Junctophilin-1

Overview
NameJunctophilin-1
Smed IDSMED30019130
Length (bp)3385
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Junctophilin-1 (SMED30019130) t-SNE clustered cells

Violin plots show distribution of expression levels for Junctophilin-1 (SMED30019130) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Junctophilin-1 (SMED30019130) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Junctophilin-1 (SMED30019130) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019130

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 16

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30019130SMESG000001306.1 Contig4800newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30019130SMESG000001306.1 Contig4800uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30019130SMESG000030899.1 Contig4800newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30019130SMESG000030899.1 Contig4800uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
nervous systemSMED30019130SMESG000001306.1 dd_Smed_v4_4752_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30019130SMESG000001306.1 dd_Smed_v4_4752_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30019130SMESG000001306.1 dd_Smed_v4_4752_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30019130SMESG000001306.1 dd_Smed_v4_4752_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30019130SMESG000001306.1 dd_Smed_v4_4752_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019130SMESG000001306.1 Contig45430newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019130SMESG000001306.1 Contig45430uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019130SMESG000001306.1 Contig4800newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019130SMESG000001306.1 Contig4800uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019130SMESG000030899.1 Contig4800newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019130SMESG000030899.1 Contig4800uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Category 2 cellSMED30019130SMESG000001306.1 dd_Smed_v4_4752_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Junctophilin-1 vs. Ensembl Human
Match: JPH3 (junctophilin 3 [Source:HGNC Symbol;Acc:HGNC:14203])

HSP 1 Score: 321.627 bits (823), Expect = 4.544e-95
Identity = 198/427 (46.37%), Postives = 270/427 (63.23%), Query Frame = 2
Query:  482 GGRFDFDDGGSYVGEWCDGRAHGLGIATGPENQGEFSGEWVMGFESRGVYIWPSGNIYAGGWMKGKRHGEGVQMKGKWIYKGEFTTGFCGRYGVKESLSSASKFEGSWHLNLFDGFGVETNADGSTYSGAWSKGVRQGLGVRKSAAYSKAATHKDP--SSVRAATSQNSLLSANDSDRQAFVDDARRPIDHRSGFVLVTTNNNADINANKEKKPSFRKALFR--KLRKQKSTGDLRSARMG-GSLRSTLSSNSAASQATNHSLPDSLPIPSRE------SIDPNVIETYSGQWKEDKRAGYGVAERTDGAKYEGEWFNNKKDGYGVTHFPNGTKEEGRYKENVLVQTLHKRHKIFALRHSRLKDSXXXXXXXXXXXXXXXXXXXXXXXNQRAQTAKNSAETAEIKAKEAQKLSNHAREVAKEFAPDF 1729
            GGRF+FDDGGSY G W DG+AHG G+ TGP+ QGE++G W  GFE  GVY WPSGN Y G W +GKRHG G++ KGKW+YKGE+T GF GRYGV+E   + +K+EG+W   L DG+G ET +DG TY G W  G+RQG GVR+S  Y  AA  + P  +S+ +  S+++  +A   D    V  A  P   R GFVLV  +++++I  +K KK  FR++L    KLRK +S   L S R    S RS    ++ +S A++     SL     E       ID    ETY G+WK DKR+G+GV++R+DG KYEGEW +N++ GYG   FP+GTKEEG+YK+N+LV    KR  +  LR S++++ V+ AV+ A  AA  AK++A   A+ R   ++  AE A   A++AQ+ +  AR  AKEF+P F
Sbjct:    4 GGRFNFDDGGSYCGGWEDGKAHGHGVCTGPKGQGEYTGSWSHGFEVLGVYTWPSGNTYQGTWAQGKRHGIGLESKGKWVYKGEWTHGFKGRYGVRECAGNGAKYEGTWSNGLQDGYGTETYSDGGTYQGQWVGGMRQGYGVRQSVPYGMAAVIRSPLRTSINSLRSEHTNGTALHPDASPAV--AGSPAVSRGGFVLV-AHSDSEILKSK-KKGLFRRSLLSGLKLRKSESKSSLASQRSKQSSFRSEAGMSTVSSTASDIHSTISLGEAEAELAVIEDDIDATTTETYVGEWKNDKRSGFGVSQRSDGLKYEGEWASNRRHGYGCMTFPDGTKEEGKYKQNILVGG--KRKNLIPLRASKIREKVDRAVEAAERAATIAKQKAEIAAS-RTSHSRAKAEAALTAAQKAQEEARIARITAKEFSPSF 423          
BLAST of Junctophilin-1 vs. Ensembl Human
Match: JPH1 (junctophilin 1 [Source:HGNC Symbol;Acc:HGNC:14201])

HSP 1 Score: 312.383 bits (799), Expect = 1.281e-92
Identity = 189/440 (42.95%), Postives = 263/440 (59.77%), Query Frame = 2
Query:  476 IEGGRFDFDDGGSYVGEWCDGRAHGLGIATGPENQGEFSGEWVMGFESRGVYIWPSGNIYAGGWMKGKRHGEGVQMKGKWIYKGEFTTGFCGRYGVKESLSSASKFEGSWHLNLFDGFGVETNADGSTYSGAWSKGVRQGLGVRKSAAYSKAATHKDP-----SSVRAATSQNSLLSANDSDRQAFVDDARRPIDHRSGFVLVTTNNNADIN-ANKEKKPSFRKALF---RKLRKQKSTGDLRSARMGGSLRSTLS--SNSAASQATNHSLPDSLPIPSRESIDPNVIETYSGQWKEDKRAGYGVAERTDGAKYEGEWFNNKKDGYGVTHFPNGTKEEGRYKENVLVQTLHKRHKIFALRHSRLKDSXXXXXXXXXXXXXXXXXXXXXXXNQRAQTAKNSAETAEIKAKEAQKLSNHAREVAKEFAPDFIQLGVLWLKTR 1762
            + GGRFDFDDGG+Y G W +G+AHG GI TGP+ QGE+SG W  GFE  G Y WPSGN Y G W +GKRHG GV+ KGKW+Y+GE++ GF GRYGV++SL + +++EG+W   L DG+GVET  DG TY G W+ G+R G GVR+S  Y  A   + P     +S+R+  S  S+L    +   +       P   R GFVL   N +AD   A K+K   FR+       KLRK +S   + S R      + +S  S+S A+   +    D    P  + +D    ETY G+WK DKR G+GV+ER++G KYEGEW NNK+ GYG T FP+G+KEEG+YK N+LV+ +  R ++  +RH++ ++   +      + AA      +E AN R   A+  A+ A+  A  A++  + AR VA+E +PDF Q G  ++K R
Sbjct:    1 MTGGRFDFDDGGTYCGGWEEGKAHGHGICTGPKGQGEYSGSWSHGFEVVGGYTWPSGNTYQGYWAQGKRHGLGVETKGKWMYRGEWSHGFKGRYGVRQSLCTPARYEGTWSNGLQDGYGVETYGDGGTYQGQWAGGMRHGYGVRQSVPYGMATVIRSPLRTSLASLRSEQSNGSVLHDAAAAADS-------PAGTRGGFVL---NFHADAELAGKKKGGLFRRGSLLGSMKLRKSESKSSISSKRSSVRSDAAMSRISSSDANSTISFGDVDCDFCPVEDHVDATTTETYMGEWKNDKRNGFGVSERSNGMKYEGEWANNKRHGYGCTVFPDGSKEEGKYKNNILVRGI--RKQLIPIRHTKTRE-KVDRAIEGAQRAAAMARTKVEIANSRTAHARAKADAADQAALAARQECDIARAVARELSPDFYQPGPDYVKQR 427          
BLAST of Junctophilin-1 vs. Ensembl Human
Match: JPH2 (junctophilin 2 [Source:HGNC Symbol;Acc:HGNC:14202])

HSP 1 Score: 300.827 bits (769), Expect = 5.187e-88
Identity = 193/464 (41.59%), Postives = 267/464 (57.54%), Query Frame = 2
Query:  476 IEGGRFDFDDGGSYVGEWCDGRAHGLGIATGPENQGEFSGEWVMGFESRGVYIWPSGNIYAGGWMKGKRHGEGVQMKGKWIYKGEFTTGFCGRYGVKESLSSASKFEGSWHLNLFDGFGVETNADGSTYSGAWSKGVRQGLGVRKSAAYSKAATHKDP-----SSVRAATSQNSLLSANDSDRQAFVDDAR--RPIDHRSGFVLVTTNNNADINANKEKKPSF-RKALFRKLRKQKSTGDLRSARMGGS-LRSTLSSNSAASQATNHSL-----PDSLPIPSRESIDPNVIETYSGQWKEDKRAGYGVAERTDGAKYEGEWFNNKKDGYGVTHFPNGTKEEGRYKENVLVQTLHKRHKIFALRHSRLKDSXXXXXXXXXXXXXXXXXXXXXXXNQRAQTAKNSAETAEIKAKEAQKLSNHAREVAKEFAPDFIQLGVLWLKTRNNIEGKLTGSVVFNNNFSLLD 1825
            + GGRFDFDDGG+Y G W  G+AHG G+ TGP+ QGE+SG W  GFE  GVY WPSGN + G W +GKRHG G++ KG+W+YKGE+T GF GRYG+++S SS +K+EG+W+  L DG+G ET ADG TY G ++ G+R G GVR+S  Y  A   + P     SS+R+  S  ++  A DS      D      P   R GF L    N        +    F R AL  KLR+ +S   + S R   S L+S LSS  A+  A+  SL           P    ID    ETY G+WK DKR+G+GV+ER+ G +YEGEW +N + GYG T  P+G +EEG+Y+ NVLV+   +R  +  L+ ++++  VE +V+ A  AAA A+++A   A++ +     +    +      Q+ SN AR +A+E APDF Q G  + K R   E       +  N+ SLL+
Sbjct:    1 MSGGRFDFDDGGAYCGGWEGGKAHGHGLCTGPKGQGEYSGSWNFGFEVAGVYTWPSGNTFEGYWSQGKRHGLGIETKGRWLYKGEWTHGFKGRYGIRQSSSSGAKYEGTWNNGLQDGYGTETYADGGTYQGQFTNGMRHGYGVRQSVPYGMAVVVRSPLRTSLSSLRSEHSNGTV--APDSPASPASDGPALPSPAIPRGGFALSLLANAEAAARAPKGGGLFQRGALLGKLRRAESRTSVGSQRSRVSFLKSDLSSG-ASDAASTASLGEAAEGADEAAPFEADIDATTTETYMGEWKNDKRSGFGVSERSSGLRYEGEWLDNLRHGYGCTTLPDGHREEGKYRHNVLVKDTKRR--MLQLKSNKVRQKVEHSVEGAQRAAAIARQKAEIAASRTSHAKAKAEAAEQAALAANQE-SNIARTLARELAPDFYQPGPEYQKRRLLQE-------ILENSESLLE 451          
BLAST of Junctophilin-1 vs. Ensembl Human
Match: JPH4 (junctophilin 4 [Source:HGNC Symbol;Acc:HGNC:20156])

HSP 1 Score: 251.906 bits (642), Expect = 2.763e-71
Identity = 146/360 (40.56%), Postives = 202/360 (56.11%), Query Frame = 2
Query:  482 GGRFDFDDGGSYVGEWCDGRAHGLGIATGPENQGEFSGEWVMGFESRGVYIWPSGNIYAGGWMKGKRHGEGVQMKGKWIYKGEFTTGFCGRYGVKESLSSASKFEGSWHLNLFDGFGVETNADGSTYSGAWSKGVRQGLGVRKSAAYSKAATHKDPSSVRAATSQNSLLSANDSDRQAFVDDARRPID-HRSGFVLVTTNNNADINANKEKKPS----FRKA-LFRKLRKQKSTGDLRSARMGGSLRSTLSSNSAASQATNHSLPDSLPIPSRESIDPNVIETYSGQWKEDKRAGYGVAERTDGAKYEGEWFNNKKDGYGVTHFPNGTKEEGRYKENVLVQTLHKRHKI-FALRHSRLKD 1540
            GG+FDFDDGG YVG W  GRAHG G+ TGP  QGE+SG W  GFES GV+  P G+ Y G W +GKR G GV+ K +W Y+GE+  G  GR GV ES+S   ++ G W     DG+G ET +DG TY G W  G R G GVR+S  Y +AA  + P    +  S +S             D+   P    R GFVL     +AD  +++++ P+    FR++ L   LR       L S R  GSLRS +SS   ++                  I+ +  E Y+G+W+ D+R+G+GV++R++G +YEGEW  N++ GYG T  P+G++EEG+YK N LV     R  +  ALR  ++K+
Sbjct:    4 GGKFDFDDGGCYVGGWEAGRAHGYGVCTGPGAQGEYSGCWAHGFESLGVFTGPGGHSYQGHWQQGKREGLGVERKSRWTYRGEWLGGLKGRSGVWESVSGL-RYAGLWKDGFQDGYGTETYSDGGTYQGQWQAGKRHGYGVRQSVPYHQAALLRSPRRT-SLDSGHSDPPTPPPPLPLPGDEGGSPASGSRGGFVLAGP-GDADGASSRKRTPAAGGFFRRSLLLSGLRAGGRRSSLGSKR--GSLRSEVSSEVGSTGPPGSEASGPPAAAPPALIEGSATEVYAGEWRADRRSGFGVSQRSNGLRYEGEWLGNRRHGYGRTTRPDGSREEGKYKRNRLVHGGRVRSLLPLALRRGKVKE 358          
BLAST of Junctophilin-1 vs. Ensembl Human
Match: JPH4 (junctophilin 4 [Source:HGNC Symbol;Acc:HGNC:20156])

