ATP-binding cassette subfamily B member 8

Overview
NameATP-binding cassette subfamily B member 8
Smed IDSMED30019132
Length (bp)2088
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ATP-binding cassette subfamily B member 8 (SMED30019132) t-SNE clustered cells

Violin plots show distribution of expression levels for ATP-binding cassette subfamily B member 8 (SMED30019132) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ATP-binding cassette subfamily B member 8 (SMED30019132) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ATP-binding cassette subfamily B member 8 (SMED30019132) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019132

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30019132h1SMcG0018150 SmedASXL_016290SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
posterior sideSMED30019132h1SMcG0018150 dd_Smed_v4_9641_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30019132h1SMcG0018150 dd_Smed_v4_9641_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ATP-binding cassette subfamily B member 8 vs. Ensembl Human
Match: ABCB8 (ATP binding cassette subfamily B member 8 [Source:HGNC Symbol;Acc:HGNC:49])

HSP 1 Score: 500.36 bits (1287), Expect = 3.560e-169
Identity = 268/568 (47.18%), Postives = 384/568 (67.61%), Query Frame = 1
Query:  328 AAVVNIQIPLKLGNVVNILSNIKEIKDNDFVAAFKIPSLQLLICYAVQALSTTTYISLLSIIGERLAVKMKKKLFEKIIIQDSKFFDNMRSGDLLNRITADVQDFKSSFKQCISQGLRGFITIIGSTISLVIVSKELTTIVIIAIPCLVLIGSIMGKILRALSREAQMQNSKAADVANESIINIRTVKSFAMEDMEIENFFIEVNEAAKLHSVLGIGIGIFQGMSNFAINGIVLGVLFTGGFMMNNGNLTPGDLMSFLVASQTIQKSLSTLSTLFGHLVKANASGARITEFLALNTCATSPXXXXXXXXXXXXXXXFDNVRKPESVEFRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYGNISXXXXXXXXXXXXXXXXXFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALMKIKGHYYELVKKLEKD 2031
            AA+VN+QIPL LG +V +++         F+   +  S  LLI Y VQ L T  Y+ LLS +GER+AV M++ LF  ++ QD  FFD  ++G L++R+T DVQ+FKSSFK  ISQGLR    + G  +SL ++S  LT ++++A P L+ +G++MG  LR LSR+ Q Q ++A  VA+E++ N+RTV++FAME  E E +  E+         LG GI +FQG+SN A N +VLG LF GG ++    LT GDLMSFLVASQT+Q+S++ LS LFG +V+  ++GAR+ E++ALN C                    + +R   SV F+N+ F+YP R    VL++F+L +P G IVAL G+SG GK+T+ASL++RFY+P +G ++++G +++ +  S LR   VG +SQ+P LF  TI ENIR+G + A++EE+  AA++A AHEFI  F +GY+T+VGER G  LSGGQ+QR+AIARA++K P +LILDEATSALD++SE +VQ AL     GRTV++IAHRLST++ A  IVV+  G+++E G HE L+K  G Y EL+++   D
Sbjct:   53 AALVNVQIPLLLGQLVEVVAKYTRDHVGSFMTESQNLSTHLLILYGVQGLLTFGYLVLLSHVGERMAVDMRRALFSSLLRQDITFFDANKTGQLVSRLTTDVQEFKSSFKLVISQGLRSCTQVAGCLVSLSMLSTRLTLLLMVATPALMGVGTLMGSGLRKLSRQCQEQIARAMGVADEALGNVRTVRAFAMEQREEERYGAELEACRCRAEELGRGIALFQGLSNIAFNCMVLGTLFIGGSLVAGQQLTGGDLMSFLVASQTVQRSMANLSVLFGQVVRGLSAGARVFEYMALNPC---------IPLSGGCCVPKEQLRG--SVTFQNVCFSYPCRPGFEVLKDFTLTLPPGKIVALVGQSGGGKTTVASLLERFYDPTAGVVMLDGRDLRTLDPSWLRGQVVGFISQEPVLFGTTIMENIRFGKLEASDEEVYTAAREANAHEFITSFPEGYNTVVGER-GTTLSGGQKQRLAIARALIKQPTVLILDEATSALDAESERVVQEALDRASAGRTVLVIAHRLSTVRGAHCIVVMADGRVWEAGTHEELLKKGGLYAELIRRQALD 608          
BLAST of ATP-binding cassette subfamily B member 8 vs. Ensembl Human
Match: ABCB8 (ATP binding cassette subfamily B member 8 [Source:HGNC Symbol;Acc:HGNC:49])

HSP 1 Score: 494.582 bits (1272), Expect = 1.219e-165
Identity = 265/564 (46.99%), Postives = 380/564 (67.38%), Query Frame = 1
Query:  340 NIQIPLKLGNVVNILSNIKEIKDNDFVAAFKIPSLQLLICYAVQALSTTTYISLLSIIGERLAVKMKKKLFEKIIIQDSKFFDNMRSGDLLNRITADVQDFKSSFKQCISQGLRGFITIIGSTISLVIVSKELTTIVIIAIPCLVLIGSIMGKILRALSREAQMQNSKAADVANESIINIRTVKSFAMEDMEIENFFIEVNEAAKLHSVLGIGIGIFQGMSNFAINGIVLGVLFTGGFMMNNGNLTPGDLMSFLVASQTIQKSLSTLSTLFGHLVKANASGARITEFLALNTCATSPXXXXXXXXXXXXXXXFDNVRKPESVEFRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYGNISXXXXXXXXXXXXXXXXXFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALMKIKGHYYELVKKLEKD 2031
            N+QIPL LG +V +++         F+   +  S  LLI Y VQ L T  Y+ LLS +GER+AV M++ LF  ++ QD  FFD  ++G L++R+T DVQ+FKSSFK  ISQGLR    + G  +SL ++S  LT ++++A P L+ +G++MG  LR LSR+ Q Q ++A  VA+E++ N+RTV++FAME  E E +  E+         LG GI +FQG+SN A N +VLG LF GG ++    LT GDLMSFLVASQT+Q+S++ LS LFG +V+  ++GAR+ E++ALN C                    + +R   SV F+N+ F+YP R    VL++F+L +P G IVAL G+SG GK+T+ASL++RFY+P +G ++++G +++ +  S LR   VG +SQ+P LF  TI ENIR+G + A++EE+  AA++A AHEFI  F +GY+T+VGER G  LSGGQ+QR+AIARA++K P +LILDEATSALD++SE +VQ AL     GRTV++IAHRLST++ A  IVV+  G+++E G HE L+K  G Y EL+++   D
Sbjct:  145 NVQIPLLLGQLVEVVAKYTRDHVGSFMTESQNLSTHLLILYGVQGLLTFGYLVLLSHVGERMAVDMRRALFSSLLRQDITFFDANKTGQLVSRLTTDVQEFKSSFKLVISQGLRSCTQVAGCLVSLSMLSTRLTLLLMVATPALMGVGTLMGSGLRKLSRQCQEQIARAMGVADEALGNVRTVRAFAMEQREEERYGAELEACRCRAEELGRGIALFQGLSNIAFNCMVLGTLFIGGSLVAGQQLTGGDLMSFLVASQTVQRSMANLSVLFGQVVRGLSAGARVFEYMALNPC---------IPLSGGCCVPKEQLRG--SVTFQNVCFSYPCRPGFEVLKDFTLTLPPGKIVALVGQSGGGKTTVASLLERFYDPTAGVVMLDGRDLRTLDPSWLRGQVVGFISQEPVLFGTTIMENIRFGKLEASDEEVYTAAREANAHEFITSFPEGYNTVVGER-GTTLSGGQKQRLAIARALIKQPTVLILDEATSALDAESERVVQEALDRASAGRTVLVIAHRLSTVRGAHCIVVMADGRVWEAGTHEELLKKGGLYAELIRRQALD 696          
BLAST of ATP-binding cassette subfamily B member 8 vs. Ensembl Human
Match: ABCB8 (ATP binding cassette subfamily B member 8 [Source:HGNC Symbol;Acc:HGNC:49])

HSP 1 Score: 494.967 bits (1273), Expect = 1.259e-165
Identity = 265/564 (46.99%), Postives = 380/564 (67.38%), Query Frame = 1
Query:  340 NIQIPLKLGNVVNILSNIKEIKDNDFVAAFKIPSLQLLICYAVQALSTTTYISLLSIIGERLAVKMKKKLFEKIIIQDSKFFDNMRSGDLLNRITADVQDFKSSFKQCISQGLRGFITIIGSTISLVIVSKELTTIVIIAIPCLVLIGSIMGKILRALSREAQMQNSKAADVANESIINIRTVKSFAMEDMEIENFFIEVNEAAKLHSVLGIGIGIFQGMSNFAINGIVLGVLFTGGFMMNNGNLTPGDLMSFLVASQTIQKSLSTLSTLFGHLVKANASGARITEFLALNTCATSPXXXXXXXXXXXXXXXFDNVRKPESVEFRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYGNISXXXXXXXXXXXXXXXXXFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALMKIKGHYYELVKKLEKD 2031
            N+QIPL LG +V +++         F+   +  S  LLI Y VQ L T  Y+ LLS +GER+AV M++ LF  ++ QD  FFD  ++G L++R+T DVQ+FKSSFK  ISQGLR    + G  +SL ++S  LT ++++A P L+ +G++MG  LR LSR+ Q Q ++A  VA+E++ N+RTV++FAME  E E +  E+         LG GI +FQG+SN A N +VLG LF GG ++    LT GDLMSFLVASQT+Q+S++ LS LFG +V+  ++GAR+ E++ALN C                    + +R   SV F+N+ F+YP R    VL++F+L +P G IVAL G+SG GK+T+ASL++RFY+P +G ++++G +++ +  S LR   VG +SQ+P LF  TI ENIR+G + A++EE+  AA++A AHEFI  F +GY+T+VGER G  LSGGQ+QR+AIARA++K P +LILDEATSALD++SE +VQ AL     GRTV++IAHRLST++ A  IVV+  G+++E G HE L+K  G Y EL+++   D
Sbjct:  162 NVQIPLLLGQLVEVVAKYTRDHVGSFMTESQNLSTHLLILYGVQGLLTFGYLVLLSHVGERMAVDMRRALFSSLLRQDITFFDANKTGQLVSRLTTDVQEFKSSFKLVISQGLRSCTQVAGCLVSLSMLSTRLTLLLMVATPALMGVGTLMGSGLRKLSRQCQEQIARAMGVADEALGNVRTVRAFAMEQREEERYGAELEACRCRAEELGRGIALFQGLSNIAFNCMVLGTLFIGGSLVAGQQLTGGDLMSFLVASQTVQRSMANLSVLFGQVVRGLSAGARVFEYMALNPC---------IPLSGGCCVPKEQLRG--SVTFQNVCFSYPCRPGFEVLKDFTLTLPPGKIVALVGQSGGGKTTVASLLERFYDPTAGVVMLDGRDLRTLDPSWLRGQVVGFISQEPVLFGTTIMENIRFGKLEASDEEVYTAAREANAHEFITSFPEGYNTVVGER-GTTLSGGQKQRLAIARALIKQPTVLILDEATSALDAESERVVQEALDRASAGRTVLVIAHRLSTVRGAHCIVVMADGRVWEAGTHEELLKKGGLYAELIRRQALD 713          
BLAST of ATP-binding cassette subfamily B member 8 vs. Ensembl Human
Match: ABCB8 (ATP binding cassette subfamily B member 8 [Source:HGNC Symbol;Acc:HGNC:49])

HSP 1 Score: 450.669 bits (1158), Expect = 5.951e-149
Identity = 252/564 (44.68%), Postives = 360/564 (63.83%), Query Frame = 1
Query:  340 NIQIPLKLGNVVNILSNIKEIKDNDFVAAFKIPSLQLLICYAVQALSTTTYISLLSIIGERLAVKMKKKLFEKIIIQDSKFFDNMRSGDLLNRITADVQDFKSSFKQCISQGLRGFITIIGSTISLVIVSKELTTIVIIAIPCLVLIGSIMGKILRALSREAQMQNSKAADVANESIINIRTVKSFAMEDMEIENFFIEVNEAAKLHSVLGIGIGIFQGMSNFAINGIVLGVLFTGGFMMNNGNLTPGDLMSFLVASQTIQKSLSTLSTLFGHLVKANASGARITEFLALNTCATSPXXXXXXXXXXXXXXXFDNVRKPESVEFRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYGNISXXXXXXXXXXXXXXXXXFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALMKIKGHYYELVKKLEKD 2031
            N+QIPL LG +V +++         F+   +  S  LLI Y VQ L T  Y+ LLS +GER+AV M++ LF  ++ QD  FFD  ++G L++R+T DVQ+FKSSFK  ISQGLR    + G  +SL ++S  LT ++++A P L+ +G++MG  LR LSR+ Q Q ++A  VA+E++ N+RTV++FAME  E E +  E+         LG GI +FQG+SN A N +VLG LF GG ++    LT GDLMSFLVASQT+Q+S++ LS LFG +V+  ++GAR+ E++ALN C                    + +R   SV F+N+ F+YP R    VL++F+L +P G IVAL G+SG GK+T+ASL++RFY+P +G ++++G +++ +  S LR   VG +SQ+P LF  TI ENIR+G + A++EE+  AA++A AHEFI  F +GY+T+VGER G  LSGGQ+QR+AIARA++K P +LILDEATSALD++SE +VQ AL     GRTV+                          G HE L+K  G Y EL+++   D
Sbjct:  145 NVQIPLLLGQLVEVVAKYTRDHVGSFMTESQNLSTHLLILYGVQGLLTFGYLVLLSHVGERMAVDMRRALFSSLLRQDITFFDANKTGQLVSRLTTDVQEFKSSFKLVISQGLRSCTQVAGCLVSLSMLSTRLTLLLMVATPALMGVGTLMGSGLRKLSRQCQEQIARAMGVADEALGNVRTVRAFAMEQREEERYGAELEACRCRAEELGRGIALFQGLSNIAFNCMVLGTLFIGGSLVAGQQLTGGDLMSFLVASQTVQRSMANLSVLFGQVVRGLSAGARVFEYMALNPC---------IPLSGGCCVPKEQLRG--SVTFQNVCFSYPCRPGFEVLKDFTLTLPPGKIVALVGQSGGGKTTVASLLERFYDPTAGVVMLDGRDLRTLDPSWLRGQVVGFISQEPVLFGTTIMENIRFGKLEASDEEVYTAAREANAHEFITSFPEGYNTVVGER-GTTLSGGQKQRLAIARALIKQPTVLILDEATSALDAESERVVQEALDRASAGRTVL-------------------------AGTHEELLKKGGLYAELIRRQALD 671          
BLAST of ATP-binding cassette subfamily B member 8 vs. Ensembl Human
Match: ABCB10 (ATP binding cassette subfamily B member 10 [Source:HGNC Symbol;Acc:HGNC:41])

HSP 1 Score: 346.28 bits (887), Expect = 2.786e-108
Identity = 218/573 (38.05%), Postives = 337/573 (58.81%), Query Frame = 1
Query:  316 YFVVAAVVNIQIPLKLGNVVNILSNIKEIKDNDFVAAFKIPSLQLLICYAVQALSTTTYISLLSIIGERLAVKMKKKLFEKIIIQDSKFFDNMRSGDLLNRITADVQDFKSSFKQCISQGLR-GFITIIGSTISLVIVSKELTTIVIIAIPCLVLIGSIMGKILRALSREAQMQNSKAADVANESIINIRTVKSFAMEDMEIENFFIEVNEAAKLHSVLGIGIGIFQGMSNFAINGIVLGVLFTGGFMMNNGNLTPGDLMSFLVASQTIQKSLSTLSTLFGHLVKANASGARITEFLALNTCATSPXXXXXXXXXXXXXXXFDNVRKPESVEFRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYG---NISXXXXXXXXXXXXXXXXXFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALM-KIKGHYYELVKK 2019
            +  +++V+++  P  LG +++++     +  +D +    +    + +C A    +    + L+   G+R+  +++  LF  I+ Q+  FFD  R+G+L+NR+++D      S  + +S GLR G    +G ++ +  VS  L T V+  +P + +I  I G+ LR L++  Q   ++A  +A E I N+RTV++F  E  EIE +  +V+   +L          F G +  + N IVL VL+ GG +M + ++T G+L SFL+ +  +  S+  LS+ +  L+K   +G R+ E L               +  +L  K F       ++EF+N+ FAYP R +  + ++FSL IP GS+ AL G SG+GKST+ SL+ R Y+P SG I ++G +I+++    LRS  +G VSQ+P LF+ +I ENI YG     S T EEI   A+ A A  FI  F  G++T+VGE+ G  LSGGQ+QRIAIARA+LKNP IL+LDEATSALD+++E LVQ AL  +M GRTV++IAHRLSTI+NA+ + VL  GKI E G HE L+ K  G Y +L+ K
Sbjct:  177 FLTMSSVISMSAPFFLGKIIDVIYTNPTVDYSDNLTRLCLGLSAVFLCGAA---ANAIRVYLMQTSGQRIVNRLRTSLFSSILRQEVAFFDKTRTGELINRLSSDTALLGRSVTENLSDGLRAGAQASVGISM-MFFVSPNLATFVLSVVPPVSIIAVIYGRYLRKLTKVTQDSLAQATQLAEERIGNVRTVRAFGKEMTEIEKYASKVDHVMQLARKEAFARAGFFGATGLSGNLIVLSVLYKGGLLMGSAHMTVGELSSFLMYAFWVGISIGGLSSFYSELMKGLGAGGRLWELLEREP------KLPFNEGVILNEKSFQG-----ALEFKNVHFAYPARPEVPIFQDFSLSIPSGSVTALVGPSGSGKSTVLSLLLRLYDPASGTISLDGHDIRQLNPVWLRS-KIGTVSQEPILFSCSIAENIAYGADDPSSVTAEEIQRVAEVANAVAFIRNFPQGFNTVVGEK-GVLLSGGQKQRIAIARALLKNPKILLLDEATSALDAENEYLVQEALDRLMDGRTVLVIAHRLSTIKNANMVAVLDQGKITEYGKHEELLSKPNGIYRKLMNK 732          
BLAST of ATP-binding cassette subfamily B member 8 vs. Ensembl Celegans
Match: haf-6 (HAlF transporter (PGP related) [Source:UniProtKB/TrEMBL;Acc:Q9BL17])

HSP 1 Score: 508.449 bits (1308), Expect = 3.480e-172
Identity = 277/586 (47.27%), Postives = 388/586 (66.21%), Query Frame = 1
Query:  307 YFSYF-------VVAAVVNIQIPLKLGNVVNILSNIKEIKDNDFVAAF---KIPSLQLLICYAVQALSTTTYISLLSIIGERLAVKMKKKLFEKIIIQDSKFFDNMRSGDLLNRITADVQDFKSSFKQCISQGLRGFITIIGSTISLVIVSKELTTIVIIAIPCLVLIGSIMGKILRALSREAQMQNSKAADVANESIINIRTVKSFAMEDMEIENFFIEVNEAAKLHSVLGIGIGIFQGMSNFAINGIVLGVLFTGGFMMNNGNLTPGDLMSFLVASQTIQKSLSTLSTLFGHLVKANASGARITEFLALNTCATSPXXXXXXXXXXXXXXXFDNVRKPESVEFRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYGNISXXXXXXXXXXXXXXXXXFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALMKIKGHYYELVKKLEKDN 2034
            +F +F       +++A +NIQIPL LG++VN +  I + + N+  + F   K  +L L+  Y  Q+  T  YI+ L+++GER+A KM+  LF+K++  D  FFD+ +SG+L  R+ ADVQ+FKSSFK C+SQGLR F   IG   SL  +S  +T   +  +P ++L GS +G  LR LSR AQ Q++ A+ V++E++ NIRT+++FAME +E   F  E+++A  +   LG+GIG+FQ  +N  +NG++L VL+ G  +++ G +TPG LMSFLV++QTIQ+SLS LS +FG  +K   +G R+ +F  L      P +       +     + +++      F ++SF+YPTR   TV EN +L IP G +VALCG SG GKSTI  L++RFYEP SG + ++G +++E+ V  LR   +G++SQ+P LFA ++ ENIRYG   AT+EE+ EAA+ A   EF+  F  GY T+VGERG + LSGGQ+QRIAIARAILKNP ILILDEATSALDS SE +VQ AL NVMKGRTV+IIAHRLSTI++A  I V+K  K  E G HE LM  KG  Y   K +E  N
Sbjct:   94 FFGWFFAAVVCAILSAYINIQIPLCLGDLVNGIVKIIKDESNNLRSHFEQLKPSALHLMTLYVAQSALTFLYITFLTVLGERMATKMRSDLFQKLLHHDMAFFDSHKSGELSARLNADVQEFKSSFKLCVSQGLRTFAQTIGCIGSLYFLSPTMTMYTVAVVPGIILAGSAIGAGLRQLSRRAQGQSATASAVSDEALTNIRTIRAFAMEKLESRLFDNELDKARAMQEQLGVGIGLFQAGTNLFLNGMILSVLYGGSNLISKGEMTPGALMSFLVSAQTIQRSLSQLSIIFGTAIKGWTAGGRVLQFSRLE-----PSIPMDTGVCIPYHSLWGDIK------FEDVSFSYPTRPGHTVFENLTLSIPAGQVVALCGPSGEGKSTITHLLERFYEPKSGRVTLDGRDLRELNVEWLRGQVIGLISQEPVLFATSVEENIRYGRPDATDEEVREAARAAHVDEFVSRFPSGYSTVVGERGAQ-LSGGQKQRIAIARAILKNPPILILDEATSALDSHSEHMVQEALNNVMKGRTVLIIAHRLSTIRSAQMIYVIKDKKALESGTHEQLMAKKGSLYR--KLVEAHN 665          
BLAST of ATP-binding cassette subfamily B member 8 vs. Ensembl Celegans
Match: haf-6 (HAlF transporter (PGP related) [Source:UniProtKB/TrEMBL;Acc:Q9BL17])

HSP 1 Score: 481.485 bits (1238), Expect = 8.076e-164
Identity = 258/528 (48.86%), Postives = 355/528 (67.23%), Query Frame = 1
Query:  451 LICYAVQALSTTTYISLLSIIGERLAVKMKKKLFEKIIIQDSKFFDNMRSGDLLNRITADVQDFKSSFKQCISQGLRGFITIIGSTISLVIVSKELTTIVIIAIPCLVLIGSIMGKILRALSREAQMQNSKAADVANESIINIRTVKSFAMEDMEIENFFIEVNEAAKLHSVLGIGIGIFQGMSNFAINGIVLGVLFTGGFMMNNGNLTPGDLMSFLVASQTIQKSLSTLSTLFGHLVKANASGARITEFLALNTCATSPXXXXXXXXXXXXXXXFDNVRKPESVEFRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYGNISXXXXXXXXXXXXXXXXXFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALMKIKGHYYELVKKLEKDN 2034
            +  Y  Q+  T  YI+ L+++GER+A KM+  LF+K++  D  FFD+ +SG+L  R+ ADVQ+FKSSFK C+SQGLR F   IG   SL  +S  +T   +  +P ++L GS +G  LR LSR AQ Q++ A+ V++E++ NIRT+++FAME +E   F  E+++A  +   LG+GIG+FQ  +N  +NG++L VL+ G  +++ G +TPG LMSFLV++QTIQ+SLS LS +FG  +K   +G R+ +F  L      P +       +     + +++      F ++SF+YPTR   TV EN +L IP G +VALCG SG GKSTI  L++RFYEP SG + ++G +++E+ V  LR   +G++SQ+P LFA ++ ENIRYG   AT+EE+ EAA+ A   EF+  F  GY T+VGERG + LSGGQ+QRIAIARAILKNP ILILDEATSALDS SE +VQ AL NVMKGRTV+IIAHRLSTI++A  I V+K  K  E G HE LM  KG  Y   K +E  N
Sbjct:    1 MTLYVAQSALTFLYITFLTVLGERMATKMRSDLFQKLLHHDMAFFDSHKSGELSARLNADVQEFKSSFKLCVSQGLRTFAQTIGCIGSLYFLSPTMTMYTVAVVPGIILAGSAIGAGLRQLSRRAQGQSATASAVSDEALTNIRTIRAFAMEKLESRLFDNELDKARAMQEQLGVGIGLFQAGTNLFLNGMILSVLYGGSNLISKGEMTPGALMSFLVSAQTIQRSLSQLSIIFGTAIKGWTAGGRVLQFSRLE-----PSIPMDTGVCIPYHSLWGDIK------FEDVSFSYPTRPGHTVFENLTLSIPAGQVVALCGPSGEGKSTITHLLERFYEPKSGRVTLDGRDLRELNVEWLRGQVIGLISQEPVLFATSVEENIRYGRPDATDEEVREAARAAHVDEFVSRFPSGYSTVVGERGAQ-LSGGQKQRIAIARAILKNPPILILDEATSALDSHSEHMVQEALNNVMKGRTVLIIAHRLSTIRSAQMIYVIKDKKALESGTHEQLMAKKGSLYR--KLVEAHN 514          
BLAST of ATP-binding cassette subfamily B member 8 vs. Ensembl Celegans
Match: haf-9 (HAlF transporter (PGP related) [Source:UniProtKB/TrEMBL;Acc:O44897])

HSP 1 Score: 300.056 bits (767), Expect = 1.843e-90
Identity = 185/504 (36.71%), Postives = 301/504 (59.72%), Query Frame = 1
Query:  532 KMKKKLFEKIIIQDSKFFDNMRSGDLLNRITADVQDFKSSFKQCISQGLRGFITIIGSTISLVIVSKELTTIVIIAIPCLVLIGSIMGKILRALSREAQMQNSKAADVANESIINIRTVKSFAMEDMEIENFFIEVNEAAKLHS-VLGIGIGIFQGMSNFAIN-GIVLGVLFTGGFMMNNGNLTPGDLMSFLVASQTIQKSLSTLSTLFGHLVKANASGARITEFL-----ALNTCATSPXXXXXXXXXXXXXXXFDNVRKPESVEFRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYGNISXXXXXXXXXXXXXXXXXFIVG-FQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALMKIKGHYYELVKK 2019
            +++  LF  ++ Q+  FFD  ++G++ +R++AD Q   ++    ++   R    + GS I +  +S +L+ I +I IP + L+  I G     LS E Q   +KA DVA E + +IRTVKSFA E+ E   F   +N   K+ +  + + IG+    SN  +  GI+  VL+ GG ++    +  G L+SFL+    + ++L  L  ++  L++A  +  ++ EF+       NT   +P                        +EFR+++F+YP R D  ++E+ +  +  G +VAL G SG GKS+  ++++ FYEP SGE+LI+GV ++E     L +  V +V Q+P L+A+++ ENI YG     ++ +  +AK A AH FI+    DGY+T VGE+G + +SGGQ+QRIAIARA+++ P +L+LDEATSALD++SE  VQ A+   +KG+TV++IAHRLST++NADKIVV+  GK+ ++G H+ LM+ +G Y +LV++
Sbjct:  278 QIRNDLFRSVVKQEIGFFDMNKTGEICSRLSADCQTMSNTLSLYMNVLTRNLTMLFGSLIFMFTLSWKLSMITLINIPIIFLVNKIFGVWYDMLSEETQNSVAKANDVAEEVLSSIRTVKSFACENYESSRFMTFLNVTLKIATRKVFVVIGLI--WSNELLQMGILTIVLWYGGHLVIENKVESGLLVSFLLYQFQLGENLRELGEVWNGLMQAVGASRKVFEFIDRPPRVENTGTYAPDGMTG------------------KIEFRHVAFSYPIRPDLPIMEDLTFTVEPGEVVALVGPSGGGKSSCIAMLEHFYEPTSGEVLIDGVPVREYDHKFLHT-KVALVGQEPVLYARSVTENIGYGLDKYDDDMVQNSAKLANAHTFIMNDTTDGYNTNVGEKGSQ-MSGGQKQRIAIARALVRQPVVLLLDEATSALDAESEHTVQEAISKNLKGKTVILIAHRLSTVENADKIVVINKGKVEQLGNHKTLMEQEGLYKQLVQR 759          
BLAST of ATP-binding cassette subfamily B member 8 vs. Ensembl Celegans
Match: haf-9 (HAlF transporter (PGP related) [Source:UniProtKB/TrEMBL;Acc:O44897])

HSP 1 Score: 300.056 bits (767), Expect = 1.843e-90
Identity = 185/504 (36.71%), Postives = 301/504 (59.72%), Query Frame = 1
Query:  532 KMKKKLFEKIIIQDSKFFDNMRSGDLLNRITADVQDFKSSFKQCISQGLRGFITIIGSTISLVIVSKELTTIVIIAIPCLVLIGSIMGKILRALSREAQMQNSKAADVANESIINIRTVKSFAMEDMEIENFFIEVNEAAKLHS-VLGIGIGIFQGMSNFAIN-GIVLGVLFTGGFMMNNGNLTPGDLMSFLVASQTIQKSLSTLSTLFGHLVKANASGARITEFL-----ALNTCATSPXXXXXXXXXXXXXXXFDNVRKPESVEFRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYGNISXXXXXXXXXXXXXXXXXFIVG-FQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALMKIKGHYYELVKK 2019
            +++  LF  ++ Q+  FFD  ++G++ +R++AD Q   ++    ++   R    + GS I +  +S +L+ I +I IP + L+  I G     LS E Q   +KA DVA E + +IRTVKSFA E+ E   F   +N   K+ +  + + IG+    SN  +  GI+  VL+ GG ++    +  G L+SFL+    + ++L  L  ++  L++A  +  ++ EF+       NT   +P                        +EFR+++F+YP R D  ++E+ +  +  G +VAL G SG GKS+  ++++ FYEP SGE+LI+GV ++E     L +  V +V Q+P L+A+++ ENI YG     ++ +  +AK A AH FI+    DGY+T VGE+G + +SGGQ+QRIAIARA+++ P +L+LDEATSALD++SE  VQ A+   +KG+TV++IAHRLST++NADKIVV+  GK+ ++G H+ LM+ +G Y +LV++
Sbjct:  278 QIRNDLFRSVVKQEIGFFDMNKTGEICSRLSADCQTMSNTLSLYMNVLTRNLTMLFGSLIFMFTLSWKLSMITLINIPIIFLVNKIFGVWYDMLSEETQNSVAKANDVAEEVLSSIRTVKSFACENYESSRFMTFLNVTLKIATRKVFVVIGLI--WSNELLQMGILTIVLWYGGHLVIENKVESGLLVSFLLYQFQLGENLRELGEVWNGLMQAVGASRKVFEFIDRPPRVENTGTYAPDGMTG------------------KIEFRHVAFSYPIRPDLPIMEDLTFTVEPGEVVALVGPSGGGKSSCIAMLEHFYEPTSGEVLIDGVPVREYDHKFLHT-KVALVGQEPVLYARSVTENIGYGLDKYDDDMVQNSAKLANAHTFIMNDTTDGYNTNVGEKGSQ-MSGGQKQRIAIARALVRQPVVLLLDEATSALDAESEHTVQEAISKNLKGKTVILIAHRLSTVENADKIVVINKGKVEQLGNHKTLMEQEGLYKQLVQR 759          
BLAST of ATP-binding cassette subfamily B member 8 vs. Ensembl Celegans
Match: haf-7 (HAlF transporter (PGP related) [Source:UniProtKB/TrEMBL;Acc:Q9U275])

HSP 1 Score: 291.582 bits (745), Expect = 2.008e-87
Identity = 191/544 (35.11%), Postives = 299/544 (54.96%), Query Frame = 1
Query:  424 AFKIPSLQLLICYAVQ----ALSTTTYISLLSIIGERLAVK-MKKKLFEKIIIQDSKFFDNMRSGDLLNRITADVQDFKSSFKQCISQGLRGFITIIGSTISLVIVSKELTTIVIIAIPCLVLIGSIMGKILRALSREAQMQNSKAADVANESIINIRTVKSFAMEDMEIENFFIEVNEAAKLHS---VLGIGIGIFQGMSNFAINGIVLGVLFTGGFMMNNGNLTPGDLMSFLVASQTIQKSLSTLSTLFGHLVKANASGARITEFLALNTCATSPXXXXXXXXXXXXXXXFDNVRKPE---SVEFRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYGNISXXXXXXXXXXXXXXXXXFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALMK-IKGHYYELVKK 2019
            +F +     ++  AVQ     ++T  YI +     ERL  + ++  LF  I+ QD  FFD+ ++G L++RIT D +   +S    I   +     + GS   +   S +L     +  P ++L     G I+  LS +     + + +   E +  IRTV+SFA E +E   +  + +   K+ +   V G     F   + + I  ++  +   GG++  NG + P  L++++     +  +L+  S+LF  ++K   S  ++     ++     P L                   PE   ++ F ++ FAYPTR +  VL   +L I  G  +AL G SG GKST+ SLIQ+FY P SG ILI+G  IQ I      + N+ +V+Q+P LF+ T+RENI YG  + T+E+++  A+ A  HEF+   + GYDT  GE+G + +SGGQ+QRIAIARA++++P +LILDEATSALDS+SE +VQ AL    + RTV++IAHRLST+++AD+I V++ G + EMG HE LMK  +G YY+LV K
Sbjct:  266 SFDVLKRACIVLAAVQFTEATVNTVRYICMQ--YAERLTARNIRVSLFRAILHQDISFFDDNKTGQLMSRITKDSESISNSLPVYIETTVNNSFMLFGSAPIMFYYSWQLAISTFVTFPIILLTTKFYGLIVEKLSEKENDATAVSNETVEEVLSAIRTVRSFAAEKIENMRYTRDTDAWFKISTKTVVFGTFFNYFWA-TMWNIEDVI--IYLYGGYLTLNGRMEPDALLTYIFYHWRLHSALNAFSSLFSDVMKTIGSSRKV-----IHIMNRQPELDYEF-----------GTETPEIVGNIIFEDVEFAYPTRKNANVLNKINLSIDPGKTIALVGPSGNGKSTLVSLIQQFYTPQSGRILIDGTPIQNIDHLHYHT-NIALVAQEPTLFSGTVRENILYGLENGTDEDMMRVAEMANVHEFVSKMEKGYDTKCGEKGVQ-MSGGQKQRIAIARALIRDPRVLILDEATSALDSESEAMVQEALNRCARERTVLVIAHRLSTVRSADRIAVIEKGNVTEMGNHEELMKNTEGLYYKLVSK 786          
BLAST of ATP-binding cassette subfamily B member 8 vs. Ensembl Fly
Match: CG1824 (gene:FBgn0030403 transcript:FBtr0073658)

