNLEKQVYDLKIRVDQIDKRNQELTRKQEAKNSEQINFFKALIQQY
KFYIDDVLAGSKGLN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR019347Axonemal_dynein_light_chain
Vocabulary: molecular function
TermDefinition
GO:0003774motor activity
Vocabulary: cellular component
TermDefinition
GO:0030286dynein complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 204..238
IPR019347Axonemal dynein light chainPFAMPF10211Ax_dynein_lightcoord: 70..251
e-value: 8.1E-53
score: 179.1
IPR019347Axonemal dynein light chainPANTHERPTHR13183AXONEMAL INNER ARM DYNEIN LIGHT CHAIN 28coord: 46..261