HSP 1 Score: 251.906 bits (642), Expect = 2.763e-71
Identity = 146/360 (40.56%), Postives = 202/360 (56.11%), Query Frame = 2
Query:  482 GGRFDFDDGGSYVGEWCDGRAHGLGIATGPENQGEFSGEWVMGFESRGVYIWPSGNIYAGGWMKGKRHGEGVQMKGKWIYKGEFTTGFCGRYGVKESLSSASKFEGSWHLNLFDGFGVETNADGSTYSGAWSKGVRQGLGVRKSAAYSKAATHKDPSSVRAATSQNSLLSANDSDRQAFVDDARRPID-HRSGFVLVTTNNNADINANKEKKPS----FRKA-LFRKLRKQKSTGDLRSARMGGSLRSTLSSNSAASQATNHSLPDSLPIPSRESIDPNVIETYSGQWKEDKRAGYGVAERTDGAKYEGEWFNNKKDGYGVTHFPNGTKEEGRYKENVLVQTLHKRHKI-FALRHSRLKD 1540
            GG+FDFDDGG YVG W  GRAHG G+ TGP  QGE+SG W  GFES GV+  P G+ Y G W +GKR G GV+ K +W Y+GE+  G  GR GV ES+S   ++ G W     DG+G ET +DG TY G W  G R G GVR+S  Y +AA  + P    +  S +S             D+   P    R GFVL     +AD  +++++ P+    FR++ L   LR       L S R  GSLRS +SS   ++                  I+ +  E Y+G+W+ D+R+G+GV++R++G +YEGEW  N++ GYG T  P+G++EEG+YK N LV     R  +  ALR  ++K+
Sbjct:    4 GGKFDFDDGGCYVGGWEAGRAHGYGVCTGPGAQGEYSGCWAHGFESLGVFTGPGGHSYQGHWQQGKREGLGVERKSRWTYRGEWLGGLKGRSGVWESVSGL-RYAGLWKDGFQDGYGTETYSDGGTYQGQWQAGKRHGYGVRQSVPYHQAALLRSPRRT-SLDSGHSDPPTPPPPLPLPGDEGGSPASGSRGGFVLAGP-GDADGASSRKRTPAAGGFFRRSLLLSGLRAGGRRSSLGSKR--GSLRSEVSSEVGSTGPPGSEASGPPAAAPPALIEGSATEVYAGEWRADRRSGFGVSQRSNGLRYEGEWLGNRRHGYGRTTRPDGSREEGKYKRNRLVHGGRVRSLLPLALRRGKVKE 358          
BLAST of Junctophilin-1 vs. Ensembl Celegans
Match: jph-1 (JunctoPHilin [Source:UniProtKB/TrEMBL;Acc:Q22667])

HSP 1 Score: 341.273 bits (874), Expect = 1.140e-102
Identity = 222/591 (37.56%), Postives = 322/591 (54.48%), Query Frame = 2
Query:  476 IEGGRFDFDDGGSYVGEWCDGRAHGLGIATGPENQGEFSGEWVMGFESRGVYIWPSGNIYAGGWMKGKRHGEGVQMKGKWIYKGEFTTGFCGRYGVKESLSSASKFEGSWHLNLFDGFGVETNADGSTYSGAWSKGVRQGLGVRKSAAYSKAATHKDPSSVRAATSQNSLLSANDSDRQAFVDDARRP-IDHRSGFVLVTTNN--NADINANKEKKPSFRKALFRKLR--KQKSTGDL--RSARMGGSLRSTLSSNSAASQATNHSLPDSLPIPSRESIDPNVIETYSGQWKEDKRAGYGVAERTDGAKYEGEWFNNKKDGYGVTHFPNGTKEEGRYKENVLVQTLHKRHKIFALRHSRLKDSXXXXXXXXXXXXXXXXXXXXXXXNQRAQTAKNSAETAEIKAKEAQKLSNHAREVAKEFAPDFIQLGVLWLKTRNNIEGKLTGSVVFNNNFS-LLDNQKYLNQNYKPQQM--DQLQPNLLNPSDPECLEVXXXXXXXXXXXXXXXXXEKRPNSPDPQNQKQTSSSKPLSGHNPNSNMTPQKPVASPTNVDCYSFEVPKIGHSVSEVAQQTPTTLLTSEPLIQRATATLT 2218
            + GGRFDFDDGG+YVG W +G+AHG G+ TGP+ +GE++G W  GFE  GVY WPSGN Y G W  GKRHG G++ +G+W+YKGE+T G+ GRYGV++S +S ++++G+W     DG+G E   D  +Y G W +G+R G G+RKS  Y KAA  +  S   A  S  SL S    +  A  +   +  +  R GFVL   ++       +  E+  + ++ L   LR  KQ STGD+  R A M GSLRS+ S+ S  S+ + H     L  P  E+++ + IETY G+WK D R+G+GV ER+DG KY+GEW NN K GYGVT F +GTKEEGRYK N+L+ +  ++  IF +R S+ ++ +E+A+  A  AA+ A+++A   A+ R  TA+  +E A   A++A   S  AR  AK+F P F Q G   L   NN      G   F  + S  +   ++L+Q +  Q      L  ++     P            S  +      +   + P+ Q Q   +S   L  H P  N+ P  P  S    D    E P I    + ++Q  P+ L T  P +  +  +L+
Sbjct:    1 MNGGRFDFDDGGTYVGGWEEGKAHGHGVCTGPQAKGEYAGAWHYGFEVSGVYTWPSGNTYQGQWQNGKRHGLGIEQRGRWLYKGEWTQGYKGRYGVRQSANSQARYQGTWSAGFHDGYGTEIYVDSGSYQGQWLRGMRHGYGIRKSTTYEKAAKFRSKSQTHA--SLTSLRSGRVEEENAAEEHRHKEGLSGRGGFVLRANSSAPQRRRRSLSERSLAVKRTLLSGLRIKKQHSTGDIHQRVASMTGSLRSSGSTMSCTSEDSLHH--HGLQQPEEEAVEESSIETYMGEWKNDMRSGFGVCERSDGLKYQGEWANNAKCGYGVTTFKDGTKEEGRYKNNILIASSRRKGVIF-MRASKFREKLEQALGAASRAASIAQQKADIAAS-RTSTARERSEQASFIARQANDDSEVARIHAKQFDPSFKQPGTRRLLKDNN------GGESFGTDLSDAISYSRHLSQTHSKQHSFEQTLSVDMAEDMTPPSKAYHNHVMPNSNTNHVNFMPQYGYSDPNSQLQTPINSQDLLQPHIP--NIDPSIPSVSIVQDD----EKPLILQPQTNISQPGPSNLSTQAPNVMSSRFSLS 573          
BLAST of Junctophilin-1 vs. Ensembl Fly
Match: jp (gene:FBgn0032129 transcript:FBtr0079861)

HSP 1 Score: 319.316 bits (817), Expect = 5.091e-92
Identity = 188/432 (43.52%), Postives = 265/432 (61.34%), Query Frame = 2
Query:  476 IEGGRFDFDDGGSYVGEWCDGRAHGLGIATGPENQGEFSGEWVMGFESRGVYIWPSGNIYAGGWMKGKRHGEGVQMKGKWIYKGEFTT-GFCGRYGVKESLSSASKFEGSWHLNLFDGFGVETNADGSTYSGAWSKGVRQGLGVRKSAAYSKAATHKDPSSVRAATSQNSLLSANDSDRQAFVDDARRPIDHRSGFVLVTTNNNADINANKEKKPSFRKALFR--KLRKQKSTGDL--RSARMGGSLRSTLSSNSAASQAT---------NHSLPDSLPIPSRESIDPNVIETYSGQWKEDKRAGYGVAERTDGAKYEGEWFNNKKDGYGVTHFPNGTKEEGRYKENVLVQTLHKRHKIFALRHSRLKDSXXXXXXXXXXXXXXXXXXXXXXXNQRAQTAKNSAETAEIKAKEAQKLSNHAREVAKEFAPDF 1729
            I GGRFDF+DGG+Y G W +G+AHG G+ TGP++QG ++G W  GFE  G YIWPSG+ Y G W  G+RHG GV+  G+ IY+GE++  G  GRYGV+ES  S +K+EG+W+    DG G ET ADG  Y G W +G R G G+R SA +  A+ H+   ++ A+ S  SL S  + +    V+ A    + R GFVL   ++   +  N     + +K      K+RKQ+STGDL  R     GS+RST+SS S  S  +         NH+  ++      E +DP V+ETY G+WK+DKR G+GVAER+DG KYEGEW+NN+K GYGVT F +GT EEG+YK N+L+ +  K+H +F  R  +L+D +  A+ +A  A   A +R+    + R  TA   A+ A+  A++A+    +A  +A+EFAPDF
Sbjct:   47 INGGRFDFEDGGTYCGGWDEGKAHGHGVCTGPKHQGAYAGAWNYGFEVSGSYIWPSGSHYEGQWQNGRRHGLGVEQIGRQIYRGEWSKDGHKGRYGVRESTVSTAKYEGTWNEGYQDGSGCETYADGGKYQGQWQEGKRHGYGIRTSAPFGLASHHRR-KNLHASLS--SLRSGENGNAAKMVEKAE---EIRGGFVLTAKSDKLPVRRNSLTDKTGKKGFLMNLKMRKQRSTGDLEKRGTIASGSIRSTMSSASWISTGSEQSNLTTKSNHTESNASFTMEDEQLDPTVVETYMGEWKKDKRCGHGVAERSDGLKYEGEWYNNRKHGYGVTTFRDGTVEEGKYKNNILITSQKKKH-LFLARSRKLRDRIAAALSSAQRALKMAMQRSDMAIS-RMATAAAKAQNADAAAEQARMDCENAVRMAREFAPDF 470          
BLAST of Junctophilin-1 vs. Ensembl Fly
Match: jp (gene:FBgn0032129 transcript:FBtr0079860)

HSP 1 Score: 319.316 bits (817), Expect = 5.091e-92
Identity = 188/432 (43.52%), Postives = 265/432 (61.34%), Query Frame = 2
Query:  476 IEGGRFDFDDGGSYVGEWCDGRAHGLGIATGPENQGEFSGEWVMGFESRGVYIWPSGNIYAGGWMKGKRHGEGVQMKGKWIYKGEFTT-GFCGRYGVKESLSSASKFEGSWHLNLFDGFGVETNADGSTYSGAWSKGVRQGLGVRKSAAYSKAATHKDPSSVRAATSQNSLLSANDSDRQAFVDDARRPIDHRSGFVLVTTNNNADINANKEKKPSFRKALFR--KLRKQKSTGDL--RSARMGGSLRSTLSSNSAASQAT---------NHSLPDSLPIPSRESIDPNVIETYSGQWKEDKRAGYGVAERTDGAKYEGEWFNNKKDGYGVTHFPNGTKEEGRYKENVLVQTLHKRHKIFALRHSRLKDSXXXXXXXXXXXXXXXXXXXXXXXNQRAQTAKNSAETAEIKAKEAQKLSNHAREVAKEFAPDF 1729
            I GGRFDF+DGG+Y G W +G+AHG G+ TGP++QG ++G W  GFE  G YIWPSG+ Y G W  G+RHG GV+  G+ IY+GE++  G  GRYGV+ES  S +K+EG+W+    DG G ET ADG  Y G W +G R G G+R SA +  A+ H+   ++ A+ S  SL S  + +    V+ A    + R GFVL   ++   +  N     + +K      K+RKQ+STGDL  R     GS+RST+SS S  S  +         NH+  ++      E +DP V+ETY G+WK+DKR G+GVAER+DG KYEGEW+NN+K GYGVT F +GT EEG+YK N+L+ +  K+H +F  R  +L+D +  A+ +A  A   A +R+    + R  TA   A+ A+  A++A+    +A  +A+EFAPDF
Sbjct:   47 INGGRFDFEDGGTYCGGWDEGKAHGHGVCTGPKHQGAYAGAWNYGFEVSGSYIWPSGSHYEGQWQNGRRHGLGVEQIGRQIYRGEWSKDGHKGRYGVRESTVSTAKYEGTWNEGYQDGSGCETYADGGKYQGQWQEGKRHGYGIRTSAPFGLASHHRR-KNLHASLS--SLRSGENGNAAKMVEKAE---EIRGGFVLTAKSDKLPVRRNSLTDKTGKKGFLMNLKMRKQRSTGDLEKRGTIASGSIRSTMSSASWISTGSEQSNLTTKSNHTESNASFTMEDEQLDPTVVETYMGEWKKDKRCGHGVAERSDGLKYEGEWYNNRKHGYGVTTFRDGTVEEGKYKNNILITSQKKKH-LFLARSRKLRDRIAAALSSAQRALKMAMQRSDMAIS-RMATAAAKAQNADAAAEQARMDCENAVRMAREFAPDF 470          
BLAST of Junctophilin-1 vs. Ensembl Fly
Match: jp (gene:FBgn0032129 transcript:FBtr0304056)