HSP 1 Score: 508.449 bits (1308), Expect = 7.540e-171
Identity = 276/576 (47.92%), Postives = 394/576 (68.40%), Query Frame = 1
Query:  322 VVAAVVNIQIPLKLGNVVNILSN-----IKEIKDNDFVAAFKIPSLQLLICYAVQALSTTTYISLLSIIGERLAVKMKKKLFEKIIIQDSKFFDNMRSGDLLNRITADVQDFKSSFKQCISQGLRGFITIIGSTISLVIVSKELTTIVIIAIPCLVLIGSIMGKILRALSREAQMQNSKAADVANESIINIRTVKSFAMEDMEIENFFIEVNEAAKLHSVLGIGIGIFQGMSNFAINGIVLGVLFTGGFMMNNGNLTPGDLMSFLVASQTIQKSLSTLSTLFGHLVKANASGARITEFLALNTCATSPXXXXXXXXXXXXXXXFDNVRKPESVEFRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYGNISXXXXXXXXXXXXXXXXXFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALMKIKGHYYELVKKLEKDN 2034
            ++ A +NI+IP  LG++VN L+      + +  +N FV     P+  LL  Y +Q+  T  YI LLS +GE++A KM++ LF +I++QD  FFD  R+G+L+NR+TADVQDFK+SFKQ +SQGLR    +IG +ISL ++S  +  I + ++PC+V+  + +GK LR+LS+ +Q Q  +A  V  E++ NIRTV+S A E  E++ F  E NEAA+L   LG GI IFQG++NF +N +VL  LF GG +M+  +L+PG LM+FLVASQ +Q+SL+  S L G +++  ++G+R+ EFL+L      P+++ L+   + + +    +R      F N+SFAYP + D  VL++FSL +  G  VAL G SG+GKSTIASL++RFYEP +G I ++G  + +I    LRS  +G + QQP LF  +I ENIRYG   A EE++  AA+ +Q+H+F+    DGY T VGERG + LSGGQRQRIAIARA+LKNP ILILDEATSALD+ SE  VQ+AL  V++ RT ++IAHRLSTI+NAD IVVL  G++ E G H+ LM  +G Y+ELV++ E+ +
Sbjct:  141 LIVAYINIRIPNLLGDLVNTLARYANTYVMDPINNSFVKDVSKPASNLLSLYMLQSGFTFMYIYLLSRVGEQMAAKMRQDLFTQIVVQDIAFFDENRTGELVNRLTADVQDFKTSFKQFVSQGLRSAAQLIGGSISLFMISPHMAAIALASVPCVVMFMTYLGKKLRSLSKSSQAQAERATGVCEEALSNIRTVRSSACEYREMQLFEAETNEAARLAQKLGYGIAIFQGLTNFFLNTLVLSTLFMGGHLMSTESLSPGALMAFLVASQGVQRSLAQGSILLGTMIRGMSAGSRVFEFLSLQ-----PQVELLRGYIIPQERLHGEIR------FENVSFAYPMQPDHLVLKDFSLTLRPGQTVALVGASGSGKSTIASLVERFYEPSAGNIKLDGYKLSDISPYWLRSNVLGFIEQQPVLFGTSILENIRYGKPDAGEEDVYAAARLSQSHDFVTALPDGYATHVGERGTQ-LSGGQRQRIAIARALLKNPRILILDEATSALDATSEAEVQKALDTVVQNRTTLVIAHRLSTIRNADLIVVLDQGRVVETGKHDELMGKRGLYFELVRQQERRD 704          
BLAST of ATP-binding cassette subfamily B member 8 vs. Ensembl Fly
Match: CG3156 (gene:FBgn0023536 transcript:FBtr0070079)

HSP 1 Score: 308.916 bits (790), Expect = 8.639e-95
Identity = 199/570 (34.91%), Postives = 325/570 (57.02%), Query Frame = 1
Query:  319 FVVAAVVNIQIPLKLGNVVNILSNIKEIKDNDFVAAFKIPSLQLLICYAVQALSTTTYISLLSIIGERLAVKMKKKLFEKIIIQDSKFFDNMRSGDLLNRITADVQDFKSSFKQCISQGLRGFITIIGSTISLVIVSKELTTIVIIAIPCLVLIGSIMGKILRALSREAQMQNSKAADVANESIINIRTVKSFAMEDMEIENFFIEVNEAAKLHSVLGIGIGIFQGMSNFAINGIVLGVLFTGGFMMNNGNLTPGDLMSFLVASQTIQKSLSTLSTLFGHLVKANASGARITEFLALNTCATSPXXXXXXXXXXXXXXXFDNVRKP-ESVEFRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYG---NISXXXXXXXXXXXXXXXXXFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALMKIK-GHYYELV 2013
             VV++ + + +PL LG V++++ N K   D+  +A     S+ L   + +   +    + L      R+   ++ +L+  +++Q+  +FD   +G+L+NR++ D     +S  Q +S GLR    I   T  ++  S +L  +  + +P +  +  + G+ +R +++    + ++    A E   N++TVK+F  E  E+  F  +++EA ++         IF G++ F  N I++ VL+ GG ++   +LT G L +F++ +  +  S++ LS  +  L K   +  RI E L    C+  P  + +             + KP   V F+N+ F +PTR +  VL +FSL +  G+  A+ G SG+GK+TIA L+ R Y+P  G + ++G++++ +    LR+ N+G VSQ+P LF+ +IRENI YG     + + E + +  + A   +F     DG DTLVG+RG   LSGGQ+QR+AIARA++KNP ILILDEATSALD+ SE LVQ AL N+++GRTV+ IAHRLSTI+NAD+I VL  GKI E G +  LM I+ G + ELV
Sbjct:  130 LVVSSAITMSVPLFLGKVIDVVFN-KSGMDSAAMAKLGEYSVLLFGIFVLGGFANFARVHLFGNAALRIVRSLRSRLYRSMLMQEVGWFDTKGTGELINRLSNDTLMVGTSLSQNVSDGLRSVAMIGVGTGMMIYTSPQLAAVSALVVPAMAGMAIVYGRYVRRITKVELDKYAEIMKFAEERFGNVKTVKTFCREQQEVAAFDGKLDEALQIGYKETRARAIFFGLTGFCGNFIIISVLYYGGTLVLQDSLTIGALTAFMLYAGYVAISMNGLSNFYSQLNKGIGASERIWEILD-RECSI-PIDKGVVP-----------LEKPVGEVGFQNVFFTFPTRPESAVLTDFSLNLMPGTTTAVVGRSGSGKTTIALLMLRLYDPQGGTVHLDGIDLRTVNPQWLRN-NIGAVSQEPVLFSCSIRENILYGANPGETPSPERLQQVIEDANVSQFTDQLPDGLDTLVGQRG-MMLSGGQKQRVAIARALIKNPAILILDEATSALDAVSENLVQNALDNLIQGRTVLTIAHRLSTIRNADQIAVLSDGKIVEQGSYNELMGIQEGVFRELV 683          
BLAST of ATP-binding cassette subfamily B member 8 vs. Ensembl Fly
Match: Mdr50 (gene:FBgn0010241 transcript:FBtr0087537)

HSP 1 Score: 262.307 bits (669), Expect = 1.989e-74
Identity = 184/505 (36.44%), Postives = 282/505 (55.84%), Query Frame = 1
Query:  535 MKKKLFEKIIIQDSKFFDNMRSGDLLNRITADVQDFKSSFKQCISQGLRGFITIIGSTISLVIVSKELTTIVIIAIPCLVLIGSIMGKILRALSREAQMQNS---KAADVANESIINIRTVKSFAMEDMEIENFFIEVNEAAKLH------SVLGIGIGIFQGMSNFAINGIV-LGVLFTGGFMMNNGNLTPGDLMSFLVASQTIQKSLSTLSTLFGHLVKANASGARITEF-LALNTCATSPXXXXXXXXXXXXXXXFDNVRKP-ESVEFRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYGNISXXXXXXXXXXXXXXXXXFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALMKIKGHYYELV 2013
            ++ K F  I+ QD K++D  +SG++ +R+  D+   +    + +   +   +  +GS +   +   +L+ + + ++P L  I   MG +  A SR A+ + +    AA VA  ++  IRTVK+F  E  E+  +   V  A  L+      S +G G+  F   +++A+     +G++  G       N   G +++               S + G +     +   I  F +A   CA    + +          +   + +P  ++EF+ + F YPTR + ++L   +L I  G  VAL G SG GKST   L+QRFY+P +G +L NG N++++ ++ LRS  +GVV Q+P LFA +I ENIRYG   AT EEI  AA  A A  FI     GYDTLVGERG + LSGGQ+QRIAIARA++++P IL+LDEATSALD+ SE  VQ AL+ V  GRT +I+AHRLST++ AD+IVV+  G++ E G H+ LM++K HY+ LV
Sbjct:  179 IRSKFFRSILHQDMKWYDFNQSGEVASRMNEDLSKMEDGLAEKVVMFVHYLVAFVGSLVLAFVKGWQLSLVCLTSLP-LTFIA--MGLVAVATSRLAKKEVTMYAGAAVVAEGALSGIRTVKAFEGEAKEVAAYKERVVAAKILNIKRNMFSGIGFGLLWFFIYASYALAFWYGVGLVIKGYHEPAYENYDAGTMITVF------------FSVMMGSM-NIGMAAPYIEAFGIAKGACAKVFHIIEQIPEINPIDGEGKKLNEPLTTIEFKEVEFQYPTRPEVSILNKLNLKIHRGQTVALVGPSGCGKSTCIQLVQRFYDPQAGNLLFNGTNLKDLDINWLRS-RIGVVGQEPILFATSIYENIRYGREDATREEIEAAAAAANAAIFIKKLPKGYDTLVGERGAQ-LSGGQKQRIAIARALIRDPEILLLDEATSALDTASEAKVQAALEKVSAGRTTIIVAHRLSTVRRADRIVVINKGEVVESGTHQELMELKDHYFNLV 665          

HSP 2 Score: 239.965 bits (611), Expect = 1.019e-66
Identity = 190/578 (32.87%), Postives = 300/578 (51.90%), Query Frame = 1
Query:  361 LGNVVNILSNIKEIKDND-FVAA-FKIPSLQLLICYAVQALSTTTYISLLSIIGERLAVKMKKKLFEKIIIQDSKFFDNMR--SGDLLNRITADVQDFKSSFKQCISQGLRGFITIIGSTISLVIVSKELTTIVIIAIPCLVLIGSIMGKILRA---LSREAQMQNSKAADVANESIINIRTVKSFAMEDMEIENF---FIEVNEAAKLHSVL-GIGIGIFQGMSNFAI-------------NGIVLGVLFTGGFMMNNGNLTPGDLMSFLVASQTIQKSLSTLSTLFGHLVKANASGARITEFLALNTCATSPXXXXXXXXXXXXXXXFDNVRKPESVEFRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYGNISXXXXXXX--XXXXXXXXXXFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALMKIKGHYYELVK 2016
             G+++ ILS    +KDND +V       SL  LI   V  ++T   I    I GERL  +++  +FE ++ Q+  +FD+    +G L  R++ D    + +  Q I   ++  I+ +   I+L +  +    +V +A    +LI   M + L A   +     M+N     +A E + NIRTV S   E+M  +N+    I   E +K ++   G+  G+ + +  FA               GI+ G +F     +  G  +  + ++F   +  +QK +S   T+F  L +  +   R             P +              D       V F  + F+YPTR++  VL+   L + +G  +AL G SG GKST   LIQRFY+   G  LI+  +++ + +++LR+  +G+VSQ+P LF +TIRENI YG+ +    +     A K++  HEFI     GYDT +GE+G + LSGGQ+QRIAIARA+++NP I++LDEATSALD++SE +VQ AL    +GRT + IAHRLST+ ++D I V ++G + E G H+ L+  +G YY L K
Sbjct:  767 FGSILQILS----VKDNDQYVRENSNQYSLYFLIAGIVVGIATFLQIYFFGIAGERLTERLRGLMFEAMLRQEVAWFDDKANGTGSLCARLSGDAAAVQGATGQRIGTIVQS-ISTLALGIALSMYYEWSLGLVALAFTPFILIAFYMQRTLMAKENMGSAKTMEN--CTKLAVEVVSNIRTVASLGREEMFHQNYIGMLIPAVEISKRNTHFRGLVYGLARSLMFFAYAACMYYGTWCVIHRGILFGDVFKVSQALIMGTASIANALAF---APNMQKGVSAAKTIFTFLRRQPSIVDR-------------PGVSR------------DPWHSEGYVRFDKVKFSYPTRSEIQVLKGLELAVSKGQKIALVGPSGCGKSTCIQLIQRFYDVDEGATLIDECDVRNVSMTNLRN-QLGIVSQEPILFDRTIRENISYGDNARNVTDQEIISACKKSNIHEFIANLPLGYDTRMGEKGAQ-LSGGQKQRIAIARALIRNPKIMLLDEATSALDAESEKVVQDALDAASEGRTTISIAHRLSTVVHSDVIFVFENGLVCEAGDHKQLLANRGLYYTLYK 1307          
BLAST of ATP-binding cassette subfamily B member 8 vs. Ensembl Fly
Match: CG10226 (gene:FBgn0035695 transcript:FBtr0332068)

HSP 1 Score: 253.832 bits (647), Expect = 1.271e-71
Identity = 177/538 (32.90%), Postives = 285/538 (52.97%), Query Frame = 1
Query:  475 LSTTTYISLLSIIGERLAVKMKKKLFEKIIIQDSKFFDNMRSGDLLNRITADVQDFKSSFKQCISQGLRGFITIIGSTISLVIVSKELTTIVIIAIPCLVLIGSIMGKILRALSREAQMQNSKAADVANESIINIRTVKSFAMEDMEIENFFIEVNEAAKLHSVLGIGIGIFQGMSNFAINGIVL----GVLFTGGFMM----------NNGNLTPGDLM----SFLVASQTIQKSLSTLSTLFGHLVKANASGARITEFLALNTCATSPXXXXXXXXXXXXXXXFDNVRKPESVEFRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYGNISXXXXXXXXXXXXXXXXXFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALMKIKGHYYELVKKLEKDN 2034
             S   Y+   + +  +L V+M+++ F+  + Q+  + D  +  +   RIT +++  +S   + +   +     +I S +   I   +L   ++  IP  +++ S +      L+ + Q    +A+ V  E I  IRTV +F  E  E   +   +  A K     G   G F G+S+  +  ++     G  + G  ++          +    TP  +M      +V++  I ++   L T       A  S + I + +   T    P  +  +           N     +VEFR++ F YP R D  VL   ++ + EG  VAL G SG GKST   L+QRFY+P+ G++L++G ++++  +  LRS N+ VV Q+P LF  +I ENIR+G   AT++E+ +AAK A AH+FI+    GYDT + E+G + LSGGQRQRIAIARA+++ P IL+LDEATSALD  SE LVQ AL    KGRT ++++HRLS I++A +IV +++GK  E G HE LMK++G Y+++V     D+
Sbjct:   24 FSGVYYVDAFNRLALKLTVRMRREFFKATLRQEIGWHDMAKDQNFAVRITDNMEKIRSGIAENLGHYVEIMCDVIISVVLSFIYGWKLALAIVFYIPLTLVVNSAVAHYQGKLTGQEQSSYVRASSVVEEVIGAIRTVVAFGGERSESLRYDSLLKPALKA----GKWKGAFSGLSDTVMKAMLFITGAGSFWYGANLILYYRDPSIPIDEREYTPAVVMIVISGIIVSANQISRTSPFLETF----AMARGSASAILDVID-RTSLIDPLSKAGKIL---------NYGLKGAVEFRDVFFRYPAREDVIVLRGLNVVVEEGQTVALVGPSGCGKSTCIQLLQRFYDPVFGQVLLDGEDVRKYNIKWLRS-NIAVVGQEPVLFQGSIGENIRHGKPEATQKEVEDAAKAANAHDFIIALHKGYDTDISEKGVQ-LSGGQRQRIAIARALIQQPKILLLDEATSALDYHSEKLVQAALDKACKGRTTLVVSHRLSAIRHAHRIVYIENGKAVEQGTHEELMKLEGFYHKMVTVHSYDD 541          

HSP 2 Score: 227.254 bits (578), Expect = 1.596e-62
Identity = 181/528 (34.28%), Postives = 276/528 (52.27%), Query Frame = 1
Query:  499 LLSIIGERLAVKMKKKLFEKIIIQDSKFFDNMRS--GDLLNRITADVQDFKSSFKQCISQGLRGFITIIGSTISLVIVSKELTTIVIIAIPCLV---LIGSIMGKILRALSREAQMQNSKAADVANESIINIRTVKSFAME-------DMEIENFFIEVNEAAKLHSV---LGIGIGIFQGMSNFAINGIVLGVLFTGGFMMNNGNLTPGDLM----SFLVASQTIQKSLSTLSTLFGHLVKANASGARITEFLALNTCATSPXXXXXXXXXXXXXXXFDNVRKPESVEFRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQ-EIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYGNISXXXXXXX--XXXXXXXXXXFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALMKIKGHYYELVK 2016
              ++ G  L  +M+ K F  I+ Q+  +FD   +  G L  R++ D    + +    +S  ++ F   I S       S EL  I +   P +V   +  +  G+      +E   + S+   +A E+I  IRTV     E       D E+E +  ++    K   +   LG  +  F     +A+       L  GG M  +G +    +M    + L     + +SL+        L+ AN    R+ E +       SP   ++Q+         + V+  + V +R ++F+YP+R    VL+NF+L I +G  VAL G SG+GKST   L+ R+Y+P  G+ILI+  +I  ++ +  LR   +G+VSQ+P LF K+I +NI YG+ S         EAAK A AHEFI+     YDT++G +G + LSGGQ+QRIAIARA+++NP IL+LDEATSALD +SE +VQ+AL +   GRT ++IAHRLSTIQNA+ I V++ GKI E G H  L+   G Y +L +
Sbjct:  694 FFNLAGVWLTTRMRSKTFRCIMNQEMGWFDRKENSIGALSARLSGDAASVQGAIGFPLSNIIQAFTNFICSIAIAFPYSWELALICLSTSPFMVASIVFEARFGEKSALKEKEVLEETSR---IATETITQIRTVAGLRREEELIKIYDKEVERYRHQILSRLKWRGLVNSLGKSLMFF----GYAVT------LTYGGHMCADGKIKFETIMKISNTMLYGLFILAQSLAFTPAFNAALLSAN----RMYEIIDRKPQIQSPESFEIQQNGNGTAYKTNVVQ--QGVSYRGLNFSYPSRPHIKVLQNFNLDINQGQTVALVGASGSGKSTCVQLLMRYYDPDEGKILIDQESIHHDMDLKTLRR-RLGIVSQEPSLFEKSIADNIGYGDTSRQVPMQQIIEAAKMANAHEFIMSLPAQYDTVLGSKGTQ-LSGGQKQRIAIARAMVRNPKILLLDEATSALDFQSERVVQQALDSACSGRTCIVIAHRLSTIQNANVICVIQAGKIVEQGSHSQLLAKNGIYSKLYR 1200          
BLAST of ATP-binding cassette subfamily B member 8 vs. Ensembl Fly
Match: CG10226 (gene:FBgn0035695 transcript:FBtr0077012)

HSP 1 Score: 253.832 bits (647), Expect = 1.487e-71
Identity = 177/538 (32.90%), Postives = 285/538 (52.97%), Query Frame = 1
Query:  475 LSTTTYISLLSIIGERLAVKMKKKLFEKIIIQDSKFFDNMRSGDLLNRITADVQDFKSSFKQCISQGLRGFITIIGSTISLVIVSKELTTIVIIAIPCLVLIGSIMGKILRALSREAQMQNSKAADVANESIINIRTVKSFAMEDMEIENFFIEVNEAAKLHSVLGIGIGIFQGMSNFAINGIVL----GVLFTGGFMM----------NNGNLTPGDLM----SFLVASQTIQKSLSTLSTLFGHLVKANASGARITEFLALNTCATSPXXXXXXXXXXXXXXXFDNVRKPESVEFRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYGNISXXXXXXXXXXXXXXXXXFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALMKIKGHYYELVKKLEKDN 2034
             S   Y+   + +  +L V+M+++ F+  + Q+  + D  +  +   RIT +++  +S   + +   +     +I S +   I   +L   ++  IP  +++ S +      L+ + Q    +A+ V  E I  IRTV +F  E  E   +   +  A K     G   G F G+S+  +  ++     G  + G  ++          +    TP  +M      +V++  I ++   L T       A  S + I + +   T    P  +  +           N     +VEFR++ F YP R D  VL   ++ + EG  VAL G SG GKST   L+QRFY+P+ G++L++G ++++  +  LRS N+ VV Q+P LF  +I ENIR+G   AT++E+ +AAK A AH+FI+    GYDT + E+G + LSGGQRQRIAIARA+++ P IL+LDEATSALD  SE LVQ AL    KGRT ++++HRLS I++A +IV +++GK  E G HE LMK++G Y+++V     D+
Sbjct:  138 FSGVYYVDAFNRLALKLTVRMRREFFKATLRQEIGWHDMAKDQNFAVRITDNMEKIRSGIAENLGHYVEIMCDVIISVVLSFIYGWKLALAIVFYIPLTLVVNSAVAHYQGKLTGQEQSSYVRASSVVEEVIGAIRTVVAFGGERSESLRYDSLLKPALKA----GKWKGAFSGLSDTVMKAMLFITGAGSFWYGANLILYYRDPSIPIDEREYTPAVVMIVISGIIVSANQISRTSPFLETF----AMARGSASAILDVID-RTSLIDPLSKAGKIL---------NYGLKGAVEFRDVFFRYPAREDVIVLRGLNVVVEEGQTVALVGPSGCGKSTCIQLLQRFYDPVFGQVLLDGEDVRKYNIKWLRS-NIAVVGQEPVLFQGSIGENIRHGKPEATQKEVEDAAKAANAHDFIIALHKGYDTDISEKGVQ-LSGGQRQRIAIARALIQQPKILLLDEATSALDYHSEKLVQAALDKACKGRTTLVVSHRLSAIRHAHRIVYIENGKAVEQGTHEELMKLEGFYHKMVTVHSYDD 655          

HSP 2 Score: 227.254 bits (578), Expect = 1.571e-62
Identity = 181/528 (34.28%), Postives = 276/528 (52.27%), Query Frame = 1
Query:  499 LLSIIGERLAVKMKKKLFEKIIIQDSKFFDNMRS--GDLLNRITADVQDFKSSFKQCISQGLRGFITIIGSTISLVIVSKELTTIVIIAIPCLV---LIGSIMGKILRALSREAQMQNSKAADVANESIINIRTVKSFAME-------DMEIENFFIEVNEAAKLHSV---LGIGIGIFQGMSNFAINGIVLGVLFTGGFMMNNGNLTPGDLM----SFLVASQTIQKSLSTLSTLFGHLVKANASGARITEFLALNTCATSPXXXXXXXXXXXXXXXFDNVRKPESVEFRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQ-EIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYGNISXXXXXXX--XXXXXXXXXXFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALMKIKGHYYELVK 2016
              ++ G  L  +M+ K F  I+ Q+  +FD   +  G L  R++ D    + +    +S  ++ F   I S       S EL  I +   P +V   +  +  G+      +E   + S+   +A E+I  IRTV     E       D E+E +  ++    K   +   LG  +  F     +A+       L  GG M  +G +    +M    + L     + +SL+        L+ AN    R+ E +       SP   ++Q+         + V+  + V +R ++F+YP+R    VL+NF+L I +G  VAL G SG+GKST   L+ R+Y+P  G+ILI+  +I  ++ +  LR   +G+VSQ+P LF K+I +NI YG+ S         EAAK A AHEFI+     YDT++G +G + LSGGQ+QRIAIARA+++NP IL+LDEATSALD +SE +VQ+AL +   GRT ++IAHRLSTIQNA+ I V++ GKI E G H  L+   G Y +L +
Sbjct:  808 FFNLAGVWLTTRMRSKTFRCIMNQEMGWFDRKENSIGALSARLSGDAASVQGAIGFPLSNIIQAFTNFICSIAIAFPYSWELALICLSTSPFMVASIVFEARFGEKSALKEKEVLEETSR---IATETITQIRTVAGLRREEELIKIYDKEVERYRHQILSRLKWRGLVNSLGKSLMFF----GYAVT------LTYGGHMCADGKIKFETIMKISNTMLYGLFILAQSLAFTPAFNAALLSAN----RMYEIIDRKPQIQSPESFEIQQNGNGTAYKTNVVQ--QGVSYRGLNFSYPSRPHIKVLQNFNLDINQGQTVALVGASGSGKSTCVQLLMRYYDPDEGKILIDQESIHHDMDLKTLRR-RLGIVSQEPSLFEKSIADNIGYGDTSRQVPMQQIIEAAKMANAHEFIMSLPAQYDTVLGSKGTQ-LSGGQKQRIAIARAMVRNPKILLLDEATSALDFQSERVVQQALDSACSGRTCIVIAHRLSTIQNANVICVIQAGKIVEQGSHSQLLAKNGIYSKLYR 1314          
BLAST of ATP-binding cassette subfamily B member 8 vs. Ensembl Zebrafish
Match: abcb8 (ATP-binding cassette, sub-family B (MDR/TAP), member 8 [Source:NCBI gene;Acc:548340])

HSP 1 Score: 530.406 bits (1365), Expect = 6.126e-180
Identity = 279/564 (49.47%), Postives = 397/564 (70.39%), Query Frame = 1
Query:  328 AAVVNIQIPLKLGNVVNILSNIKEIKDNDFVAAFKIPSLQLLICYAVQALSTTTYISLLSIIGERLAVKMKKKLFEKIIIQDSKFFDNMRSGDLLNRITADVQDFKSSFKQCISQGLRGFITIIGSTISLVIVSKELTTIVIIAIPCLVLIGSIMGKILRALSREAQMQNSKAADVANESIINIRTVKSFAMEDMEIENFFIEVNEAAKLHSVLGIGIGIFQGMSNFAINGIVLGVLFTGGFMMNNGNLTPGDLMSFLVASQTIQKSLSTLSTLFGHLVKANASGARITEFLALNTCATSPXXXXXXXXXXXXXXXFDNVRKPESVEFRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYGNISXXXXXXXXXXXXXXXXXFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALMKIKGHYYELVKK 2019
            AA +NIQIPL LG++VN+++     +   ++   + P+++LL  YA+Q L T+ YI LLS +GER+A  M+  LF  ++ QD  FFD  ++G L+NR+T+D+Q+FKSSFK  ISQGLR     +G  +SL  +S +LT + ++ +PCLV  G+++G  LR LSR+AQ Q +KA  VA+E++ N+RTV++FAMED E+E +  EV ++A ++  LG GI +FQG+SN  +N IVLG +F GG +M   +L+PGDLMSFLVASQT+Q+SL+++S LFG +V+  ++GAR+ E+LAL+                      D++     V+F NISF+YPTR    +L++FSL +P    VA+ GESG GKST+A+L++RFY+P SG ++++G++I+ +  S LR   +G +SQ+P LF  ++ ENIR+G  SAT+ E++ AAKQA AH FI GF DGY+T+VGER G  LSGGQ+QRIAIARA++KNP+ILILDEATSALD++SE +VQ AL     GRTV+IIAHRLSTIQ AD I V+ +G+I E G H  L+   G Y EL+K+
Sbjct:  156 AAALNIQIPLMLGDLVNVVARHMREQAGHYMRDIQAPAVKLLGLYALQGLLTSGYIILLSRVGERVAADMRTTLFTSLLRQDIAFFDANKTGQLVNRLTSDIQEFKSSFKLVISQGLRSATQTVGCFVSLYFISPKLTGLTVVVLPCLVGAGALIGSFLRKLSRKAQEQVAKATGVADEALGNVRTVRAFAMEDRELEMYAAEVQKSAAMNETLGTGIAVFQGLSNIVLNCIVLGTIFAGGSLMARDDLSPGDLMSFLVASQTVQRSLASISILFGQMVRGMSAGARVFEYLALDPSVP---------LTGGGRIPLDSLMG--RVDFMNISFSYPTRPGNQILKHFSLTLPPCKTVAIVGESGGGKSTVAALLERFYDPSSGVVMLDGLDIRTLDPSWLRGHVIGFISQEPVLFGTSVMENIRFGKPSATDAEVVSAAKQANAHNFITGFADGYNTVVGER-GVTLSGGQKQRIAIARALVKNPSILILDEATSALDAESERVVQEALDRATTGRTVLIIAHRLSTIQAADLICVMSNGRIVEAGTHLELLSKGGLYAELIKR 707          
BLAST of ATP-binding cassette subfamily B member 8 vs. Ensembl Zebrafish
Match: abcb10 (ATP-binding cassette, sub-family B (MDR/TAP), member 10 [Source:ZFIN;Acc:ZDB-GENE-040525-2])

HSP 1 Score: 323.553 bits (828), Expect = 1.737e-101
Identity = 213/591 (36.04%), Postives = 337/591 (57.02%), Query Frame = 1
Query:  316 YFVVAAVVNIQIPLKLGNVVNILSNIKEIKDNDFVAAFKIPSLQLLICYAVQALSTTTYISLLSIIGERLAVKMKKKLFEKIIIQDSKFFDNMRSGDLLNRITADVQDFKSSFKQCISQGLRGFITIIGSTISLVIVSKELTTIVIIAIPCLVLIGSIMGKILRALSREAQMQNSKAADVANESIINIRTVKSFAMEDMEIENFFIEVN---EAAKLHSVLGIGIGIFQGMSNFAINGIVLGVLFTGGFMMNNGNLTPGDLMSFLVASQTIQKSLSTLSTLFGHLVKANASGARITEFLALNTCATSPXXXXXXXXXXXXXXXFDNVRKPE----------------SVEFRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYGNISXXXXXX---XXXXXXXXXXXFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALM-KIKGHYYELVKK 2019
            + V+++ V +  P  LG V++    I      DF ++     L L   +     +    + L+ I G+++  K+++ LF  I+ Q+  FFD  R+G+L+NR++AD           +S GLR           ++ VS  L   V++ +P +  +  I G+ LR++SR  Q   ++A  +A E I N+RTV++F  E  E++ +  +V+   E AK  +V+  G   F G++  + N I+L VL+ GG +M +  +T G L SFL+ +  +  S++  S+ +  L+K   +G R+ E +                            RKPE                 +EFRN+SFAYPTR D  + ++ SL++P GS++A+ G SG+GKS++ SL+ R Y+P SG + ++G +I+++    LRS ++G VSQ+P LF+ +I ENI YG    ++  +     AA+ A AH+FI  F  GYDT+VGE+G   LSGGQ+QR+AIARA+LKNP IL+LDEATSALD+++E LVQ AL+ +M GRTV+IIAHRLSTIQ+AD + VL   ++ E+G H  L+   +G + +L++K
Sbjct:   11 FLVISSTVTMSAPFFLGKVID---TIYTSPTEDFSSSLTSLCLMLTGVFLCGGAANAARVYLMQISGQQIVRKLRESLFSSILKQELGFFDKTRTGELINRLSADTAIVGRCLTDNLSDGLRSLAQAGAGVGMMLYVSPSLAAFVLMVVPPIACLAVIFGRFLRSISRRTQDALAEATQLAEERISNLRTVRAFGKELTEVQKYSQKVDHIFELAKKEAVVSAG---FYGVTGLSGNVIILSVLYKGGLLMASEAMTVGQLSSFLMYAFWVGISIAGFSSFYSELMKGLGAGTRLWELID---------------------------RKPEFPLNEGLVLTSELLKGELEFRNVSFAYPTRKDSPIFQDLSLHVPAGSVLAVVGSSGSGKSSLVSLLLRLYDPDSGIVSVDGHDIRDLNPYWLRS-HIGTVSQEPVLFSCSIAENIAYGAPDPSQVTVEDIYRAAQIANAHDFIQEFPKGYDTVVGEKG-VLLSGGQKQRVAIARALLKNPKILLLDEATSALDAENEFLVQEALERLMDGRTVLIIAHRLSTIQSADSVAVLDQHRVMEIGSHSQLLANDQGLFRKLMEK 566          
BLAST of ATP-binding cassette subfamily B member 8 vs. Ensembl Zebrafish
Match: abcb10 (ATP-binding cassette, sub-family B (MDR/TAP), member 10 [Source:ZFIN;Acc:ZDB-GENE-040525-2])

HSP 1 Score: 323.939 bits (829), Expect = 3.671e-100
Identity = 213/591 (36.04%), Postives = 337/591 (57.02%), Query Frame = 1
Query:  316 YFVVAAVVNIQIPLKLGNVVNILSNIKEIKDNDFVAAFKIPSLQLLICYAVQALSTTTYISLLSIIGERLAVKMKKKLFEKIIIQDSKFFDNMRSGDLLNRITADVQDFKSSFKQCISQGLRGFITIIGSTISLVIVSKELTTIVIIAIPCLVLIGSIMGKILRALSREAQMQNSKAADVANESIINIRTVKSFAMEDMEIENFFIEVN---EAAKLHSVLGIGIGIFQGMSNFAINGIVLGVLFTGGFMMNNGNLTPGDLMSFLVASQTIQKSLSTLSTLFGHLVKANASGARITEFLALNTCATSPXXXXXXXXXXXXXXXFDNVRKPE----------------SVEFRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYGNISXXXXXX---XXXXXXXXXXXFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALM-KIKGHYYELVKK 2019
            + V+++ V +  P  LG V++    I      DF ++     L L   +     +    + L+ I G+++  K+++ LF  I+ Q+  FFD  R+G+L+NR++AD           +S GLR           ++ VS  L   V++ +P +  +  I G+ LR++SR  Q   ++A  +A E I N+RTV++F  E  E++ +  +V+   E AK  +V+  G   F G++  + N I+L VL+ GG +M +  +T G L SFL+ +  +  S++  S+ +  L+K   +G R+ E +                            RKPE                 +EFRN+SFAYPTR D  + ++ SL++P GS++A+ G SG+GKS++ SL+ R Y+P SG + ++G +I+++    LRS ++G VSQ+P LF+ +I ENI YG    ++  +     AA+ A AH+FI  F  GYDT+VGE+G   LSGGQ+QR+AIARA+LKNP IL+LDEATSALD+++E LVQ AL+ +M GRTV+IIAHRLSTIQ+AD + VL   ++ E+G H  L+   +G + +L++K
Sbjct:  141 FLVISSTVTMSAPFFLGKVID---TIYTSPTEDFSSSLTSLCLMLTGVFLCGGAANAARVYLMQISGQQIVRKLRESLFSSILKQELGFFDKTRTGELINRLSADTAIVGRCLTDNLSDGLRSLAQAGAGVGMMLYVSPSLAAFVLMVVPPIACLAVIFGRFLRSISRRTQDALAEATQLAEERISNLRTVRAFGKELTEVQKYSQKVDHIFELAKKEAVVSAG---FYGVTGLSGNVIILSVLYKGGLLMASEAMTVGQLSSFLMYAFWVGISIAGFSSFYSELMKGLGAGTRLWELID---------------------------RKPEFPLNEGLVLTSELLKGELEFRNVSFAYPTRKDSPIFQDLSLHVPAGSVLAVVGSSGSGKSSLVSLLLRLYDPDSGIVSVDGHDIRDLNPYWLRS-HIGTVSQEPVLFSCSIAENIAYGAPDPSQVTVEDIYRAAQIANAHDFIQEFPKGYDTVVGEKG-VLLSGGQKQRVAIARALLKNPKILLLDEATSALDAENEFLVQEALERLMDGRTVLIIAHRLSTIQSADSVAVLDQHRVMEIGSHSQLLANDQGLFRKLMEK 696          
BLAST of ATP-binding cassette subfamily B member 8 vs. Ensembl Zebrafish
Match: abcb9 (ATP-binding cassette, sub-family B (MDR/TAP), member 9 [Source:ZFIN;Acc:ZDB-GENE-050517-12])

HSP 1 Score: 313.923 bits (803), Expect = 1.136e-95
Identity = 191/574 (33.28%), Postives = 323/574 (56.27%), Query Frame = 1
Query:  310 FSYFVVAAVVNIQIPLKLGNVVNILSNIKEIKDNDFVAAFKIPSLQLLICYAVQALSTTTYISLLSIIGERLAVKMKKKLFEKIIIQDSKFFDNMRSGDLLNRITADVQDFKSSFKQCISQGLRGFITIIGSTISLVIVSKELTTIVIIAIPCLVLIGSIMGKILRALSREAQMQNSKAADVANESIINIRTVKSFAMEDMEIENFFIEVNEAAKLHSVLGIGIGIFQGMSNFAINGIVLGVLFTGGFMMNNGNLTPGDLMSFLVASQTIQKSLSTLSTLFGHLVKANASGARITEFLALNTCATSPXXXXXXXXXXXXXXXFDNVRKPES----VEFRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYGNISXXXXXXXXXXXXXXXXXFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALMKIKGHYYELVKK 2019
            F + +++AV    IP   G  ++ +  I++  D+     F  P + L +   V +++      + S+   RL ++++  LF  ++ Q+  FFD   +GD+ +R+T+D         Q ++  LR F+  +G  I +  +S +L+ + I+  P + ++  + G+  + L++E Q   ++A  VA E+I  +RTV+SFA ED E + ++  + E   L+    I    F   S  +   + + +LF GG ++    ++ G L+SF++    + ++L ++S+++  L++   +  ++ E++                         +    PE+    VEF N++FAYP+R +  VL+N S  +  G + AL G SG GKS+   L++ FY P  G++L++G  +         S  V +V+Q+P LFA+T++ NI YG   A  E +I AA  A AH+FI G   GYD+ VGE+G + LSGGQ+QR+AIARA++++P ILILDEATSALDS+SE +VQ+AL N+M+  TV++IAHRLST++ AD I+V+  G + E GPH  LM   G Y +LV++
Sbjct:  199 FFFLLLSAVCEAFIPYYTGQAIDGIV-IQKSMDH-----FAKPMITLSVLALVSSIAIGFRGGVFSVTFARLNIRLRNLLFRSLMHQEIGFFDANHTGDITSRLTSDTTQVSDLISQNVNLFLRSFVKAVGIFIFMFGMSWKLSVVTIMGFPYIAVVSKLYGEYYKKLTKEVQTALAQANKVAEETISAMRTVRSFANEDQEGDMYYSRLQEMFVLNKKQAIAYACFMWSSYISELALQVAILFYGGHLVVTNQMSGGTLISFVIYELELGEALESISSVYTGLMQGVGAAEKVFEYI-----------------DRKPKHALNGQEAPETLEGQVEFNNVTFAYPSRPEMDVLKNVSFSLRPGQVTALVGPSGGGKSSCVCLLENFYAPQQGQVLVDGRPVNTYQHKYYHS-KVALVAQEPVLFARTVQMNISYGVPEAPMEAVIRAAINANAHDFITGLSKGYDSGVGEKGTQ-LSGGQKQRVAIARALIRSPRILILDEATSALDSESEYIVQQALNNLMREHTVLVIAHRLSTVERADNILVIDKGSVVEQGPHAELMARGGLYCKLVQR 747          
BLAST of ATP-binding cassette subfamily B member 8 vs. Ensembl Zebrafish
Match: abcb9 (ATP-binding cassette, sub-family B (MDR/TAP), member 9 [Source:ZFIN;Acc:ZDB-GENE-050517-12])

HSP 1 Score: 313.923 bits (803), Expect = 1.136e-95
Identity = 191/574 (33.28%), Postives = 323/574 (56.27%), Query Frame = 1
Query:  310 FSYFVVAAVVNIQIPLKLGNVVNILSNIKEIKDNDFVAAFKIPSLQLLICYAVQALSTTTYISLLSIIGERLAVKMKKKLFEKIIIQDSKFFDNMRSGDLLNRITADVQDFKSSFKQCISQGLRGFITIIGSTISLVIVSKELTTIVIIAIPCLVLIGSIMGKILRALSREAQMQNSKAADVANESIINIRTVKSFAMEDMEIENFFIEVNEAAKLHSVLGIGIGIFQGMSNFAINGIVLGVLFTGGFMMNNGNLTPGDLMSFLVASQTIQKSLSTLSTLFGHLVKANASGARITEFLALNTCATSPXXXXXXXXXXXXXXXFDNVRKPES----VEFRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYGNISXXXXXXXXXXXXXXXXXFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALMKIKGHYYELVKK 2019
            F + +++AV    IP   G  ++ +  I++  D+     F  P + L +   V +++      + S+   RL ++++  LF  ++ Q+  FFD   +GD+ +R+T+D         Q ++  LR F+  +G  I +  +S +L+ + I+  P + ++  + G+  + L++E Q   ++A  VA E+I  +RTV+SFA ED E + ++  + E   L+    I    F   S  +   + + +LF GG ++    ++ G L+SF++    + ++L ++S+++  L++   +  ++ E++                         +    PE+    VEF N++FAYP+R +  VL+N S  +  G + AL G SG GKS+   L++ FY P  G++L++G  +         S  V +V+Q+P LFA+T++ NI YG   A  E +I AA  A AH+FI G   GYD+ VGE+G + LSGGQ+QR+AIARA++++P ILILDEATSALDS+SE +VQ+AL N+M+  TV++IAHRLST++ AD I+V+  G + E GPH  LM   G Y +LV++
Sbjct:  199 FFFLLLSAVCEAFIPYYTGQAIDGIV-IQKSMDH-----FAKPMITLSVLALVSSIAIGFRGGVFSVTFARLNIRLRNLLFRSLMHQEIGFFDANHTGDITSRLTSDTTQVSDLISQNVNLFLRSFVKAVGIFIFMFGMSWKLSVVTIMGFPYIAVVSKLYGEYYKKLTKEVQTALAQANKVAEETISAMRTVRSFANEDQEGDMYYSRLQEMFVLNKKQAIAYACFMWSSYISELALQVAILFYGGHLVVTNQMSGGTLISFVIYELELGEALESISSVYTGLMQGVGAAEKVFEYI-----------------DRKPKHALNGQEAPETLEGQVEFNNVTFAYPSRPEMDVLKNVSFSLRPGQVTALVGPSGGGKSSCVCLLENFYAPQQGQVLVDGRPVNTYQHKYYHS-KVALVAQEPVLFARTVQMNISYGVPEAPMEAVIRAAINANAHDFITGLSKGYDSGVGEKGTQ-LSGGQKQRVAIARALIRSPRILILDEATSALDSESEYIVQQALNNLMREHTVLVIAHRLSTVERADNILVIDKGSVVEQGPHAELMARGGLYCKLVQR 747          
BLAST of ATP-binding cassette subfamily B member 8 vs. Ensembl Xenopus
Match: gpc4 (glypican 4 [Source:Xenbase;Acc:XB-GENE-976427])

HSP 1 Score: 290.426 bits (742), Expect = 7.077e-87
Identity = 171/522 (32.76%), Postives = 305/522 (58.43%), Query Frame = 1
Query:  472 ALSTTTYISLLSIIGERLAVKMKKKLFEKIIIQDSKFFDNMRSGDLLNRITADVQDFKSSFKQCISQGLRGFITIIGSTISLVIVSKELTTIVIIAIPCLVLIGSIMGKILRALSREAQMQNSKAADVANESIINIRTVKSFAMEDMEIENFFIEVNEAAKLHSVLGIGIGIFQGMSNFAINGIVLGVLFTGGFMMNNGNLTPGDLMSFLVASQTIQKSLSTLSTLFGHLVKANASGARITEFLALNTCATSPXXXXXXXXXXXXXXXFDNVRKPES----VEFRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVN--VGVVSQQPQLFAKTIRENIRYGNISXXXXXXXXXXXXXXXXXFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALMKIKGHYYELVKK 2019
            A S+     L +    RL ++++  LF  ++ Q+  FFD   +GD+++R+T+D         + ++  LR  +  +G    +  +S +L+ +  +  P ++++  + GK  + L++E Q   ++A  +A E+I +++TV+SFA ED E   +   + +   LH    I    +   + F    + + +L+ GG ++ +  +T G+L+SF++    +   + ++ +++G L++   +  ++ EF+        P++++            +    PE     VEFRN++F+YPTR    VL+N S  +  G I AL G SG+GKS+  ++++ FY    GE+L++G   Q I + D + ++  + +VSQ+P LFA++I  NI YG  S   E ++ AAK+A AH FI+  Q+GY+T  GE+G + LSGGQ+QR+A+AR++++NP +LILDEATSALD++SE  +Q+A+ + ++ RTV+I+AHRLSTI+ A  I+VL  G++ + G H  LM+  G Y  LV++
Sbjct:  244 AFSSGVRGGLFTFTFARLNIRIRNLLFRSLLSQEIGFFDENHTGDIISRLTSDTTIVSDVVSENVNIFLRSLVKAVGVIAFMFSLSWQLSLLTFMGFPLIIMVSRVYGKYYKKLAKEVQTALAQANSIAEETISSMKTVRSFANEDTEACVYKERLQQVYALHKKEAIAYTYYVWSTGFTQLVLQISILYYGGHLVISEQMTSGNLISFVIYEFLLGGCMESVGSVYGGLMQGVGAAEKVFEFI-----DRKPKMEN------------NGTLAPEHLEGKVEFRNVTFSYPTRPTSLVLQNLSFNLYPGKITALVGPSGSGKSSCVNILENFYSVQDGEVLLDG---QPIKMYDHKYLHAKISMVSQEPVLFARSIENNISYGLNSVPLESVVSAAKRANAHSFIMELQEGYNTEAGEKGAQ-LSGGQKQRVAVARSLIRNPQVLILDEATSALDAESEHAIQQAMNSDLQNRTVLIVAHRLSTIEKAHNIIVLDKGQMVQQGSHSELMEQGGLYSHLVQR 744          
BLAST of ATP-binding cassette subfamily B member 8 vs. Ensembl Xenopus
Match: gpc4 (glypican 4 [Source:Xenbase;Acc:XB-GENE-976427])

HSP 1 Score: 290.426 bits (742), Expect = 1.009e-86
Identity = 168/506 (33.20%), Postives = 300/506 (59.29%), Query Frame = 1
Query:  520 RLAVKMKKKLFEKIIIQDSKFFDNMRSGDLLNRITADVQDFKSSFKQCISQGLRGFITIIGSTISLVIVSKELTTIVIIAIPCLVLIGSIMGKILRALSREAQMQNSKAADVANESIINIRTVKSFAMEDMEIENFFIEVNEAAKLHSVLGIGIGIFQGMSNFAINGIVLGVLFTGGFMMNNGNLTPGDLMSFLVASQTIQKSLSTLSTLFGHLVKANASGARITEFLALNTCATSPXXXXXXXXXXXXXXXFDNVRKPES----VEFRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVN--VGVVSQQPQLFAKTIRENIRYGNISXXXXXXXXXXXXXXXXXFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALMKIKGHYYELVKK 2019
            RL ++++  LF  ++ Q+  FFD   +GD+++R+T+D         + ++  LR  +  +G    +  +S +L+ +  +  P ++++  + GK  + L++E Q   ++A  +A E+I +++TV+SFA ED E   +   + +   LH    I    +   + F    + + +L+ GG ++ +  +T G+L+SF++    +   + ++ +++G L++   +  ++ EF+        P++++            +    PE     VEFRN++F+YPTR    VL+N S  +  G I AL G SG+GKS+  ++++ FY    GE+L++G   Q I + D + ++  + +VSQ+P LFA++I  NI YG  S   E ++ AAK+A AH FI+  Q+GY+T  GE+G + LSGGQ+QR+A+AR++++NP +LILDEATSALD++SE  +Q+A+ + ++ RTV+I+AHRLSTI+ A  I+VL  G++ + G H  LM+  G Y  LV++
Sbjct:  260 RLNIRIRNLLFRSLLSQEIGFFDENHTGDIISRLTSDTTIVSDVVSENVNIFLRSLVKAVGVIAFMFSLSWQLSLLTFMGFPLIIMVSRVYGKYYKKLAKEVQTALAQANSIAEETISSMKTVRSFANEDTEACVYKERLQQVYALHKKEAIAYTYYVWSTGFTQLVLQISILYYGGHLVISEQMTSGNLISFVIYEFLLGGCMESVGSVYGGLMQGVGAAEKVFEFI-----DRKPKMEN------------NGTLAPEHLEGKVEFRNVTFSYPTRPTSLVLQNLSFNLYPGKITALVGPSGSGKSSCVNILENFYSVQDGEVLLDG---QPIKMYDHKYLHAKISMVSQEPVLFARSIENNISYGLNSVPLESVVSAAKRANAHSFIMELQEGYNTEAGEKGAQ-LSGGQKQRVAVARSLIRNPQVLILDEATSALDAESEHAIQQAMNSDLQNRTVLIVAHRLSTIEKAHNIIVLDKGQMVQQGSHSELMEQGGLYSHLVQR 744          
BLAST of ATP-binding cassette subfamily B member 8 vs. Ensembl Xenopus
Match: gpc4 (glypican 4 [Source:Xenbase;Acc:XB-GENE-976427])

HSP 1 Score: 284.648 bits (727), Expect = 8.117e-85
Identity = 170/524 (32.44%), Postives = 305/524 (58.21%), Query Frame = 1
Query:  472 ALSTTTYISLLSIIGERLAVKMKKKLFEKIIIQDSKFFDNMRSGDLLNRITADVQDFKSSFKQCISQGLRGFITIIGSTISLVIVSKELTTIVIIAIPCLVLIGSIMGKILRALSREAQMQNSKAADVANESIINIRTVKSFAMEDMEIENFFIEVNEAAKLHSVLGIGIGIFQGMSNFAINGIVLGVLFTGGFMMNNGNLTPGDLMSFLVASQTIQKSLSTLSTLFGHLVKANASGARITEFLALNTCATSPXXXXXXXXXXXXXXXFDNVRKPE----SVEFRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVN--VGVVSQQPQLFAKTIRENIRYGNISXXXXXXXXXXXXXXXXXFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSE--VLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALMKIKGHYYELVKK 2019
            A S+     L +    RL ++++  LF  ++ Q+  FFD   +GD+++R+T+D         + ++  LR  +  +G    +  +S +L+ +  +  P ++++  + GK  + L++E Q   ++A  +A E+I +++TV+SFA ED E   +   + +   LH    I    +   + F    + + +L+ GG ++ +  +T G+L+SF++    +   + ++ +++G L++   +  ++ EF+        P++++            +    PE     VEFRN++F+YPTR    VL+N S  +  G I AL G SG+GKS+  ++++ FY    GE+L++G   Q I + D + ++  + +VSQ+P LFA++I  NI YG  S   E ++ AAK+A AH FI+  Q+GY+T  GE+G + LSGGQ+QR+A+AR++++NP +LILDEATSALD++S+    +Q+A+ + ++ RTV+I+AHRLSTI+ A  I+VL  G++ + G H  LM+  G Y  LV++
Sbjct:  244 AFSSGVRGGLFTFTFARLNIRIRNLLFRSLLSQEIGFFDENHTGDIISRLTSDTTIVSDVVSENVNIFLRSLVKAVGVIAFMFSLSWQLSLLTFMGFPLIIMVSRVYGKYYKKLAKEVQTALAQANSIAEETISSMKTVRSFANEDTEACVYKERLQQVYALHKKEAIAYTYYVWSTGFTQLVLQISILYYGGHLVISEQMTSGNLISFVIYEFLLGGCMESVGSVYGGLMQGVGAAEKVFEFI-----DRKPKMEN------------NGTLAPEHLEGKVEFRNVTFSYPTRPTSLVLQNLSFNLYPGKITALVGPSGSGKSSCVNILENFYSVQDGEVLLDG---QPIKMYDHKYLHAKISMVSQEPVLFARSIENNISYGLNSVPLESVVSAAKRANAHSFIMELQEGYNTEAGEKGAQ-LSGGQKQRVAVARSLIRNPQVLILDEATSALDAESDHSFQIQQAMNSDLQNRTVLIVAHRLSTIEKAHNIIVLDKGQMVQQGSHSELMEQGGLYSHLVQR 746          
BLAST of ATP-binding cassette subfamily B member 8 vs. Ensembl Xenopus
Match: gpc4 (glypican 4 [Source:Xenbase;Acc:XB-GENE-976427])

HSP 1 Score: 272.322 bits (695), Expect = 6.304e-82
Identity = 160/479 (33.40%), Postives = 284/479 (59.29%), Query Frame = 1
Query:  601 GDLLNRITADVQDFKSSFKQCISQGLRGFITIIGSTISLVIVSKELTTIVIIAIPCLVLIGSIMGKILRALSREAQMQNSKAADVANESIINIRTVKSFAMEDMEIENFFIEVNEAAKLHSVLGIGIGIFQGMSNFAINGIVLGVLFTGGFMMNNGNLTPGDLMSFLVASQTIQKSLSTLSTLFGHLVKANASGARITEFLALNTCATSPXXXXXXXXXXXXXXXFDNVRKPES----VEFRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVN--VGVVSQQPQLFAKTIRENIRYGNISXXXXXXXXXXXXXXXXXFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALMKIKGHYYELVKK 2019
            GD+++R+T+D         + ++  LR  +  +G    +  +S +L+ +  +  P ++++  + GK  + L++E Q   ++A  +A E+I +++TV+SFA ED E   +   + +   LH    I    +   + F    + + +L+ GG ++ +  +T G+L+SF++    +   + ++ +++G L++   +  ++ EF+        P++++            +    PE     VEFRN++F+YPTR    VL+N S  +  G I AL G SG+GKS+  ++++ FY    GE+L++G   Q I + D + ++  + +VSQ+P LFA++I  NI YG  S   E ++ AAK+A AH FI+  Q+GY+T  GE+G + LSGGQ+QR+A+AR++++NP +LILDEATSALD++SE  +Q+A+ + ++ RTV+I+AHRLSTI+ A  I+VL  G++ + G H  LM+  G Y  LV++
Sbjct:   84 GDIISRLTSDTTIVSDVVSENVNIFLRSLVKAVGVIAFMFSLSWQLSLLTFMGFPLIIMVSRVYGKYYKKLAKEVQTALAQANSIAEETISSMKTVRSFANEDTEACVYKERLQQVYALHKKEAIAYTYYVWSTGFTQLVLQISILYYGGHLVISEQMTSGNLISFVIYEFLLGGCMESVGSVYGGLMQGVGAAEKVFEFI-----DRKPKMEN------------NGTLAPEHLEGKVEFRNVTFSYPTRPTSLVLQNLSFNLYPGKITALVGPSGSGKSSCVNILENFYSVQDGEVLLDG---QPIKMYDHKYLHAKISMVSQEPVLFARSIENNISYGLNSVPLESVVSAAKRANAHSFIMELQEGYNTEAGEKGAQ-LSGGQKQRVAVARSLIRNPQVLILDEATSALDAESEHAIQQAMNSDLQNRTVLIVAHRLSTIEKAHNIIVLDKGQMVQQGSHSELMEQGGLYSHLVQR 541          
BLAST of ATP-binding cassette subfamily B member 8 vs. Ensembl Xenopus
Match: ENSXETT00000050925.1 (transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) [Source:NCBI gene;Acc:100488534])

HSP 1 Score: 259.996 bits (663), Expect = 1.879e-78
Identity = 163/476 (34.24%), Postives = 274/476 (57.56%), Query Frame = 1
Query:  598 SGDLLNRITADVQDFKSSFKQCISQGLRGFITIIGSTISLVIVSKELTTIVIIAIPCLVLIGSIMGKILRALSREAQMQNSKAADVANESIINIRTVKSFAMEDMEIENFFIEVNEAAKLHSVLGIGIGIFQGMSNFAINGIVL--GVLFTGGFMMNNGNLTPGDLMSFLVASQTIQKSLSTLSTLFGHLVKANASGARITEFLALNTCATSPXXXXXXXXXXXXXXXFDNVRKPESVEFRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYGNISXXXXXXXXXXXXXXXXXFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALMKIKGHYYELVKK 2019
            SGD+ +R+T D      S    +S  +   + ++  +  ++++S +LT   I+ +  + ++  + G     ++   Q   SKA  VA E+  N++TV+SFA E+ E + +   +++  +L+ V  +  G     ++F+  G+VL   +L+ GG ++ NG ++ G+L+SF++       ++  L  ++  + KA  S  ++ E++     + SP               F        ++F+N++F+YPTR D   L++ S  +  G + AL G   AGKST+  L+ R Y+P  GEIL++   I        R+  V VVSQ+P L A+++++NI YG    + E + EAA+ A AH+FI    +GY T  G++GG  LSGGQ+QR+A+ARA+L+NP ILILD+ATS+LD +SE  VQ A+ +  + RTV++I+HR+ST+Q AD+I+VL+ G+I E G HE L+K +G Y  L +K
Sbjct:   14 SGDITSRVTTDTITMSESLSHELSLLMWYLMRVVFLSSYMIMLSPKLTFFTILCLCVITIVPKLTGTFSEGMAVRVQESLSKANQVALETFSNMKTVRSFANEEGECQRYEQRLHDTYQLNKVEAVAYGCSMVATSFS--GLVLKVAILYFGGRLVTNGEVSGGELVSFVLYELQFSSAVEVLLRMYPEVRKAVGSSEKVFEYMDRKPQSPSPGS-------------FSPQDLKGIIQFQNVTFSYPTRPDSLALQDVSFKLHPGEVTALVGPCDAGKSTVVQLLLRLYQPQKGEILLDEKCINLYKNEYYRN-KVSVVSQEPTLSARSLQDNIAYGMGEVSLEYVKEAAQTAHAHDFISEMANGYQTGAGQKGG-LLSGGQKQRVALARALLRNPKILILDDATSSLDLESEQKVQCAVYDGPRDRTVLLISHRISTVQRADRILVLEGGRITEEGTHEQLLKQEGSYTRLWQK 472          
BLAST of ATP-binding cassette subfamily B member 8 vs. Ensembl Mouse
Match: Abcb8 (ATP-binding cassette, sub-family B (MDR/TAP), member 8 [Source:MGI Symbol;Acc:MGI:1351667])

HSP 1 Score: 498.434 bits (1282), Expect = 2.571e-167
Identity = 270/568 (47.54%), Postives = 389/568 (68.49%), Query Frame = 1
Query:  328 AAVVNIQIPLKLGNVVNILSNIKEIKDNDFVAAFKIPSLQLLICYAVQALSTTTYISLLSIIGERLAVKMKKKLFEKIIIQDSKFFDNMRSGDLLNRITADVQDFKSSFKQCISQGLRGFITIIGSTISLVIVSKELTTIVIIAIPCLVLIGSIMGKILRALSREAQMQNSKAADVANESIINIRTVKSFAMEDMEIENFFIEVNEAAKLHSVLGIGIGIFQGMSNFAINGIVLGVLFTGGFMMNNGNLTPGDLMSFLVASQTIQKSLSTLSTLFGHLVKANASGARITEFLALNTCATSPXXXXXXXXXXXXXXXFDNVRKPESVEFRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYGNISXXXXXXXXXXXXXXXXXFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALMKIKGHYYELVKKLEKD 2031
            AA+VN+QIPL LG +V I++         FV+  +  S+QLL+ Y VQ L T  Y+ LLS IGER+A+ M+K LF  ++ QD  FFD  ++G L++R+T DVQ+FKSSFK  ISQGLR    +IGS +SL ++S  LT ++ +  P L+ +G++MG  LR LSR+ Q Q ++A  VA+E++ N+RTV++FAME  E E +  E+         LG GI +FQG+SN A N +VLG LF GG ++    L  GDLMSFLVASQT+Q+S+++LS LFG +V+  ++GAR+ E++AL     SP +       +       ++R   S+ F+N++F+YP R    VL++F+L +P G IVAL G+SG GK+T+ASL++RFY+P +G + ++G +++ +  S LR   +G +SQ+P LFA TI ENIR+G + A++EE+  AA++A AHEFI  F DGY T+VGER G  LSGGQ+QR+AIARA++K P +LILDEATSALD++SE +VQ AL     GRTV++IAHRLST++ A  I+V+ +G++ E G HE L+K  G Y EL+++   D
Sbjct:  140 AALVNVQIPLLLGQLVEIVAKYTRDHMGSFVSESRKLSVQLLLLYGVQGLLTFGYLVLLSHIGERMAMDMRKALFSSLLRQDIAFFDAKKTGQLVSRLTTDVQEFKSSFKLVISQGLRSCTQVIGSLVSLSMLSPRLTLMLAVVTPALMGVGTLMGSGLRKLSRQCQEQIARATGVADEALGNVRTVRAFAMEKREEERYQAELESCCCKAEELGRGIALFQGLSNIAFNCMVLGTLFIGGSLVAGQQLKGGDLMSFLVASQTVQRSMASLSVLFGQVVRGLSAGARVFEYMAL-----SPVIPLTGGYCIPN----KDIRG--SITFQNVTFSYPCRPGFNVLKDFTLKLPSGKIVALVGQSGGGKTTVASLLERFYDPEAGSVTLDGHDLRTLNPSWLRGQVIGFISQEPVLFATTIMENIRFGKLDASDEEVYTAAREANAHEFISSFPDGYSTVVGER-GTTLSGGQKQRLAIARALIKQPTVLILDEATSALDAESERVVQEALDRASAGRTVLVIAHRLSTVRAAHSIIVMANGQVCEAGTHEELLKKGGLYSELIRRQTLD 695          
BLAST of ATP-binding cassette subfamily B member 8 vs. Ensembl Mouse
Match: Abcb8 (ATP-binding cassette, sub-family B (MDR/TAP), member 8 [Source:MGI Symbol;Acc:MGI:1351667])

HSP 1 Score: 498.434 bits (1282), Expect = 2.571e-167
Identity = 270/568 (47.54%), Postives = 389/568 (68.49%), Query Frame = 1
Query:  328 AAVVNIQIPLKLGNVVNILSNIKEIKDNDFVAAFKIPSLQLLICYAVQALSTTTYISLLSIIGERLAVKMKKKLFEKIIIQDSKFFDNMRSGDLLNRITADVQDFKSSFKQCISQGLRGFITIIGSTISLVIVSKELTTIVIIAIPCLVLIGSIMGKILRALSREAQMQNSKAADVANESIINIRTVKSFAMEDMEIENFFIEVNEAAKLHSVLGIGIGIFQGMSNFAINGIVLGVLFTGGFMMNNGNLTPGDLMSFLVASQTIQKSLSTLSTLFGHLVKANASGARITEFLALNTCATSPXXXXXXXXXXXXXXXFDNVRKPESVEFRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYGNISXXXXXXXXXXXXXXXXXFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALMKIKGHYYELVKKLEKD 2031
            AA+VN+QIPL LG +V I++         FV+  +  S+QLL+ Y VQ L T  Y+ LLS IGER+A+ M+K LF  ++ QD  FFD  ++G L++R+T DVQ+FKSSFK  ISQGLR    +IGS +SL ++S  LT ++ +  P L+ +G++MG  LR LSR+ Q Q ++A  VA+E++ N+RTV++FAME  E E +  E+         LG GI +FQG+SN A N +VLG LF GG ++    L  GDLMSFLVASQT+Q+S+++LS LFG +V+  ++GAR+ E++AL     SP +       +       ++R   S+ F+N++F+YP R    VL++F+L +P G IVAL G+SG GK+T+ASL++RFY+P +G + ++G +++ +  S LR   +G +SQ+P LFA TI ENIR+G + A++EE+  AA++A AHEFI  F DGY T+VGER G  LSGGQ+QR+AIARA++K P +LILDEATSALD++SE +VQ AL     GRTV++IAHRLST++ A  I+V+ +G++ E G HE L+K  G Y EL+++   D
Sbjct:  140 AALVNVQIPLLLGQLVEIVAKYTRDHMGSFVSESRKLSVQLLLLYGVQGLLTFGYLVLLSHIGERMAMDMRKALFSSLLRQDIAFFDAKKTGQLVSRLTTDVQEFKSSFKLVISQGLRSCTQVIGSLVSLSMLSPRLTLMLAVVTPALMGVGTLMGSGLRKLSRQCQEQIARATGVADEALGNVRTVRAFAMEKREEERYQAELESCCCKAEELGRGIALFQGLSNIAFNCMVLGTLFIGGSLVAGQQLKGGDLMSFLVASQTVQRSMASLSVLFGQVVRGLSAGARVFEYMAL-----SPVIPLTGGYCIPN----KDIRG--SITFQNVTFSYPCRPGFNVLKDFTLKLPSGKIVALVGQSGGGKTTVASLLERFYDPEAGSVTLDGHDLRTLNPSWLRGQVIGFISQEPVLFATTIMENIRFGKLDASDEEVYTAAREANAHEFISSFPDGYSTVVGER-GTTLSGGQKQRLAIARALIKQPTVLILDEATSALDAESERVVQEALDRASAGRTVLVIAHRLSTVRAAHSIIVMANGQVCEAGTHEELLKKGGLYSELIRRQTLD 695          
BLAST of ATP-binding cassette subfamily B member 8 vs. Ensembl Mouse
Match: Abcb10 (ATP-binding cassette, sub-family B (MDR/TAP), member 10 [Source:MGI Symbol;Acc:MGI:1860508])

HSP 1 Score: 350.132 bits (897), Expect = 3.771e-110
Identity = 217/575 (37.74%), Postives = 337/575 (58.61%), Query Frame = 1
Query:  316 YFVVAAVVNIQIPLKLGNVVNIL-SNIKEIKDNDFVAAFKIPSLQLLIC-YAVQALSTTTYISLLSIIGERLAVKMKKKLFEKIIIQDSKFFDNMRSGDLLNRITADVQDFKSSFKQCISQGLR-GFITIIGSTISLVIVSKELTTIVIIAIPCLVLIGSIMGKILRALSREAQMQNSKAADVANESIINIRTVKSFAMEDMEIENFFIEVNEAAKLHSVLGIGIGIFQGMSNFAINGIVLGVLFTGGFMMNNGNLTPGDLMSFLVASQTIQKSLSTLSTLFGHLVKANASGARITEFLALNTCATSPXXXXXXXXXXXXXXXFDNVRKPESVEFRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYG--NISXXXXXXXXXXXXXX-XXXFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEA-LMKIKGHYYELVKK 2019
            +  V++V+ +  P  LG +++++ +N  E   +       +     L C +   A +    + L+   G+ +  +++  LF  I+ Q+  FFD  R+G+L+NR+++D      S  + +S GLR G    +G  + +  VS  L T V+  +P + ++  I G+ LR LS+  Q   ++A  +A E I NIRT+++F  E  E+E +   V++  +L     +    F G +  + N IVL VL+ GG +M + ++T G+L SFL+ +  +  S+  LS+ +  L+K   +G R+ E L               +    +    D      ++EFRN+ F YP R + +V ++FSL IP GS+ AL G SG+GKST+ SL+ R Y+P SG + ++G +I+++    LRS  +G VSQ+P LF+ ++ ENI YG  N+S+   + +E A +   A EFI  F  G+DT+VGE+G   LSGGQ+QRIAIARA+LKNP IL+LDEATSALD+++E LVQ AL  +M+GRTV+IIAHRLSTI+NA+ + VL HGKI E G HE  L+K  G Y +L+ K
Sbjct:  142 FLAVSSVITMSAPFFLGRIIDVIYTNPSEGYGDSLTRLCAV-----LTCVFLCGAAANGIRVYLMQSSGQSIVNRLRTSLFSSILRQEVAFFDKTRTGELINRLSSDTALLGRSVTENLSDGLRAGAQASVGVGM-MFFVSPSLATFVLSVVPPISVLAVIYGRYLRKLSKATQDSLAEATQLAEERIGNIRTIRAFGKEMTEVEKYTGRVDQLLQLAQKEALARAGFFGAAGLSGNLIVLSVLYKGGLLMGSAHMTVGELSSFLMYAFWVGLSIGGLSSFYSELMKGLGAGGRLWELLERQP-----------RLPFNEGMVLDEKTFQGALEFRNVHFTYPARPEVSVFQDFSLSIPSGSVTALVGPSGSGKSTVVSLLLRLYDPNSGTVSLDGHDIRQLNPVWLRS-KIGTVSQEPVLFSCSVAENIAYGADNLSSVTAQQVERAAEVANAAEFIRSFPQGFDTVVGEKG-ILLSGGQKQRIAIARALLKNPKILLLDEATSALDAENEHLVQEALDRLMEGRTVLIIAHRLSTIKNANFVAVLDHGKICEHGTHEELLLKPNGLYRKLMNK 697          
BLAST of ATP-binding cassette subfamily B member 8 vs. Ensembl Mouse
Match: Abcb9 (ATP-binding cassette, sub-family B (MDR/TAP), member 9 [Source:MGI Symbol;Acc:MGI:1861729])