HSP 1 Score: 319.316 bits (817), Expect = 5.091e-92
Identity = 188/432 (43.52%), Postives = 265/432 (61.34%), Query Frame = 2
Query:  476 IEGGRFDFDDGGSYVGEWCDGRAHGLGIATGPENQGEFSGEWVMGFESRGVYIWPSGNIYAGGWMKGKRHGEGVQMKGKWIYKGEFTT-GFCGRYGVKESLSSASKFEGSWHLNLFDGFGVETNADGSTYSGAWSKGVRQGLGVRKSAAYSKAATHKDPSSVRAATSQNSLLSANDSDRQAFVDDARRPIDHRSGFVLVTTNNNADINANKEKKPSFRKALFR--KLRKQKSTGDL--RSARMGGSLRSTLSSNSAASQAT---------NHSLPDSLPIPSRESIDPNVIETYSGQWKEDKRAGYGVAERTDGAKYEGEWFNNKKDGYGVTHFPNGTKEEGRYKENVLVQTLHKRHKIFALRHSRLKDSXXXXXXXXXXXXXXXXXXXXXXXNQRAQTAKNSAETAEIKAKEAQKLSNHAREVAKEFAPDF 1729
            I GGRFDF+DGG+Y G W +G+AHG G+ TGP++QG ++G W  GFE  G YIWPSG+ Y G W  G+RHG GV+  G+ IY+GE++  G  GRYGV+ES  S +K+EG+W+    DG G ET ADG  Y G W +G R G G+R SA +  A+ H+   ++ A+ S  SL S  + +    V+ A    + R GFVL   ++   +  N     + +K      K+RKQ+STGDL  R     GS+RST+SS S  S  +         NH+  ++      E +DP V+ETY G+WK+DKR G+GVAER+DG KYEGEW+NN+K GYGVT F +GT EEG+YK N+L+ +  K+H +F  R  +L+D +  A+ +A  A   A +R+    + R  TA   A+ A+  A++A+    +A  +A+EFAPDF
Sbjct:   47 INGGRFDFEDGGTYCGGWDEGKAHGHGVCTGPKHQGAYAGAWNYGFEVSGSYIWPSGSHYEGQWQNGRRHGLGVEQIGRQIYRGEWSKDGHKGRYGVRESTVSTAKYEGTWNEGYQDGSGCETYADGGKYQGQWQEGKRHGYGIRTSAPFGLASHHRR-KNLHASLS--SLRSGENGNAAKMVEKAE---EIRGGFVLTAKSDKLPVRRNSLTDKTGKKGFLMNLKMRKQRSTGDLEKRGTIASGSIRSTMSSASWISTGSEQSNLTTKSNHTESNASFTMEDEQLDPTVVETYMGEWKKDKRCGHGVAERSDGLKYEGEWYNNRKHGYGVTTFRDGTVEEGKYKNNILITSQKKKH-LFLARSRKLRDRIAAALSSAQRALKMAMQRSDMAIS-RMATAAAKAQNADAAAEQARMDCENAVRMAREFAPDF 470          
BLAST of Junctophilin-1 vs. Ensembl Fly
Match: jp (gene:FBgn0032129 transcript:FBtr0304057)

HSP 1 Score: 319.316 bits (817), Expect = 5.091e-92
Identity = 188/432 (43.52%), Postives = 265/432 (61.34%), Query Frame = 2
Query:  476 IEGGRFDFDDGGSYVGEWCDGRAHGLGIATGPENQGEFSGEWVMGFESRGVYIWPSGNIYAGGWMKGKRHGEGVQMKGKWIYKGEFTT-GFCGRYGVKESLSSASKFEGSWHLNLFDGFGVETNADGSTYSGAWSKGVRQGLGVRKSAAYSKAATHKDPSSVRAATSQNSLLSANDSDRQAFVDDARRPIDHRSGFVLVTTNNNADINANKEKKPSFRKALFR--KLRKQKSTGDL--RSARMGGSLRSTLSSNSAASQAT---------NHSLPDSLPIPSRESIDPNVIETYSGQWKEDKRAGYGVAERTDGAKYEGEWFNNKKDGYGVTHFPNGTKEEGRYKENVLVQTLHKRHKIFALRHSRLKDSXXXXXXXXXXXXXXXXXXXXXXXNQRAQTAKNSAETAEIKAKEAQKLSNHAREVAKEFAPDF 1729
            I GGRFDF+DGG+Y G W +G+AHG G+ TGP++QG ++G W  GFE  G YIWPSG+ Y G W  G+RHG GV+  G+ IY+GE++  G  GRYGV+ES  S +K+EG+W+    DG G ET ADG  Y G W +G R G G+R SA +  A+ H+   ++ A+ S  SL S  + +    V+ A    + R GFVL   ++   +  N     + +K      K+RKQ+STGDL  R     GS+RST+SS S  S  +         NH+  ++      E +DP V+ETY G+WK+DKR G+GVAER+DG KYEGEW+NN+K GYGVT F +GT EEG+YK N+L+ +  K+H +F  R  +L+D +  A+ +A  A   A +R+    + R  TA   A+ A+  A++A+    +A  +A+EFAPDF
Sbjct:   47 INGGRFDFEDGGTYCGGWDEGKAHGHGVCTGPKHQGAYAGAWNYGFEVSGSYIWPSGSHYEGQWQNGRRHGLGVEQIGRQIYRGEWSKDGHKGRYGVRESTVSTAKYEGTWNEGYQDGSGCETYADGGKYQGQWQEGKRHGYGIRTSAPFGLASHHRR-KNLHASLS--SLRSGENGNAAKMVEKAE---EIRGGFVLTAKSDKLPVRRNSLTDKTGKKGFLMNLKMRKQRSTGDLEKRGTIASGSIRSTMSSASWISTGSEQSNLTTKSNHTESNASFTMEDEQLDPTVVETYMGEWKKDKRCGHGVAERSDGLKYEGEWYNNRKHGYGVTTFRDGTVEEGKYKNNILITSQKKKH-LFLARSRKLRDRIAAALSSAQRALKMAMQRSDMAIS-RMATAAAKAQNADAAAEQARMDCENAVRMAREFAPDF 470          
BLAST of Junctophilin-1 vs. Ensembl Fly
Match: Als2 (gene:FBgn0037116 transcript:FBtr0078462)

HSP 1 Score: 58.151 bits (139), Expect = 5.358e-8
Identity = 45/144 (31.25%), Postives = 60/144 (41.67%), Query Frame = 2
Query:  491 FDFDDGGSYVGEWCDGRAHGLGIATGPENQGEFSGEWVMG-FESRGVYIW-----PSGNIYAGGWMKGKRHGEGVQMKGKWIYKGEFTTGFCGRYGVKESLSSASKFEGSWHLNLFDGFGVETNADGSTYSGAWSKGVRQGLGV 904
             ++ DG  Y GE   G   G G    P   G + G +  G F   GVY       P   +Y G + +G  HG GV    ++IY GE+       YGV E L S  K+ G +  N   G G      G  + G++S     G GV
Sbjct:  758 LEYPDGSVYCGELQHGIIEGFGKMVIPTT-GLYVGNFKGGRFHGHGVYEMHCKDSPESEVYEGNFCEGLFHGHGVMRNNRYIYVGEYQANARSGYGVIEDLVSGDKYMGMFADNKRSGIGSCITNRGDYFEGSFSGDDLTGSGV 900          
BLAST of Junctophilin-1 vs. Ensembl Zebrafish
Match: jph1a (junctophilin 1a [Source:ZFIN;Acc:ZDB-GENE-040724-233])

HSP 1 Score: 326.635 bits (836), Expect = 8.038e-98
Identity = 189/437 (43.25%), Postives = 271/437 (62.01%), Query Frame = 2
Query:  476 IEGGRFDFDDGGSYVGEWCDGRAHGLGIATGPENQGEFSGEWVMGFESRGVYIWPSGNIYAGGWMKGKRHGEGVQMKGKWIYKGEFTTGFCGRYGVKESLSSASKFEGSWHLNLFDGFGVETNADGSTYSGAWSKGVRQGLGVRKSAAYSKAATHKDPSSVRAATSQNSLLSANDSDRQAFVDDARRPIDHRSGFVLVTTNNNADINANKEKKPSFRKALF---RKLRKQKSTGDLRSARMGGSLRSTLS--SNSAASQATNH---SLPDSLPIPSRESIDPNVIETYSGQWKEDKRAGYGVAERTDGAKYEGEWFNNKKDGYGVTHFPNGTKEEGRYKENVLVQTLHKRHKIFALRHSRLKDSXXXXXXXXXXXXXXXXXXXXXXXNQRAQTAKNSAETAEIKAKEAQKLSNHAREVAKEFAPDFIQLGVLWLKTR 1762
            + GGRFDFDDGG+Y G W DG+AHG GI TGP+ QGE+SG W  GFE  GVY WPSGN Y G W +GKRHG GV+ KGKW+Y+GE++ GF GRYGV++S ++ ++++G+W   L DG+GVET  D  TY G W  G+R G GVR+S  Y  A   + P  +R + +    + +N +  Q  V D   P+  R GFVL   +++ ++   K+K    R +LF   R+LRK  S   + S R      +T+S  S+S A+   ++    +PD    P  + +D    E+Y G+WK DKR G+GV+ER++G KYEGEW NNK+ GYG T FP+GTKEEG+YK NVLV+ +  R ++  L++ + K+ V+ AV+ A  +AA A+ +     + R   A+  +E A+  A  A + S+ AR VA E +P F Q G+ ++K +
Sbjct:    1 MTGGRFDFDDGGTYCGGWEDGKAHGHGICTGPKGQGEYSGSWSHGFEVVGVYTWPSGNTYQGYWSQGKRHGLGVETKGKWLYRGEWSHGFKGRYGVRQSTNTPARYDGTWSNGLQDGYGVETYGDSGTYQGQWMGGMRHGYGVRQSVPYGMATIIRSP--LRTSLASLRSVQSNGAVLQDTVPDT--PVGSRGGFVL-NFHSDTEVVTGKKKGLFRRGSLFGSLRQLRKSDSKTSISSKRSSARSDATMSRISSSDANSTISYGEGEVPDDY-TPMEDHVDATTTESYMGEWKNDKRNGFGVSERSNGLKYEGEWMNNKRHGYGCTIFPDGTKEEGKYKNNVLVRGI--RKQLIPLKNHKTKEKVDRAVEGARRSAAIARTKVEIAVS-RTSHARTKSEAADQAALAACQESDLARAVACELSPSFHQPGLEYIKQK 428          
BLAST of Junctophilin-1 vs. Ensembl Zebrafish
Match: jph1a (junctophilin 1a [Source:ZFIN;Acc:ZDB-GENE-040724-233])

HSP 1 Score: 308.531 bits (789), Expect = 7.341e-95
Identity = 165/363 (45.45%), Postives = 231/363 (63.64%), Query Frame = 2
Query:  476 IEGGRFDFDDGGSYVGEWCDGRAHGLGIATGPENQGEFSGEWVMGFESRGVYIWPSGNIYAGGWMKGKRHGEGVQMKGKWIYKGEFTTGFCGRYGVKESLSSASKFEGSWHLNLFDGFGVETNADGSTYSGAWSKGVRQGLGVRKSAAYSKAATHKDPSSVRAATSQNSLLSANDSDRQAFVDDARRPIDHRSGFVLVTTNNNADINANKEKKPSFRKALF---RKLRKQKSTGDLRSARMGGSLRSTLS--SNSAASQATNHS---LPDSLPIPSRESIDPNVIETYSGQWKEDKRAGYGVAERTDGAKYEGEWFNNKKDGYGVTHFPNGTKEEGRYKENVLVQTLHKRHKIFALRHSRLKD 1540
            + GGRFDFDDGG+Y G W DG+AHG GI TGP+ QGE+SG W  GFE  GVY WPSGN Y G W +GKRHG GV+ KGKW+Y+GE++ GF GRYGV++S ++ ++++G+W   L DG+GVET  D  TY G W  G+R G GVR+S  Y  A   + P  +R + +    + +N +  Q  V D   P+  R GFVL   +++ ++   K+K    R +LF   R+LRK  S   + S R      +T+S  S+S A+   ++    +PD    P  + +D    E+Y G+WK DKR G+GV+ER++G KYEGEW NNK+ GYG T FP+GTKEEG+YK NVLV+ +  R ++  L++ + K+
Sbjct:    1 MTGGRFDFDDGGTYCGGWEDGKAHGHGICTGPKGQGEYSGSWSHGFEVVGVYTWPSGNTYQGYWSQGKRHGLGVETKGKWLYRGEWSHGFKGRYGVRQSTNTPARYDGTWSNGLQDGYGVETYGDSGTYQGQWMGGMRHGYGVRQSVPYGMATIIRSP--LRTSLASLRSVQSNGAVLQDTVPDT--PVGSRGGFVL-NFHSDTEVVTGKKKGLFRRGSLFGSLRQLRKSDSKTSISSKRSSARSDATMSRISSSDANSTISYGEGEVPDDY-TPMEDHVDATTTESYMGEWKNDKRNGFGVSERSNGLKYEGEWMNNKRHGYGCTIFPDGTKEEGKYKNNVLVRGI--RKQLIPLKNHKTKE 355          
BLAST of Junctophilin-1 vs. Ensembl Zebrafish
Match: jph1b (junctophilin 1b [Source:ZFIN;Acc:ZDB-GENE-060616-389])