HSP 1 Score: 287.345 bits (734), Expect = 5.594e-86
Identity = 167/511 (32.68%), Postives = 297/511 (58.12%), Query Frame = 1
Query:  499 LLSIIGERLAVKMKKKLFEKIIIQDSKFFDNMRSGDLLNRITADVQDFKSSFKQCISQGLRGFITIIGSTISLVIVSKELTTIVIIAIPCLVLIGSIMGKILRALSREAQMQNSKAADVANESIINIRTVKSFAMEDMEIENFFIEVNEAAKLHSVLGIGIGIFQGMSNFAINGIVLGVLFTGGFMMNNGNLTPGDLMSFLVASQTIQKSLSTLSTLFGHLVKANASGARITEFLALNTCATSPXXXXXXXXXXXXXXXFDNVRKPESVE----FRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYGNISXXXXXXXXXXXXXXXXXFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALMKIKGHYYELVKK 2019
            + +++  RL ++++  LF  ++ Q++ FFD  R+GDL++R+T+D         Q I+  LR  + + G  + +  +S +L+ +  +  P ++++ +I GK  + LS+E Q   ++A+  A E+I  ++TV+SFA E+ E E F  ++ +  KL+         +   S   +  + + +L+ GG ++ +G ++ G+L++F++    +   + ++ +++  L++   +  ++ EF+                         D    P+ +E    F N++F Y TR    VL+N S  +  G + AL G SG+GKS+  ++++ FY    G +L++G  I       L  V + +VSQ+P LFA++I +NI YG  +   E ++EAA++A AH FI+  QDGY T  GE+G + LSGGQ+QR+A+ARA+++NP +LILDEATSALD++SE L+Q+A+   ++  TV+IIAHRLST++ A  IVVL  G++ + G H+ L+   G Y +LV++
Sbjct:  245 IFTLVFARLNIRLRNCLFRSLVSQETSFFDENRTGDLISRLTSDTTMVSDLVSQNINIFLRNTVKVTGVVVFMFSLSWQLSLVTFMGFPIIMMVSNIYGKYYKRLSKEVQSALARASTTAEETISAMKTVRSFANEEEEAEVFLRKLQQVYKLNRKEAAAYMSYVWGSGLTLLVVQVSILYYGGHLVISGQMSSGNLIAFIIYEFVLGDCMESVGSVYSGLMQGVGAAEKVFEFIDRQPTMVH-----------------DGSLAPDHLEGRVDFENVTFTYRTRPHTQVLQNVSFSLSPGKVTALVGPSGSGKSSCVNILENFYPLQGGRVLLDGKPIGAYDHKYLHRV-ISLVSQEPVLFARSITDNISYGLPTVPFEMVVEAAQKANAHGFIMELQDGYSTETGEKGAQ-LSGGQKQRVAMARALVRNPPVLILDEATSALDAESEYLIQQAIHGNLQRHTVLIIAHRLSTVERAHLIVVLDKGRVVQQGTHQQLLAQGGLYAKLVQR 736          
BLAST of ATP-binding cassette subfamily B member 8 vs. Ensembl Mouse
Match: Abcb1a (ATP-binding cassette, sub-family B (MDR/TAP), member 1A [Source:MGI Symbol;Acc:MGI:97570])

HSP 1 Score: 270.781 bits (691), Expect = 3.127e-77
Identity = 187/511 (36.59%), Postives = 278/511 (54.40%), Query Frame = 1
Query:  493 ISLLSIIGERLAVKMKKKLFEKIIIQDSKFFDNMRSGDLLNRITADVQDFKSSFKQCISQGLRGFITIIGSTISLVIVSKELTTIVIIAIPCLVLIGSIMGKILRALSREAQMQNSKAADVANESIINIRTVKSFAMEDMEIENFFIEVNEAAKLHSVLGIGIGIFQGMSNFAINGIVLGVLFTGGFMMNNGNLTPGDLM----SFLVASQTIQKSLSTLSTLFGHLVKANASGARITEFLALNTCATSPXXXXXXXXXXXXXXXFDNVRKPESVEFRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYGNISXXXXXXXXXXXXXXXXXFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALMKIKGHYYELV 2013
            +S   +   R   K+++K F  I+ Q+  +FD    G+L  R+T DV          I    +   T  G  I       +LT +++   P L L   I  KIL + + +     +KA  VA E +  IRTV +F  +  E+E +   + EA +L     I   I  G +   I        + G  ++ +   + G ++    S L+ + ++ ++   +         ANA GA    F  ++     P +    K         DN++   ++EF+NI F+YP+R +  +L+  +L +  G  VAL G SG GKST   L+QR Y+P+ G + I+G +I+ I V  LR + +GVVSQ+P LFA TI ENIRYG    T +EI +A K+A A++FI+     +DTLVGERG + LSGGQ+QRIAIARA+++NP IL+LDEATSALD++SE +VQ AL    +GRT ++IAHRLST++NAD I     G I E G H+ LM+ KG Y++LV
Sbjct:  129 VSFWCLAAGRQIHKIRQKFFHAIMNQEIGWFDVHDVGELNTRLTDDVSKINEGIGDKIGMFFQAMATFFGGFIIGFTRGWKLTLVILAISPVLGLSAGIWAKILSSFTDKELHAYAKAGAVAEEVLAAIRTVIAFGGQKKELERYNNNLEEAKRLGIKKAITANISMGAAFLLIYASYALAFWYGTSLVISKEYSIGQVLTVFFSVLIGAFSVGQASPNIEAF------ANARGAAYEVFKIIDN---KPSIDSFSKSGHKP----DNIQG--NLEFKNIHFSYPSRKEVQILKGLNLKVKSGQTVALVGNSGCGKSTTVQLMQRLYDPLDGMVSIDGQDIRTINVRYLREI-IGVVSQEPVLFATTIAENIRYGREDVTMDEIEKAVKEANAYDFIMKLPHQFDTLVGERGAQ-LSGGQKQRIAIARALVRNPKILLLDEATSALDTESEAVVQAALDKAREGRTTIVIAHRLSTVRNADVIAGFDGGVIVEQGNHDELMREKGIYFKLV 622          

HSP 2 Score: 242.662 bits (618), Expect = 1.666e-67
Identity = 169/510 (33.14%), Postives = 272/510 (53.33%), Query Frame = 1
Query:  514 GERLAVKMKKKLFEKIIIQDSKFFDNMR--SGDLLNRITADVQDFKSSFKQCISQGLRGFITIIGSTISLVIVSKELTTIVIIAIPCLVLIGSIMGKIL--RALSREAQMQNSKAADVANESIINIRTVKSFA----MEDMEIENFFIEVNEAAKLHSVLGIGIGIFQGMSNFAINGIVLGVLFTGGFMMNNGNLTPGDLMSFLVASQTIQKSLSTLSTLFGHLVKANASGARITEFLALNTCATSPXXXXXXXXXXXXXXXFDNVRKPESVEFRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYGNISXXXXXXXXXXXXXXX--XXFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALMKIKGHYYELV 2013
            GE L  +++  +F+ ++ QD  +FD+ +  +G L  R+  D    K +    ++   +    +    I  +I   +LT +++  +P + + G +  K+L  +AL  + +++ S    +A E+I N RTV S       E M  ++  I    A K   V GI     Q M  F+           G +++    +T  +++    A      ++  +S+      KA  S + I   +       +P +     + L       NV      +F  + F YPTR    VL+  SL + +G  +AL G SG GKST+  L++RFY+P++G + ++G  I+++ V  LR+  +G+VSQ+P LF  +I ENI YG+ S             +A  H+FI    D Y+T VG++G + LSGGQ+QRIAIARA+++ P+IL+LDEATSALD++SE +VQ AL    +GRT ++IAHRLSTIQNAD IVV+++GK+ E G H+ L+  KG Y+ +V
Sbjct:  777 GEILTKRLRYMVFKSMLRQDVSWFDDPKNTTGALTTRLANDAAQVKGATGSRLAVIFQNIANLGTGIIISLIYGWQLTLLLLAIVPIIAIAGVVEMKMLSGQALKDKKELEGS--GKIATEAIENFRTVVSLTREQKFETMYAQSLQIPYRNAMKKAHVFGITFSFTQAMMYFS----YAACFRFGAYLVTQQLMTFENVLLVFSAIVFGAMAVGQVSSFAPDYAKATVSASHIIRIIE-----KTPEIDSYSTQGLKPNMLEGNV------QFSGVVFNYPTRPSIPVLQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPMAGSVFLDGKEIKQLNVQWLRA-QLGIVSQEPILFDCSIAENIAYGDNSRVVSYEEIVRAAKEANIHQFIDSLPDKYNTRVGDKGTQ-LSGGQKQRIAIARALVRQPHILLLDEATSALDTESEKVVQEALDKAREGRTCIVIAHRLSTIQNADLIVVIQNGKVKEHGTHQQLLAQKGIYFSMV 1267          
BLAST of ATP-binding cassette subfamily B member 8 vs. UniProt/SwissProt
Match: sp|Q56A55|MITOS_DANRE (Mitochondrial potassium channel ATP-binding subunit OS=Danio rerio OX=7955 GN=abcb8 PE=2 SV=2)

HSP 1 Score: 530.406 bits (1365), Expect = 4.624e-179
Identity = 279/564 (49.47%), Postives = 397/564 (70.39%), Query Frame = 1
Query:  328 AAVVNIQIPLKLGNVVNILSNIKEIKDNDFVAAFKIPSLQLLICYAVQALSTTTYISLLSIIGERLAVKMKKKLFEKIIIQDSKFFDNMRSGDLLNRITADVQDFKSSFKQCISQGLRGFITIIGSTISLVIVSKELTTIVIIAIPCLVLIGSIMGKILRALSREAQMQNSKAADVANESIINIRTVKSFAMEDMEIENFFIEVNEAAKLHSVLGIGIGIFQGMSNFAINGIVLGVLFTGGFMMNNGNLTPGDLMSFLVASQTIQKSLSTLSTLFGHLVKANASGARITEFLALNTCATSPXXXXXXXXXXXXXXXFDNVRKPESVEFRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYGNISXXXXXXXXXXXXXXXXXFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALMKIKGHYYELVKK 2019
            AA +NIQIPL LG++VN+++     +   ++   + P+++LL  YA+Q L T+ YI LLS +GER+A  M+  LF  ++ QD  FFD  ++G L+NR+T+D+Q+FKSSFK  ISQGLR     +G  +SL  +S +LT + ++ +PCLV  G+++G  LR LSR+AQ Q +KA  VA+E++ N+RTV++FAMED E+E +  EV ++A ++  LG GI +FQG+SN  +N IVLG +F GG +M   +L+PGDLMSFLVASQT+Q+SL+++S LFG +V+  ++GAR+ E+LAL+                      D++     V+F NISF+YPTR    +L++FSL +P    VA+ GESG GKST+A+L++RFY+P SG ++++G++I+ +  S LR   +G +SQ+P LF  ++ ENIR+G  SAT+ E++ AAKQA AH FI GF DGY+T+VGER G  LSGGQ+QRIAIARA++KNP+ILILDEATSALD++SE +VQ AL     GRTV+IIAHRLSTIQ AD I V+ +G+I E G H  L+   G Y EL+K+
Sbjct:  156 AAALNIQIPLMLGDLVNVVARHMREQAGHYMRDIQAPAVKLLGLYALQGLLTSGYIILLSRVGERVAADMRTTLFTSLLRQDIAFFDANKTGQLVNRLTSDIQEFKSSFKLVISQGLRSATQTVGCFVSLYFISPKLTGLTVVVLPCLVGAGALIGSFLRKLSRKAQEQVAKATGVADEALGNVRTVRAFAMEDRELEMYAAEVQKSAAMNETLGTGIAVFQGLSNIVLNCIVLGTIFAGGSLMARDDLSPGDLMSFLVASQTVQRSLASISILFGQMVRGMSAGARVFEYLALDPSVP---------LTGGGRIPLDSLMG--RVDFMNISFSYPTRPGNQILKHFSLTLPPCKTVAIVGESGGGKSTVAALLERFYDPSSGVVMLDGLDIRTLDPSWLRGHVIGFISQEPVLFGTSVMENIRFGKPSATDAEVVSAAKQANAHNFITGFADGYNTVVGER-GVTLSGGQKQRIAIARALVKNPSILILDEATSALDAESERVVQEALDRATTGRTVLIIAHRLSTIQAADLICVMSNGRIVEAGTHLELLSKGGLYAELIKR 707          
BLAST of ATP-binding cassette subfamily B member 8 vs. UniProt/SwissProt
Match: sp|Q9CXJ4|MITOS_MOUSE (Mitochondrial potassium channel ATP-binding subunit OS=Mus musculus OX=10090 GN=Abcb8 PE=1 SV=1)

HSP 1 Score: 498.434 bits (1282), Expect = 1.799e-166
Identity = 270/568 (47.54%), Postives = 389/568 (68.49%), Query Frame = 1
Query:  328 AAVVNIQIPLKLGNVVNILSNIKEIKDNDFVAAFKIPSLQLLICYAVQALSTTTYISLLSIIGERLAVKMKKKLFEKIIIQDSKFFDNMRSGDLLNRITADVQDFKSSFKQCISQGLRGFITIIGSTISLVIVSKELTTIVIIAIPCLVLIGSIMGKILRALSREAQMQNSKAADVANESIINIRTVKSFAMEDMEIENFFIEVNEAAKLHSVLGIGIGIFQGMSNFAINGIVLGVLFTGGFMMNNGNLTPGDLMSFLVASQTIQKSLSTLSTLFGHLVKANASGARITEFLALNTCATSPXXXXXXXXXXXXXXXFDNVRKPESVEFRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYGNISXXXXXXXXXXXXXXXXXFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALMKIKGHYYELVKKLEKD 2031
            AA+VN+QIPL LG +V I++         FV+  +  S+QLL+ Y VQ L T  Y+ LLS IGER+A+ M+K LF  ++ QD  FFD  ++G L++R+T DVQ+FKSSFK  ISQGLR    +IGS +SL ++S  LT ++ +  P L+ +G++MG  LR LSR+ Q Q ++A  VA+E++ N+RTV++FAME  E E +  E+         LG GI +FQG+SN A N +VLG LF GG ++    L  GDLMSFLVASQT+Q+S+++LS LFG +V+  ++GAR+ E++AL     SP +       +       ++R   S+ F+N++F+YP R    VL++F+L +P G IVAL G+SG GK+T+ASL++RFY+P +G + ++G +++ +  S LR   +G +SQ+P LFA TI ENIR+G + A++EE+  AA++A AHEFI  F DGY T+VGER G  LSGGQ+QR+AIARA++K P +LILDEATSALD++SE +VQ AL     GRTV++IAHRLST++ A  I+V+ +G++ E G HE L+K  G Y EL+++   D
Sbjct:  140 AALVNVQIPLLLGQLVEIVAKYTRDHMGSFVSESRKLSVQLLLLYGVQGLLTFGYLVLLSHIGERMAMDMRKALFSSLLRQDIAFFDAKKTGQLVSRLTTDVQEFKSSFKLVISQGLRSCTQVIGSLVSLSMLSPRLTLMLAVVTPALMGVGTLMGSGLRKLSRQCQEQIARATGVADEALGNVRTVRAFAMEKREEERYQAELESCCCKAEELGRGIALFQGLSNIAFNCMVLGTLFIGGSLVAGQQLKGGDLMSFLVASQTVQRSMASLSVLFGQVVRGLSAGARVFEYMAL-----SPVIPLTGGYCIPN----KDIRG--SITFQNVTFSYPCRPGFNVLKDFTLKLPSGKIVALVGQSGGGKTTVASLLERFYDPEAGSVTLDGHDLRTLNPSWLRGQVIGFISQEPVLFATTIMENIRFGKLDASDEEVYTAAREANAHEFISSFPDGYSTVVGER-GTTLSGGQKQRLAIARALIKQPTVLILDEATSALDAESERVVQEALDRASAGRTVLVIAHRLSTVRAAHSIIVMANGQVCEAGTHEELLKKGGLYSELIRRQTLD 695          
BLAST of ATP-binding cassette subfamily B member 8 vs. UniProt/SwissProt
Match: sp|Q5RKI8|MITOS_RAT (Mitochondrial potassium channel ATP-binding subunit OS=Rattus norvegicus OX=10116 GN=Abcb8 PE=2 SV=1)

HSP 1 Score: 494.967 bits (1273), Expect = 2.862e-165
Identity = 268/568 (47.18%), Postives = 389/568 (68.49%), Query Frame = 1
Query:  328 AAVVNIQIPLKLGNVVNILSNIKEIKDNDFVAAFKIPSLQLLICYAVQALSTTTYISLLSIIGERLAVKMKKKLFEKIIIQDSKFFDNMRSGDLLNRITADVQDFKSSFKQCISQGLRGFITIIGSTISLVIVSKELTTIVIIAIPCLVLIGSIMGKILRALSREAQMQNSKAADVANESIINIRTVKSFAMEDMEIENFFIEVNEAAKLHSVLGIGIGIFQGMSNFAINGIVLGVLFTGGFMMNNGNLTPGDLMSFLVASQTIQKSLSTLSTLFGHLVKANASGARITEFLALNTCATSPXXXXXXXXXXXXXXXFDNVRKPESVEFRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYGNISXXXXXXXXXXXXXXXXXFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALMKIKGHYYELVKKLEKD 2031
            AA+VN+QIPL LG +V I++         FV+  +  S+QLL+ Y VQ L T  Y+ LLS +GER+A+ M+K LF  ++ QD  FFD  ++G L++R+T DVQ+FKSSFK  ISQGLR    +IGS ++L I+S  LT ++ +  P L+ +G++MG  LR LSR+ Q Q ++A  VA+E++ ++RTV++FAME  E E +  E+         LG GI +FQG+SN A N +VLG LF GG ++    L  GDLMSFLVASQT+Q+S+++LS LFG +V+  ++GAR+ E+++L     SP +       +       ++R   S+ F+N+SF+YP R    VL+NF+L +P G IVAL G+SG GK+T+ASL++RFY+P +G + ++G +++ +  S LR   +G +SQ+P LFA TI ENIR+G + A++EE+  AA++A AHEFI  F DGY T+VGER G  LSGGQ+QR+AIARA++K P +LILDEATSALD++SE +VQ AL     GRTV++IAHRLST++ A  I+V+ +G++ E G HE L++  G Y EL+++   D
Sbjct:  140 AALVNVQIPLLLGQLVEIVAKYTREHVGSFVSESRRLSIQLLLLYGVQGLLTFGYLVLLSHMGERMAMDMRKALFSSLLRQDIAFFDAKKTGQLVSRLTTDVQEFKSSFKLVISQGLRSSTQVIGSLMTLSILSPRLTLMLAVVTPALMGVGTLMGSGLRKLSRQCQEQIARATGVADEALGSVRTVRAFAMEKREEERYQAELESCCCKAEELGRGIALFQGLSNIAFNCMVLGTLFIGGSLVAGQQLKGGDLMSFLVASQTVQRSMASLSVLFGQVVRGLSAGARVFEYMSL-----SPVIPLTGGYSIPS----KDLRG--SITFQNVSFSYPCRPGFNVLKNFTLKLPPGKIVALVGQSGGGKTTVASLLERFYDPTAGVVTLDGHDLRTLDPSWLRGQVIGFISQEPVLFATTIMENIRFGKLDASDEEVYTAARKANAHEFISSFPDGYSTVVGER-GTTLSGGQKQRLAIARALIKRPTVLILDEATSALDAESERIVQEALDRASAGRTVLVIAHRLSTVRAAHSIIVMANGQVCEAGTHEELLQKGGLYAELIRRQALD 695          
BLAST of ATP-binding cassette subfamily B member 8 vs. UniProt/SwissProt
Match: sp|Q9NUT2|MITOS_HUMAN (Mitochondrial potassium channel ATP-binding subunit OS=Homo sapiens OX=9606 GN=ABCB8 PE=1 SV=3)

HSP 1 Score: 494.967 bits (1273), Expect = 6.046e-165
Identity = 265/564 (46.99%), Postives = 380/564 (67.38%), Query Frame = 1
Query:  340 NIQIPLKLGNVVNILSNIKEIKDNDFVAAFKIPSLQLLICYAVQALSTTTYISLLSIIGERLAVKMKKKLFEKIIIQDSKFFDNMRSGDLLNRITADVQDFKSSFKQCISQGLRGFITIIGSTISLVIVSKELTTIVIIAIPCLVLIGSIMGKILRALSREAQMQNSKAADVANESIINIRTVKSFAMEDMEIENFFIEVNEAAKLHSVLGIGIGIFQGMSNFAINGIVLGVLFTGGFMMNNGNLTPGDLMSFLVASQTIQKSLSTLSTLFGHLVKANASGARITEFLALNTCATSPXXXXXXXXXXXXXXXFDNVRKPESVEFRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYGNISXXXXXXXXXXXXXXXXXFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALMKIKGHYYELVKKLEKD 2031
            N+QIPL LG +V +++         F+   +  S  LLI Y VQ L T  Y+ LLS +GER+AV M++ LF  ++ QD  FFD  ++G L++R+T DVQ+FKSSFK  ISQGLR    + G  +SL ++S  LT ++++A P L+ +G++MG  LR LSR+ Q Q ++A  VA+E++ N+RTV++FAME  E E +  E+         LG GI +FQG+SN A N +VLG LF GG ++    LT GDLMSFLVASQT+Q+S++ LS LFG +V+  ++GAR+ E++ALN C                    + +R   SV F+N+ F+YP R    VL++F+L +P G IVAL G+SG GK+T+ASL++RFY+P +G ++++G +++ +  S LR   VG +SQ+P LF  TI ENIR+G + A++EE+  AA++A AHEFI  F +GY+T+VGER G  LSGGQ+QR+AIARA++K P +LILDEATSALD++SE +VQ AL     GRTV++IAHRLST++ A  IVV+  G+++E G HE L+K  G Y EL+++   D
Sbjct:  162 NVQIPLLLGQLVEVVAKYTRDHVGSFMTESQNLSTHLLILYGVQGLLTFGYLVLLSHVGERMAVDMRRALFSSLLRQDITFFDANKTGQLVSRLTTDVQEFKSSFKLVISQGLRSCTQVAGCLVSLSMLSTRLTLLLMVATPALMGVGTLMGSGLRKLSRQCQEQIARAMGVADEALGNVRTVRAFAMEQREEERYGAELEACRCRAEELGRGIALFQGLSNIAFNCMVLGTLFIGGSLVAGQQLTGGDLMSFLVASQTVQRSMANLSVLFGQVVRGLSAGARVFEYMALNPC---------IPLSGGCCVPKEQLRG--SVTFQNVCFSYPCRPGFEVLKDFTLTLPPGKIVALVGQSGGGKTTVASLLERFYDPTAGVVMLDGRDLRTLDPSWLRGQVVGFISQEPVLFGTTIMENIRFGKLEASDEEVYTAAREANAHEFITSFPEGYNTVVGER-GTTLSGGQKQRLAIARALIKQPTVLILDEATSALDAESERVVQEALDRASAGRTVLVIAHRLSTVRGAHCIVVMADGRVWEAGTHEELLKKGGLYAELIRRQALD 713          
BLAST of ATP-binding cassette subfamily B member 8 vs. UniProt/SwissProt
Match: sp|Q5RFQ9|MITOS_PONAB (Mitochondrial potassium channel ATP-binding subunit OS=Pongo abelii OX=9601 GN=ABCB8 PE=2 SV=1)

HSP 1 Score: 493.812 bits (1270), Expect = 1.130e-164
Identity = 265/564 (46.99%), Postives = 380/564 (67.38%), Query Frame = 1
Query:  340 NIQIPLKLGNVVNILSNIKEIKDNDFVAAFKIPSLQLLICYAVQALSTTTYISLLSIIGERLAVKMKKKLFEKIIIQDSKFFDNMRSGDLLNRITADVQDFKSSFKQCISQGLRGFITIIGSTISLVIVSKELTTIVIIAIPCLVLIGSIMGKILRALSREAQMQNSKAADVANESIINIRTVKSFAMEDMEIENFFIEVNEAAKLHSVLGIGIGIFQGMSNFAINGIVLGVLFTGGFMMNNGNLTPGDLMSFLVASQTIQKSLSTLSTLFGHLVKANASGARITEFLALNTCATSPXXXXXXXXXXXXXXXFDNVRKPESVEFRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYGNISXXXXXXXXXXXXXXXXXFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALMKIKGHYYELVKKLEKD 2031
            N+QIPL LG +V I++         F+   +  S  LLI Y VQ L T  Y+ LLS +GER+AV M++ LF  ++ QD  FFD  ++G L++R+T DVQ+FKSSFK  ISQGLR    + G  +SL ++S  LT ++++A P L+ +G++MG  LR LSR+ Q Q ++A  VA+E++ N+RTV++FAME  E E +  E+         LG GI + QG+SN A N +VLG LF GG ++    LT GDLMSFLVASQT+Q+S++ LS LFG +V+  ++GAR+ E++ALN C                    + +R   SV F+N+ F+YP R    VL++F+L +P G IVAL G+SG GK+T+ASL++RFY+P +G ++++G +++ +  S LR   VG +SQ+P LF  TI ENIR+G + A++EE+  AA++A AHEFI  F +GY+T+VGER G  LSGGQ+QR+AIARA++K P +LILDEATSALD++SE +VQ AL     GRTV++IAHRLST++ A +IVV+  G+++E G HE L+K  G Y EL+++   D
Sbjct:  145 NVQIPLLLGQLVEIVAKYTRDHVGSFMTESQNLSTHLLILYGVQGLLTFGYLVLLSHVGERMAVDMRRALFSSLLRQDIAFFDANKTGQLVSRLTTDVQEFKSSFKLVISQGLRSCTQVAGCLVSLSMLSTRLTLLLMLATPALMGVGTLMGSGLRKLSRQCQEQIARAMGVADEALGNVRTVRAFAMEQREEERYGAELEACRCRAEELGRGIALSQGLSNIAFNCMVLGTLFIGGSLVAGQQLTGGDLMSFLVASQTVQRSMANLSVLFGQVVRGLSAGARVFEYMALNPC---------IPLSGGCCVPKEQLRG--SVTFQNVCFSYPCRPGFEVLKDFTLTLPPGKIVALVGQSGGGKTTVASLLERFYDPTAGVVMLDGRDLRTLDPSWLRGQVVGFISQEPVLFGTTIMENIRFGKLEASDEEVYAAAREANAHEFITSFPEGYNTIVGER-GTTLSGGQKQRLAIARALIKQPTVLILDEATSALDAESERVVQEALDRASAGRTVLVIAHRLSTVRGAHRIVVMADGRVWEAGTHEELLKKGGLYAELIRRQALD 696          
BLAST of ATP-binding cassette subfamily B member 8 vs. TrEMBL
Match: K1PYF9 (ATP-binding cassette sub-family B member 8, mitochondrial OS=Crassostrea gigas OX=29159 GN=CGI_10015190 PE=4 SV=1)

HSP 1 Score: 546.199 bits (1406), Expect = 0.000e+0
Identity = 286/568 (50.35%), Postives = 418/568 (73.59%), Query Frame = 1
Query:  322 VVAAVVNIQIPLKLGNVVNILSNIKEIKDNDFVAAFKIPSLQLLICYAVQALSTTTYISLLSIIGERLAVKMKKKLFEKIIIQDSKFFDNMRSGDLLNRITADVQDFKSSFKQCISQGLRGFITIIGSTISLVIVSKELTTIVIIAIPCLVLIGSIMGKILRALSREAQMQNSKAADVANESIINIRTVKSFAMEDMEIENFFIEVNEAAKLHSVLGIGIGIFQGMSNFAINGIVLGVLFTGGFMMNNGNLTPGDLMSFLVASQTIQKSLSTLSTLFGHLVKANASGARITEFLALNTCATSPXXXXXXXXXXXXXXXFDNVRKPESVEFRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYGNISXXXXXXXXXXXXXXXXXFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALMKIKGHYYELVKKLE 2025
            V AA+VNI+IPL LG++VN++SN+ +   +DF+   +IP+++L++ Y++Q L T  YISLLS +GE +A +M+ KLF+ ++ QD +FFD  ++G+L++R+T+D+QDFKSSFK CISQGLR     IG   +L  +S +LT +++  IP ++ +G++MG  LRALS+ AQ Q +K+  VA+E++ N+RTV++FAME  E E F  +V  + K++  LG+GIG FQG+SN A+NGIVLG LF GG++M+ G +T GDLMSFLVASQTI++SL+ +S LFG++VK  ++GAR  EF+        P++     + +     + +      VEF +++F+YPTR  Q VL++FSL +P G++VAL G SG GKST+A+L++RFY+   G+I I+GV+++E+  + LR   +G ++Q+P LFA ++ ENIRYG   AT+ E+IEAA  A A  FI  F +GYDT++GER G  +SGGQ+QRIAIARA++KNP+IL+LDEATSALD++SE +VQ AL NV+KGRTV+IIAHRLSTI++AD I V+ +G+I E G H+ L K KG Y+EL++K E
Sbjct:  130 VAAALVNIKIPLLLGDMVNVVSNMTKEATSDFINNLRIPAIKLMMFYSLQGLLTFIYISLLSTVGENVAAQMRIKLFDSLLRQDVEFFDTHKTGELVDRLTSDIQDFKSSFKLCISQGLRAVTQTIGCVFTLYAISPKLTVLMVTVIPAVIGVGTMMGSGLRALSKAAQDQVAKSTAVADEALGNVRTVRAFAMETKENEIFSQQVELSKKMNINLGLGIGAFQGLSNVALNGIVLGTLFAGGYLMSGGEITAGDLMSFLVASQTIERSLAQMSFLFGNVVKGMSAGARAFEFI-----NNEPKIPIKGGKIIPYYAMYGD------VEFEHVNFSYPTRAGQKVLKDFSLKVPRGTVVALVGLSGGGKSTVAALLERFYDIDEGKISIDGVSLKELDPTWLRGKAIGFINQEPVLFATSVMENIRYGRPDATDVEVIEAASMANADGFIRSFPEGYDTVLGER-GVTVSGGQKQRIAIARALIKNPSILVLDEATSALDAESEQIVQAALDNVVKGRTVLIIAHRLSTIRDADIIAVVSNGQIVEQGSHDELRKKKGLYWELIRKQE 685          
BLAST of ATP-binding cassette subfamily B member 8 vs. TrEMBL
Match: V4A1S9 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_208936 PE=4 SV=1)

HSP 1 Score: 537.724 bits (1384), Expect = 0.000e+0
Identity = 285/590 (48.31%), Postives = 422/590 (71.53%), Query Frame = 1
Query:  247 PKEYYVLRNLAAILY*YCMLYFSYFVVAAVVNIQIPLKLGNVVNILSNIKEIKDNDFVAAFKIPSLQLLICYAVQALSTTTYISLLSIIGERLAVKMKKKLFEKIIIQDSKFFDNMRSGDLLNRITADVQDFKSSFKQCISQGLRGFITIIGSTISLVIVSKELTTIVIIAIPCLVLIGSIMGKILRALSREAQMQNSKAADVANESIINIRTVKSFAMEDMEIENFFIEVNEAAKLHSVLGIGIGIFQGMSNFAINGIVLGVLFTGGFMMNNGNLTPGDLMSFLVASQTIQKSLSTLSTLFGHLVKANASGARITEFLALNTCATSPXXXXXXXXXXXXXXXFDNVRKPESVEFRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYGNISXXXXXXXXXXXXXXXXXFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALMKIKGHYYELVK 2016
            P+ +Y+L ++ + L              A+VN+QIPL LG +VN++S         F+   K P+++L+I Y++Q L T  YI+LLS +GE +A +M+KKLF+ ++ QD +FFD  ++G+L++R+T+DVQDFKSSFK CISQGLR     +G   +L+++S +LT +++  +P +++ G+++G  LR  +++AQ Q ++A  VA+E+I N+RTV++FAME  E E +  EV +A KL+  LG+GI IFQG+SN A+NGIVLG +F GG+MM+   +T GDLMSFLVA+QTI++SL+ +S LFG +VK  ++GAR+ EF+    C  S          L+  K  ++     ++EF++++F+YPTR  Q +L++FSL I  G ++AL G SG GKST+ASL++RFY+   G+I I+GV+I+++  + LR   +G ++Q+P LFA ++ ENIRYG   AT++E+IEAA+QA A  FI  F  GY+T++GER G  +SGGQ+QRIAIARA++K+P+ILILDEATSALD++SE +VQ AL NV+KGRTV+IIAHRLSTI++AD I V+ HG+I EMG H +L K KG Y+EL+K
Sbjct:    6 PEIWYLLASVISAL------------AVAIVNVQIPLMLGEIVNVISQFTTQTAELFLQQIKEPAIRLVILYSIQGLLTFCYITLLSTVGENVATRMRKKLFDSLLKQDIEFFDKHKTGELIDRLTSDVQDFKSSFKLCISQGLRAVTQTVGCMATLLMISVKLTAVMLAVVPAIIIGGTVIGSTLRMFAKDAQTQVAQATAVADEAIGNVRTVRAFAMEKKENELYSNEVEKAGKLNIKLGVGIAIFQGLSNIALNGIVLGTMFAGGYMMSLHEITAGDLMSFLVATQTIERSLAHMSLLFGQVVKGISAGARVFEFI---KCTPS--------IPLVGGKTIEHKELEGNIEFKHVNFSYPTRPGQVILKDFSLKIKGGQVMALVGLSGGGKSTVASLLERFYDIDQGQITIDGVDIKDLDPTWLRGHAIGFINQEPILFATSVMENIRYGRPDATDQEVIEAARQANADMFINKFPQGYNTVLGER-GVTVSGGQKQRIAIARALIKDPSILILDEATSALDAESERIVQEALDNVIKGRTVLIIAHRLSTIRDADVIAVVAHGQILEMGDHNSLKKRKGLYWELIK 571          
BLAST of ATP-binding cassette subfamily B member 8 vs. TrEMBL
Match: C3Z387 (Uncharacterized protein (Fragment) OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_215834 PE=4 SV=1)