HSP 1 Score: 315.849 bits (808), Expect = 7.365e-94
Identity = 190/445 (42.70%), Postives = 278/445 (62.47%), Query Frame = 2
Query:  476 IEGGRFDFDDGGSYVGEWCDGRAHGLGIATGPENQGEFSGEWVMGFESRGVYIWPSGNIYAGGWMKGKRHGEGVQMKGKWIYKGEFTTGFCGRYGVKESLSSASKFEGSWHLNLFDGFGVETNADGSTYSGAWSKGVRQGLGVRKSAAYSKAATHKDP-----SSVRAATSQNSLLSANDSDRQAFVDDARRPIDHRSGFVLVTTNNNADINANKEKKPSFRKALF---RKLRKQKSTGDLRSARMGGSLRSTLSSNSAASQATNHSLPDSLP----IPSRESIDPNVIETYSGQWKEDKRAGYGVAERTDGAKYEGEWFNNKKDGYGVTHFPNGTKEEGRYKENVLVQTLHKRHKIFALRHSRLKDSXXXXXXXXXXXXXXXXXXXXXXXNQRAQTAKNSAETAEIKAKEAQKLSNHAREVAKEFAPDFIQLGVLWLKTRNNIE 1774
            + GGRFDFDDGG++ G W DG+AHG GI TGP+ QGE+SG W  GFE  GVY WPSGN Y G W +GKRHG GV+ KG+W+Y+GE++ GF GRYGV++SL++ +++EG+W   L DG+GVET  DG TY G W  G+R G GVR+S  Y  A   + P     +S+R+  S  S+L  + SD          P   R GFVL   ++++++ + K+K    R +LF   ++LRK  S   + S R      +T+S  S++   +  S  D       +P+ +++D    E+Y G+WK DKR G+GV+ER++G KYEGEW NNK+ GYG T FP+GTKEEG+YK NVLV+ + K  ++  L++++ K  V+ AV+ A+ A+A A+ +     + R   A+  AE A+  +  A + S+ AR VA++ +P+F Q G  ++K R + E
Sbjct:    1 MTGGRFDFDDGGTFCGGWEDGKAHGHGICTGPKGQGEYSGSWSNGFEVVGVYTWPSGNTYKGYWAQGKRHGLGVESKGRWLYRGEWSHGFKGRYGVRQSLNTPARYEGTWSNGLQDGYGVETYGDGGTYQGQWMGGMRHGYGVRQSVPYGMATVIRSPLRTSLASLRSEQSNGSVLHDHMSD---------SPAGTRGGFVL-NFHSDSEVVSGKKKGLFRRGSLFGSLKQLRKSDSRSSISSKRSSARSDATMSRISSSDANSTISFGDGEVADEYMPAEDNVDATTTESYLGEWKNDKRNGFGVSERSNGMKYEGEWINNKRHGYGCTMFPDGTKEEGKYKNNVLVRGIKK--QLIPLKNTKTKQKVDRAVEGAIRASAIARTKVEIATS-RTAHARAKAEAADQASLSASQESDLARAVARDLSPNFHQPGPDYIKQRFSSE 432          
BLAST of Junctophilin-1 vs. Ensembl Zebrafish
Match: jph1b (junctophilin 1b [Source:ZFIN;Acc:ZDB-GENE-060616-389])

HSP 1 Score: 315.849 bits (808), Expect = 7.365e-94
Identity = 190/445 (42.70%), Postives = 278/445 (62.47%), Query Frame = 2
Query:  476 IEGGRFDFDDGGSYVGEWCDGRAHGLGIATGPENQGEFSGEWVMGFESRGVYIWPSGNIYAGGWMKGKRHGEGVQMKGKWIYKGEFTTGFCGRYGVKESLSSASKFEGSWHLNLFDGFGVETNADGSTYSGAWSKGVRQGLGVRKSAAYSKAATHKDP-----SSVRAATSQNSLLSANDSDRQAFVDDARRPIDHRSGFVLVTTNNNADINANKEKKPSFRKALF---RKLRKQKSTGDLRSARMGGSLRSTLSSNSAASQATNHSLPDSLP----IPSRESIDPNVIETYSGQWKEDKRAGYGVAERTDGAKYEGEWFNNKKDGYGVTHFPNGTKEEGRYKENVLVQTLHKRHKIFALRHSRLKDSXXXXXXXXXXXXXXXXXXXXXXXNQRAQTAKNSAETAEIKAKEAQKLSNHAREVAKEFAPDFIQLGVLWLKTRNNIE 1774
            + GGRFDFDDGG++ G W DG+AHG GI TGP+ QGE+SG W  GFE  GVY WPSGN Y G W +GKRHG GV+ KG+W+Y+GE++ GF GRYGV++SL++ +++EG+W   L DG+GVET  DG TY G W  G+R G GVR+S  Y  A   + P     +S+R+  S  S+L  + SD          P   R GFVL   ++++++ + K+K    R +LF   ++LRK  S   + S R      +T+S  S++   +  S  D       +P+ +++D    E+Y G+WK DKR G+GV+ER++G KYEGEW NNK+ GYG T FP+GTKEEG+YK NVLV+ + K  ++  L++++ K  V+ AV+ A+ A+A A+ +     + R   A+  AE A+  +  A + S+ AR VA++ +P+F Q G  ++K R + E
Sbjct:    1 MTGGRFDFDDGGTFCGGWEDGKAHGHGICTGPKGQGEYSGSWSNGFEVVGVYTWPSGNTYKGYWAQGKRHGLGVESKGRWLYRGEWSHGFKGRYGVRQSLNTPARYEGTWSNGLQDGYGVETYGDGGTYQGQWMGGMRHGYGVRQSVPYGMATVIRSPLRTSLASLRSEQSNGSVLHDHMSD---------SPAGTRGGFVL-NFHSDSEVVSGKKKGLFRRGSLFGSLKQLRKSDSRSSISSKRSSARSDATMSRISSSDANSTISFGDGEVADEYMPAEDNVDATTTESYLGEWKNDKRNGFGVSERSNGMKYEGEWINNKRHGYGCTMFPDGTKEEGKYKNNVLVRGIKK--QLIPLKNTKTKQKVDRAVEGAIRASAIARTKVEIATS-RTAHARAKAEAADQASLSASQESDLARAVARDLSPNFHQPGPDYIKQRFSSE 432          
BLAST of Junctophilin-1 vs. Ensembl Zebrafish
Match: jph3 (junctophilin 3 [Source:ZFIN;Acc:ZDB-GENE-060503-415])

HSP 1 Score: 316.235 bits (809), Expect = 7.255e-93
Identity = 197/444 (44.37%), Postives = 270/444 (60.81%), Query Frame = 2
Query:  482 GGRFDFDDGGSYVGEWCDGRAHGLGIATGPENQGEFSGEWVMGFESRGVYIWPSGNIYAGGWMKGKRHGEGVQMKGKWIYKGEFTTGFCGRYGVKESLSSASKFEGSWHLNLFDGFGVETNADGSTYSGAWSKGVRQGLGVRKSAAYSKAATHKDPSSVRAATSQNSLLSANDSDRQAFVDD--------------ARRPIDHRSGFVLVTTNNNADINANKEKKPSFRKALFR--KLRKQKSTGDLRSARMG-GSLRST--LSSNSAASQATNHSLP-----DSLPIPSRESIDPNVIETYSGQWKEDKRAGYGVAERTDGAKYEGEWFNNKKDGYGVTHFPNGTKEEGRYKENVLVQTLHKRHKIFALRHSRLKDSXXXXXXXXXXXXXXXXXXXXXXXNQRAQTAKNSAETAEIKAKEAQKLSNHAREVAKEFAPDFIQLG 1741
            GGRF+FDDGGSY G W +G+AHG GI TGP+ QGE++G W  GFE  G+Y WPSGN + G W +GKRHG G++ KGKW+YKGE+T GF GRYGV+ES  ++ K+EG+W+  L DG+G ET +DG TY G W  G+R G GVR+S  Y  AA  + P      TS NSL S + +       D                 P   R GFVL T ++ A++  NK KK  FR++L    KLRK +S   L S R    S RS   +S+ S+A+   N ++        LP+   + +D    E+Y+G+WK DKR G GV+ R+DG +Y+GEW  NK+ GYG T FP+GTKEEG+YK+N+LV    KR  +  LR S++++ V+ AV++A +AA  AK++A    ++ A  A+  A+ A   A++AQ+    AR  AKEF+P F   G
Sbjct:    4 GGRFNFDDGGSYCGGWEEGKAHGHGICTGPKGQGEYAGSWSHGFEVVGIYTWPSGNTFQGTWAQGKRHGIGIENKGKWVYKGEWTHGFKGRYGVRESTGTSGKYEGTWNNGLQDGYGTETYSDGGTYQGQWVGGMRHGYGVRQSVPYGMAAVIRSP----LRTSINSLRSEHSNGTALLTGDRAPVAGVGGSGVLVVGSPAVSRGGFVL-TAHSEAELLKNK-KKGLFRRSLLSGLKLRKSESKSSLASQRSKQSSFRSEAGMSTVSSAASDINSTISLGEGEGELPVGD-DDVDATTTESYAGEWKNDKRTGCGVSRRSDGLQYQGEWLGNKRHGYGCTTFPDGTKEEGKYKQNILVSG--KRKNLIPLRASKIREKVDRAVESADKAADIAKQKAEIALSRTAH-ARGKADAATAAAQKAQEECRLARITAKEFSPSFQHRG 437          
BLAST of Junctophilin-1 vs. Ensembl Xenopus
Match: ing2 (inhibitor of growth family member 2 [Source:Xenbase;Acc:XB-GENE-951849])

HSP 1 Score: 320.472 bits (820), Expect = 8.491e-97
Identity = 187/444 (42.12%), Postives = 266/444 (59.91%), Query Frame = 2
Query:  476 IEGGRFDFDDGGSYVGEWCDGRAHGLGIATGPENQGEFSGEWVMGFESRGVYIWPSGNIYAGGWMKGKRHGEGVQMKGKWIYKGEFTTGFCGRYGVKESLSSASKFEGSWHLNLFDGFGVETNADGSTYSGAWSKGVRQGLGVRKSAAYSKAATHKDP-----SSVRAATSQNSLLSANDSDRQAFVDDARRPIDHRSGFVLVTTNNNADINANKEKKPSFRKALFR--------KLRKQKSTGDLRSARMGGSLRSTLS--SNSAASQATNHSLPDSLPIPSRESIDPNVIETYSGQWKEDKRAGYGVAERTDGAKYEGEWFNNKKDGYGVTHFPNGTKEEGRYKENVLVQTLHKRHKIFALRHSRLKDSXXXXXXXXXXXXXXXXXXXXXXXNQRAQTAKNSAETAEIKAKEAQKLSNHAREVAKEFAPDFIQLGVLWLKTR 1762
            + GGRFDFDDGG+Y G W DG+AHG GI TGP+ QGE+SG W  GFE  G Y WPSGN Y G W +GKRHG GV+ KG+WIY+GE++ GF GRYGV++S+S+ ++++G+W   L DG+GVET  DG TY G W  G+R G GVR+S  Y  A     P     SS+R+  S  ++L     D          P+  R GFVL       + +++ E     +K LFR        KLRK  S   + S R      + +S  S+S A+   +    D    P  + +D    ETY G+WK DKR G+GV+ER++G KYEGEW NN++ GYG T FP+GTKEEG+YK NVLV+ +  R ++  +++++ K+ V+ A++ A  AAA A+ +     + R + A+  A  A+  ++ A++ S+ AR VA+E +P F Q G  ++K +
Sbjct:    1 MTGGRFDFDDGGTYCGGWEDGKAHGHGICTGPKGQGEYSGSWSHGFEVVGAYTWPSGNTYLGYWAQGKRHGLGVETKGRWIYRGEWSHGFKGRYGVRQSMSTPARYDGTWSNGLQDGYGVETYGDGGTYQGQWMGGMRHGYGVRQSVPYGMATVIHSPLRTSLSSLRSEQSNGTVLHDIGVD---------SPVGSRGGFVL-------NFHSDSELMTGKKKGLFRRGSLLGSIKLRKSDSKISISSKRSSVRSDAAMSRISSSDANSTISFGDGDCDYCPVEDHVDATTTETYMGEWKNDKRTGFGVSERSNGMKYEGEWLNNRRHGYGCTIFPDGTKEEGKYKNNVLVRGI--RKQLIPIKNTKTKEKVDRAIEGAQRAAAVARTKVEIAVS-RTEHARAKANAADQASQAARQESDIARAVARELSPSFHQPGPEYIKQK 425          
BLAST of Junctophilin-1 vs. Ensembl Xenopus
Match: ing2 (inhibitor of growth family member 2 [Source:Xenbase;Acc:XB-GENE-951849])

HSP 1 Score: 320.472 bits (820), Expect = 1.452e-96
Identity = 187/444 (42.12%), Postives = 266/444 (59.91%), Query Frame = 2
Query:  476 IEGGRFDFDDGGSYVGEWCDGRAHGLGIATGPENQGEFSGEWVMGFESRGVYIWPSGNIYAGGWMKGKRHGEGVQMKGKWIYKGEFTTGFCGRYGVKESLSSASKFEGSWHLNLFDGFGVETNADGSTYSGAWSKGVRQGLGVRKSAAYSKAATHKDP-----SSVRAATSQNSLLSANDSDRQAFVDDARRPIDHRSGFVLVTTNNNADINANKEKKPSFRKALFR--------KLRKQKSTGDLRSARMGGSLRSTLS--SNSAASQATNHSLPDSLPIPSRESIDPNVIETYSGQWKEDKRAGYGVAERTDGAKYEGEWFNNKKDGYGVTHFPNGTKEEGRYKENVLVQTLHKRHKIFALRHSRLKDSXXXXXXXXXXXXXXXXXXXXXXXNQRAQTAKNSAETAEIKAKEAQKLSNHAREVAKEFAPDFIQLGVLWLKTR 1762
            + GGRFDFDDGG+Y G W DG+AHG GI TGP+ QGE+SG W  GFE  G Y WPSGN Y G W +GKRHG GV+ KG+WIY+GE++ GF GRYGV++S+S+ ++++G+W   L DG+GVET  DG TY G W  G+R G GVR+S  Y  A     P     SS+R+  S  ++L     D          P+  R GFVL       + +++ E     +K LFR        KLRK  S   + S R      + +S  S+S A+   +    D    P  + +D    ETY G+WK DKR G+GV+ER++G KYEGEW NN++ GYG T FP+GTKEEG+YK NVLV+ +  R ++  +++++ K+ V+ A++ A  AAA A+ +     + R + A+  A  A+  ++ A++ S+ AR VA+E +P F Q G  ++K +
Sbjct:    1 MTGGRFDFDDGGTYCGGWEDGKAHGHGICTGPKGQGEYSGSWSHGFEVVGAYTWPSGNTYLGYWAQGKRHGLGVETKGRWIYRGEWSHGFKGRYGVRQSMSTPARYDGTWSNGLQDGYGVETYGDGGTYQGQWMGGMRHGYGVRQSVPYGMATVIHSPLRTSLSSLRSEQSNGTVLHDIGVD---------SPVGSRGGFVL-------NFHSDSELMTGKKKGLFRRGSLLGSIKLRKSDSKISISSKRSSVRSDAAMSRISSSDANSTISFGDGDCDYCPVEDHVDATTTETYMGEWKNDKRTGFGVSERSNGMKYEGEWLNNRRHGYGCTIFPDGTKEEGKYKNNVLVRGI--RKQLIPIKNTKTKEKVDRAIEGAQRAAAVARTKVEIAVS-RTEHARAKANAADQASQAARQESDIARAVARELSPSFHQPGPEYIKQK 425          
BLAST of Junctophilin-1 vs. Ensembl Xenopus
Match: JPH3 (junctophilin 3 [Source:NCBI gene;Acc:105947054])