HSP 1 Score: 536.954 bits (1382), Expect = 0.000e+0
Identity = 281/566 (49.65%), Postives = 404/566 (71.38%), Query Frame = 1
Query:  322 VVAAVVNIQIPLKLGNVVNILSNIKEIKDNDFVAAFKIPSLQLLICYAVQALSTTTYISLLSIIGERLAVKMKKKLFEKIIIQDSKFFDNMRSGDLLNRITADVQDFKSSFKQCISQGLRGFITIIGSTISLVIVSKELTTIVIIAIPCLVLIGSIMGKILRALSREAQMQNSKAADVANESIINIRTVKSFAMEDMEIENFFIEVNEAAKLHSVLGIGIGIFQGMSNFAINGIVLGVLFTGGFMMNNGNLTPGDLMSFLVASQTIQKSLSTLSTLFGHLVKANASGARITEFLALNTCATSPXXXXXXXXXXXXXXXFDNVRKPESVEFRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYGNISXXXXXXXXXXXXXXXXXFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALMKIKGHYYELVKK 2019
            V +A++NIQIPL LG VVN++S     +  +++     P+ +L+  YA+Q + +  YI LL+ +GER+A +M+  LFE ++ QD  FFD+  +G L++R+T+DVQDFKSSFK CISQGLR    + G  +SL ++S +LT ++++ +P +V  G ++G  LRALSR AQ Q +K   VANE++ NIRTV++FAME+ E   +  EVN+A +L+ +LG+GIG+FQG +NF +NGIVLGVLF+GG M++  +++ GDLMSFL A+Q IQ+SL+++S LFG  V+  ++GAR+ E++ L      P +     R++     F       +VEF+++SF+YPTR DQ VL NF+L +P   +VALCG SGAGKST+A+L++RFY+   G + ++G +I+E+  + LR   +G + Q+P LFA +I ENI YG  +AT++E+ EAAK A A  FI  F DGYDT+VGER G  +SGGQ+QRIAIARA+LKNP++L+LDEATSALD+ SE LVQ AL+ VMKGRTV+IIAHRLSTI+NAD IVV+  G++ E G H  L +  G Y +L+++
Sbjct:    3 VGSALLNIQIPLMLGTVVNVVSECMADQQQNYLQMIVPPASRLMAVYALQGVLSFGYIWLLAAVGERMAARMRIALFENLVQQDMAFFDSHMTGQLVDRLTSDVQDFKSSFKLCISQGLRSVTQVTGCFVSLYLISPKLTGLLVLVMPTVVAGGGMIGSGLRALSRAAQEQVAKGTAVANEALGNIRTVRAFAMEEKESRLYADEVNKAGRLNEMLGLGIGVFQGAANFVLNGIVLGVLFSGGLMLSTNDMSAGDLMSFLAAAQMIQRSLASVSILFGQAVRGVSAGARVLEYMQLE-----PTIPRTGGRKIPFHSLFG------TVEFKDVSFSYPTRPDQQVLNNFNLVLPPCKVVALCGMSGAGKSTVAALLERFYDVEGGSVRLDGKDIREMDATWLRGRVIGFIHQEPVLFATSILENICYGKPTATDQEVYEAAKLANADGFIRDFPDGYDTVVGER-GVTVSGGQKQRIAIARALLKNPSVLVLDEATSALDADSERLVQEALERVMKGRTVLIIAHRLSTIENADVIVVMSKGRVVEQGTHAELKRKGGMYADLIRR 556          
BLAST of ATP-binding cassette subfamily B member 8 vs. TrEMBL
Match: H9J3Q5 (Uncharacterized protein OS=Bombyx mori OX=7091 PE=4 SV=1)

HSP 1 Score: 536.569 bits (1381), Expect = 0.000e+0
Identity = 285/571 (49.91%), Postives = 402/571 (70.40%), Query Frame = 1
Query:  331 AVVNIQIPLKLGNVVNILSNIKEIKDNDFVAAFKIPSLQLLICYAVQALSTTTYISLLSIIGERLAVKMKKKLFEKIIIQDSKFFDNMRSGDLLNRITADVQDFKSSFKQCISQGLRGFITIIGSTISLVIVSKELTTIVIIAIPCLVLIGSIMGKILRALSREAQMQNSKAADVANESIINIRTVKSFAMEDMEIENFFIEVNEAAKLHSVLGIGIGIFQGMSNFAINGIVLGVLFTGGFMMNNGNLTPGDLMSFLVASQTIQKSLSTLSTLFGHLVKANASGARITEFL----ALNTCATSPXXXXXXXXXXXXXXXFDNVRKPESVEFRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYGNISXXXXXXXXXXXXXXXXXFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALMKIKGHYYELVKKLEKD 2031
            A +N+ IP  LG +VN+L+ I+     DF+   K+P+ +L+  Y  QA  T  YI LLS +GE++A +MK+ LF  I+ QD +FFD  R+G+L+NR+T DVQDFKSSFKQ IS GLR    ++GS +SL+++S  LT + +I +P +V+ G+ +G +LR LSREAQ Q  KA  VA E++ N+RTV++FA ED E + F  E +EAA+L   LG+GIG+FQ  +N  +NG+VLG +F GG +M+ G ++ GD+M+FLV +QT+Q+S++ LS LFG +VK  ++G R+ E++    A++T  T            +K  +F        +EF+N++FAYPTR +  +L++F+L IP G  VA+ G SG GKSTIA+L++RFY+   G++ I+GV ++E     LR   +G++ Q+P LFA T+RENIRYG   AT+ E+++AA  A AHEFI  F +GYDTLVGER G ALSGGQ+QR+AIARA+LKNP ++ILDEATSALDS SE +VQ+AL+   KGRTV++IAHRLST+ NAD IVVL  GKI EMG HE L K+KG Y+ L+K+ ++D
Sbjct:   22 AFLNVYIPAMLGVIVNVLAGIRNNPAADFIDEIKMPAFKLISLYVGQAAFTFFYIHLLSQVGEKVATQMKQDLFVSILRQDIEFFDKERTGELVNRLTVDVQDFKSSFKQTISGGLRAITQVVGSAVSLLVISPHLTGLTMICVPSVVIGGTFIGSLLRKLSREAQTQIEKATLVAEEALSNMRTVRAFAAEDSEAQMFAKECDEAAQLSMELGLGIGLFQAGTNLFLNGMVLGTMFLGGHLMSTGQMSAGDVMAFLVNAQTVQRSVAQLSLLFGSVVKGISAGGRVFEYINKKPAMDTSGTK----------YIKYHEFHG-----DIEFKNVTFAYPTRPEAVILKDFNLKIPAGKTVAIVGTSGNGKSTIAALLERFYDVNEGQVSIDGVVLREFDGKWLRGRALGLIGQEPVLFATTVRENIRYGRPEATDAEVMQAATIANAHEFIQSFPEGYDTLVGER-GMALSGGQKQRVAIARAVLKNPPVIILDEATSALDSASEKVVQKALETAAKGRTVLVIAHRLSTVINADLIVVLNKGKIVEMGNHEQLKKLKGFYWNLIKQQDQD 576          
BLAST of ATP-binding cassette subfamily B member 8 vs. TrEMBL
Match: A0A210Q3D9 (ATP-binding cassette sub-family B member 8, mitochondrial OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT18787 PE=4 SV=1)

HSP 1 Score: 536.184 bits (1380), Expect = 5.543e-180
Identity = 279/559 (49.91%), Postives = 410/559 (73.35%), Query Frame = 1
Query:  340 NIQIPLKLGNVVNILSNIKEIKDNDFVAAFKIPSLQLLICYAVQALSTTTYISLLSIIGERLAVKMKKKLFEKIIIQDSKFFDNMRSGDLLNRITADVQDFKSSFKQCISQGLRGFITIIGSTISLVIVSKELTTIVIIAIPCLVLIGSIMGKILRALSREAQMQNSKAADVANESIINIRTVKSFAMEDMEIENFFIEVNEAAKLHSVLGIGIGIFQGMSNFAINGIVLGVLFTGGFMMNNGNLTPGDLMSFLVASQTIQKSLSTLSTLFGHLVKANASGARITEFLALNTCATSPXXXXXXXXXXXXXXXFDNVRKPESVEFRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYGNISXXXXXXXXXXXXXXXXXFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALMKIKGHYYELVK 2016
            NIQIPL LG +VNILS+       DF+   + P++++++ YA+Q++ T TY+SLL+ +GE +A +M+ +LF+ ++ QD +FFD  ++G+L++R+T+D+QDFKSSFK CISQGL+     +G   S+ ++S +LT  ++  +P +V +G++MG  LR+LSR AQ Q SK+  +A+E+I N+RTV++FAMED E E +  EV  A +++  LG+GIG FQG++NFA+NGIVLG LFTGG++M+   +T G+LMSFLVASQTI++SL+ +S LFG++V+  ++GAR+ EF  +N+  + P     +      +          +VEF N+SFAYPTR++QTVL +FSL I  G++VAL G SG GKST+A L++RFY+   G+I I+G +++++  + LR   VG ++Q+P LFA ++ ENIRYG   A++ E+IEAA  A AH+FI  F +GY+T++GER G  +SGGQ+QRIAIARA++KNP+ILILDEATSALD++SE +VQ AL  V+KGRT ++IAHRLSTI++AD I V+  GKI EMG H +L K KG Y+EL++
Sbjct:   70 NIQIPLVLGEIVNILSSFTRDAARDFIQEVRQPAMKMIVYYALQSVLTCTYLSLLATVGENVAARMRTRLFDSLLRQDIEFFDKHKTGELVDRLTSDIQDFKSSFKLCISQGLKASTQAVGCVGSMFVISPKLTVAMVTILPAIVGVGTVMGSGLRSLSRSAQEQLSKSTALADEAIGNVRTVRAFAMEDKENELYSREVEMARRINIKLGLGIGSFQGLANFALNGIVLGTLFTGGWLMSKQEITAGNLMSFLVASQTIERSLAQMSLLFGNVVRGMSAGARVFEF--INSVPSIPLKGGKKIAFHSLMG---------NVEFENVSFAYPTRSEQTVLNDFSLKIRSGAVVALVGLSGGGKSTVAVLLERFYDVQKGKITIDGYDLKDLDPTWLRGNAVGYINQEPVLFATSVMENIRYGMPEASDIEVIEAATLANAHDFISQFPEGYNTVLGER-GVTVSGGQKQRIAIARALIKNPSILILDEATSALDAESERIVQEALDQVIKGRTTLVIAHRLSTIRDADVIAVVSGGKIVEMGDHTSLKKKKGLYWELIR 616          
BLAST of ATP-binding cassette subfamily B member 8 vs. Ensembl Cavefish
Match: abcb8 (ATP binding cassette subfamily B member 8 [Source:NCBI gene;Acc:103032723])

HSP 1 Score: 520.776 bits (1340), Expect = 3.079e-176
Identity = 285/569 (50.09%), Postives = 400/569 (70.30%), Query Frame = 1
Query:  328 AAVVNIQIPLKLGNVVNILSNIKEIKDNDFVAAFKIPSLQLLICYAVQALSTTTYISLLSIIGERLAVKMKKKLFEKIIIQDSKFFDNMRSGDLLNRITADVQDFKSSFKQCISQGLRGFITIIGSTISLVIVSKELTTIVIIAIPCLVLIGSIMGKILRALSREAQMQNSKAADVANESIINIRTVKSFAMEDMEIENFFIEVNEAAKLHSVLGIGIGIFQGMSNFAINGIVLGVLFTGGFMMNNGNLTPGDLMSFLVASQTIQKSLSTLSTLFGHLVKANASGARITEFLALNTCATSPXXXXXXXXXXXXXXXFDNVRKPES-----VEFRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYGNISXXXXXXXXXXXXXXXXXFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALMKIKGHYYELVKK 2019
            AA +NIQIPL LG++VN+++        +++   + P+L+LL  Y +Q L TT YI LLS +GER+A  M+K LF  ++ QD  FFD  ++G L+NR+TAD+Q+FKSSFK  ISQGLR     +G  +SL I+S +LT + ++ +PCLV  G+I+G  LR LSR+AQ Q SKA  VA+E++ N+RTV++F+MED E+E +  EV+++A ++  LG GI +FQG+SN  +N IVLG +F GG +M + +++PGDLMSFLVASQT+Q+SL+++S LFG +V+  ++GAR+ E+LAL    T P                   R P       V+F NI+F+YPTR    VL+NFSL +P    VA+ GESG GKST+A+L++RFY+P +G I+++G++I+ +  S LR   +G +SQ+P LF  ++ ENIR+G  SAT+ E++ AAKQA AH FI+GF +GY T+VGER G  LSGGQ+QRIAIARA++KNP+ILILDEATSALD++SE +VQ AL     GRTV+IIAHRLSTIQ AD I V+ +GK+ E G H  L+   G Y EL+++
Sbjct:  150 AAALNIQIPLMLGDLVNVVAQHLREHAGNYMRDIRAPALKLLGLYGLQGLLTTGYIILLSRVGERVAADMRKTLFSSLLRQDVAFFDANKTGQLVNRLTADIQEFKSSFKLVISQGLRSVTQTVGCFVSLYIISPKLTGLTVVILPCLVGAGAIIGSFLRRLSRKAQEQISKATGVADEALGNVRTVRAFSMEDRELEMYATEVDKSAAMNEALGTGIAVFQGLSNIVLNCIVLGTIFAGGSLMAHNDMSPGDLMSFLVASQTVQRSLASISILFGQMVRGISAGARVFEYLALE--PTIP--------------LIGGGRIPHKSLSGRVDFMNINFSYPTRPGNQVLKNFSLTLPPRKTVAIVGESGGGKSTVAALLERFYDPGNGVIMLDGLDIRTLDPSWLRGDVIGFISQEPVLFGTSVMENIRFGKPSATDAEVVAAAKQANAHNFIIGFTEGYSTVVGER-GVTLSGGQKQRIAIARALIKNPSILILDEATSALDAESERVVQEALDRATTGRTVLIIAHRLSTIQGADIICVMSNGKVVETGTHLELLSKGGLYAELIRR 701          
BLAST of ATP-binding cassette subfamily B member 8 vs. Ensembl Cavefish
Match: abcb10 (ATP binding cassette subfamily B member 10 [Source:NCBI gene;Acc:103038971])

HSP 1 Score: 343.584 bits (880), Expect = 8.868e-108
Identity = 214/579 (36.96%), Postives = 341/579 (58.89%), Query Frame = 1
Query:  316 YFVVAAVVNIQIPLKLGNVVNILSNIKEIKDNDFVAAFKIPSLQLLICYAVQALSTTTYISLLSIIGERLAVKMKKKLFEKIIIQDSKFFDNMRSGDLLNRITADVQDFKSSFKQCISQGLRGFITIIGSTISLVIVSKELTTIVIIAIPCLVLIGSIMGKILRALSREAQMQNSKAADVANESIINIRTVKSFAMEDMEIENFFIEVNEA---AKLHSVLGIGIGIFQGMSNFAINGIVLGVLFTGGFMMNNGNLTPGDLMSFLVASQTIQKSLSTLSTLFGHLVKANASGARITEFLALNTCATSPXXXXXXXXXXXXXXXFDNVRKPE----SVEFRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYGNISXXXXXXX---XXXXXXXXXXFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALMKIK-GHYYELVKK 2019
            +  +++ V +  P  LG V++    I      DF ++     + L   +     +    + L+ I G+++   +++ LF  I+ Q+  FFD  R+G+L+NR++AD      +    +S GLR           +  VS  L T V++ +P +  +  I G+ LR++S++ Q   ++A  +A E I N+RTV++F  E  E + +  +V+     AK  +VL  G   F G +  + N I+L VL+ GG +M + ++T G+L SFL+ +  +  S++ LS+ +  L+K   +G R+ E   ++     P  + L             V KPE    ++EF N+SFAYPTR D  + ++ SL +P GS++A+ G SG+GKST+ SL+ R Y+P  G + ++G +I+EI    LRS ++G VSQ+P LF+ +I ENI YG    ++        AA+ A AHEFI+GF +G+DT+VGE+ G  LSGGQ+QRIAIARA+LK+P IL+LDEATSALD+++E LVQ AL+ +M+GRTV+IIAHRLSTIQ+A+ + VL   ++ E G H  L+  + G + +L++K
Sbjct:  144 FLAISSAVTMSAPFFLGQVID---TIYTSTSEDFSSSLTSLCIMLGGIFLFGGAANAARVYLMQISGQQIVRNLRESLFSSILRQEVGFFDKTRTGELINRLSADTALVGRALTDNLSDGLRSVAQATAGVSMMFYVSPTLATFVLMIVPPMAGLAVIYGRYLRSISKQTQDSLAEATQLAEERISNMRTVRAFGKELTEAQKYAEKVDHVLHLAKKEAVLRAG---FFGATGLSGNIIILSVLYKGGLLMASEHMTVGELSSFLMYAFWVGISIAGLSSFYSELMKGFGAGTRLWEL--MDRKPEFPLNEGL-------------VLKPEQLKGALEFHNVSFAYPTRKDAPIFQDLSLSVPAGSVMAVVGPSGSGKSTLVSLLLRLYDPDIGTVTVDGRDIREINPYWLRS-HIGTVSQEPVLFSCSIAENIAYGATDPSKVTTQDILRAAQIANAHEFILGFPNGFDTVVGEK-GVLLSGGQKQRIAIARALLKDPKILLLDEATSALDAENEFLVQEALERLMEGRTVLIIAHRLSTIQSANAVAVLDQHRVVECGRHAQLLANQDGLFRKLMEK 699          
BLAST of ATP-binding cassette subfamily B member 8 vs. Ensembl Cavefish
Match: abcb10 (ATP binding cassette subfamily B member 10 [Source:NCBI gene;Acc:103038971])

HSP 1 Score: 317.39 bits (812), Expect = 7.046e-98
Identity = 206/579 (35.58%), Postives = 331/579 (57.17%), Query Frame = 1
Query:  316 YFVVAAVVNIQIPLKLGNVVNILSNIKEIKDNDFVAAFKIPSLQLLICYAVQALSTTTYISLLSIIGERLAVKMKKKLFEKIIIQDSKFFDNMRSGDLLNRITADVQDFKSSFKQCISQGLRGFITIIGSTISLVIVSKELTTIVIIAIPCLVLIGSIMGKILRALSREAQMQNSKAADVANESIINIRTVKSFAMEDMEIENFFIEVNEA---AKLHSVLGIGIGIFQGMSNFAINGIVLGVLFTGGFMMNNGNLTPGDLMSFLVASQTIQKSLSTLSTLFGHLVKANASGARITEFLALNTCATSPXXXXXXXXXXXXXXXFDNVRKPE----SVEFRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYGNISXXXXXXX---XXXXXXXXXXFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALMKIK-GHYYELVKK 2019
            +  +++ V +  P  LG V++    I      DF ++     + L   +     +    + L+ I G+++   +++ LF  I+ Q+  FFD  R+G+L+NR++AD      +    +S GLR           +  VS  L T V++ +P +  +  I G+ LR++S++ Q   ++A  +A E I N+RTV++F  E  E + +  +V+     AK  +VL  G   F G +  + N I+L VL+ GG +M + ++T G+L SFL+ +  +  S++ LS+ +  L+K   +G R+ E   ++     P  + L             V KPE    ++EF N+SFAYPTR D  + ++ SL +P GS++A+ G SG+GKST+ SL+ R Y+P  G + ++G +I+EI    LRS ++G VSQ+P LF+ +I ENI YG    ++        AA+ A AHEFI+GF +G+DT+VGE+ G  LSGGQ+QRIAIARA+LK           SALD+++E LVQ AL+ +M+GRTV+IIAHRLSTIQ+A+ + VL   ++ E G H  L+  + G + +L++K
Sbjct:  144 FLAISSAVTMSAPFFLGQVID---TIYTSTSEDFSSSLTSLCIMLGGIFLFGGAANAARVYLMQISGQQIVRNLRESLFSSILRQEVGFFDKTRTGELINRLSADTALVGRALTDNLSDGLRSVAQATAGVSMMFYVSPTLATFVLMIVPPMAGLAVIYGRYLRSISKQTQDSLAEATQLAEERISNMRTVRAFGKELTEAQKYAEKVDHVLHLAKKEAVLRAG---FFGATGLSGNIIILSVLYKGGLLMASEHMTVGELSSFLMYAFWVGISIAGLSSFYSELMKGFGAGTRLWEL--MDRKPEFPLNEGL-------------VLKPEQLKGALEFHNVSFAYPTRKDAPIFQDLSLSVPAGSVMAVVGPSGSGKSTLVSLLLRLYDPDIGTVTVDGRDIREINPYWLRS-HIGTVSQEPVLFSCSIAENIAYGATDPSKVTTQDILRAAQIANAHEFILGFPNGFDTVVGEK-GVLLSGGQKQRIAIARALLK----------VSALDAENEFLVQEALERLMEGRTVLIIAHRLSTIQSANAVAVLDQHRVVECGRHAQLLANQDGLFRKLMEK 689          
BLAST of ATP-binding cassette subfamily B member 8 vs. Ensembl Cavefish
Match: tap2a (transporter associated with antigen processing, subunit type a [Source:ZFIN;Acc:ZDB-GENE-030616-245])

HSP 1 Score: 292.738 bits (748), Expect = 2.905e-88
Identity = 193/584 (33.05%), Postives = 318/584 (54.45%), Query Frame = 1
Query:  310 FSYFVVAAVVNIQIPLKLGNVVNILSNIKEIKDNDFVAAFKIPSLQLLICYAVQALSTTTYIS-----LLSIIGERLAVKMKKKLFEKIIIQDSKFFDNMRSGDLLNRITADVQDFKSSFKQCISQGLRGFITIIGSTISLVIVSKELTTIVIIAIPCLVLIGSIMGKILRALSREAQMQNSKAADVANESIINIRTVKSFAMEDMEIENFFIEVNEAAKLHSVLGIGIGIFQGMSNFAINGIVLGVLFTGGFMMNNGNLTPGDLMSFLVASQTIQKSLSTLSTLFGHLVKANASGARITEFLALNTCATSPXXXXXXXXXXXXXXXFDNVRKPESVE----FRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYGNISXXXXXXXXXXXXXXXXXFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALMKIKGHYYELVKKLEKDN 2034
            F +  +A +  + IPL  G +++IL    E   +DF +A        +I  AV ++ ++          +  IG     ++K +LF  ++ Q+  FF+  ++GD+ +R++ D      +    ++  LR  I  +G    +  +S +LT ++++  P   L+ +I     + LS+E Q   + + D A E++  IRTVKSF  E  E+  +   + +   L +  G    ++  +      G+ + +L  G   + +G +T G L+SF++    + +++ TL  +FG ++    +  ++ E+L      ++                 D   +PE +E    F+ ++F+YPTR D  VLE+F+L +  G   AL G SG GKST  SL+QRFY+P  G+IL++G  +Q      L S  V  V Q+P LF+ T+RENI YG    + E + +AA++A AHEFI     GY+T VGER G  L   Q+QRIAIARA+++ P +++LDE TS LD++SE +VQ+AL N     T+++IAHRL TI+ AD+I+V+  GK+ E G H+ LM+ KGHYY+L +KL  D+
Sbjct:  171 FVFLTLAVLCEMFIPLYTGKLIDILR--VEQHWDDFRSA--------VILMAVFSIGSSFSAGCRGGLFMCAIGS-FICRVKLQLFGSLVRQEIGFFERTKTGDITSRLSTDTTLMARAVALNVNVLLRTLIKTLGMLYLMFSLSWKLTLLMLMETPLTGLLQNIYDTHYQRLSKEVQDSVASSNDAAGEAVSGIRTVKSFNSEPSELHRYNNRLMDTHNLKTRRGTVRAVYLLVRRLIGLGVNVAMLHYGRLFIQHGQMTTGSLVSFILYQSNLGRNIRTLIYIFGDMLNCVGAAGKVFEYLDRKPEVST-----------------DGTLQPEKLEGHVCFQELTFSYPTRTDHNVLEDFTLELKPGQTTALVGISGGGKSTCVSLLQRFYQPHHGQILLDGQPLQNYQHKYLHS-KVVAVGQEPVLFSGTVRENIAYGLPDCSLERVQDAARKANAHEFICELNKGYNTDVGER-GNLLGSSQKQRIAIARALIRQPQVILLDEITSFLDAESEQMVQKALANC-SNHTLLVIAHRLKTIERADQIIVIDQGKVLEQGTHQELMEKKGHYYKLKEKLFADD 723          
BLAST of ATP-binding cassette subfamily B member 8 vs. Ensembl Cavefish
Match: tap2a (transporter associated with antigen processing, subunit type a [Source:ZFIN;Acc:ZDB-GENE-030616-245])

HSP 1 Score: 290.041 bits (741), Expect = 2.620e-87
Identity = 197/585 (33.68%), Postives = 318/585 (54.36%), Query Frame = 1
Query:  310 FSYFVVAAVVNIQIPLKLGNVVNILSNIKEIKDNDFVAAFKIPSLQLLICYAVQALSTTTYIS-----LLSIIGERLAVKMKKKLFEKIIIQDSKFFDNMRSGDLLNRITADVQDFKSSFKQCISQGLRGFITIIGSTISLVIVSKELTTIVIIAIPCLVLIGSIMGKILRALSREAQMQNSKAADVANESIINIRTVKSFAMEDMEIENFFIEVNEAAKLHSVLGIGIGIFQGMSNFAINGIVLGVLFTGGFMMNNGNLTPGDLMSFLVASQTIQKSLSTLSTLFGHLVKANASGARITEFLALNTCATSPXXXXXXXXXXXXXXXFDNVRKPESVE----FRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYGNISXXXXXXXXXXXXXXXXXFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALMKIKGHYYELVKKL-EKDN 2034
            F +  +A +  + IPL  G +++IL    E    DF +A        +I   V +  ++          +  IG  ++ +MK KLF  ++ Q+  FF++ ++GD+ +R++ D      +    ++  LR FI  +G    +  +S +LT ++++  P   L+ +I     + LS+E Q    +A D A ES+  IRTV+SF  E  E+  +   + +   L +       ++  +      G+ + +L      +  G +T G L+SF++    +  ++ TL  +FG ++    +  ++ E+L      ++                 D   +PE +E    F+ ++F+YPTR D  VLE+FSL +  G   AL G SG GKST  SL+QRFY+P  G+IL++G  +Q+     L S  V  V Q+P LF+ T+R+NI YG    +++ I EAA++A AHEFI   Q+ YDT VGER G  L   Q+QRIAIARA+++ P +++LDE TS LD++SE  VQ AL N    +T+++IAHRL TI+ AD+I+V+  GK+ E G H+ LM+ KGHYY+L +KL  +DN
Sbjct:  171 FVFLTLAVLCEMFIPLYTGKLIDILQT--EHHWGDFRSA--------IIFMTVFSFGSSFSAGCRGGLFMCAIGSFIS-RMKLKLFGSLVRQEIGFFESTKTGDITSRLSTDTTLMARAVALNVNVLLRTFIKTMGMLYLMFSLSWKLTLLILMETPLTGLLQNIYDTHYQRLSKEVQDSIGRANDAAGESVSGIRTVRSFNSEQNELRRYDGRLMDTHNLKTQRDTVRAVYLLVRRLIELGVKVTMLHYARLFIQYGQMTTGSLVSFILYQSDLGDNIRTLIYIFGDMLNCVGAAGKVFEYLDRKPEVST-----------------DGNLQPEKLEGHVCFQELTFSYPTRTDHNVLEDFSLELKSGQTTALVGISGGGKSTCVSLLQRFYQPQHGQILLDGQPLQDYQHKYLHS-KVVAVGQEPVLFSGTVRDNIAYGLSGCSQKSIEEAARKANAHEFICQLQNKYDTDVGER-GNLLGSSQKQRIAIARALIRQPQVILLDEITSFLDAESEQAVQEALANC-SNQTLLVIAHRLKTIERADQIIVIDQGKVLEQGTHQELMEKKGHYYKLKEKLFAEDN 724          
BLAST of ATP-binding cassette subfamily B member 8 vs. Ensembl Sea Lamprey
Match: abcb8 (ATP-binding cassette, sub-family B (MDR/TAP), member 8 [Source:NCBI gene;Acc:548340])

HSP 1 Score: 505.753 bits (1301), Expect = 2.777e-172
Identity = 264/564 (46.81%), Postives = 389/564 (68.97%), Query Frame = 1
Query:  328 AAVVNIQIPLKLGNVVNILSNIKEIKDNDFVAAFKIPSLQLLICYAVQALSTTTYISLLSIIGERLAVKMKKKLFEKIIIQDSKFFDNMRSGDLLNRITADVQDFKSSFKQCISQGLRGFITIIGSTISLVIVSKELTTIVIIAIPCLVLIGSIMGKILRALSREAQMQNSKAADVANESIINIRTVKSFAMEDMEIENFFIEVNEAAKLHSVLGIGIGIFQGMSNFAINGIVLGVLFTGGFMMNNGNLTPGDLMSFLVASQTIQKSLSTLSTLFGHLVKANASGARITEFLALNTCATSPXXXXXXXXXXXXXXXFDNVRKPESVEFRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYGNISXXXXXXXXXXXXXXXXXFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALMKIKGHYYELVKK 2019
            AA++NI+IP+ LG +VN++S   + +  D++A  ++P+ +LL+ Y  Q   T  YI+LLS +GER+A  M+K LFE +I QD  FFD  R+G L+NR+T+DVQ+FKSSFK  ISQGLR     +G   SL ++S +LT ++++ +  +V  G+++G  LR LSR AQ Q SKA  VA+E++ N+RTV++FAMED + E + +EV+++ K++  LGIGI IFQG+SN  +N IVLG +F GG +M    L+PG+LMSFLVASQT+Q+S++++S LFG +V+  ++GAR+ E++ L      P +       +       +VR      F N++F+YPTR  Q VL NF+L +P    +A+ G SG GKST+A+L++RFY+P SG I ++G +++ +  S LR   +G ++Q+P LF  TI ENIR+G   AT++E+  AA+ A A +FI  F DGY+T+VGERG   LSGGQ+QR+AIARA++K P +L+LDEATSALD+++E  VQ AL+    GRTV++IAHRLST+  A+ I V+  G + EMG H  L+K  G Y EL+++
Sbjct:   68 AAILNIKIPMLLGELVNVVSRYVQEQAGDYLADMRLPATRLLVMYGFQGALTFGYIALLSQVGERIAASMRKSLFEALIRQDVAFFDANRTGHLVNRLTSDVQEFKSSFKLVISQGLRSVTQTVGCVASLYLISPKLTGLMVVVMTAMVGGGALIGSFLRKLSRRAQEQISKATGVADETLGNVRTVRAFAMEDSKSEQYAVEVDKSCKMNEDLGIGIAIFQGLSNIVLNCIVLGTIFVGGSLMAGEELSPGELMSFLVASQTVQRSMASVSILFGQMVRGLSAGARLFEYMELE-----PSIPVRGGGIIPHHSCLGHVR------FNNVTFSYPTRPGQVVLHNFNLNLPPSQTIAIVGLSGGGKSTVAALLERFYDPASGSITLDGKDLRTLDPSWLRGRVIGFINQEPVLFGTTIIENIRFGKPGATDDEVYAAARLANADDFIRSFPDGYNTVVGERGA-TLSGGQKQRVAIARALIKQPAVLVLDEATSALDAEAEGAVQEALERAAHGRTVLVIAHRLSTVAGANLICVVAGGTVQEMGTHAELLKKGGLYAELIRR 619          
BLAST of ATP-binding cassette subfamily B member 8 vs. Ensembl Sea Lamprey
Match: abcb10 (ATP-binding cassette, sub-family B (MDR/TAP), member 10 [Source:ZFIN;Acc:ZDB-GENE-040525-2])