HSP 1 Score: 325.094 bits (832), Expect = 2.949e-96
Identity = 196/427 (45.90%), Postives = 265/427 (62.06%), Query Frame = 2
Query:  482 GGRFDFDDGGSYVGEWCDGRAHGLGIATGPENQGEFSGEWVMGFESRGVYIWPSGNIYAGGWMKGKRHGEGVQMKGKWIYKGEFTTGFCGRYGVKESLSSASKFEGSWHLNLFDGFGVETNADGSTYSGAWSKGVRQGLGVRKSAAYSKAATHKDP--SSVRAATSQNSLLSANDSDRQAFVDDARRPIDHRSGFVLVTTNNNADINANKEKKPSFRKALFR--KLRKQKSTGDLRSARMG-GSLRSTLSSNSAASQATNHSLPDSLPIPSRE------SIDPNVIETYSGQWKEDKRAGYGVAERTDGAKYEGEWFNNKKDGYGVTHFPNGTKEEGRYKENVLVQTLHKRHKIFALRHSRLKDSXXXXXXXXXXXXXXXXXXXXXXXNQRAQTAKNSAETAEIKAKEAQKLSNHAREVAKEFAPDF 1729
            GGRF+FDDGGSY G W DG+AHG GI TGP+ QGE++G W  GFE  GVY WPSGN Y G W +GKRHG GV+ KGKW+Y+GE+T GF GRYGV+E   + +K+EG+W   L DG+G ET +DG TY G W+ G+R G GVR+S  Y  AA  + P  +S+ +  S+++  +A   D    V  +  P   R GFVL+  +++A+I  NK KK  FR+++    KLRK +S   L S R    S RS    ++ +S A++ +   SL     E       ID    E Y G+WK DKR+G+GV++R+DG KYEGEW NNK+ GYG   FP+GTKEEG+YK NVLV    KR  +  LR S++++ V+ AV  A      AK++A   A+ R   ++  A+ A   A +AQ+ +  AR  AKEF+P F
Sbjct:    4 GGRFNFDDGGSYCGGWQDGKAHGHGICTGPKGQGEYAGSWSHGFEVLGVYTWPSGNTYQGTWAQGKRHGLGVESKGKWVYRGEWTHGFKGRYGVRECTGNGAKYEGTWSNGLQDGYGTETYSDGGTYQGQWAAGIRHGYGVRQSVPYGMAAVIRSPLRTSINSLRSEHTNGTALHPDASCTVSGS--PAVSRGGFVLM-AHSDAEILKNK-KKGIFRRSILSGLKLRKSESKSSLASQRSKQSSFRSEAGMSTVSSTASDINSTISLGEGETELSVIEDDIDATTTEVYMGEWKHDKRSGFGVSQRSDGLKYEGEWANNKRHGYGCMTFPDGTKEEGKYKHNVLVSG--KRKNLIPLRASKIREKVDRAVDEAERVCNIAKQKAEIAAS-RTSHSRAKADAAATAALKAQEEAQIARISAKEFSPSF 423          
BLAST of Junctophilin-1 vs. Ensembl Xenopus
Match: ing2 (inhibitor of growth family member 2 [Source:Xenbase;Acc:XB-GENE-951849])

HSP 1 Score: 321.627 bits (823), Expect = 4.315e-96
Identity = 187/444 (42.12%), Postives = 266/444 (59.91%), Query Frame = 2
Query:  476 IEGGRFDFDDGGSYVGEWCDGRAHGLGIATGPENQGEFSGEWVMGFESRGVYIWPSGNIYAGGWMKGKRHGEGVQMKGKWIYKGEFTTGFCGRYGVKESLSSASKFEGSWHLNLFDGFGVETNADGSTYSGAWSKGVRQGLGVRKSAAYSKAATHKDP-----SSVRAATSQNSLLSANDSDRQAFVDDARRPIDHRSGFVLVTTNNNADINANKEKKPSFRKALFR--------KLRKQKSTGDLRSARMGGSLRSTLS--SNSAASQATNHSLPDSLPIPSRESIDPNVIETYSGQWKEDKRAGYGVAERTDGAKYEGEWFNNKKDGYGVTHFPNGTKEEGRYKENVLVQTLHKRHKIFALRHSRLKDSXXXXXXXXXXXXXXXXXXXXXXXNQRAQTAKNSAETAEIKAKEAQKLSNHAREVAKEFAPDFIQLGVLWLKTR 1762
            + GGRFDFDDGG+Y G W DG+AHG GI TGP+ QGE+SG W  GFE  G Y WPSGN Y G W +GKRHG GV+ KG+WIY+GE++ GF GRYGV++S+S+ ++++G+W   L DG+GVET  DG TY G W  G+R G GVR+S  Y  A     P     SS+R+  S  ++L     D          P+  R GFVL       + +++ E     +K LFR        KLRK  S   + S R      + +S  S+S A+   +    D    P  + +D    ETY G+WK DKR G+GV+ER++G KYEGEW NN++ GYG T FP+GTKEEG+YK NVLV+ +  R ++  +++++ K+ V+ A++ A  AAA A+ +     + R + A+  A  A+  ++ A++ S+ AR VA+E +P F Q G  ++K +
Sbjct:    1 MTGGRFDFDDGGTYCGGWEDGKAHGHGICTGPKGQGEYSGSWSHGFEVVGAYTWPSGNTYLGYWAQGKRHGLGVETKGRWIYRGEWSHGFKGRYGVRQSMSTPARYDGTWSNGLQDGYGVETYGDGGTYQGQWMGGMRHGYGVRQSVPYGMATVIHSPLRTSLSSLRSEQSNGTVLHDIGVD---------SPVGSRGGFVL-------NFHSDSELMTGKKKGLFRRGSLLGSIKLRKSDSKISISSKRSSVRSDAAMSRISSSDANSTISFGDGDCDYCPVEDHVDATTTETYMGEWKNDKRTGFGVSERSNGMKYEGEWLNNRRHGYGCTIFPDGTKEEGKYKNNVLVRGI--RKQLIPIKNTKTKEKVDRAIEGAQRAAAVARTKVEIAVS-RTEHARAKANAADQASQAARQESDIARAVARELSPSFHQPGPEYIKQK 425          
BLAST of Junctophilin-1 vs. Ensembl Xenopus
Match: ing2 (inhibitor of growth family member 2 [Source:Xenbase;Acc:XB-GENE-951849])

HSP 1 Score: 322.013 bits (824), Expect = 6.315e-96
Identity = 187/444 (42.12%), Postives = 266/444 (59.91%), Query Frame = 2
Query:  476 IEGGRFDFDDGGSYVGEWCDGRAHGLGIATGPENQGEFSGEWVMGFESRGVYIWPSGNIYAGGWMKGKRHGEGVQMKGKWIYKGEFTTGFCGRYGVKESLSSASKFEGSWHLNLFDGFGVETNADGSTYSGAWSKGVRQGLGVRKSAAYSKAATHKDP-----SSVRAATSQNSLLSANDSDRQAFVDDARRPIDHRSGFVLVTTNNNADINANKEKKPSFRKALFR--------KLRKQKSTGDLRSARMGGSLRSTLS--SNSAASQATNHSLPDSLPIPSRESIDPNVIETYSGQWKEDKRAGYGVAERTDGAKYEGEWFNNKKDGYGVTHFPNGTKEEGRYKENVLVQTLHKRHKIFALRHSRLKDSXXXXXXXXXXXXXXXXXXXXXXXNQRAQTAKNSAETAEIKAKEAQKLSNHAREVAKEFAPDFIQLGVLWLKTR 1762
            + GGRFDFDDGG+Y G W DG+AHG GI TGP+ QGE+SG W  GFE  G Y WPSGN Y G W +GKRHG GV+ KG+WIY+GE++ GF GRYGV++S+S+ ++++G+W   L DG+GVET  DG TY G W  G+R G GVR+S  Y  A     P     SS+R+  S  ++L     D          P+  R GFVL       + +++ E     +K LFR        KLRK  S   + S R      + +S  S+S A+   +    D    P  + +D    ETY G+WK DKR G+GV+ER++G KYEGEW NN++ GYG T FP+GTKEEG+YK NVLV+ +  R ++  +++++ K+ V+ A++ A  AAA A+ +     + R + A+  A  A+  ++ A++ S+ AR VA+E +P F Q G  ++K +
Sbjct:    1 MTGGRFDFDDGGTYCGGWEDGKAHGHGICTGPKGQGEYSGSWSHGFEVVGAYTWPSGNTYLGYWAQGKRHGLGVETKGRWIYRGEWSHGFKGRYGVRQSMSTPARYDGTWSNGLQDGYGVETYGDGGTYQGQWMGGMRHGYGVRQSVPYGMATVIHSPLRTSLSSLRSEQSNGTVLHDIGVD---------SPVGSRGGFVL-------NFHSDSELMTGKKKGLFRRGSLLGSIKLRKSDSKISISSKRSSVRSDAAMSRISSSDANSTISFGDGDCDYCPVEDHVDATTTETYMGEWKNDKRTGFGVSERSNGMKYEGEWLNNRRHGYGCTIFPDGTKEEGKYKNNVLVRGI--RKQLIPIKNTKTKEKVDRAIEGAQRAAAVARTKVEIAVS-RTEHARAKANAADQASQAARQESDIARAVARELSPSFHQPGPEYIKQK 425          
BLAST of Junctophilin-1 vs. Ensembl Mouse
Match: Jph3 (junctophilin 3 [Source:MGI Symbol;Acc:MGI:1891497])

HSP 1 Score: 324.324 bits (830), Expect = 3.208e-96
Identity = 199/427 (46.60%), Postives = 270/427 (63.23%), Query Frame = 2
Query:  482 GGRFDFDDGGSYVGEWCDGRAHGLGIATGPENQGEFSGEWVMGFESRGVYIWPSGNIYAGGWMKGKRHGEGVQMKGKWIYKGEFTTGFCGRYGVKESLSSASKFEGSWHLNLFDGFGVETNADGSTYSGAWSKGVRQGLGVRKSAAYSKAATHKDP--SSVRAATSQNSLLSANDSDRQAFVDDARRPIDHRSGFVLVTTNNNADINANKEKKPSFRKALFR--KLRKQKSTGDLRSARMG-GSLRSTLSSNSAASQATNHSLPDSLPIPSRE------SIDPNVIETYSGQWKEDKRAGYGVAERTDGAKYEGEWFNNKKDGYGVTHFPNGTKEEGRYKENVLVQTLHKRHKIFALRHSRLKDSXXXXXXXXXXXXXXXXXXXXXXXNQRAQTAKNSAETAEIKAKEAQKLSNHAREVAKEFAPDF 1729
            GGRF+FDDGGSY G W DG+AHG G+ TGP+ QGE++G W  GFE  GVY WPSGN Y G W +GKRHG G++ KGKW+YKGE+T GF GRYGV+E   + +K+EG+W   L DG+G ET +DG TY G W  G+RQG GVR+S  Y  AA  + P  +S+ +  S+++  +A   D    V  A  P   R GFVLV  +++++I  +K KK  FR++L    KLRK +S   L S R    S RS    ++ +S A++     SL     E       ID    ETY G+WK DKR+G+GV++R+DG KYEGEW +N++ GYG   FP+GTKEEG+YK+NVLV    KR  +  LR S++++ V+ AV+ A  AA  AK++A   A+ R   ++  AE A   A++AQ+ +  AR  AKEF+P F
Sbjct:    4 GGRFNFDDGGSYCGGWEDGKAHGHGVCTGPKGQGEYTGSWSHGFEVLGVYTWPSGNTYQGTWAQGKRHGIGLESKGKWVYKGEWTHGFKGRYGVRECTGNGAKYEGTWSNGLQDGYGTETYSDGGTYQGQWVGGMRQGYGVRQSVPYGMAAVIRSPLRTSINSLRSEHTNGAALHPDASPAV--AGSPAVSRGGFVLV-AHSDSEILKSK-KKGLFRRSLLSGLKLRKSESKSSLASQRSKQSSFRSEAGMSTVSSTASDIHSTISLGEAEAELAVIEDDIDATTTETYVGEWKNDKRSGFGVSQRSDGLKYEGEWVSNRRHGYGCMTFPDGTKEEGKYKQNVLVSG--KRKNLIPLRASKIREKVDRAVEAAERAATIAKQKAEIAAS-RTSHSRAKAEAALTAAQKAQEEARIARITAKEFSPSF 423          
BLAST of Junctophilin-1 vs. Ensembl Mouse
Match: Jph3 (junctophilin 3 [Source:MGI Symbol;Acc:MGI:1891497])

HSP 1 Score: 324.324 bits (830), Expect = 3.208e-96
Identity = 199/427 (46.60%), Postives = 270/427 (63.23%), Query Frame = 2
Query:  482 GGRFDFDDGGSYVGEWCDGRAHGLGIATGPENQGEFSGEWVMGFESRGVYIWPSGNIYAGGWMKGKRHGEGVQMKGKWIYKGEFTTGFCGRYGVKESLSSASKFEGSWHLNLFDGFGVETNADGSTYSGAWSKGVRQGLGVRKSAAYSKAATHKDP--SSVRAATSQNSLLSANDSDRQAFVDDARRPIDHRSGFVLVTTNNNADINANKEKKPSFRKALFR--KLRKQKSTGDLRSARMG-GSLRSTLSSNSAASQATNHSLPDSLPIPSRE------SIDPNVIETYSGQWKEDKRAGYGVAERTDGAKYEGEWFNNKKDGYGVTHFPNGTKEEGRYKENVLVQTLHKRHKIFALRHSRLKDSXXXXXXXXXXXXXXXXXXXXXXXNQRAQTAKNSAETAEIKAKEAQKLSNHAREVAKEFAPDF 1729
            GGRF+FDDGGSY G W DG+AHG G+ TGP+ QGE++G W  GFE  GVY WPSGN Y G W +GKRHG G++ KGKW+YKGE+T GF GRYGV+E   + +K+EG+W   L DG+G ET +DG TY G W  G+RQG GVR+S  Y  AA  + P  +S+ +  S+++  +A   D    V  A  P   R GFVLV  +++++I  +K KK  FR++L    KLRK +S   L S R    S RS    ++ +S A++     SL     E       ID    ETY G+WK DKR+G+GV++R+DG KYEGEW +N++ GYG   FP+GTKEEG+YK+NVLV    KR  +  LR S++++ V+ AV+ A  AA  AK++A   A+ R   ++  AE A   A++AQ+ +  AR  AKEF+P F
Sbjct:    4 GGRFNFDDGGSYCGGWEDGKAHGHGVCTGPKGQGEYTGSWSHGFEVLGVYTWPSGNTYQGTWAQGKRHGIGLESKGKWVYKGEWTHGFKGRYGVRECTGNGAKYEGTWSNGLQDGYGTETYSDGGTYQGQWVGGMRQGYGVRQSVPYGMAAVIRSPLRTSINSLRSEHTNGAALHPDASPAV--AGSPAVSRGGFVLV-AHSDSEILKSK-KKGLFRRSLLSGLKLRKSESKSSLASQRSKQSSFRSEAGMSTVSSTASDIHSTISLGEAEAELAVIEDDIDATTTETYVGEWKNDKRSGFGVSQRSDGLKYEGEWVSNRRHGYGCMTFPDGTKEEGKYKQNVLVSG--KRKNLIPLRASKIREKVDRAVEAAERAATIAKQKAEIAAS-RTSHSRAKAEAALTAAQKAQEEARIARITAKEFSPSF 423          
BLAST of Junctophilin-1 vs. Ensembl Mouse
Match: Jph1 (junctophilin 1 [Source:MGI Symbol;Acc:MGI:1891495])

HSP 1 Score: 315.079 bits (806), Expect = 1.015e-93
Identity = 189/439 (43.05%), Postives = 264/439 (60.14%), Query Frame = 2
Query:  476 IEGGRFDFDDGGSYVGEWCDGRAHGLGIATGPENQGEFSGEWVMGFESRGVYIWPSGNIYAGGWMKGKRHGEGVQMKGKWIYKGEFTTGFCGRYGVKESLSSASKFEGSWHLNLFDGFGVETNADGSTYSGAWSKGVRQGLGVRKSAAYSKAATHKDP-----SSVRAATSQNSLLSANDSDRQAFVDDARRPIDHRSGFVLVTTNNNADINANKEKKPSFRKALF---RKLRKQKSTGDLRSARMGGSLRSTLS--SNSAASQATNHSLPDSLPIPSRESIDPNVIETYSGQWKEDKRAGYGVAERTDGAKYEGEWFNNKKDGYGVTHFPNGTKEEGRYKENVLVQTLHKRHKIFALRHSRLKDSXXXXXXXXXXXXXXXXXXXXXXXNQRAQTAKNSAETAEIKAKEAQKLSNHAREVAKEFAPDFIQLGVLWLKTR 1762
            + GGRFDFDDGG+Y G W +G+AHG GI TGP+ QGE+SG W  GFE  GVY WPSGN Y G W +GKRHG GV+ KGKW+Y+GE++ GF GRYGV++SL + +++EG+W   L DG+GVET  DG TY G W+ G+R G GVR+S  Y  A   + P     +S+R+  S  S+L       +A    A  P   R GFVL   N +AD    K+K   FR+       KLRK +S   + S R      + +S  S+S A+   +    D    P  + +D    ETY G+WK DKR G+G++ER++G KYEGEW NNK+ GYG T FP+G+KEEG+YK N+LV+ +  R ++  +R+++ ++   +      + AA      +E AN R   A+  A+ A+  A  A++  + AR VA+E +PDF Q G  ++K R
Sbjct:    1 MTGGRFDFDDGGTYCGGWEEGKAHGHGICTGPKGQGEYSGSWSHGFEVVGVYTWPSGNTYQGYWAQGKRHGLGVETKGKWMYRGEWSHGFKGRYGVRQSLCTPARYEGTWSNGLQDGYGVETYGDGGTYQGQWAGGMRHGYGVRQSVPYGMATVIRSPLRTSLASLRSEQSNGSVL------HEAAAAAADSPAGTRGGFVL---NFHADTELGKKKGGLFRRGSLLGSMKLRKSESKSSISSKRSSVRSDAAMSRISSSDANSTISFGDVDCDFCPVEDHVDATTTETYMGEWKNDKRNGFGISERSNGMKYEGEWANNKRHGYGCTVFPDGSKEEGKYKNNILVRGI--RKQLIPIRNTKTRE-KVDRAIEGAQRAAAMARTKVEIANSRTAHARAKADAADQAALAARQECDIARAVARELSPDFYQPGPDYIKQR 427          
BLAST of Junctophilin-1 vs. Ensembl Mouse
Match: Jph2 (junctophilin 2 [Source:MGI Symbol;Acc:MGI:1891496])

HSP 1 Score: 298.901 bits (764), Expect = 1.664e-87
Identity = 185/461 (40.13%), Postives = 263/461 (57.05%), Query Frame = 2
Query:  476 IEGGRFDFDDGGSYVGEWCDGRAHGLGIATGPENQGEFSGEWVMGFESRGVYIWPSGNIYAGGWMKGKRHGEGVQMKGKWIYKGEFTTGFCGRYGVKESLSSASKFEGSWHLNLFDGFGVETNADGSTYSGAWSKGVRQGLGVRKSAAYSKAATHKDP-----SSVRAATSQNSLLSANDSDRQAFVDDARRPIDHRSGFVLVTTNNNADINANKEKKPSFRKALFRKLRKQKSTGDLRSARMGGSLRSTLSSNSAASQATNHSLPDSLPIP------SRESIDPNVIETYSGQWKEDKRAGYGVAERTDGAKYEGEWFNNKKDGYGVTHFPNGTKEEGRYKENVLVQTLHKRHKIFALRHSRLKDSXXXXXXXXXXXXXXXXXXXXXXXNQRAQTAKNSAETAEIKAKEAQKLSNHAREVAKEFAPDFIQLGVLWLKTRNNIEGKLTGSVVFNNNFSLLD 1825
            + GGRFDFDDGG+Y G W  G+AHG G+ TGP+ QGE+SG W  GFE  GVY WPSGN + G W +GKRHG G++ KG+W+YKGE+T GF GRYG+++S +S +K+EG+W+  L DG+G ET ADG TY G ++ G+R G GVR+S  Y  A   + P     SS+R+  S  ++   + +     +     P   R GF L      A   A + +    R  L  +LR+ +S   L S R   S   +  S+ A+  A+  SL +    P          ID    ETY G+WK DKR+G+GV+ER+ G +YEGEW +N + GYG T  P+G +EEG+Y+ NVLV+   +R  +  L+ S+++  VE  V+ A  AAA A+++A   A++ +     +    +      Q+ SN AR +AKE APDF Q G  + K R   E       +  N+ SLL+
Sbjct:    1 MSGGRFDFDDGGAYCGGWEGGKAHGHGLCTGPKGQGEYSGSWNFGFEVAGVYTWPSGNTFEGYWSQGKRHGLGIETKGRWLYKGEWTHGFKGRYGIRQSTNSGAKYEGTWNNGLQDGYGTETYADGGTYQGQFTNGMRHGYGVRQSVPYGMAVVVRSPLRTSLSSLRSEHSNGTVAPDSPAADGPMLPSPPVP---RGGFALTLL---ATAEAARPQGLFTRGTLLGRLRRSESRTSLGSQRSRLSFLKSELSSGASDAASTGSLAEGAEGPDDAAAPFDADIDATTTETYMGEWKNDKRSGFGVSERSSGLRYEGEWLDNLRHGYGRTTLPDGHREEGKYRHNVLVKGTKRR--VLPLKSSKVRQKVEHGVEGAQRAAAIARQKAEIAASRTSHAKAKAEAAEQAALAANQE-SNIARTLAKELAPDFYQPGPEYQKRRLLQE-------ILENSESLLE 445          
BLAST of Junctophilin-1 vs. Ensembl Mouse
Match: Jph2 (junctophilin 2 [Source:MGI Symbol;Acc:MGI:1891496])

HSP 1 Score: 298.901 bits (764), Expect = 1.664e-87
Identity = 185/461 (40.13%), Postives = 263/461 (57.05%), Query Frame = 2
Query:  476 IEGGRFDFDDGGSYVGEWCDGRAHGLGIATGPENQGEFSGEWVMGFESRGVYIWPSGNIYAGGWMKGKRHGEGVQMKGKWIYKGEFTTGFCGRYGVKESLSSASKFEGSWHLNLFDGFGVETNADGSTYSGAWSKGVRQGLGVRKSAAYSKAATHKDP-----SSVRAATSQNSLLSANDSDRQAFVDDARRPIDHRSGFVLVTTNNNADINANKEKKPSFRKALFRKLRKQKSTGDLRSARMGGSLRSTLSSNSAASQATNHSLPDSLPIP------SRESIDPNVIETYSGQWKEDKRAGYGVAERTDGAKYEGEWFNNKKDGYGVTHFPNGTKEEGRYKENVLVQTLHKRHKIFALRHSRLKDSXXXXXXXXXXXXXXXXXXXXXXXNQRAQTAKNSAETAEIKAKEAQKLSNHAREVAKEFAPDFIQLGVLWLKTRNNIEGKLTGSVVFNNNFSLLD 1825
            + GGRFDFDDGG+Y G W  G+AHG G+ TGP+ QGE+SG W  GFE  GVY WPSGN + G W +GKRHG G++ KG+W+YKGE+T GF GRYG+++S +S +K+EG+W+  L DG+G ET ADG TY G ++ G+R G GVR+S  Y  A   + P     SS+R+  S  ++   + +     +     P   R GF L      A   A + +    R  L  +LR+ +S   L S R   S   +  S+ A+  A+  SL +    P          ID    ETY G+WK DKR+G+GV+ER+ G +YEGEW +N + GYG T  P+G +EEG+Y+ NVLV+   +R  +  L+ S+++  VE  V+ A  AAA A+++A   A++ +     +    +      Q+ SN AR +AKE APDF Q G  + K R   E       +  N+ SLL+
Sbjct:    1 MSGGRFDFDDGGAYCGGWEGGKAHGHGLCTGPKGQGEYSGSWNFGFEVAGVYTWPSGNTFEGYWSQGKRHGLGIETKGRWLYKGEWTHGFKGRYGIRQSTNSGAKYEGTWNNGLQDGYGTETYADGGTYQGQFTNGMRHGYGVRQSVPYGMAVVVRSPLRTSLSSLRSEHSNGTVAPDSPAADGPMLPSPPVP---RGGFALTLL---ATAEAARPQGLFTRGTLLGRLRRSESRTSLGSQRSRLSFLKSELSSGASDAASTGSLAEGAEGPDDAAAPFDADIDATTTETYMGEWKNDKRSGFGVSERSSGLRYEGEWLDNLRHGYGRTTLPDGHREEGKYRHNVLVKGTKRR--VLPLKSSKVRQKVEHGVEGAQRAAAIARQKAEIAASRTSHAKAKAEAAEQAALAANQE-SNIARTLAKELAPDFYQPGPEYQKRRLLQE-------ILENSESLLE 445          
BLAST of Junctophilin-1 vs. UniProt/SwissProt
Match: sp|Q9ET77|JPH3_MOUSE (Junctophilin-3 OS=Mus musculus OX=10090 GN=Jph3 PE=1 SV=1)