HSP 1 Score: 355.14 bits (910), Expect = 3.571e-114
Identity = 223/590 (37.80%), Postives = 349/590 (59.15%), Query Frame = 1
Query:  268 RNLAAILY*YCMLYFSYFVVAAVVNIQIPLKLGNVVNILSNIKEIKDNDFVAAFKIPSLQLLIC--YAVQALSTTTYISLLSIIGERLAVKMKKKLFEKIIIQDSKFFDNMRSGDLLNRITADVQDFKSSFKQCISQGLRGFITIIGSTISLVIVSKELTTIVIIAIPCLVLIGSIMGKILRALSREAQMQNSKAADVANESIINIRTVKSFAMEDMEIENFFIEVNEAAKLHSVLGIGIGIFQGMSNFAINGIVLGVLFTGGFMMNNGNLTPGDLMSFLVASQTIQKSLSTLSTLFGHLVKANASGARITEFLALNTCATSPXXXXXXXXXXXXXXXFDNVRKPESVEFRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYGNI---SXXXXXXXXXXXXXXXXXFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALM-KIKGHYYELVKK 2019
            R LAA +   C        +++VV + +P  LG V++++++   +     +A   +  L  ++   +   A++    + L+ + G+R+  +++  LF  I+ Q+  FFD  R+G+L+NR++AD      +  + +S GLR    +      +  VS +L T V+  +P + LI  + G+ LR +++  Q   ++A  VA E I NIRTV+SFA E++E++ +  +VN   +L     +    F G +  + N IVL VL+ GG +M + ++T GDL +FL+ S  +  S+  LS+ +  L+K   +G+RI +   L+   T P           ++     +R    +EFR + FAYPTR    V  +  L +P G + A+ G SG GKST+ SL+ R Y+P  G++LI+G +++E+  S LRS  +G VSQ+P LF+ +I ENI YG     +A++ +I  AA+ A A+ FI GF  G+DT+VGE+ G  LSGGQ+QRIAIARAILKNPNIL+LDEATSALDS+SE LVQ AL  +M GRTV++IAHRLSTIQ AD+I VL+ G++ + G +  L     G ++ LV++
Sbjct:   28 RTLAAAVGLLC--------ISSVVTMSVPFCLGKVIDVINSTGGVD----MAPTDLAHLATVLSGIFMAGAIANAGRVYLMQVSGQRIVQRLRDSLFRAIMRQELGFFDRTRTGELVNRLSADTALMGRAVTENLSDGLRSVAQVTVGIGMMFYVSPKLATFVLGVVPPIALIAVVYGRYLRRITKRTQDSLAEATQVAEERIGNIRTVRSFAKEELEMQKYSSKVNYVLQLAYKEALARAGFFGATGLSGNLIVLAVLYKGGLLMQSAHITVGDLSAFLLYSGWVGISIGGLSSFYSELMKGLGTGSRIWQL--LDRQPTIP-------LGEGQVVPLQALRG--EIEFRGVHFAYPTRETAPVFRSLDLAVPAGQVTAVVGPSGCGKSTLLSLLLRLYDPQKGQVLIDGQDVREVNPSWLRS-QIGTVSQEPILFSCSIAENIAYGAANPEAASKADIARAAQAANAYGFIEGFPSGFDTVVGEK-GVLLSGGQKQRIAIARAILKNPNILLLDEATSALDSESESLVQEALDRLMTGRTVLVIAHRLSTIQGADRIAVLERGRVAQAGTYAQLTADTGGMFHRLVER 592          
BLAST of ATP-binding cassette subfamily B member 8 vs. Ensembl Sea Lamprey
Match: abcb9 (ATP-binding cassette, sub-family B (MDR/TAP), member 9 [Source:ZFIN;Acc:ZDB-GENE-050517-12])

HSP 1 Score: 281.952 bits (720), Expect = 2.534e-84
Identity = 182/571 (31.87%), Postives = 311/571 (54.47%), Query Frame = 1
Query:  310 FSYFVVAAVVNIQIPLKLGNVVNILSNIKEIKDNDFVAAFKIPSLQLLICYAVQALSTTTYISLLSIIGERLAVKMKKKLFEKIIIQDSKFFDNMRSGDLLNRITADVQDFKSSFKQCISQGLRGFITIIGSTISLVIVSKELTTIVIIAIPCLVLIGSIMGKILRALSREAQMQNSKAADVANESIINIRTVKSFAMEDMEIENFFIEVNEAAKLHSVLGIGIGIFQGMSNFAINGIVLGVLFTGGFMMNNGNLTPGDLMSFLVASQTIQKSLSTLSTLFGHLVKANASGARITEFLALNTCATSPXXXXXXXXXXXXXXXFDNVRKPESVEFRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYGNISXXXXXXXXXXXXXXXXXFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKN-VMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALMKIKGHYYELVKK 2019
            F + V+ ++  I IP   G V++ +     IK +   AAF    L + +     +++      L ++   RL ++++  LF  +I Q+  FFD  R+GD+ +R+ +D         Q  +  LR  +   G  I +  +S  L+ + ++ +P + L+    G     LS+  Q   + A+  A E++  IRTV+S A E+ E   +   +    + +    +    F   ++     + +G+L+ GG ++    ++   L+SF++    +   L  + +++  L++A  +  ++ E++                 R+        V+    V F++++FAYP+R D  VL+  S  +  G + AL G SG+GKS+   L+QR YEP+ G +L++G ++ +     L +  V +V Q+P LFA+++R+NI YG     E  +I A++QA AHEFI      Y T  GE+G + LSGGQ+QR+AIARA++++P +LILDEATSALD++SE +VQ+AL N  ++GRTV++IAHRLS+++ AD IVVL+HG++ E GPH  LM+  G Y  LV +
Sbjct:  216 FMFLVICSIGEIFIPYYTGQVIDGIV----IKKSQ--AAFSKAILYMSLIAIASSIAAGLRGGLFTLTMSRLNIRIRNLLFRSLIHQEVAFFDTTRTGDITSRLNSDTTVVSDVVSQNANVFLRSLVKAGGVCIFMFGLSWRLSLLTLLGLPIVTLVSKFYGDFYEKLSKAVQDSLAVASGAAEETLAAIRTVRSLAGEEAECRRYRDALQHTYRHNRRQALAYAGFSCSNSLTQLALQVGILYYGGHLVVTDRISGAHLISFILYQMELGACLENMGSVYTGLMQAVGAAGKVFEYMEREP-------------RMRTDGTLAPVQLEGQVSFKDVTFAYPSRPDAPVLKGVSFELQPGLVTALVGPSGSGKSSCVHLLQRLYEPLGGRVLLDGQSVHKYQHHYLHT-KVALVGQEPVLFARSLRDNIAYGMEDCPENAVISASQQANAHEFISDLPLAYQTEAGEKGAQ-LSGGQKQRVAIARALVRDPRVLILDEATSALDAESEHMVQQALYNGELRGRTVLVIAHRLSSVERADHIVVLEHGRLVEQGPHAQLMQQGGLYARLVHR 765          
BLAST of ATP-binding cassette subfamily B member 8 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001786.1 (pep scaffold:Pmarinus_7.0:GL477870:201625:214977:-1 gene:ENSPMAG00000001622.1 transcript:ENSPMAT00000001786.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 240.736 bits (613), Expect = 4.638e-72
Identity = 172/495 (34.75%), Postives = 262/495 (52.93%), Query Frame = 1
Query:  565 IQDSKFFDNMR--SGDLLNRITAD---VQDFKSSFKQCISQGLRGFITIIGSTISLVIVSKELTTIVIIAIPCLVLIGSIMGKILRALSREAQMQNSKAADVANESIINIRTVKSFAMEDM---EIENFFIEVNEAAKLHSVL-GIGIGIFQGMSNFAINGIVLGVLFTGGFMMNNGNLTPGDLMSFLVASQTIQKSLSTLSTLFGHLVKANASGARITEFLALNTCATSPXXXXXXXXXXXXXXXFDNVRKPESVEFRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYGNISXXXXXXXXXXXXXXX--XXFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALMKIKGHYYELVK 2016
            +Q+ ++F N +  +G L  +++ D   VQ         + Q + G  T  G  I+L +V  +L  +++  +P +V  G +   +  + +   +    +A+ ++ E++ NIRTV S  +E+      E   +E     K    L  +  G  QG+  FA       V   GGF++  G LT  D+     A      ++     +  +  +A  S ARI   L       S           ++   FD   +   V FR     YPTR    VL   SL +  G  +AL G SG+GKSTI  L+ RFY+  +G++L+NGV ++++ +  LR   +GVVSQ+P LF  +I ENI YG++S         A    A  H+F+      YDT+VGERG + LSGGQ+QR+AIARA+L++P +L+LDEATSALD++SE +VQ AL+   +GRT ++IAHRLST++ AD I VL+ G I E+G HE L+  +G YY LV+
Sbjct:    6 LQEIRWFYNHKNNTGALTAQLSTDAAQVQGATGRRAGMLVQNVSGLAT--GLLIAL-LVGWKLALLMLAFMPFMVGAGLVQSVLQGSEATTIKRAYEQASKISTEAVQNIRTVASLCLEEKFSGMFEQCLLEPYRVIKRRGYLFSVTFGFTQGILCFAYAA----VFRLGGFLVAQGELTFQDVYKVFGAIIFGALAVGQAMAMAPNYGRAKVSAARILALLRREMAIDS------YSEGGIQPDAFDGELQLSGVHFR-----YPTRPHAEVLRGVSLRVAPGQTLALVGPSGSGKSTIMQLLLRFYDSSAGQLLLNGVEVRQLNLGWLRR-QLGVVSQEPVLFGCSIAENIAYGDVSRAVSRDEVVAAARAANLHDFVESLPQAYDTVVGERGAQ-LSGGQKQRVAIARALLRDPRVLLLDEATSALDAESEKVVQDALEKAQQGRTCIVIAHRLSTVRAADVIAVLQDGDICELGSHEELLSARGLYYRLVE 480          
BLAST of ATP-binding cassette subfamily B member 8 vs. Ensembl Sea Lamprey
Match: abcb11b (ATP-binding cassette, sub-family B (MDR/TAP), member 11b [Source:ZFIN;Acc:ZDB-GENE-050517-14])

HSP 1 Score: 223.016 bits (567), Expect = 9.029e-62
Identity = 178/517 (34.43%), Postives = 266/517 (51.45%), Query Frame = 1
Query:  499 LLSIIGERLAVKMKKKLFEKIIIQDSKFFDNMRS--GDLLNRITADVQDFKSSFKQCISQGLRGFITIIGSTISLVIVSKELTTIVIIAIPCLVLIGSIMGKILRALSREAQMQNSKAADVANESIINIRTVKSFAMEDMEIENFF----IEVNEAAKLHSVLGIGIGIFQGMSNFAINGIVLGVLFTGGFMMNNGNLT-P--GDLMSFLVASQTIQKSLSTLSTLFGHLVKANASGARITE-FLALNTCATSPXXXXXXXXXXXXXXXFDNVRKPESVEFRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYGN--ISXXXXXXXXXXXXXXXXXFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALMKIKGHYYELV 2013
            + S  GE L  ++++  F  ++ QD  +FD++++  G L  R+  D    +   K C        +    S+       +      I+ I            I      + + +N++A  V NESI+NIRTV     E   ++ +     +    A +  +V G      Q +  F            GGF++ +  L  P    + S LV S T   +L   S+      KA  S AR+ + F       +SP               +D  R    V F N +F YP+R D  VL   S+ +  G  +AL G SG GKST   L++RFY+P  G++LI+G + + + V  LRS  +G+VSQ+P LF  +I +NIRYG      T +E+I A+K AQ H+F++G  + Y+T VG++G + LS G++QR+AIARAI+++P IL+LDEATSALD++SE  VQ AL    +GRT ++IAHRLSTIQNAD+I V+  G + E G H  LM  +G YY+LV
Sbjct:  818 MFSKSGELLTRRLRRCGFTAMLRQDVGWFDDLKNSPGALTTRLATDASQVQG-VKICYVFEFHSRMFFSFSSSCCCCSHRWERQTFIMNI-----------YIRTPYGEDNRTRNARAHFV-NESIVNIRTVAGLGKERTFVKQYTDSLTVPHRAAIRKANVFGATFSFSQSVIFFT----YAASFRYGGFLVAHDGLKFPLVFRVFSALVFSGT---ALGRASSYAPDYAKAKISAARLFKLFDRTPAIDSSPDKGVS----------WDGFRG--DVTFTNCTFTYPSRPDTQVLNGLSVSVQPGQTLALVGTSGCGKSTSVQLLERFYDPDGGQVLIDGRDSRTVNVGFLRS-KIGIVSQEPVLFDCSIADNIRYGANFRELTWDEVINASKAAQLHDFVMGLPEKYETNVGDKGAQ-LSRGEKQRVAIARAIIRDPRILLLDEATSALDTESEQTVQSALDQARQGRTCIVIAHRLSTIQNADQIAVISQGLVIEKGTHNELMDAQGAYYKLV 1300          

HSP 2 Score: 222.631 bits (566), Expect = 1.239e-61
Identity = 190/552 (34.42%), Postives = 283/552 (51.27%), Query Frame = 1
Query:  448 LLICYAVQALSTTTYISLLSIIGERLAVKMKKKLFEKIIIQDSKFFDNMRSGDLLNRITADVQDFKSSFKQCISQGLRGFITIIGSTISLVIVSKELTTIVIIAIPCLVLIGSIMGKILRALSREAQMQNSKAADVANESIINIRTVKSFAMEDMEIENFFIEVNEAAKLHSVLGIGIGIFQGMSNFAIN-GIVLGVLFTGGFMMNNGNLTPGDLMSFLVASQTIQKSLSTLSTLFGHLVKANASGARITEFLALNTCATSPXXXXXXXXXXXXXXXFDNV-RKP----------------ESVEFRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYGNISXXXXXXXXXXXXXXXXXFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALMKIKGHYYELVK-KLEKDN*LGN 2046
            L IC+ V A +             R  +++++  F  I+  +  +FD    G+L  RI+ D+     +    +S  ++ F T +   +   +   +LT +++   P L L G++MG  +  ++       +KA  VA E + +IRTV +F  E  E   +   +  A K     G+ +G FQG   F I     L   +    ++     +PG L                L   FG LV A            +N    SP L+     R      F+ + R+P                  +EF N+ F+YPTR D T L +F+L +  G   A  G SGAGKST   LIQRFY+P  G++ ++G +I+ + +  +RS+ +GVV Q+P LFA TI ENIRYG  + T  E+ +AA++A A+ FI+     +DT+VGE GG+   G Q+QRIAIARA+++NP IL+LD+ATSALD++SE +VQ AL  V KG T + IAHRLSTI +AD IV  + G   E G HEALM  +G Y+ LV  + + D+ LG+
Sbjct:  161 LQICFWVMAAA-------------RQVLRIRQAFFHNIMRMEIGWFDMNSVGELNTRISDDINKINDAIADKMSIFIQRFTTFVCGFLIGFLNGWKLTLVILAVSPLLGLGGALMGSFVARMTGRELKAYAKAGAVAEEVLSSIRTVAAFGGEKKEENRYDKNLVMAQKWGIRKGMILGFFQGYMWFIIFLCYALAFWYGSNLVLEEEEYSPGTL----------------LQVFFGVLVGA------------INLGQASPCLEAFASGRGAATHVFNIIDREPIIDCMSDDGNILQKVKGDIEFHNVKFSYPTRLDLTALHSFNLKVNAGETTAFVGPSGAGKSTAMQLIQRFYDPQEGKVTLDGHDIRSLNLRWMRSL-IGVVEQEPILFATTIAENIRYGRDNVTVSEVEQAARRANAYNFIMELPHKFDTMVGEGGGQMSGG-QKQRIAIARALVRNPRILLLDQATSALDNESEAVVQSALDKVRKGCTTISIAHRLSTIHSADVIVGFELGCAVERGSHEALMARQGVYFTLVTLQSQSDHMLGS 669          
BLAST of ATP-binding cassette subfamily B member 8 vs. Ensembl Yeast
Match: MDL1 (Mitochondrial inner membrane half-type ABC transporter; mediates export of peptides generated upon proteolysis of mitochondrial proteins; plays a role in the regulation of cellular resistance to oxidative stress [Source:SGD;Acc:S000004178])

HSP 1 Score: 262.692 bits (670), Expect = 2.652e-78
Identity = 176/520 (33.85%), Postives = 278/520 (53.46%), Query Frame = 1
Query:  460 YAVQALSTTTYISLLSIIGERLAVKMKKKLFEKIIIQDSKFFDNMRSGDLLNRITADVQDFKSSFKQCISQGLRGFITIIGSTISLVIVSKELTTIVIIAIPCLVLIGSIMGKILRALSREAQMQNSKAADVANESIINIRTVKSFAMEDMEIENFFIEVNEAAKLHSVLGIGIGIFQGMSNFAINGIVLGVLFTGGFMMNNGNLTPGDLMSFLVASQTIQKSLSTLSTLFGHLVKANASGARITEF-----LALNTCATSPXXXXXXXXXXXXXXXFDNVRKPESVEFRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRY---GNISXXXXXXXXXXXXXXXXXFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRAL-KNVMKGRTVVIIAHRLSTIQNADKIVVL-KHGKIFEMGPHEALMKI 1989
            + + A++  + I +L + GERL  +++ +  +  + QD+ F D  R GDL++R+++D      S  Q +S G R  I        +  +S +LT +++I  P L  +  I G+ +R LSR+ Q        VA E +   RT++++  E  E+  +  EV     +     +  G+F G +    N  +L +L  G  M+ +G++T G+L SF++ +     SL  LS+ +  L+K   + AR+ E      L   T    P                   +KP  + F+N+SF YPTR    + ++ ++ I  G  V   G SG+GKSTIASL+ R+Y+  SG I     +I+   +   R + +G V Q+P LF  TI +NI Y     I+  ++ I  A  +A   +F+  F DG  T+VG RG + LSGGQ+QRIA+ARA L +P +LILDEATSALDS+SE +V + L + V +G T + IAHRLSTI+++ +++VL KHG + E G    L+ I
Sbjct:  163 FIIGAVANASRIIILKVTGERLVARLRTRTMKAALDQDATFLDTNRVGDLISRLSSDASIVAKSVTQNVSDGTRAIIQGFVGFGMMSFLSWKLTCVMMILAPPLGAMALIYGRKIRNLSRQLQTSVGGLTKVAEEQLNATRTIQAYGGEKNEVRRYAKEVRNVFHIGLKEAVTSGLFFGSTGLVGNTAMLSLLLVGTSMIQSGSMTVGELSSFMMYAVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIRPTIGKDPVSL---------------AQKP--IVFKNVSFTYPTRPKHQIFKDLNITIKPGEHVCAVGPSGSGKSTIASLLLRYYDVNSGSIEFGDEDIRNFNLRKYRRL-IGYVQQEPLLFNGTILDNILYCIPPEIAEQDDRIRRAIGKANCTKFLANFPDGLQTMVGARGAQ-LSGGQKQRIALARAFLLDPAVLILDEATSALDSQSEEIVAKNLQRRVERGFTTISIAHRLSTIKHSTRVIVLGKHGSVVETGSFRDLIAI 663          
BLAST of ATP-binding cassette subfamily B member 8 vs. Ensembl Yeast
Match: MDL2 (Mitochondrial inner membrane half-type ABC transporter; required for respiratory growth at high temperature; localizes to vacuole membrane in response to H2O2; similar to human TAP1 and TAP2 implicated in bare lymphocyte syndrome and Wegener-like granulomatosis [Source:SGD;Acc:S000006191])

HSP 1 Score: 264.233 bits (674), Expect = 2.840e-78
Identity = 183/562 (32.56%), Postives = 304/562 (54.09%), Query Frame = 1
Query:  337 VNIQIPLKLGNVVNILSNIKEIKDNDF----VAAFKIPSLQLLICYAVQAL----STTTYISLLSIIGERLAVKMKKKLFEKIIIQDSKFFDNMRSGDLLNRITADVQDFKSSFKQCISQGLRGFITIIGSTISLVIVSKELTTIVIIAIPCLVLIGSIMGKILRALSREAQMQNSKAADVANESIINIRTVKSFAMEDMEIENFFIEVNEAAKLHSVLGIGIGIFQGMSNFAINGIVLGVLFTGGFMMNNGNLTPGDLMSFLVASQTIQKSLSTLSTLFGHLVKANASGARITEFLALNTCATSPXXXXXXXXXXXXXXXFDNVRKPES--VEFRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYG-NISXXXXXXXXXXXXXXXXXFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGR--TVVIIAHRLSTIQNADKIVVLKH-GKIFEMGPHEAL 1980
            + + IP  +G V++ L   K    +DF    +  F +P  + L  + V  L    +      LL I+ ER+  +++  + +K + QD++FFDN + GDL++R+ +D      S  Q +S G++  I  +     +  +S +L+ +++   P ++   S+ GK +R  S++ Q    +   VA E +  I+TV+SF  E  E+  + + + +  ++          F   ++   +   L VL  G +++    L+ GDL +F++ ++    ++  LST +  +++   + +R+ E L     + SP +               +  KP+   +EF+++SF+YPTR    + +N +  I  GS V + G SG GKSTIA L+ R+Y P +G I I+  +I ++    LR  ++G+V Q+P L + TIR+NI YG   + T+EEI   AKQ   H FI  F + YDT++G   G  LSGGQ+QRIAIARA++K P ILILDEATSALD +SE  +      +MK +  T+V IAHRLSTI+ ++ ++VL H G + EMG  + L
Sbjct:  132 IGMSIPKVIGIVLDTL---KTSSGSDFFDLKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRANVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGKTAAFTNAKFFTTTSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFE-LTDRKPSISPTV--------------GHKYKPDRGVIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRR-HIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPH-GTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKEL 673          
BLAST of ATP-binding cassette subfamily B member 8 vs. Ensembl Yeast
Match: ATM1 (Mitochondrial inner membrane ATP-binding cassette (ABC) transporter; exports mitochondrially synthesized precursors of iron-sulfur (Fe/S) clusters to the cytosol; human homolog ABCB7 can complement yeast null mutant [Source:SGD;Acc:S000004916])

HSP 1 Score: 204.912 bits (520), Expect = 2.689e-57
Identity = 182/596 (30.54%), Postives = 287/596 (48.15%), Query Frame = 1
Query:  319 FVVAAVVNIQIPLKLGNVVNILSNIKEIKDNDFVAAFKIPSLQLLICYAVQALSTTTYISLLSIIGERLAVKMKKKLFEKIIIQDSKFFDNMRSGDLLNRITADVQDFKSSFKQCISQGLRGFI-TIIGSTISLVIVSKELT-----TIVIIAIPCLVL--IGSIMGKILRA-LSREAQMQNSKAADVANESIINIRTVKSFAMEDMEIENFFIEVNEAAKLHSVLGIGIGIFQGMSNFAINGIVLGVLFTGGFMMNNGNLTPGDL-------------MSFL-VASQTIQKSLSTLSTLFGHLVKANASGARITEFLALNTCATSPXXXXXXXXXXXXXXXFDNVRKPESVEFRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYGNISXXXXXXXXXXXXXXXXXFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALK-NVMKG-RTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALMKIKGHYYELVKKLEKD 2031
             + A ++N+Q+P      ++ ++    I  +D   A        ++CY V    +  +  L + +  ++A    +     + +Q  +    +  G  L+R T  +        + ISQ L   +  II  +  + +V   LT     +   I    ++L  I +I     R    R+A   ++KAA VA +S+IN   VK F  E    + +   +         +   +       N      +  +++ G   +  GNLT GDL             ++FL    + +++SL  + TLF    K   +  +I         A  P +              +NV  P  + F N++F Y    D+ +L+N S  IP G   A+ G SG+GKSTI  L+ RFY+P SG ILING +I+E  +  LR V +GVV Q   LF  TI EN+++G I AT+EE+I   ++AQ    I     G+DT+VGER G  +SGG++QR+AIAR +LKN  I+  DEATSALD+ +E  + R ++ N   G RT V IAHRL TI +ADKI+VL +G++ E G H  L+ + G  Y  +  +++D
Sbjct:  118 LISAKILNVQVPFFFKQTIDSMN----IAWDDPTVALPAAIGLTILCYGVARFGSVLFGELRNAVFAKVA----QNAIRTVSLQTFQHLMKLDLGWHLSRQTGGLTRAMDRGTKGISQVLTAMVFHIIPISFEISVVCGILTYQFGASFAAITFSTMLLYSIFTIKTTAWRTHFRRDANKADNKAASVALDSLINFEAVKYFNNEKYLADKYNGSLMNYRDSQIKVSQSLAFLNSGQNLIFTTALTAMMYMGCTGVIGGNLTVGDLVLINQLVFQLSVPLNFLGSVYRDLKQSLIDMETLF----KLRKNEVKIKN-------AERPLMLP------------ENV--PYDITFENVTFGY--HPDRKILKNASFTIPAGWKTAIVGSSGSGKSTILKLVFRFYDPESGRILINGRDIKEYDIDALRKV-IGVVPQDTPLFNDTIWENVKFGRIDATDEEVITVVEKAQLAPLIKKLPQGFDTIVGER-GLMISGGEKQRLAIARVLLKNARIMFFDEATSALDTHTEQALLRTIRDNFTSGSRTSVYIAHRLRTIADADKIIVLDNGRVREEGKHLELLAMPGSLYRELWTIQED 676          
BLAST of ATP-binding cassette subfamily B member 8 vs. Ensembl Yeast
Match: STE6 (Plasma membrane ATP-binding cassette (ABC) transporter; required for the export of a-factor, catalyzes ATP hydrolysis coupled to a-factor transport; contains 12 transmembrane domains and two ATP binding domains; expressed only in MATa cells; human homolog ABCB1 mediates multidrug resistance in many chemotherapy-resistant tumors by effluxing toxic compounds from the cell [Source:SGD;Acc:S000001692])

HSP 1 Score: 177.178 bits (448), Expect = 1.009e-46
Identity = 150/547 (27.42%), Postives = 257/547 (46.98%), Query Frame = 1
Query:  466 VQALSTTTYISLLSIIGERLAVKMKKKLFEKIIIQDS-KFFDNMRS--GDLLNRITADVQDFKSSFKQCISQGLRGFITIIGSTISLVIVSKELTTIVIIAIPCLVLIGSIMGKILRALSREAQMQNSKAADVANESIINIRTVKSFAMEDME----------IENFFIEVNEAAKLHSVLGIGIGIFQGMSNFAINGIVLGVLFTGGFMMNNGNLTPGDLMSFLVASQTIQKSLSTLSTLFGHLVKANASGARITEFLAL--NTCATSPXXXXXXXXXXXXXXXFDNVRKPESVEFRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYGNISXXXXXXXXX----------XXXXXXXXFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALMKIKGHYYELVKKLEKD 2031
            V  LS T+++     IGER   +++ ++ E  + +   +++DN     GD   +I   V++ +SS  +  +   +  + I     +    S  LT I++ + P +     +  +++   S +   + SKAA +   S+   + V+ +  + +E             FFI+    +        GI  F  ++ F     V G  F G  M+  G L   D+++   +   +    STL+     +V     G  + + + L  +    +P  + +  +  L     D       + F N+SF+YP+R  + VL+N SL    G    + G+SG+GKST+++L+ RFY+  +G I ING NIQ I    L   N+ VV Q+  LF  T+R+NI  G+  +                   + A    FI+   DG +TL+G  GG  LSGGQ+QR+AIARA +++  IL LDEA SALD     L+ +A+++  KG+T +I+ H LS I++ D + ++K G++ E G    L+      +     L+ D
Sbjct:   88 VMWLSLTSWMH----IGERQGFRIRSQILEAYLEEKPMEWYDNNEKLLGDF-TQINRCVEELRSSSAEASAITFQNLVAICALLGTSFYYSWSLTLIILCSSPIITFFAVVFSRMIHVYSEKENSETSKAAQLLTWSMNAAQLVRLYCTQRLERKKFKEIILNCNTFFIK----SCFFVAANAGILRFLTLTMF-----VQGFWF-GSAMIKKGKLNINDVITCFHSCIMLG---STLNNTLHQIVVLQKGGVAMEKIMTLLKDGSKRNPLNKTVAHQFPLDYATSD-------LTFANVSFSYPSRPSEAVLKNVSLNFSAGQFTFIVGKSGSGKSTLSNLLLRFYDGYNGSISINGHNIQTID-QKLLIENITVVEQRCTLFNDTLRKNILLGSTDSVRNADCSTNENRHLIKDACQMALLDRFILDLPDGLETLIGT-GGVTLSGGQQQRVAIARAFIRDTPILFLDEAVSALDIVHRNLLMKAIRHWRKGKTTIILTHELSQIESDDYLYLMKEGEVVESGTQSELLADPTTTFSTWYHLQND 607          

HSP 2 Score: 150.214 bits (378), Expect = 5.674e-38
Identity = 130/514 (25.29%), Postives = 246/514 (47.86%), Query Frame = 1
Query:  499 LLSIIGERLAVKMKKKLFEKIIIQDSKFF--DNMRSGDLLNRITADVQDFKSSFKQCISQGLRGFITIIGSTISLV---IVSKELTTIVIIAIPCLVLIGSIMGKILRALSREAQMQNSKAADVANESIINIRTVKSFAME---DMEIENFFIEVNEAAKLHSVLGIGIGIFQGMSNFAINGIVLGVLFTGGFMMNNGNLTPGDLMSFLVASQTIQKSLSTLSTLFGHLVKANASGARITEFLALNTCATSPXXXXXXXXXXXXXXXFDNVRKPESVEFRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYG-NISXXXXXXXXXXXXXXXXXFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALMKIKGHYYELV 2013
            LL    E   + ++ ++ EK+  ++  +F  +N ++ ++   +  D++D +S   + +S  +  F+T+  STI L+   +   +L+ + I   P +++  +I G IL+    + +   ++  +   + + NI+T+K    E    +   +  I++ + A   ++   G GI   M+N  +  I   + + G  ++     T  ++ +          S ++L +    + +   + + I   L      T     +  +   +    +    K   V  +N++FAYP+     V +N +  +  G  + + GESG GKST+  L+ + Y    G+I I+G ++ +  ++ LR   + VV Q+P LF  TIR+N+ YG      E E+ +A K    H+F++    G DT +       LSGGQ QR+ IARA+L+   ILILDE TSALDS S  ++   +K        ++I H    +++ + I VLK GK+ E G  + L   +G  +++V
Sbjct:  783 LLDCCSEYWVMDLRNEVMEKLTRKNMDWFSGENNKASEISALVLNDLRDLRSLVSEFLS-AMTSFVTV--STIGLIWALVSGWKLSLVCISMFPLIIIFSAIYGGILQKCETDYKTSVAQLENCLYQIVTNIKTIKCLQAEFHFQLTYHDLKIKMQQIASKRAI-ATGFGI--SMTNMIVMCIQAIIYYYGLKLVMIHEYTSKEMFTTFTLLLFTIMSCTSLVSQIPDISRGQRAASWIYRILD-EKHNTLEVENNNARTVGIAGHTYHGKEKKPIVSIQNLTFAYPSAPTAFVYKNMNFDMFCGQTLGIIGESGTGKSTLVLLLTKLYNCEVGKIKIDGTDVNDWNLTSLRK-EISVVEQKPLLFNGTIRDNLTYGLQDEILEIEMYDALKYVGIHDFVISSPQGLDTRIDT---TLLSGGQAQRLCIARALLRKSKILILDECTSALDSVSSSIINEIVKKGPPALLTMVITHSEQMMRSCNSIAVLKDGKVVERGNFDTLYNNRGELFQIV 1285          
BLAST of ATP-binding cassette subfamily B member 8 vs. Ensembl Yeast
Match: YCF1 (Vacuolar glutathione S-conjugate transporter; ABC-C transporter of the ATP-binding cassette family; required for vacuole fusion; forms stable complexes with vacuole fusion machinery; regulates Vam7p recruitment to vacuoles; role in detoxifying metals (Cd, Hg, As); transports GSSG that is not immediately reduced in cytosol to vacuole; transports unconjugated bilirubin, selenodigluthatione, oxidized glutathione; similar to human cystic fibrosis protein CFTR [Source:SGD;Acc:S000002542])

HSP 1 Score: 140.198 bits (352), Expect = 9.377e-35
Identity = 134/498 (26.91%), Postives = 220/498 (44.18%), Query Frame = 1
Query:  580 FFDNMRSGDLLNRITADVQDFKSSFKQCISQGLRGFITIIGSTISLVIVSKELTTIVIIAIPCLVLIGSIMGKILRA---LSREAQMQNSKAADVANESIINIRTVKSFAME-----------DMEIENFFIEVNEAAKLHSVLGIGIGIFQGMSNFAINGIVLGVLFTGGFMMNNGNLTPGDLMSFLVASQTIQKSLSTLSTLFGHLVKANASGARITEFLALNTCATSPXXXXXXXXXXXXXXXFDNVRKPE------SVEFRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYGNISXXXXXXXXXXXXXXXXXFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEM-GPHEALMKIKGHYYEL 2010
            FF+    G +LNR + D+    +   +  SQ    F+  +  T ++ ++       + I IP  V         LR    L R   +  S       E++  + TV+ ++ +           D  +  F+  +N    L   L + IG          + I+LG      F +  G LT G +   L  +  I ++L+ +  +   +     S  RI E+  L + A                   +  R P+       ++F N S  Y    D  VL++ +++I     V + G +GAGKS++   + R  E   G I+I+ + I EI + DLR   + ++ Q  Q+F  T+RENI   N    E               +    DG D  + E GG  LS GQRQ + +ARA+L    IL+LDEAT+A+D +++ +VQ  ++   K RT++ IAHRL+TI ++D+I+VL +GK+ E   P + L   K  +Y L
Sbjct: 1040 FFETTPIGRILNRFSNDIYKVDALLGRTFSQF---FVNAVKVTFTITVICATTWQFIFIIIPLSVFYIYYQQYYLRTSRELRRLDSITRSPIYSHFQETLGGLATVRGYSQQKRFSHINQCRIDNNMSAFYPSINANRWLAYRLEL-IG----------SIIILGAATLSVFRLKQGTLTAGMVGLSLSYALQITQTLNWIVRMTVEVETNIVSVERIKEYADLKSEAP---------------LIVEGHRPPKEWPSQGDIKFNNYSTRYRPELD-LVLKHINIHIKPNEKVGIVGRTGAGKSSLTLALFRMIEASEGNIVIDNIAINEIGLYDLRH-KLSIIPQDSQVFEGTVRENIDPINQYTDEAIWRALELSHLKEHVLSMSNDGLDAQLTEGGGN-LSVGQRQLLCLARAMLVPSKILVLDEATAAVDVETDKVVQETIRTAFKDRTILTIAHRLNTIMDSDRIIVLDNGKVAEFDSPGQLLSDNKSLFYSL 1505          