HSP 1 Score: 324.324 bits (830), Expect = 2.244e-95
Identity = 199/427 (46.60%), Postives = 270/427 (63.23%), Query Frame = 2
Query:  482 GGRFDFDDGGSYVGEWCDGRAHGLGIATGPENQGEFSGEWVMGFESRGVYIWPSGNIYAGGWMKGKRHGEGVQMKGKWIYKGEFTTGFCGRYGVKESLSSASKFEGSWHLNLFDGFGVETNADGSTYSGAWSKGVRQGLGVRKSAAYSKAATHKDP--SSVRAATSQNSLLSANDSDRQAFVDDARRPIDHRSGFVLVTTNNNADINANKEKKPSFRKALFR--KLRKQKSTGDLRSARMG-GSLRSTLSSNSAASQATNHSLPDSLPIPSRE------SIDPNVIETYSGQWKEDKRAGYGVAERTDGAKYEGEWFNNKKDGYGVTHFPNGTKEEGRYKENVLVQTLHKRHKIFALRHSRLKDSXXXXXXXXXXXXXXXXXXXXXXXNQRAQTAKNSAETAEIKAKEAQKLSNHAREVAKEFAPDF 1729
            GGRF+FDDGGSY G W DG+AHG G+ TGP+ QGE++G W  GFE  GVY WPSGN Y G W +GKRHG G++ KGKW+YKGE+T GF GRYGV+E   + +K+EG+W   L DG+G ET +DG TY G W  G+RQG GVR+S  Y  AA  + P  +S+ +  S+++  +A   D    V  A  P   R GFVLV  +++++I  +K KK  FR++L    KLRK +S   L S R    S RS    ++ +S A++     SL     E       ID    ETY G+WK DKR+G+GV++R+DG KYEGEW +N++ GYG   FP+GTKEEG+YK+NVLV    KR  +  LR S++++ V+ AV+ A  AA  AK++A   A+ R   ++  AE A   A++AQ+ +  AR  AKEF+P F
Sbjct:    4 GGRFNFDDGGSYCGGWEDGKAHGHGVCTGPKGQGEYTGSWSHGFEVLGVYTWPSGNTYQGTWAQGKRHGIGLESKGKWVYKGEWTHGFKGRYGVRECTGNGAKYEGTWSNGLQDGYGTETYSDGGTYQGQWVGGMRQGYGVRQSVPYGMAAVIRSPLRTSINSLRSEHTNGAALHPDASPAV--AGSPAVSRGGFVLV-AHSDSEILKSK-KKGLFRRSLLSGLKLRKSESKSSLASQRSKQSSFRSEAGMSTVSSTASDIHSTISLGEAEAELAVIEDDIDATTTETYVGEWKNDKRSGFGVSQRSDGLKYEGEWVSNRRHGYGCMTFPDGTKEEGKYKQNVLVSG--KRKNLIPLRASKIREKVDRAVEAAERAATIAKQKAEIAAS-RTSHSRAKAEAALTAAQKAQEEARIARITAKEFSPSF 423          
BLAST of Junctophilin-1 vs. UniProt/SwissProt
Match: sp|Q8WXH2|JPH3_HUMAN (Junctophilin-3 OS=Homo sapiens OX=9606 GN=JPH3 PE=1 SV=2)

HSP 1 Score: 321.627 bits (823), Expect = 2.182e-94
Identity = 198/427 (46.37%), Postives = 270/427 (63.23%), Query Frame = 2
Query:  482 GGRFDFDDGGSYVGEWCDGRAHGLGIATGPENQGEFSGEWVMGFESRGVYIWPSGNIYAGGWMKGKRHGEGVQMKGKWIYKGEFTTGFCGRYGVKESLSSASKFEGSWHLNLFDGFGVETNADGSTYSGAWSKGVRQGLGVRKSAAYSKAATHKDP--SSVRAATSQNSLLSANDSDRQAFVDDARRPIDHRSGFVLVTTNNNADINANKEKKPSFRKALFR--KLRKQKSTGDLRSARMG-GSLRSTLSSNSAASQATNHSLPDSLPIPSRE------SIDPNVIETYSGQWKEDKRAGYGVAERTDGAKYEGEWFNNKKDGYGVTHFPNGTKEEGRYKENVLVQTLHKRHKIFALRHSRLKDSXXXXXXXXXXXXXXXXXXXXXXXNQRAQTAKNSAETAEIKAKEAQKLSNHAREVAKEFAPDF 1729
            GGRF+FDDGGSY G W DG+AHG G+ TGP+ QGE++G W  GFE  GVY WPSGN Y G W +GKRHG G++ KGKW+YKGE+T GF GRYGV+E   + +K+EG+W   L DG+G ET +DG TY G W  G+RQG GVR+S  Y  AA  + P  +S+ +  S+++  +A   D    V  A  P   R GFVLV  +++++I  +K KK  FR++L    KLRK +S   L S R    S RS    ++ +S A++     SL     E       ID    ETY G+WK DKR+G+GV++R+DG KYEGEW +N++ GYG   FP+GTKEEG+YK+N+LV    KR  +  LR S++++ V+ AV+ A  AA  AK++A   A+ R   ++  AE A   A++AQ+ +  AR  AKEF+P F
Sbjct:    4 GGRFNFDDGGSYCGGWEDGKAHGHGVCTGPKGQGEYTGSWSHGFEVLGVYTWPSGNTYQGTWAQGKRHGIGLESKGKWVYKGEWTHGFKGRYGVRECAGNGAKYEGTWSNGLQDGYGTETYSDGGTYQGQWVGGMRQGYGVRQSVPYGMAAVIRSPLRTSINSLRSEHTNGTALHPDASPAV--AGSPAVSRGGFVLV-AHSDSEILKSK-KKGLFRRSLLSGLKLRKSESKSSLASQRSKQSSFRSEAGMSTVSSTASDIHSTISLGEAEAELAVIEDDIDATTTETYVGEWKNDKRSGFGVSQRSDGLKYEGEWASNRRHGYGCMTFPDGTKEEGKYKQNILVGG--KRKNLIPLRASKIREKVDRAVEAAERAATIAKQKAEIAAS-RTSHSRAKAEAALTAAQKAQEEARIARITAKEFSPSF 423          
BLAST of Junctophilin-1 vs. UniProt/SwissProt
Match: sp|Q9ET80|JPH1_MOUSE (Junctophilin-1 OS=Mus musculus OX=10090 GN=Jph1 PE=1 SV=1)

HSP 1 Score: 315.079 bits (806), Expect = 7.103e-93
Identity = 189/439 (43.05%), Postives = 264/439 (60.14%), Query Frame = 2
Query:  476 IEGGRFDFDDGGSYVGEWCDGRAHGLGIATGPENQGEFSGEWVMGFESRGVYIWPSGNIYAGGWMKGKRHGEGVQMKGKWIYKGEFTTGFCGRYGVKESLSSASKFEGSWHLNLFDGFGVETNADGSTYSGAWSKGVRQGLGVRKSAAYSKAATHKDP-----SSVRAATSQNSLLSANDSDRQAFVDDARRPIDHRSGFVLVTTNNNADINANKEKKPSFRKALF---RKLRKQKSTGDLRSARMGGSLRSTLS--SNSAASQATNHSLPDSLPIPSRESIDPNVIETYSGQWKEDKRAGYGVAERTDGAKYEGEWFNNKKDGYGVTHFPNGTKEEGRYKENVLVQTLHKRHKIFALRHSRLKDSXXXXXXXXXXXXXXXXXXXXXXXNQRAQTAKNSAETAEIKAKEAQKLSNHAREVAKEFAPDFIQLGVLWLKTR 1762
            + GGRFDFDDGG+Y G W +G+AHG GI TGP+ QGE+SG W  GFE  GVY WPSGN Y G W +GKRHG GV+ KGKW+Y+GE++ GF GRYGV++SL + +++EG+W   L DG+GVET  DG TY G W+ G+R G GVR+S  Y  A   + P     +S+R+  S  S+L       +A    A  P   R GFVL   N +AD    K+K   FR+       KLRK +S   + S R      + +S  S+S A+   +    D    P  + +D    ETY G+WK DKR G+G++ER++G KYEGEW NNK+ GYG T FP+G+KEEG+YK N+LV+ +  R ++  +R+++ ++   +      + AA      +E AN R   A+  A+ A+  A  A++  + AR VA+E +PDF Q G  ++K R
Sbjct:    1 MTGGRFDFDDGGTYCGGWEEGKAHGHGICTGPKGQGEYSGSWSHGFEVVGVYTWPSGNTYQGYWAQGKRHGLGVETKGKWMYRGEWSHGFKGRYGVRQSLCTPARYEGTWSNGLQDGYGVETYGDGGTYQGQWAGGMRHGYGVRQSVPYGMATVIRSPLRTSLASLRSEQSNGSVL------HEAAAAAADSPAGTRGGFVL---NFHADTELGKKKGGLFRRGSLLGSMKLRKSESKSSISSKRSSVRSDAAMSRISSSDANSTISFGDVDCDFCPVEDHVDATTTETYMGEWKNDKRNGFGISERSNGMKYEGEWANNKRHGYGCTVFPDGSKEEGKYKNNILVRGI--RKQLIPIRNTKTRE-KVDRAIEGAQRAAAMARTKVEIANSRTAHARAKADAADQAALAARQECDIARAVARELSPDFYQPGPDYIKQR 427          
BLAST of Junctophilin-1 vs. UniProt/SwissProt
Match: sp|Q9HDC5|JPH1_HUMAN (Junctophilin-1 OS=Homo sapiens OX=9606 GN=JPH1 PE=1 SV=2)

HSP 1 Score: 312.383 bits (799), Expect = 6.154e-92
Identity = 189/440 (42.95%), Postives = 263/440 (59.77%), Query Frame = 2
Query:  476 IEGGRFDFDDGGSYVGEWCDGRAHGLGIATGPENQGEFSGEWVMGFESRGVYIWPSGNIYAGGWMKGKRHGEGVQMKGKWIYKGEFTTGFCGRYGVKESLSSASKFEGSWHLNLFDGFGVETNADGSTYSGAWSKGVRQGLGVRKSAAYSKAATHKDP-----SSVRAATSQNSLLSANDSDRQAFVDDARRPIDHRSGFVLVTTNNNADIN-ANKEKKPSFRKALF---RKLRKQKSTGDLRSARMGGSLRSTLS--SNSAASQATNHSLPDSLPIPSRESIDPNVIETYSGQWKEDKRAGYGVAERTDGAKYEGEWFNNKKDGYGVTHFPNGTKEEGRYKENVLVQTLHKRHKIFALRHSRLKDSXXXXXXXXXXXXXXXXXXXXXXXNQRAQTAKNSAETAEIKAKEAQKLSNHAREVAKEFAPDFIQLGVLWLKTR 1762
            + GGRFDFDDGG+Y G W +G+AHG GI TGP+ QGE+SG W  GFE  G Y WPSGN Y G W +GKRHG GV+ KGKW+Y+GE++ GF GRYGV++SL + +++EG+W   L DG+GVET  DG TY G W+ G+R G GVR+S  Y  A   + P     +S+R+  S  S+L    +   +       P   R GFVL   N +AD   A K+K   FR+       KLRK +S   + S R      + +S  S+S A+   +    D    P  + +D    ETY G+WK DKR G+GV+ER++G KYEGEW NNK+ GYG T FP+G+KEEG+YK N+LV+ +  R ++  +RH++ ++   +      + AA      +E AN R   A+  A+ A+  A  A++  + AR VA+E +PDF Q G  ++K R
Sbjct:    1 MTGGRFDFDDGGTYCGGWEEGKAHGHGICTGPKGQGEYSGSWSHGFEVVGGYTWPSGNTYQGYWAQGKRHGLGVETKGKWMYRGEWSHGFKGRYGVRQSLCTPARYEGTWSNGLQDGYGVETYGDGGTYQGQWAGGMRHGYGVRQSVPYGMATVIRSPLRTSLASLRSEQSNGSVLHDAAAAADS-------PAGTRGGFVL---NFHADAELAGKKKGGLFRRGSLLGSMKLRKSESKSSISSKRSSVRSDAAMSRISSSDANSTISFGDVDCDFCPVEDHVDATTTETYMGEWKNDKRNGFGVSERSNGMKYEGEWANNKRHGYGCTVFPDGSKEEGKYKNNILVRGI--RKQLIPIRHTKTRE-KVDRAIEGAQRAAAMARTKVEIANSRTAHARAKADAADQAALAARQECDIARAVARELSPDFYQPGPDYVKQR 427          
BLAST of Junctophilin-1 vs. UniProt/SwissProt
Match: sp|Q9GKY8|JPH1_RABIT (Junctophilin-1 OS=Oryctolagus cuniculus OX=9986 GN=JPH1 PE=2 SV=1)

HSP 1 Score: 309.686 bits (792), Expect = 6.772e-91
Identity = 187/440 (42.50%), Postives = 262/440 (59.55%), Query Frame = 2
Query:  476 IEGGRFDFDDGGSYVGEWCDGRAHGLGIATGPENQGEFSGEWVMGFESRGVYIWPSGNIYAGGWMKGKRHGEGVQMKGKWIYKGEFTTGFCGRYGVKESLSSASKFEGSWHLNLFDGFGVETNADGSTYSGAWSKGVRQGLGVRKSAAYSKAATHKDP-----SSVRAATSQNSLLSANDSDRQAFVDDARRPIDHRSGFVLVTTNNNADIN-ANKEKKPSFRKALF---RKLRKQKSTGDLRSARMGGSLRSTLS--SNSAASQATNHSLPDSLPIPSRESIDPNVIETYSGQWKEDKRAGYGVAERTDGAKYEGEWFNNKKDGYGVTHFPNGTKEEGRYKENVLVQTLHKRHKIFALRHSRLKDSXXXXXXXXXXXXXXXXXXXXXXXNQRAQTAKNSAETAEIKAKEAQKLSNHAREVAKEFAPDFIQLGVLWLKTR 1762
            + GGRFDFDDGG+Y G W +G+AHG GI TGP+ QGE+SG W  GFE  G Y WPSGN Y G W +GKRHG GV+ KGKW+Y+GE++ GF GRYGV++SL + +++EG+W   L DG+GVET  DG TY G W+ G+R G GVR+S  Y  A   + P     +S+R+  S  S+L    +           P   R GFVL   N +AD   A K+K   FR+       KLRK +S   + S R      + +S  S+S A+   +    D    P  + +D    ETY G+WK DKR G+G++ER++G KYEGEW NNK+ GYG T FP+G+KEEG+YK N+LV+ +  R ++  +R+++ ++   +      + AA      +E AN R   A+  A+ A+  A  A++  + AR VA+E +PDF Q G  ++K R
Sbjct:    1 MTGGRFDFDDGGTYCGGWEEGKAHGHGICTGPKGQGEYSGSWSHGFEVVGGYTWPSGNTYQGYWAQGKRHGLGVETKGKWMYRGEWSHGFKGRYGVRQSLCTPARYEGTWSNGLQDGYGVETYGDGGTYQGQWAGGMRHGYGVRQSVPYGMATVIRSPLRTSLASLRSEQSNGSVLHDAAAAADT-------PTGTRGGFVL---NFHADAELAGKKKGGLFRRGSLLGSMKLRKSESKSSISSKRSSVRSDAAMSRISSSDANSTISFGDVDCDFCPVEDHVDATTTETYMGEWKNDKRNGFGISERSNGMKYEGEWANNKRHGYGCTVFPDGSKEEGKYKNNILVRGI--RKQLIPIRNTKTRE-KVDRAIEGAQRAAAMARTKVEIANSRTAHARAKADAADQAALAARQECDIARAVARELSPDFYQPGPDYIKQR 427          
BLAST of Junctophilin-1 vs. TrEMBL
Match: G4VRF7 (Putative junctophilin OS=Schistosoma mansoni OX=6183 GN=Smp_084090 PE=4 SV=1)