HSP 2 Score: 79.7221 bits (195), Expect = 1.032e-15
Identity = 103/485 (21.24%), Postives = 208/485 (42.89%), Query Frame = 1
Query:  598 SGDLLNRITADVQDFKSSFKQCISQGLRGFITIIGSTISLVIVSKELTTIVIIAIPCLVLIGSIMGKILRALSREAQMQNSKAADVANESIINIRTVKSFAMEDMEIENFFIEVNEAAKLHSVLGIGIGIFQGMSNFAIN---GIVLGVLFTGGFMMNNGNLTPGDLMSFLVASQTIQKSLSTLSTLFGHLVKANASGARITEFLALNTCATSPXXXXXXXXXXXXXXXFDNVRKPESVE----FRNI-----------SFAYPTRNDQTV-LENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYGNISXXXXXXXXXXXXXXXXXFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSK-SEVLVQRAL--KNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALMK 1986
            +GD++N ++ DVQ  +    Q ++    G   II    SL  +      + +I +  ++ + S + +I + L +       +   V +E + NI+++K +A E    E    EV    +L ++    +G +  +++F  N    +V    F       +  LT   +   L     +   L  +  +    ++A+ S  R+  F                          +   +P+SV+     +NI           +F +  + +  V L+N +    +G++  + G+ G+GK+ + S +      + G   ++G              +V  VSQ P +   T++ENI +G+    E         A   +  +   DG  TLVGE+G  +LSGGQ+ R+++ARA+    +  +LD+  +A+D   +  L++  L    ++  +T V+  +++S +  AD I +L +G+I + G ++ + K
Sbjct:  402 TGDIVNLMSVDVQKLQD-LTQWLNLIWSGPFQIIICLYSLYKLLGNSMWVGVIILVIMMPLNSFLMRIQKKLQKSQMKYKDERTRVISEILNNIKSLKLYAWEKPYREKL-EEVRNNKELKNL--TKLGCYMAVTSFQFNIVPFLVSCCTFAVFVYTEDRALTTDLVFPALTLFNLLSFPLMIIPMVLNSFIEASVSIGRLFTFFT------------------------NEELQPDSVQRLPKVKNIGDVAINIGDDATFLWQRKPEYKVALKNINFQAKKGNLTCIVGKVGSGKTALLSCMLGDLFRVKGFATVHG--------------SVAYVSQVPWIMNGTVKENILFGHRYDAEFYEKTIKACALTIDLAI-LMDGDKTLVGEKG-ISLSGGQKARLSLARAVYARADTYLLDDPLAAVDEHVARHLIEHVLGPNGLLHTKTKVLATNKVSALSIADSIALLDNGEITQQGTYDEITK 842          
BLAST of ATP-binding cassette subfamily B member 8 vs. Ensembl Nematostella
Match: EDO39130 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAY5])

HSP 1 Score: 332.798 bits (852), Expect = 3.382e-104
Identity = 207/582 (35.57%), Postives = 335/582 (57.56%), Query Frame = 1
Query:  319 FVVAAVVNIQIPLKLGNVVNILSNIKEIKDNDFVAAFKIPSLQLLIC------YAVQALSTTTYISLLSIIGERLAVKMKKKLFEKIIIQDSKFFDNMRSGDLLNRITADVQDFKSSFKQCISQGLRGFITIIGSTISLVIVSKELTTIVIIAIPCLVLIGSIMGKILRALSREAQMQNSKAADVANESIINIRTVKSFAMEDMEIENFFIEVNEAAKLHSVLGIGIGIFQGMSNFAINGIVLGVLFTGGFMMNNGNLTPGDLMSFLVASQTIQKSLSTLSTLFGHLVKANASGARITEFLALNTCATSPXXXXXXXXXXXXXXXFDNVRKP------ESVEFRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYGNISXXXXXXX--XXXXXXXXXXFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALM-KIKGHYYELVKK 2019
             +V++ V + +P  +G +++I+    E  +       ++ +L   IC      + +   +    + L+ + G+R+  ++++ LF  I+ Q++ FFD  ++G+L+NR++AD      +    +S GLR    +      +  VS +LT IV++ +P + +   + G+ LR++++  Q   + A  VA E I NI  V++F  E+ EI+++   V    +L     +   +F G +  + N IVL VL++GG MM +  ++ G+L SF++ +  +  S++ LS+ +  L+K   + +R+ + L+    A S                F    +P        ++F+N++F YP+R +  +  + SL +  GS+ A+ G SG+GKST+ +L+ R Y+P SG + + G +++ + +  LR   VG V Q P LF+ +I ENI YG  S+        +AA+QA A  FI  F +GYDT+VGER G+ LSGGQRQRIAIARAILKNP IL+LDEATSALDS+SE LVQ AL+ +MKGRTV+ IAHRLSTI+NAD IVVL  G I E G +  LM +  G + +LV++
Sbjct:  137 LLVSSTVTMAVPFSIGKIIDIIYTASEDPE-------RMMNLLKTICQVLCGVFLLGGAANFGRVYLIQVSGQRIVKQLRQNLFSSILRQETAFFDRTKTGELVNRLSADTILVGKAVTDNVSDGLRAVAQVTAGVSMMAYVSPKLTGIVLLIVPPVAVGAVVYGRFLRSITKRTQDSLADATQVAEERISNIHVVRAFGQENREIKSYTDRVEYVLQLAKREALARAVFFGFTGLSGNLIVLSVLYSGGMMMTSAQISVGELTSFMLYTGFVGVSIAGLSSFYSELMKGIGASSRVWQ-LSDRKPAMS----------------FTGGLQPSIDVLARGIQFKNVNFTYPSRPNARIFADLSLDMRAGSVTAVVGPSGSGKSTLGALLLRLYDPESGSVFVGGHDVKSLSLDWLRGA-VGAVHQDPILFSCSIAENIAYGAASSEVSMDAIKDAARQANAANFIESFPNGYDTIVGER-GQMLSGGQRQRIAIARAILKNPKILLLDEATSALDSESEHLVQEALERLMKGRTVITIAHRLSTIKNADNIVVLDGGSIVESGSYSQLMEEPDGLFRKLVER 692          
BLAST of ATP-binding cassette subfamily B member 8 vs. Ensembl Nematostella
Match: EDO45926 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRD5])

HSP 1 Score: 295.434 bits (755), Expect = 2.088e-91
Identity = 190/583 (32.59%), Postives = 321/583 (55.06%), Query Frame = 1
Query:  295 YCMLYFSYFVVAAVVNIQIPLKLGNVVNILSNIKEIKDNDFVAAFKIPSLQL-LICYAVQALSTTTYISLLSIIGERLAVKMKKKLFEKIIIQDSKFFDNMRSGDLLNRITADVQDFKSSFKQCISQGLRGFITIIGSTISLVIVSKELTTIVIIAIPCLVLIGSIMGKILRALSREAQMQNSKAADVANESIINIRTVKSFAMEDMEIENFFIEVNEAAKLHSVLGIGIGIFQGMSNFAINGIVLGVLFTGGFMMNNGNLTPGDLMSFLVASQTIQKSLSTLSTLFGHLVKANASGARITEFLA-----LNTCATSPXXXXXXXXXXXXXXXFDNVRKPESVEFRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYG--NISXXXXXXXXXXXXXXXXXFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALMKIKGHYYELVKK 2019
            Y  L F + V A    I IP   G V++ ++  K  K       F++  L + LIC   +A+      ++   +  R  +++   LF  I+ QD  FFD  ++G++++R+T+D           ++  LR      G  I +  +S +L+ + +I +P +  +  + G   + LS   Q   ++  +VA E + +++TV+SFA E  E+  +  + NE  KL     + IG + G +      + + +L+ GG ++  G LT G+L+SF++    +  +L  +  ++  L++A  +  ++ + +      LN     P   +                   ++EF+++SF+YPTR D  VL+N S  +  G +VAL G SG GKST  +L++  YEP  GE+LI+ V ++++    L +  V +V Q+P LFA++I++NI YG  +++   E +   ++ A AH F+ G   GYDT  GE+G + LSGGQ+QRIAIARA+++NP IL+LDEATSALD++SE LVQ A+   ++G TV+IIAHRLSTI+ AD I+V+  G++ E+G +  L+   G +  LV++
Sbjct:   12 YVALAFFFLVAACAAQIFIPYYTGLVIDGIAIEKNKKK------FEMAILTMGLICLG-EAICAGFRGAIFRYVASRFNIRINNLLFGSIVNQDISFFDKTKTGEIVSRLTSDTTKMSDQVSLNVNVFLRNVFKGAGVCIFMFKLSWQLSVVTMIGLPLIAFLSEVYGNYYKKLSTAVQDAIARTNEVAAEVVSSMKTVRSFANEQGELNRYKEKNNEVFKLQIKEAVVIGGYNGCTEIMFLAMEVIILYYGGHLVLEGYLTGGNLVSFILYQLELADALEEIGDVYTGLMEAVGAAEKVFKLIDREPAILNNGKVIPLSCEG------------------AIEFKDVSFSYPTRPDIPVLDNVSFMVEPGQVVALVGPSGGGKSTCINLLEHLYEPTGGEVLIDAVPVKDLDHYYLHN-KVSLVGQEPVLFARSIKKNIAYGVEDLADNPETVEHVSRLANAHSFVSGMPKGYDTETGEKGLQ-LSGGQKQRIAIARALIRNPKILLLDEATSALDAESEHLVQDAIYKNLQGHTVLIIAHRLSTIEKADLIIVIDKGQVAEIGTYSHLIAKDGLFNRLVQR 567          
BLAST of ATP-binding cassette subfamily B member 8 vs. Ensembl Nematostella
Match: EDO41930 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S348])

HSP 1 Score: 301.597 bits (771), Expect = 4.024e-91
Identity = 199/542 (36.72%), Postives = 319/542 (58.86%), Query Frame = 1
Query:  442 LQLLICYAVQALSTTTYISLLSIIGERLAVKMKKKLFEKIIIQDSKFFDNMRSGDLLNRITADVQDFKSSFKQCISQGLRGFITIIGSTISLVIVSKELTTIVIIAIPCLVLIGSIMGKILRALSREAQMQNSKAADVANESIINIRTVKSFAMEDMEIENFFIEVNEAAKLHSVLGIGIGIFQGMSNFAINGIVLGVLFTGGFMMNNGNLTPGDLMSFLVASQTIQKSLSTLSTLFGHLVKANASGARITEFLALNTCATSPXXXXXXXXXXXXXXXFDNVRKPESVEFRNISFAYPTRNDQTVL------------------ENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYGNISXXXXXXXXXXXXXXXXXFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALMKIKGHYYELV 2013
            L LL  Y   +++      L ++ G+RL  +++++LF  II Q+  FFD  R+G+L+NR+++D Q  +++    +S  LR  + IIGS + +  +S +LT ++I  IP + +     G+ ++ L ++ Q +   A+ VA ESI +IRTV+SF+ E   ++ +   ++E+  + + L I  G F G+        ++ VL+ GG ++N G +  G L +F + +  +  + + LS+L+G  ++A  +  R+ E +             + K ++       + ++P  + F ++ F+YP+R D  VL                  E  S  I  G  VAL G SG GKST+ SLI+RFY+P++G I I   +I  + ++  R   + +VSQ+P LFA TI  NI YG   A++EEI EAA+QA AH+FI  F+DGY T VGERG + LSGGQ+QR+AIARA+L +P IL+LDEATSALD++SE  V+ A+   M  RTV++IAHRLST+++A+ ++V+  GKI E G H++L+   G Y +LV
Sbjct:  266 LTLLGLYVGGSIAAMIRAWLFTLAGQRLVARIRRELFNAIIKQEVAFFDTNRTGELINRLSSDTQVIQNAVTVNVSMLLRYIVQIIGSLVFMFTLSAKLTGVLISVIPIVGVGAQKYGQFVQGLRKKFQDELGNASTVAEESIGSIRTVRSFSQEKKTMKLYAEAIHESYLVGARLAIASGAFSGVVMAVGQAAIVLVLWYGGKLVNEGEMNVGILTAFALYTVNVAMAFAFLSSLYGDFMQAVGASFRMFELM-----------DRVPKIKMEGGVILPSFKEP--IVFDDVRFSYPSREDTEVLKIEEAARQANAHDFITTFEALSFKINPGETVALVGPSGGGKSTVISLIERFYDPMTGNIRIGDTDISLLDLAWYRK-KIALVSQEPVLFATTIASNIAYGR-DASQEEIEEAARQANAHDFITTFEDGYKTQVGERGVK-LSGGQKQRVAIARALLMDPEILLLDEATSALDAESEHFVKEAIDRAMVNRTVLVIAHRLSTVRSANLVLVMDKGKIVERGNHDSLLAKGGVYRKLV 791          
BLAST of ATP-binding cassette subfamily B member 8 vs. Ensembl Nematostella
Match: EDO49737 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFK3])

HSP 1 Score: 278.485 bits (711), Expect = 6.481e-81
Identity = 183/513 (35.67%), Postives = 277/513 (54.00%), Query Frame = 1
Query:  520 RLAVKMKKKLFEKIIIQDSKFFDNMRSGDLLNRITADVQDFKSSFKQCISQGLRGFITIIGSTISLVIVSKELTTIVIIAIPCLVLIGSIMGKILRALSREAQMQNSKAADVANESIINIRTVKSFAMEDMEIENFFIEVNEAAKLHSVLGIGIGIFQGMSNFAINGIVLGVLFTGGFMMNNGNLTPGDLM----SFLVASQTIQKSLSTLSTLFGHLVKANASGARITEFLALNTCATSPXXXXXXXXXXXXXXXFDNVRKPESV----EFRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYGNISXXXXXXXXXXXXXXXXXFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALMKIKGHYYELVKKLEKDN 2034
            R A +++   F+ ++ QD  +FD   +G+L NR+T D+          +   ++   T +   I     S +LT +++   P +V+ G IMGK++   + +     +KA  +A E + +IRTV +F  E  E E +   + EA       G+  G+  G     + G      + G  ++ +  +  GDL+    S +V +  + ++   +  +      A A GA    +  ++     P                +   KP SV    +F +I F YP+R D  VL+   L I  G  VAL GESG GKST+  L+QRFY+P  G + ++G++I+ + +  LR  ++GVVSQ+P LFA T+ ENIRYG    T+ EI +A K A AH+FI     GY+T+VGERG + +SGGQ+QRIAIARA++KNP +LILDEATSALD++SE +VQ AL    +GRT ++IAHRLSTI+NA  I  ++ G + E G H  LM   G Y +L+    K N
Sbjct:   32 RQAKRIRCNFFKAVMRQDIGWFDTYDAGELNNRLTEDISKVVDGLGSKVGLVVQFTTTFLAGFIMGFAYSWKLTLVILALTPLMVIAGGIMGKVISVFTSKELEAYAKAGAIAEEVLSSIRTVAAFGGEKKECERYNSHLGEAQAFGVKKGLSTGLGFGFFQLIMFGSYSLAFWYGAVLVADKAINSGDLLVVFFSVMVGATQLGQAGPNIEAI------ATARGAAYELYSIIDR--QPPIDSSS-----------EEGLKPASVKGDIDFTDIHFQYPSRPDVKVLKGLHLTIRSGQTVALVGESGCGKSTLIKLVQRFYDPAEGTVCMDGIDIRSLNLKWLRQ-HIGVVSQEPILFATTVAENIRYGREGITQAEIEKATKMANAHDFIRNLPQGYNTVVGERGAQ-MSGGQKQRIAIARALVKNPTLLILDEATSALDTESEKIVQAALDKASEGRTTLVIAHRLSTIRNATVIAAIQDGVVVEKGSHNELMATDGLYRQLITLQGKHN 523          

HSP 2 Score: 253.447 bits (646), Expect = 4.574e-72
Identity = 183/591 (30.96%), Postives = 304/591 (51.44%), Query Frame = 1
Query:  322 VVAAVVNIQIPLK----LGNVVNILS--NIKEIKDNDFVAAFKIPSLQLLICYAVQALSTTTYISLLSIIGERLAVKMKKKLFEKIIIQDSKFFDN--MRSGDLLNRITADVQDFKSSFKQCISQGLRGFITIIGSTISLVIVSKELTTIVIIAIPCLVLIGSIMGKILRALSREAQMQNS--KAADVANESIINIRTVKSFAMEDMEIENFFIEVNEAAKLHSVLGIGIGIFQGMSNFAINGIVLGVLFT--------GGFMMNNGNLTPGDLMSF---LVASQTIQKSLSTLSTLFGHLVKANASGARITEFLALNTCATSPXXXXXXXXXXXXXXXFDNVRKPE----SVEFRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYGNISXXXXXXXXXXXXXXX--XXFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALMKIKGHYYELV 2013
            V++A++N  +P+     LG ++N+ +  N  E+K     A F   +L  L+       +      + +I GE L VK+++  F+ ++ Q+  FFD+    +G L   +     D K +    +     G  T++ S I       +L+ +V   IP +VL G++    ++A + +   ++   ++  +A E+  N+RT+ +   E    E++   ++   K        + + +   + A  G+   ++F         G +++  G +    +M     +V +  +   +S+LS  +    KA  +  +I + L       S                 +N  +P     +V+ R++ F YPTR +  VL   SL + +G  +AL G SG GKST  SL++RFY+P  GE+ I+  N++++ +  LRS  +G+VSQ+P LF  +I +NI YG+ S              A  H FI G   GYDT VG++G   +SGGQ+QRIAIARA+++NP IL+LDEATSALD++SE +VQ AL    +GRTV++IAHRLST++NAD I V+ HG++ E G H+ LM + G Y  LV
Sbjct:  554 VISALINGLLPMSFALLLGEILNVFTLVNTDEMKKE---ATFW--ALMFLVMGGASFFTQIFQNYMFAISGEALTVKIRRLSFKSLLRQEMAFFDDPFHTTGALTTALATHASDVKGAAGSRLGTLALGLSTVVASAIYAFYNGWKLSLVVCAFIPFIVLAGALH---MKAFTGDHGGKDDYIESGKIAVEAFENVRTIATLGREHTFFEHYSRSIDGPHK--------VAVRRAHLSGASYGLTEAIMFLCNAACFRFGAYLIVQGEMDMPRVMKVVMCIVIAGLVAGQISSLSPDY---QKARTAAGKIFKLLDRTPAIDSAS---------------ENGLQPAAVRGTVQVRSVRFKYPTRPNVKVLRGLSLEVNQGQTLALVGPSGCGKSTTVSLLERFYDPEDGEMAIDNANVRQLNLKWLRS-KIGIVSQEPVLFGYSIAQNIAYGDNSREVSMAEIETAAKAANIHNFICGLPKGYDTEVGDKG-TLISGGQKQRIAIARALIRNPPILLLDEATSALDTESEKVVQDALDAASEGRTVIMIAHRLSTVKNADVICVIDHGRVAEQGTHQELMAMNGIYTGLV 1108          
BLAST of ATP-binding cassette subfamily B member 8 vs. Ensembl Nematostella
Match: EDO48846 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHG7])

HSP 1 Score: 220.705 bits (561), Expect = 1.310e-61
Identity = 156/450 (34.67%), Postives = 234/450 (52.00%), Query Frame = 1
Query:  700 GSTISLVIVSKELTTIVIIAIPCLVLIGSIMGKILRALSREAQMQNS--KAADVANESIINIRTVKSFAMEDMEIENF---FIEVNEAAKLHSVL-GIGIGIFQGMSNFAINGIVLGVLFTGGFMMNNGNLTPGDLMSFLVASQTIQKSLSTLSTLFGHLVKANASGARITEFLALNTCATSPXXXXXXXXXXXXXXXFDNVRKPESVE----FRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYGNISXXXXXXXXXXXXXXX--XXFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALMKIKGHYYELV 2013
             S I   I   +LT  V+  +P L  IG  +   ++  + +   QN   ++  VA E+  N+RT+     E    E +    +  + AA + + L G G G+ + +  F            G  +M    +T  ++M  ++           L       +KA  +GARI + +       S                 D    P +V+     R++ F YP R D  VL   SL + +G  +AL G SG GKST  SL++RFY+P  G++ ++  +++++ +  LRS  +G+VSQ+P LF  +I +NI YG+ S              A  H+FI G   GY+T VG++G   LSGGQ+QRIAIARA++KNP IL+LDEATSALD++SE +VQ AL    +GRTV++IAHRLST++NAD I V+ HG++ E G H+ LM + G Y  LV
Sbjct:  414 ASAIYASINGWKLTLAVLAFVPFLA-IGRALE--IKGYTGDTGGQNDYIESGKVAVEAFENVRTIAILGREKTFFERYAQTLVRPHRAAVVRAHLFGAGYGVTEAIMYFCFAA----CFRYGAHLMVEKEMTMEEVMKVVMCIMIAGMVAGELFAFSPDYLKAKVAGARIFKLVDRIPVIDSAS---------------DEGLTPSTVQGTLQMRSLRFRYPARPDVKVLRGLSLEVKQGQTLALVGPSGCGKSTTVSLLERFYDPEEGKVAVDNRDVRQLNIKWLRS-KIGIVSQEPVLFGYSIAQNIAYGDNSREVSMKEIETAARAANIHDFISGLPKGYETEVGDKG-TLLSGGQKQRIAIARALVKNPPILLLDEATSALDTESEKVVQDALDAASEGRTVIMIAHRLSTVKNADVICVIDHGRVAEHGTHQELMAMNGIYTGLV 839          

HSP 2 Score: 188.734 bits (478), Expect = 1.506e-50
Identity = 105/195 (53.85%), Postives = 141/195 (72.31%), Query Frame = 1
Query: 1429 STIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYGNISXXXXXXXXXXXXXXXXXFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALMKIKGHYYELV 2013
            ST+  LIQRFY+P +G + ++G +I+ + +  LR   +GVVSQ+P LFA TI ENIRYG    T+ EI +AAK A AH+FI     GY+T+VGE+G + LSGGQ+QR+AIARA+++NP ILILDEATSALD++SE +VQ AL    +GRT ++IAHRLST++NAD I  + +G + E G H  LM   G Y +LV
Sbjct:    1 STVIKLIQRFYDPENGSVCLDGTDIRSLNLHWLRQ-RIGVVSQEPALFATTIAENIRYGQDGVTQAEIEQAAKMANAHDFITKLPKGYETVVGEQGSQ-LSGGQKQRVAIARALVRNPRILILDEATSALDTESERVVQAALDKAREGRTTLVIAHRLSTVRNADMIAAIHNGVVVETGSHAELMATDGVYRQLV 193          
BLAST of ATP-binding cassette subfamily B member 8 vs. Ensembl Medaka
Match: abcb8 (ATP binding cassette subfamily B member 8 [Source:NCBI gene;Acc:101174865])

HSP 1 Score: 524.628 bits (1350), Expect = 8.661e-178
Identity = 278/571 (48.69%), Postives = 405/571 (70.93%), Query Frame = 1
Query:  328 AAVVNIQIPLKLGNVVNILSNIKEIKDN--DFVAAFKIPSLQLLICYAVQALSTTTYISLLSIIGERLAVKMKKKLFEKIIIQDSKFFDNMRSGDLLNRITADVQDFKSSFKQCISQGLRGFITIIGSTISLVIVSKELTTIVIIAIPCLVLIGSIMGKILRALSREAQMQNSKAADVANESIINIRTVKSFAMEDMEIENFFIEVNEAAKLHSVLGIGIGIFQGMSNFAINGIVLGVLFTGGFMMNNGNLTPGDLMSFLVASQTIQKSLSTLSTLFGHLVKANASGARITEFLALNTCATSPXXXXXXXXXXXXXXXFDNVRKPES-----VEFRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYGNISXXXXXXXXXXXXXXXXXFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALMKIKGHYYELVKK 2019
            AA++NIQIPL LG++VN+++  + ++DN  +++   + P+L+LL  Y +Q L T+ YI LLS +GER+A  M+K LF  ++ QD  FFD  ++G L+NR+TAD+Q+FKSSFK  ISQGLR     +G  +SL ++S +LT + ++ +PCLV  G+++G  LR LSR AQ Q +KA  VA+E++ N+RTVK+FAME+ E++ +  EV+++ +++  LG GI IFQG+SN A+N IVLG +F GG +++N  L+PGDLMSFLVASQT+Q+SL+++S LFG +V+  +SGAR+ E+L+L                   +      R P       V+F NISF+YPTR    VL+ F+L +P    +A+ GESG GKST+A+L++RFY+P SG I+++G++I+ + +S LR   +G ++Q+P LF  +I ENIR+G   AT+ E+IEA+KQA A+ FI  F +G++TLVGERG   LSGGQ+QRIAIARA++KNP+IL+LDEATSALD++SE +VQ AL    +GRTV+IIAHRLSTIQ AD I V+ +G+I E G H  L+   G Y +L+++
Sbjct:  147 AAILNIQIPLMLGHLVNVVA--RHLRDNTGNYIGEMRGPALKLLGMYGIQGLLTSGYIILLSRVGERVAADMRKTLFASLLRQDVAFFDANKTGQLVNRLTADIQEFKSSFKLVISQGLRSVTQTVGCFVSLYVISPKLTGLTVVVLPCLVGAGALIGSFLRKLSRLAQEQVAKATGVADEALGNVRTVKAFAMEERELQLYAYEVDKSCEMNENLGNGIAIFQGLSNVALNCIVLGTIFAGGTLISNNELSPGDLMSFLVASQTVQRSLASISILFGQMVRGISSGARVFEYLSLQP----------------SIPLCGGGRIPHHSLMGRVDFMNISFSYPTRPGHEVLKKFNLMLPPSKTIAIVGESGGGKSTVAALLERFYDPSSGVIMLDGLDIRTLDLSWLRGQVIGFINQEPVLFGSSIMENIRFGKPEATDAEVIEASKQANAYGFITSFPEGFNTLVGERGA-TLSGGQKQRIAIARALIKNPSILVLDEATSALDAESERVVQEALDRATRGRTVLIIAHRLSTIQRADLICVMSNGRIVEAGTHLELLSKGGIYSDLIRR 698          
BLAST of ATP-binding cassette subfamily B member 8 vs. Ensembl Medaka
Match: abcb10 (ATP binding cassette subfamily B member 10 [Source:NCBI gene;Acc:101167109])

HSP 1 Score: 320.472 bits (820), Expect = 5.748e-99
Identity = 215/580 (37.07%), Postives = 339/580 (58.45%), Query Frame = 1
Query:  316 YFVVAAVVNIQIPLKLGNVVN-ILSNIKEIKDNDFVAAFKIPSLQLLICYAVQALSTTTYISLLSIIGERLAVKMKKKLFEKIIIQDSKFFDNMRSGDLLNRITADVQDFKSSFKQCISQGLRGFITIIGSTISLVIVSKELTTIVIIAIPCLVLIGSIMGKILRALSREAQMQNSKAADVANESIINIRTVKSFAMEDMEIENFFIEVN---EAAKLHSVLGIGIGIFQGMSNFAINGIVLGVLFTGGFMMNNGNLTPGDLMSFLVASQTIQKSLSTLSTLFGHLVKANASGARITEFLALNTCATSPXXXXXXXXXXXXXXXFDNVRKPE----SVEFRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYGNI---SXXXXXXXXXXXXXXXXXFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMG-PHEALMKIKGHYYELVKK 2019
            +  V++ V +  P  LG V++ I S   +I+     A+     + L   +     +    + L+ + G+++   ++  +F  I+ Q+  FFD  R+G+L+NR++AD      S    +S GLR     +     +  VS  L + V++ +P +  +  I G+ LR++S+  Q   ++A  +A E I N+RTV++F  E  E+  +  + +     AK  + +  G   F G++  + N ++L VL+ GG +M N ++T G+L SFL+ +  +  S++ LS+ +  L+K   +GAR+ E L        P     +           +V  PE     +EF N+SFAYPTR +  + +N +L +P G+I+A+ G SG+GKS++ SL+ R Y+P SG I I+G +I+++    LR+ ++G VSQ+P LF+ +IR+NI YG     + T E+I  AAK A A +F+  F  G+DT+VGE+ G  LSGGQ+QRIAIARA+LKNP IL+LDEATSALDS++E LVQ AL+ +M+GRTVVIIAHRLSTI+NAD + VL    I E G P E L   +G + +L++K
Sbjct:  144 FLTVSSTVTMSAPFFLGKVIDTIYSTGTDIET--MTASLTSLCIMLTGVFLCGGAANAARVYLMEVSGQQIIRNLRGSIFMSILRQEVAFFDKNRTGELINRLSADSAIVGRSITDNLSDGLRAVAQAVAGVSMMFYVSPSLASFVLLIVPPMAALAVIYGRYLRSISKRTQDALAQATQLAEERISNLRTVRAFGKELSEVNAYKQKADFVLSLAKKEAKMRAG---FFGVTGLSGNLMILSVLYKGGLLMANHHMTVGELSSFLMYTFWVGISIAGLSSFYSELMKGFGAGARLWELL-----ERKPEFPLDE----------GHVLPPEQLKGQLEFCNVSFAYPTRKEAQIFQNLNLLVPAGTIMAVVGPSGSGKSSLVSLLLRLYDPDSGLITIDGHDIRDLNPYWLRA-HIGTVSQEPVLFSCSIRDNIAYGATDPDAVTTEDIYRAAKVANAFDFVQRFPKGFDTVVGEK-GVLLSGGQKQRIAIARALLKNPKILLLDEATSALDSENESLVQEALERLMEGRTVVIIAHRLSTIKNADTVAVLDQRHIAECGNPTELLSNREGQFRKLMEK 701          
BLAST of ATP-binding cassette subfamily B member 8 vs. Ensembl Medaka
Match: abcb10 (ATP binding cassette subfamily B member 10 [Source:NCBI gene;Acc:101167109])

HSP 1 Score: 320.472 bits (820), Expect = 5.748e-99
Identity = 215/580 (37.07%), Postives = 339/580 (58.45%), Query Frame = 1
Query:  316 YFVVAAVVNIQIPLKLGNVVN-ILSNIKEIKDNDFVAAFKIPSLQLLICYAVQALSTTTYISLLSIIGERLAVKMKKKLFEKIIIQDSKFFDNMRSGDLLNRITADVQDFKSSFKQCISQGLRGFITIIGSTISLVIVSKELTTIVIIAIPCLVLIGSIMGKILRALSREAQMQNSKAADVANESIINIRTVKSFAMEDMEIENFFIEVN---EAAKLHSVLGIGIGIFQGMSNFAINGIVLGVLFTGGFMMNNGNLTPGDLMSFLVASQTIQKSLSTLSTLFGHLVKANASGARITEFLALNTCATSPXXXXXXXXXXXXXXXFDNVRKPE----SVEFRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYGNI---SXXXXXXXXXXXXXXXXXFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMG-PHEALMKIKGHYYELVKK 2019
            +  V++ V +  P  LG V++ I S   +I+     A+     + L   +     +    + L+ + G+++   ++  +F  I+ Q+  FFD  R+G+L+NR++AD      S    +S GLR     +     +  VS  L + V++ +P +  +  I G+ LR++S+  Q   ++A  +A E I N+RTV++F  E  E+  +  + +     AK  + +  G   F G++  + N ++L VL+ GG +M N ++T G+L SFL+ +  +  S++ LS+ +  L+K   +GAR+ E L        P     +           +V  PE     +EF N+SFAYPTR +  + +N +L +P G+I+A+ G SG+GKS++ SL+ R Y+P SG I I+G +I+++    LR+ ++G VSQ+P LF+ +IR+NI YG     + T E+I  AAK A A +F+  F  G+DT+VGE+ G  LSGGQ+QRIAIARA+LKNP IL+LDEATSALDS++E LVQ AL+ +M+GRTVVIIAHRLSTI+NAD + VL    I E G P E L   +G + +L++K
Sbjct:  144 FLTVSSTVTMSAPFFLGKVIDTIYSTGTDIET--MTASLTSLCIMLTGVFLCGGAANAARVYLMEVSGQQIIRNLRGSIFMSILRQEVAFFDKNRTGELINRLSADSAIVGRSITDNLSDGLRAVAQAVAGVSMMFYVSPSLASFVLLIVPPMAALAVIYGRYLRSISKRTQDALAQATQLAEERISNLRTVRAFGKELSEVNAYKQKADFVLSLAKKEAKMRAG---FFGVTGLSGNLMILSVLYKGGLLMANHHMTVGELSSFLMYTFWVGISIAGLSSFYSELMKGFGAGARLWELL-----ERKPEFPLDE----------GHVLPPEQLKGQLEFCNVSFAYPTRKEAQIFQNLNLLVPAGTIMAVVGPSGSGKSSLVSLLLRLYDPDSGLITIDGHDIRDLNPYWLRA-HIGTVSQEPVLFSCSIRDNIAYGATDPDAVTTEDIYRAAKVANAFDFVQRFPKGFDTVVGEK-GVLLSGGQKQRIAIARALLKNPKILLLDEATSALDSENESLVQEALERLMEGRTVVIIAHRLSTIKNADTVAVLDQRHIAECGNPTELLSNREGQFRKLMEK 701          
BLAST of ATP-binding cassette subfamily B member 8 vs. Ensembl Medaka
Match: abcb9 (ATP binding cassette subfamily B member 9 [Source:NCBI gene;Acc:101157664])

HSP 1 Score: 308.145 bits (788), Expect = 2.236e-93
Identity = 184/572 (32.17%), Postives = 324/572 (56.64%), Query Frame = 1
Query:  316 YFVVAAVVNIQIPLKLGNVVNILSNIKEIKDNDFVAAFKIPSLQLLICYAVQALSTTTYISLLSIIGERLAVKMKKKLFEKIIIQDSKFFDNMRSGDLLNRITADVQDFKSSFKQCISQGLRGFITIIGSTISLVIVSKELTTIVIIAIPCLVLIGSIMGKILRALSREAQMQNSKAADVANESIINIRTVKSFAMEDMEIENFFIEVNEAAKLHSVLGIGIGIFQGMSNFAINGIVLGVLFTGGFMMNNGNLTPGDLMSFLVASQTIQKSLSTLSTLFGHLVKANASGARITEFLALNTCATSPXXXXXXXXXXXXXXXFDNVRKPES----VEFRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYGNISXXXXXXXXXXXXXXXXXFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALMKIKGHYYELVKK 2019
            + +++A+    IP   G  ++       I  +  +  F  P + L     V +L+      + ++I  RL ++++  LF  ++ Q+  FFD   +GD+++R++AD         Q I+  LR  I  +G  I ++ +S +LT + I+  P + L+  + GK  + LS+E Q   ++A  +A E++  +RTV+SFA E  E +++  +++   +++    +    +   S  +   + + +L+ GG ++  G ++ G L+SF +    + + L  +++++  L++   +  ++ E+L  +     P                D    P++    VEF++I+FAYPTR +  +L+  S  +  G + AL G SG+GKS+  SL++ FY P  G++L++G  +     + L S  V +VSQ+P LFA+T++ENI YG      E +++AA +A AH+FI     GYDT VGE+G + LSGGQ+QR+AIARA+++NP +L+LDEATSALD++SE +VQ+AL N+M+  TV++IAHRLST++ AD I+V+  G + E G H  LM     Y ++V++
Sbjct:  216 FLLISALCEAFIPFFYGKAID------GIVVHQSMGYFAKPVITLAALALVSSLAIGIRGGVFTLIMARLNLRLRSHLFRTLMRQEIAFFDENHTGDIISRLSADTTQVSDLISQNINIFLRSGIKGVGFIIFMLGMSWKLTMVAIMGFPFIALVSKVYGKYYKKLSKEVQTTLAEANKIAEETMSAMRTVRSFANETGESDSYCSKLSAMFQINKKQALAYACYMWSSCISELALEVAILYYGGHLVIAGQISSGTLISFFIYMLELGECLGEIASVYTGLMQGVGAAEKVFEYL--DRKPKHPA---------------DGTEAPDTCTGLVEFKDITFAYPTRPETDILQGVSFALQPGEVTALVGPSGSGKSSCVSLLENFYLPQQGQVLLDGKPVNTFQHTYLHS-KVALVSQEPVLFARTVKENITYGLTGVPMEAVVQAAIKANAHDFITALPKGYDTSVGEKGTQ-LSGGQKQRVAIARALIRNPTVLLLDEATSALDAESEHMVQQALNNIMQDHTVLVIAHRLSTVEKADNIIVIDGGHVVEQGTHSHLMATSRLYSKMVQR 762          
BLAST of ATP-binding cassette subfamily B member 8 vs. Ensembl Medaka
Match: abcb4 (ATP binding cassette subfamily B member 1 [Source:NCBI gene;Acc:101171435])

HSP 1 Score: 282.722 bits (722), Expect = 1.321e-85
Identity = 193/520 (37.12%), Postives = 294/520 (56.54%), Query Frame = 1
Query:  493 ISLLSIIGERLAVKMKKKLFEKIIIQDSKFFDNMRSGDLLNRITADVQDFKSSFKQCIS---QGLRGFIT--IIGSTISLVIVSKELTTIVIIAIPCLVLIGSIMGKILRALSREAQMQNSKAADVANESIINIRTVKSFAMEDMEIENFFIEVNEAAKLHSVLGIGIGIFQGMSNFAINGIVLGVLFTGGFMMNNGNLTPGDLMSF----LVASQTIQKSLSTLSTLFGHLVKANASGARITEFLALNTCATSPXXXXXXXXXXXXXXXFDNVRKPE----SVEFRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYGNISXXXXXXXXXXXXXXXXXFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALMKIKGHYYELV 2013
            +SL +I   R   +++   F KI+ QD  +FD   +G+L  R+T DV   +      +    Q +  FIT  +IG T        +LT +++   P L + G++  K+L + + + Q   +KA  VA E + +IRTV +F+ ++ EIE +   + +A K+     I   I  G +   I        + G  ++ +G  T G +++     ++   T+ ++   + T       A+A GA    +   N     P +              ++  KP+     +EF NI F YP+R D  +LEN SL +  G  +AL G SG GKST   L+QRFY+P+ G + I+G +I+ + V  LR + +GVVSQ+P LFA TI ENIRYG    T+ EI +AAK+A A++FI+   + ++TLVG+RG + +SGGQ+QRIAIARA+++NP IL+LDEATSALD++SE +VQ AL  V  GRT +I+AHRLSTI+NAD I   ++GK+ E+G H  LM+ +G Y  LV
Sbjct:  113 VSLWTIAAGRQVKRIRTLFFHKIMQQDIGWFDINETGELNTRLTDDVYKIQEGIGDKVGMLIQSVSSFITAFVIGFTKGW-----KLTLVILAVSPALGISGALFSKVLTSFTSKEQSAYAKAGAVAEEVLSSIRTVFAFSGQNKEIERYHKNLQQAKKMGMKKAISANIAMGFTFLMIYFSYALAFWYGSTLILSGEYTIGSVLTVFFVVIIGVFTMGQTSPNIQTF------ASARGAAHKVY---NIIDKEPIIDSYS----------EDGFKPDFIKGDIEFSNIHFTYPSRPDVKILENMSLSVKSGQTMALVGSSGCGKSTTIQLLQRFYDPVEGNVSIDGHDIRSLNVRYLREM-IGVVSQEPILFATTISENIRYGRPDVTQPEIEQAAKEANAYDFIMNLPNKFETLVGDRGTQ-MSGGQKQRIAIARALVRNPKILLLDEATSALDAESETIVQSALDKVRLGRTTLIVAHRLSTIRNADVIAGFQNGKVVEVGTHSELMEKQGVYRMLV 606          
BLAST of ATP-binding cassette subfamily B member 8 vs. Planmine SMEST
Match: SMESG000038762.1 (SMESG000038762.1)

HSP 1 Score: 1072 bits (2771), Expect = 0.000e+0
Identity = 571/571 (100.00%), Postives = 571/571 (100.00%), Query Frame = 1
Query:  322 VVAAVVNIQIPLKLGNVVNILSNIKEIKDNDFVAAFKIPSLQLLICYAVQALSTTTYISLLSIIGERLAVKMKKKLFEKIIIQDSKFFDNMRSGDLLNRITADVQDFKSSFKQCISQGLRGFITIIGSTISLVIVSKELTTIVIIAIPCLVLIGSIMGKILRALSREAQMQNSKAADVANESIINIRTVKSFAMEDMEIENFFIEVNEAAKLHSVLGIGIGIFQGMSNFAINGIVLGVLFTGGFMMNNGNLTPGDLMSFLVASQTIQKSLSTLSTLFGHLVKANASGARITEFLALNTCATSPXXXXXXXXXXXXXXXFDNVRKPESVEFRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYGNISXXXXXXXXXXXXXXXXXFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALMKIKGHYYELVKKLEKDN 2034
            VVAAVVNIQIPLKLGNVVNILSNIKEIKDNDFVAAFKIPSLQLLICYAVQALSTTTYISLLSIIGERLAVKMKKKLFEKIIIQDSKFFDNMRSGDLLNRITADVQDFKSSFKQCISQGLRGFITIIGSTISLVIVSKELTTIVIIAIPCLVLIGSIMGKILRALSREAQMQNSKAADVANESIINIRTVKSFAMEDMEIENFFIEVNEAAKLHSVLGIGIGIFQGMSNFAINGIVLGVLFTGGFMMNNGNLTPGDLMSFLVASQTIQKSLSTLSTLFGHLVKANASGARITEFLALNTCATSPRLQDLQKRRLLKLKDFDNVRKPESVEFRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYGNISATEEEIIEAAKQAQAHEFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALMKIKGHYYELVKKLEKDN
Sbjct:  105 VVAAVVNIQIPLKLGNVVNILSNIKEIKDNDFVAAFKIPSLQLLICYAVQALSTTTYISLLSIIGERLAVKMKKKLFEKIIIQDSKFFDNMRSGDLLNRITADVQDFKSSFKQCISQGLRGFITIIGSTISLVIVSKELTTIVIIAIPCLVLIGSIMGKILRALSREAQMQNSKAADVANESIINIRTVKSFAMEDMEIENFFIEVNEAAKLHSVLGIGIGIFQGMSNFAINGIVLGVLFTGGFMMNNGNLTPGDLMSFLVASQTIQKSLSTLSTLFGHLVKANASGARITEFLALNTCATSPRLQDLQKRRLLKLKDFDNVRKPESVEFRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYGNISATEEEIIEAAKQAQAHEFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALMKIKGHYYELVKKLEKDN 675          

HSP 2 Score: 168.703 bits (426), Expect = 5.381e-44
Identity = 97/97 (100.00%), Postives = 97/97 (100.00%), Query Frame = 2
Query:   17 MHVLSRMLLKSQNFVKYFINCSVKIKNRRYVIIKNSFAIVGCSYFGYYICSNLFNKSLIIGNCLSTXXXXXXXXXXXXXXXTYYEIWQPSYIDIVCF 307
            MHVLSRMLLKSQNFVKYFINCSVKIKNRRYVIIKNSFAIVGCSYFGYYICSNLFNKSLIIGNCLSTIENEIIIPENNQKNITYYEIWQPSYIDIVCF
Sbjct:    1 MHVLSRMLLKSQNFVKYFINCSVKIKNRRYVIIKNSFAIVGCSYFGYYICSNLFNKSLIIGNCLSTIENEIIIPENNQKNITYYEIWQPSYIDIVCF 97          
BLAST of ATP-binding cassette subfamily B member 8 vs. Planmine SMEST
Match: SMESG000038762.1 (SMESG000038762.1)

HSP 1 Score: 1071.61 bits (2770), Expect = 0.000e+0
Identity = 571/571 (100.00%), Postives = 571/571 (100.00%), Query Frame = 1
Query:  322 VVAAVVNIQIPLKLGNVVNILSNIKEIKDNDFVAAFKIPSLQLLICYAVQALSTTTYISLLSIIGERLAVKMKKKLFEKIIIQDSKFFDNMRSGDLLNRITADVQDFKSSFKQCISQGLRGFITIIGSTISLVIVSKELTTIVIIAIPCLVLIGSIMGKILRALSREAQMQNSKAADVANESIINIRTVKSFAMEDMEIENFFIEVNEAAKLHSVLGIGIGIFQGMSNFAINGIVLGVLFTGGFMMNNGNLTPGDLMSFLVASQTIQKSLSTLSTLFGHLVKANASGARITEFLALNTCATSPXXXXXXXXXXXXXXXFDNVRKPESVEFRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYGNISXXXXXXXXXXXXXXXXXFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALMKIKGHYYELVKKLEKDN 2034
            VVAAVVNIQIPLKLGNVVNILSNIKEIKDNDFVAAFKIPSLQLLICYAVQALSTTTYISLLSIIGERLAVKMKKKLFEKIIIQDSKFFDNMRSGDLLNRITADVQDFKSSFKQCISQGLRGFITIIGSTISLVIVSKELTTIVIIAIPCLVLIGSIMGKILRALSREAQMQNSKAADVANESIINIRTVKSFAMEDMEIENFFIEVNEAAKLHSVLGIGIGIFQGMSNFAINGIVLGVLFTGGFMMNNGNLTPGDLMSFLVASQTIQKSLSTLSTLFGHLVKANASGARITEFLALNTCATSPRLQDLQKRRLLKLKDFDNVRKPESVEFRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYGNISATEEEIIEAAKQAQAHEFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALMKIKGHYYELVKKLEKDN
Sbjct:   99 VVAAVVNIQIPLKLGNVVNILSNIKEIKDNDFVAAFKIPSLQLLICYAVQALSTTTYISLLSIIGERLAVKMKKKLFEKIIIQDSKFFDNMRSGDLLNRITADVQDFKSSFKQCISQGLRGFITIIGSTISLVIVSKELTTIVIIAIPCLVLIGSIMGKILRALSREAQMQNSKAADVANESIINIRTVKSFAMEDMEIENFFIEVNEAAKLHSVLGIGIGIFQGMSNFAINGIVLGVLFTGGFMMNNGNLTPGDLMSFLVASQTIQKSLSTLSTLFGHLVKANASGARITEFLALNTCATSPRLQDLQKRRLLKLKDFDNVRKPESVEFRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYGNISATEEEIIEAAKQAQAHEFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALMKIKGHYYELVKKLEKDN 669          

HSP 2 Score: 155.992 bits (393), Expect = 1.092e-39
Identity = 91/91 (100.00%), Postives = 91/91 (100.00%), Query Frame = 2
Query:   35 MLLKSQNFVKYFINCSVKIKNRRYVIIKNSFAIVGCSYFGYYICSNLFNKSLIIGNCLSTXXXXXXXXXXXXXXXTYYEIWQPSYIDIVCF 307
            MLLKSQNFVKYFINCSVKIKNRRYVIIKNSFAIVGCSYFGYYICSNLFNKSLIIGNCLSTIENEIIIPENNQKNITYYEIWQPSYIDIVCF
Sbjct:    1 MLLKSQNFVKYFINCSVKIKNRRYVIIKNSFAIVGCSYFGYYICSNLFNKSLIIGNCLSTIENEIIIPENNQKNITYYEIWQPSYIDIVCF 91          
BLAST of ATP-binding cassette subfamily B member 8 vs. Planmine SMEST
Match: SMESG000038762.1 (SMESG000038762.1)

HSP 1 Score: 596.275 bits (1536), Expect = 0.000e+0
Identity = 327/327 (100.00%), Postives = 327/327 (100.00%), Query Frame = 1
Query: 1054 MMNNGNLTPGDLMSFLVASQTIQKSLSTLSTLFGHLVKANASGARITEFLALNTCATSPXXXXXXXXXXXXXXXFDNVRKPESVEFRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYGNISXXXXXXXXXXXXXXXXXFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALMKIKGHYYELVKKLEKDN 2034
            MMNNGNLTPGDLMSFLVASQTIQKSLSTLSTLFGHLVKANASGARITEFLALNTCATSPRLQDLQKRRLLKLKDFDNVRKPESVEFRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYGNISATEEEIIEAAKQAQAHEFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALMKIKGHYYELVKKLEKDN
Sbjct:    1 MMNNGNLTPGDLMSFLVASQTIQKSLSTLSTLFGHLVKANASGARITEFLALNTCATSPRLQDLQKRRLLKLKDFDNVRKPESVEFRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYGNISATEEEIIEAAKQAQAHEFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALMKIKGHYYELVKKLEKDN 327          
BLAST of ATP-binding cassette subfamily B member 8 vs. Planmine SMEST
Match: SMESG000038762.1 (SMESG000038762.1)

HSP 1 Score: 593.964 bits (1530), Expect = 0.000e+0
Identity = 326/326 (100.00%), Postives = 326/326 (100.00%), Query Frame = 1
Query: 1057 MNNGNLTPGDLMSFLVASQTIQKSLSTLSTLFGHLVKANASGARITEFLALNTCATSPXXXXXXXXXXXXXXXFDNVRKPESVEFRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYGNISXXXXXXXXXXXXXXXXXFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALMKIKGHYYELVKKLEKDN 2034
            MNNGNLTPGDLMSFLVASQTIQKSLSTLSTLFGHLVKANASGARITEFLALNTCATSPRLQDLQKRRLLKLKDFDNVRKPESVEFRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYGNISATEEEIIEAAKQAQAHEFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALMKIKGHYYELVKKLEKDN
Sbjct:    1 MNNGNLTPGDLMSFLVASQTIQKSLSTLSTLFGHLVKANASGARITEFLALNTCATSPRLQDLQKRRLLKLKDFDNVRKPESVEFRNISFAYPTRNDQTVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVNIQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYGNISATEEEIIEAAKQAQAHEFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILDEATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGKIFEMGPHEALMKIKGHYYELVKKLEKDN 326          
BLAST of ATP-binding cassette subfamily B member 8 vs. Planmine SMEST
Match: SMESG000038762.1 (SMESG000038762.1)

HSP 1 Score: 458.759 bits (1179), Expect = 5.837e-172
Identity = 233/233 (100.00%), Postives = 233/233 (100.00%), Query Frame = 1
Query:  322 VVAAVVNIQIPLKLGNVVNILSNIKEIKDNDFVAAFKIPSLQLLICYAVQALSTTTYISLLSIIGERLAVKMKKKLFEKIIIQDSKFFDNMRSGDLLNRITADVQDFKSSFKQCISQGLRGFITIIGSTISLVIVSKELTTIVIIAIPCLVLIGSIMGKILRALSREAQMQNSKAADVANESIINIRTVKSFAMEDMEIENFFIEVNEAAKLHSVLGIGIGIFQGMSNFAING 1020
            VVAAVVNIQIPLKLGNVVNILSNIKEIKDNDFVAAFKIPSLQLLICYAVQALSTTTYISLLSIIGERLAVKMKKKLFEKIIIQDSKFFDNMRSGDLLNRITADVQDFKSSFKQCISQGLRGFITIIGSTISLVIVSKELTTIVIIAIPCLVLIGSIMGKILRALSREAQMQNSKAADVANESIINIRTVKSFAMEDMEIENFFIEVNEAAKLHSVLGIGIGIFQGMSNFAING
Sbjct:  105 VVAAVVNIQIPLKLGNVVNILSNIKEIKDNDFVAAFKIPSLQLLICYAVQALSTTTYISLLSIIGERLAVKMKKKLFEKIIIQDSKFFDNMRSGDLLNRITADVQDFKSSFKQCISQGLRGFITIIGSTISLVIVSKELTTIVIIAIPCLVLIGSIMGKILRALSREAQMQNSKAADVANESIINIRTVKSFAMEDMEIENFFIEVNEAAKLHSVLGIGIGIFQGMSNFAING 337          

HSP 2 Score: 166.392 bits (420), Expect = 5.837e-172
Identity = 97/97 (100.00%), Postives = 97/97 (100.00%), Query Frame = 2
Query:   17 MHVLSRMLLKSQNFVKYFINCSVKIKNRRYVIIKNSFAIVGCSYFGYYICSNLFNKSLIIGNCLSTXXXXXXXXXXXXXXXTYYEIWQPSYIDIVCF 307
            MHVLSRMLLKSQNFVKYFINCSVKIKNRRYVIIKNSFAIVGCSYFGYYICSNLFNKSLIIGNCLSTIENEIIIPENNQKNITYYEIWQPSYIDIVCF
Sbjct:    1 MHVLSRMLLKSQNFVKYFINCSVKIKNRRYVIIKNSFAIVGCSYFGYYICSNLFNKSLIIGNCLSTIENEIIIPENNQKNITYYEIWQPSYIDIVCF 97          
The following BLAST results are available for this feature:
BLAST of ATP-binding cassette subfamily B member 8 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ABCB83.560e-16947.18ATP binding cassette subfamily B member 8 [Source:... [more]
ABCB81.219e-16546.99ATP binding cassette subfamily B member 8 [Source:... [more]
ABCB81.259e-16546.99ATP binding cassette subfamily B member 8 [Source:... [more]
ABCB85.951e-14944.68ATP binding cassette subfamily B member 8 [Source:... [more]
ABCB102.786e-10838.05ATP binding cassette subfamily B member 10 [Source... [more]
back to top
BLAST of ATP-binding cassette subfamily B member 8 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
haf-63.480e-17247.27HAlF transporter (PGP related) [Source:UniProtKB/... [more]
haf-68.076e-16448.86HAlF transporter (PGP related) [Source:UniProtKB/... [more]
haf-91.843e-9036.71HAlF transporter (PGP related) [Source:UniProtKB/... [more]
haf-91.843e-9036.71HAlF transporter (PGP related) [Source:UniProtKB/... [more]
haf-72.008e-8735.11HAlF transporter (PGP related) [Source:UniProtKB/... [more]
back to top
BLAST of ATP-binding cassette subfamily B member 8 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG18247.540e-17147.92gene:FBgn0030403 transcript:FBtr0073658[more]
CG31568.639e-9534.91gene:FBgn0023536 transcript:FBtr0070079[more]
Mdr501.989e-7436.44gene:FBgn0010241 transcript:FBtr0087537[more]
CG102261.271e-7132.90gene:FBgn0035695 transcript:FBtr0332068[more]
CG102261.487e-7132.90gene:FBgn0035695 transcript:FBtr0077012[more]
back to top
BLAST of ATP-binding cassette subfamily B member 8 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abcb86.126e-18049.47ATP-binding cassette, sub-family B (MDR/TAP), memb... [more]
abcb101.737e-10136.04ATP-binding cassette, sub-family B (MDR/TAP), memb... [more]
abcb103.671e-10036.04ATP-binding cassette, sub-family B (MDR/TAP), memb... [more]
abcb91.136e-9533.28ATP-binding cassette, sub-family B (MDR/TAP), memb... [more]
abcb91.136e-9533.28ATP-binding cassette, sub-family B (MDR/TAP), memb... [more]
back to top
BLAST of ATP-binding cassette subfamily B member 8 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gpc47.077e-8732.76glypican 4 [Source:Xenbase;Acc:XB-GENE-976427][more]
gpc41.009e-8633.20glypican 4 [Source:Xenbase;Acc:XB-GENE-976427][more]
gpc48.117e-8532.44glypican 4 [Source:Xenbase;Acc:XB-GENE-976427][more]
gpc46.304e-8233.40glypican 4 [Source:Xenbase;Acc:XB-GENE-976427][more]
ENSXETT00000050925.11.879e-7834.24transporter 1, ATP-binding cassette, sub-family B ... [more]
back to top
BLAST of ATP-binding cassette subfamily B member 8 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Abcb82.571e-16747.54ATP-binding cassette, sub-family B (MDR/TAP), memb... [more]
Abcb82.571e-16747.54ATP-binding cassette, sub-family B (MDR/TAP), memb... [more]
Abcb103.771e-11037.74ATP-binding cassette, sub-family B (MDR/TAP), memb... [more]
Abcb95.594e-8632.68ATP-binding cassette, sub-family B (MDR/TAP), memb... [more]
Abcb1a3.127e-7736.59ATP-binding cassette, sub-family B (MDR/TAP), memb... [more]
back to top
BLAST of ATP-binding cassette subfamily B member 8 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q56A55|MITOS_DANRE4.624e-17949.47Mitochondrial potassium channel ATP-binding subuni... [more]
sp|Q9CXJ4|MITOS_MOUSE1.799e-16647.54Mitochondrial potassium channel ATP-binding subuni... [more]
sp|Q5RKI8|MITOS_RAT2.862e-16547.18Mitochondrial potassium channel ATP-binding subuni... [more]
sp|Q9NUT2|MITOS_HUMAN6.046e-16546.99Mitochondrial potassium channel ATP-binding subuni... [more]
sp|Q5RFQ9|MITOS_PONAB1.130e-16446.99Mitochondrial potassium channel ATP-binding subuni... [more]
back to top
BLAST of ATP-binding cassette subfamily B member 8 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K1PYF90.000e+050.35ATP-binding cassette sub-family B member 8, mitoch... [more]
V4A1S90.000e+048.31Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
C3Z3870.000e+049.65Uncharacterized protein (Fragment) OS=Branchiostom... [more]
H9J3Q50.000e+049.91Uncharacterized protein OS=Bombyx mori OX=7091 PE=... [more]
A0A210Q3D95.543e-18049.91ATP-binding cassette sub-family B member 8, mitoch... [more]
back to top
BLAST of ATP-binding cassette subfamily B member 8 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abcb83.079e-17650.09ATP binding cassette subfamily B member 8 [Source:... [more]
abcb108.868e-10836.96ATP binding cassette subfamily B member 10 [Source... [more]
abcb107.046e-9835.58ATP binding cassette subfamily B member 10 [Source... [more]
tap2a2.905e-8833.05transporter associated with antigen processing, su... [more]
tap2a2.620e-8733.68transporter associated with antigen processing, su... [more]
back to top
BLAST of ATP-binding cassette subfamily B member 8 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abcb82.777e-17246.81ATP-binding cassette, sub-family B (MDR/TAP), memb... [more]
abcb103.571e-11437.80ATP-binding cassette, sub-family B (MDR/TAP), memb... [more]
abcb92.534e-8431.87ATP-binding cassette, sub-family B (MDR/TAP), memb... [more]
ENSPMAT00000001786.14.638e-7234.75pep scaffold:Pmarinus_7.0:GL477870:201625:214977:-... [more]
abcb11b9.029e-6234.43ATP-binding cassette, sub-family B (MDR/TAP), memb... [more]
back to top
BLAST of ATP-binding cassette subfamily B member 8 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
MDL12.652e-7833.85Mitochondrial inner membrane half-type ABC transpo... [more]
MDL22.840e-7832.56Mitochondrial inner membrane half-type ABC transpo... [more]
ATM12.689e-5730.54Mitochondrial inner membrane ATP-binding cassette ... [more]
STE61.009e-4627.42Plasma membrane ATP-binding cassette (ABC) transpo... [more]
YCF19.377e-3526.91Vacuolar glutathione S-conjugate transporter; ABC-... [more]
back to top
BLAST of ATP-binding cassette subfamily B member 8 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO391303.382e-10435.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO459262.088e-9132.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO419304.024e-9136.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO497376.481e-8135.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO488461.310e-6134.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ATP-binding cassette subfamily B member 8 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abcb88.661e-17848.69ATP binding cassette subfamily B member 8 [Source:... [more]
abcb105.748e-9937.07ATP binding cassette subfamily B member 10 [Source... [more]
abcb105.748e-9937.07ATP binding cassette subfamily B member 10 [Source... [more]
abcb92.236e-9332.17ATP binding cassette subfamily B member 9 [Source:... [more]
abcb41.321e-8537.12ATP binding cassette subfamily B member 1 [Source:... [more]
back to top
BLAST of ATP-binding cassette subfamily B member 8 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000038762.15.381e-44100.00SMESG000038762.1[more]
SMESG000038762.11.092e-39100.00SMESG000038762.1[more]
SMESG000038762.10.000e+0100.00SMESG000038762.1[more]
SMESG000038762.10.000e+0100.00SMESG000038762.1[more]
SMESG000038762.15.837e-172100.00SMESG000038762.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019132 ID=SMED30019132|Name=ATP-binding cassette subfamily B member 8|organism=Schmidtea mediterranea sexual|type=transcript|length=2088bp
AAATCGCATTTTCATAATGCATGTTTTAAGTCGCATGTTATTGAAATCCC
AAAATTTTGTCAAATATTTCATTAACTGTTCCGTAAAAATTAAAAACAGA
AGATACGTAATTATCAAAAACTCTTTTGCAATTGTTGGATGCAGTTATTT
CGGTTATTACATCTGTTCAAATTTATTTAATAAATCTTTAATAATTGGTA
ATTGTTTATCAACAATTGAAAATGAAATCATTATACCTGAAAACAACCAA
AAGAATATTACGTATTACGAAATTTGGCAGCCATCTTATATTGATATTGT
ATGCTTTATTTTAGCTATTTTGTTGTTGCAGCAGTTGTTAATATACAAAT
TCCGTTAAAACTTGGAAATGTTGTAAATATTTTGAGCAATATCAAAGAAA
TCAAGGATAATGATTTTGTAGCTGCATTTAAAATTCCTTCGTTGCAACTA
TTAATTTGTTATGCAGTGCAAGCATTGTCAACCACTACATACATTAGTTT
GTTGTCGATTATTGGGGAAAGACTTGCTGTCAAAATGAAAAAGAAATTAT
TTGAAAAAATCATAATTCAAGATTCAAAATTTTTCGATAATATGAGAAGT
GGTGACTTGTTGAATCGGATTACAGCTGACGTACAAGATTTTAAAAGTTC
TTTCAAACAATGCATATCTCAGGGACTAAGAGGATTTATAACTATTATTG
GCTCTACAATATCATTAGTAATAGTGTCCAAAGAACTAACTACAATTGTT
ATTATTGCAATTCCATGTCTTGTACTTATAGGTAGTATAATGGGCAAGAT
ATTACGTGCTCTAAGTCGCGAAGCACAAATGCAAAATTCTAAGGCTGCAG
ATGTTGCCAATGAAAGTATTATTAATATCAGAACAGTTAAAAGTTTTGCA
ATGGAAGATATGGAAATTGAAAATTTTTTCATTGAAGTAAATGAAGCTGC
AAAATTGCATTCAGTGCTTGGAATTGGCATAGGAATATTTCAAGGAATGT
CAAATTTCGCGATAAATGGAATTGTTCTTGGAGTCTTGTTTACCGGTGGC
TTTATGATGAATAATGGAAACTTGACTCCAGGAGATTTAATGTCTTTCCT
TGTGGCATCTCAAACTATTCAAAAATCCCTATCTACTTTGTCAACTCTGT
TTGGACACTTAGTCAAAGCTAACGCTTCAGGCGCCAGAATAACGGAGTTT
CTGGCTTTGAATACTTGTGCAACTTCTCCAAGACTTCAAGATTTACAAAA
GAGAAGACTTTTAAAATTAAAGGATTTTGATAATGTTAGAAAACCAGAAT
CTGTCGAATTTCGAAATATTTCATTTGCCTATCCTACAAGAAATGACCAA
ACAGTTTTAGAAAATTTTTCTCTGTATATTCCTGAAGGATCTATAGTTGC
TTTATGTGGGGAATCTGGTGCAGGTAAATCAACTATTGCAAGCTTGATCC
AACGATTTTACGAACCGATATCTGGAGAAATTTTAATAAATGGAGTTAAC
ATCCAAGAAATTCCAGTATCTGATCTTAGATCTGTAAATGTTGGAGTTGT
CAGCCAACAACCGCAACTGTTTGCAAAAACTATTCGAGAAAATATTCGTT
ACGGAAACATCAGTGCTACAGAAGAGGAGATTATTGAAGCAGCAAAACAG
GCACAAGCTCACGAATTTATTGTTGGTTTTCAAGATGGCTATGATACATT
AGTAGGTGAACGTGGTGGTGAGGCTCTTAGCGGAGGTCAAAGGCAAAGGA
TTGCTATTGCTCGAGCTATCTTAAAAAATCCAAACATTTTGATATTAGAT
GAAGCTACTAGCGCCTTAGATAGTAAATCTGAAGTTCTTGTACAGAGAGC
TTTAAAAAATGTCATGAAAGGTCGTACTGTTGTAATAATAGCTCATCGTT
TGAGCACTATTCAGAATGCAGACAAAATCGTGGTTTTGAAACATGGCAAA
ATTTTTGAAATGGGACCTCATGAAGCTTTGATGAAGATAAAAGGTCACTA
TTATGAATTGGTTAAAAAATTAGAAAAAGATAATTAGCTTGGAAATATTT
TTATATTTTTCGTTTTTTAATACATTTTATTGTTCTGC
back to top

protein sequence of SMED30019132-orf-1

>SMED30019132-orf-1 ID=SMED30019132-orf-1|Name=SMED30019132-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=579bp
MLYFSYFVVAAVVNIQIPLKLGNVVNILSNIKEIKDNDFVAAFKIPSLQL
LICYAVQALSTTTYISLLSIIGERLAVKMKKKLFEKIIIQDSKFFDNMRS
GDLLNRITADVQDFKSSFKQCISQGLRGFITIIGSTISLVIVSKELTTIV
IIAIPCLVLIGSIMGKILRALSREAQMQNSKAADVANESIINIRTVKSFA
MEDMEIENFFIEVNEAAKLHSVLGIGIGIFQGMSNFAINGIVLGVLFTGG
FMMNNGNLTPGDLMSFLVASQTIQKSLSTLSTLFGHLVKANASGARITEF
LALNTCATSPRLQDLQKRRLLKLKDFDNVRKPESVEFRNISFAYPTRNDQ
TVLENFSLYIPEGSIVALCGESGAGKSTIASLIQRFYEPISGEILINGVN
IQEIPVSDLRSVNVGVVSQQPQLFAKTIRENIRYGNISATEEEIIEAAKQ
AQAHEFIVGFQDGYDTLVGERGGEALSGGQRQRIAIARAILKNPNILILD
EATSALDSKSEVLVQRALKNVMKGRTVVIIAHRLSTIQNADKIVVLKHGK
IFEMGPHEALMKIKGHYYELVKKLEKDN*
back to top

protein sequence of SMED30019132-orf-2

>SMED30019132-orf-2 ID=SMED30019132-orf-2|Name=SMED30019132-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=119bp
NRIFIMHVLSRMLLKSQNFVKYFINCSVKIKNRRYVIIKNSFAIVGCSYF
GYYICSNLFNKSLIIGNCLSTIENEIIIPENNQKNITYYEIWQPSYIDIV
CFILAILLLQQLLIYKFR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0002056medial muscle cell
PLANA:0002109X1 cell
PLANA:0003001lateral region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR036640ABC1_TM_sf
IPR039421Type_I_exporter
IPR003593AAA+_ATPase
IPR011527ABC1_TM_dom
IPR003439ABC_transporter-like
IPR027417P-loop_NTPase
IPR017871ABC_transporter_CS
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0055085transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0005739mitochondrion
GO:0005743mitochondrial inner membrane
GO:0016020membrane
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0042626ATPase activity, coupled to transmembrane movement of substances
GO:0016887ATPase activity
GO:0000166nucleotide binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 168..188
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 328..578
e-value: 6.4E-95
score: 319.4
NoneNo IPR availablePANTHERPTHR24221:SF167ATP-BINDING CASSETTE SUB-FAMILY B MEMBER 8, MITOCHONDRIALcoord: 8..573
NoneNo IPR availableCDDcd03249ABC_MTABC3_MDL1_MDL2coord: 335..573
e-value: 1.33047E-132
score: 384.584
NoneNo IPR availableCDDcd18574ABC_6TM_ABCB8_likecoord: 8..297
e-value: 5.34373E-139
score: 403.079
NoneNo IPR availableTMHMMTMhelixcoord: 125..142
NoneNo IPR availableTMHMMTMhelixcoord: 146..168
NoneNo IPR availableTMHMMTMhelixcoord: 2..19
NoneNo IPR availableTMHMMTMhelixcoord: 50..72
NoneNo IPR availableTMHMMTMhelixcoord: 221..243
IPR003593AAA+ ATPase domainSMARTSM00382AAA_5coord: 362..550
e-value: 7.9E-18
score: 75.2
IPR036640ABC transporter type 1, transmembrane domain superfamilyGENE3DG3DSA:1.20.1560.10coord: 1..307
e-value: 1.2E-68
score: 233.9
IPR036640ABC transporter type 1, transmembrane domain superfamilySUPERFAMILYSSF90123ABC transporter transmembrane regioncoord: 4..301
IPR003439ABC transporter-likePFAMPF00005ABC_trancoord: 353..504
e-value: 9.7E-35
score: 120.1
IPR003439ABC transporter-likePROSITEPS50893ABC_TRANSPORTER_2coord: 335..573
score: 25.217
IPR011527ABC transporter type 1, transmembrane domainPFAMPF00664ABC_membranecoord: 3..276
e-value: 1.2E-47
score: 162.8
IPR011527ABC transporter type 1, transmembrane domainPROSITEPS50929ABC_TM1Fcoord: 1..289
score: 44.856
IPR039421Type I protein exporterPANTHERPTHR24221FAMILY NOT NAMEDcoord: 8..573
IPR017871ABC transporter, conserved sitePROSITEPS00211ABC_TRANSPORTER_1coord: 476..490
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 331..572