HSP 1 Score: 626.32 bits (1614), Expect = 0.000e+0
Identity = 437/1087 (40.20%), Postives = 584/1087 (53.73%), Query Frame = 2
Query:  470 SVIEGGRFDFDDGGSYVGEWCDGRAHGLGIATGPENQGEFSGEWVMGFESRGVYIWPSGNIYAGGWMKGKRHGEGVQMKGKWIYKGEFTTGFCGRYGVKESLSSASKFEGSWHLNLFDGFGVETNADGSTYSGAWSKGVRQGLGVRKSAAYSKAATHKDPSSVRAATSQNSLLSANDSDR---------QAFVDDAR------RPIDHRSGFVLVTTN----------------NNADINANKEKKPSFRKALFRKLRKQKSTGDL-----------------------RSARMGGSLRSTLSSNSAASQATNHSL-----------PDSLPIPSRESIDPNVIETYSGQWKEDKRAGYGVAERTDGAKYEGEWFNNKKDGYGVTHFPNGTKEEGRYKENVLVQTLHKRHKIFALRHSRLKDSXXXXXXXXXXXXXXXXXXXXXXXNQRAQTAKNSAETAEIKAKEAQKLSNHAREVAKEFAPDFIQLGVLWLKTRNNIEGKLTGSVVFNNNFSLLDNQKYLNQNYKPQQMDQLQPNLLNPSDP----ECLEVXXXXXXXXXXXX---------XXXXXEKRPN----------SPDPQNQKQTSSSKPLSGHNPNSNMTPQKPVASPTNVDCYSFEVPKIGHSVSEVAQQTPTTLLTSEPLIQRATATLTRQ--KAPQKIHSNI----INIQPQNPKKEGLHY-------------AIVQSGDVIKPQIAQXXXXXXXXXXXPRNVLVKEFDTGNDFFDYYSNNQN------------ELNDGNFIDYEYEERRKIENEVLESKATRLEE----RRRSVPSIMTSKPVTANLTSSVKY----PDNKYD-------------------IVHSSEILNS-TTSVYIIENGIRKRMKADENILPR------------QPPLSPKSNRLMGKRIQ-------------------------NPLNIEPEADELTPLPRNYKIESSHN-PHRKLEGSLPDVSY--------------CNEIKTKTGTLMSRQEASQLSQQRRQEILHEQERQRRGEIVIRMADIKDWFKQNFTIVLILLLNCVIAVGFLHIL 3133
            S +EGGRFDFDDGGSYVGEWC+GRAHGLGIATGPENQGE+SGEW MGFESRGVYIWPSGNIY+G W+KGKRHGEGVQ+KG+W+Y+G FTTGFCGRYG+KESL+S +K+EGSWHLN FDGFGVETN+DGS Y+GAWSKG+RQGLGVR+SA Y+ AA      +VRAA SQNSL S  DS+R              D R      RP + RSGFVL  T+                         EKK  F++++FRKLRKQKSTGDL                       R  R GGSLRS +S+   +SQ T +S               L     E + PNV ETYSGQW ED+R+GYGVAER+DG +Y GEWFNNKKDGYG T+  +GTKEEGRYKEN+LVQ L+++ K+F LRH++L+D++EEAVKNA +AA  A+E + E+A QRAQTA+  A TA+ +A+EA+KLS  AR +A+EF+P+F+QLG+LW K +N +  K       NN   L+   +  + N    Q   L+ N L P +       LEVSGGSR+GSFRSS           +  E  PN          + +P    Q   SK   G    +N+  Q      +      ++    G  ++  A  T  T L   P  Q+  A    Q   +P  I S      I ++PQN   +G  Y             A + S  +   ++ +  +  S      +  LV+  +T      Y  N Q             ++N+ +     +E+   +  E +    T L      RRR++PSIMT  P+     + +K     P+++ +                    VHS+E L +   + YIIENGIRKR++A+ +   +             P  + ++N L G R +                         N  + +PE+ +L PLP++Y IES  N P    E S+PD+S               C   +     +++R+E ++LSQ RRQE+ HE ER++RGEIVIR+ADIKDW   NF IV +LL+N  +A  F ++L
Sbjct:    4 SEMEGGRFDFDDGGSYVGEWCEGRAHGLGIATGPENQGEYSGEWNMGFESRGVYIWPSGNIYSGTWLKGKRHGEGVQIKGRWVYRGSFTTGFCGRYGIKESLTSCAKYEGSWHLNQFDGFGVETNSDGSIYAGAWSKGMRQGLGVRRSAPYALAAEFN--RTVRAAQSQNSLPSGTDSERGWKGTNSSGGGSGGDVRNSAERGRPDERRSGFVLRATSCPLPSSLSNNSRSSSSGYRSATPTTEKKSIFKRSIFRKLRKQKSTGDLSMVGGRSIGAFSTCGGSGGLFHSRGRRPGGSLRSNIST---SSQITTNSFGRGDVKAVGNGGQGLHEFMEEPLGPNVTETYSGQWNEDRRSGYGVAERSDGLRYAGEWFNNKKDGYGTTYRTDGTKEEGRYKENILVQALNRKSKLFMLRHTKLRDAIEEAVKNAEDAAKKAQESSYESAFQRAQTARTVAGTADARAREARKLSEEARAIAREFSPEFVQLGILWEK-QNPLMKKDVFGFSSNNEEDLIARGRRTDVNSLHAQ-GMLKENTLGPDNSAQIGNSLEVSGGSRQGSFRSSFRRRGNAAPGLQQNEHYPNDHYKYEDEMQTSNPNIDSQRYHSKEFHGVGKENNLNTQYRKQIDSQNATLGYQRSPAGRPIARAA-TTGFTGLGYSPSDQQQFAQHMAQHPHSPYLIASASQQLDIPVEPQNNPSKGFEYGTMPRAHNRPTDTASLHSPVINSAKLMKTGAHRSTEIRIDKTQLVQPCETYRAHVGYVDNFQTHNFQNMEMDFNGQINNEDMFMDNWEQESVLSKEPVPPPETPLSSINKVRRRTLPSIMTEPPIQVTRNACIKMGSQIPNSRRNETTKGSTLSSKLSSIIDDQTVHSAENLPADAAATYIIENGIRKRVQAETHHRQQNQRDKISKGSTGSPQKASETNYLEGSRPEWTTAYDPYRPAMENTGVITANRSGANKQHRDPESPDLLPLPKSYVIESIINLPGAVKEASMPDISTNRGHTAGRYDSPSRCTAAQQPVSGVLTREEVARLSQARRQELYHEMERRKRGEIVIRLADIKDWIHANFVIVFVLLINASLAFFFFNLL 1082          
BLAST of Junctophilin-1 vs. TrEMBL
Match: A0A095BXM5 (Junctophilin-1 OS=Schistosoma haematobium OX=6185 GN=MS3_01977 PE=4 SV=1)

HSP 1 Score: 621.313 bits (1601), Expect = 0.000e+0
Identity = 441/1086 (40.61%), Postives = 588/1086 (54.14%), Query Frame = 2
Query:  470 SVIEGGRFDFDDGGSYVGEWCDGRAHGLGIATGPENQGEFSGEWVMGFESRGVYIWPSGNIYAGGWMKGKRHGEGVQMKGKWIYKGEFTTGFCGRYGVKESLSSASKFEGSWHLNLFDGFGVETNADGSTYSGAWSKGVRQGLGVRKSAAYSKAATHKDPSSVRAATSQNSLLSANDSDR---------QAFVDDAR------RPIDHRSGFVLVTTN----------------NNADINANKEKKPSFRKALFRKLRKQKSTGDL-----------------------RSARMGGSLRSTLSSNSAASQATNHSL-----------PDSLPIPSRESIDPNVIETYSGQWKEDKRAGYGVAERTDGAKYEGEWFNNKKDGYGVTHFPNGTKEEGRYKENVLVQTLHKRHKIFALRHSRLKDSXXXXXXXXXXXXXXXXXXXXXXXNQRAQTAKNSAETAEIKAKEAQKLSNHAREVAKEFAPDFIQLGVLWLKTRNNIEGKLTGSVVFNNNFSLLDNQKYLNQNYKPQQMDQLQPNLLNPSDP----ECLEVXXXXXXXXXXXXXXXXXEKRP----NSPDP------QNQKQTSS---------SKPLSGHNPNSNMTPQKPVASPTNVDCYSFEVPKIGHSVSEVAQQTPTTL-LTSEPLIQRATATLTRQKAPQKIHSNI----INIQPQNPKKEGLHY-------------AIVQSGDVIKPQIAQXXXXXXXXXXXPRNVLVKEFDTGNDFFDYYSNNQ------------NELNDGNFIDYEYEERRKIENEVL---ESKATRLEERRR-SVPSIMTSKPVTANLTSSVK----YPDNKYD-------------------IVHSSEILNS-TTSVYIIENGIRKRMKAD-----ENILPRQ-------PPLSPKSNRLMGKRIQ-------------------------NPLNIEPEADELTPLPRNYKIES-SHNPHRKLEGSLPDVSY--------------CNEIKTKTGTLMSRQEASQLSQQRRQEILHEQERQRRGEIVIRMADIKDWFKQNFTIVLILLLNCVIAVGFLHIL 3133
            S +EGGRFDFDDGGSYVGEWC+GRAHGLGIATGPENQGE+SGEW MGFESRGVYIWPSGNIY+G W+KGKRHGEGVQ+KG+W+Y+G FTTGFCGRYG+KESL+S +K+EGSWHLN FDGFGVETN+DGS Y+GAWSKG+RQGLGVR+SA Y+ AA      +VRAA SQNSL S  DS+R              D R      RP + RSGFVL  T+                         EKK  F+++ FRKLRKQKSTGDL                       R  R GGSLRS LS+   +SQ T +S               L     E++ PNV ETYSGQW ED+R+GYGVAER+DG +Y GEWFNNKKDGYG+T+  +GTKEEGRYKEN+LVQ L+++ K+F LRH++L+D++EEAVKNA +AA  A+E + E+A QRAQTA+  A TA+ +A+EA+KLS  AR +A+EF+P+F+QLG++W K    ++  + G    NN   L    +  + N    Q   L+ N L P +       LEVSGGSR+GSFRSSFRR G   P    N   P      Q++ QTS+         SK   G    +N+  Q      +      ++    G  ++  A    T L   S    Q A        +P  I S      I I+PQN    G  Y             A + S  +   ++ +  +  S      +  LV+  +T      Y  N+Q             ++N+       +E+   +  E +   E+  + + + RR ++PSIMT  P+     +  K     P+++ +                    VHS+E L +   + YIIENGIRKR++A+     +N   R        P  + ++N L G R +                         N  + +PE+ +L PLP++Y IES  H P    E S+PD+S               C   +     +++R+E ++LSQ RRQE+ HE ER++RGEIVIR+ADIKDW   NF IV +LL+N  +A  F ++L
Sbjct:    4 SEMEGGRFDFDDGGSYVGEWCEGRAHGLGIATGPENQGEYSGEWNMGFESRGVYIWPSGNIYSGTWLKGKRHGEGVQIKGRWVYRGSFTTGFCGRYGIKESLTSCAKYEGSWHLNQFDGFGVETNSDGSIYAGAWSKGMRQGLGVRRSAPYALAAEFN--RTVRAAQSQNSLPSGTDSERGWKGTNSSGGGSGGDVRNSAERGRPDERRSGFVLRATSCPLPSSLSNNSRSSSSGYRSATPTTEKKSIFKRSFFRKLRKQKSTGDLSMVGGRSIGTFSTCGGSGGLFHSRGRRPGGSLRSNLST---SSQITTNSFGRGDVKAVGNGGQGLHEFMEETLGPNVTETYSGQWNEDRRSGYGVAERSDGLRYAGEWFNNKKDGYGITYRTDGTKEEGRYKENILVQGLNRKSKLFMLRHTKLRDAIEEAVKNAEDAAKKAQESSYESAFQRAQTARTVAGTADARAREARKLSEEARAIAREFSPEFVQLGIMWEKQNPLVKKDIFG-FSSNNEEDLTARGRRTDLNSLHTQ-GMLKENTLGPENSAQIGNSLEVSGGSRQGSFRSSFRRRGNAAPGLQQNEHYPNDHYKYQDEMQTSNPNIDSQRYHSKEFHGVGKENNLNTQYRKQIDSQNTTLRYQRSPAGRPIARAATTGFTGLGYPSSDQQQFAQHMAQHPHSPYLIASASQQLDIPIEPQNNSSRGFEYSTMPRTHNRPTDTASLHSPVINSAKLMKTGAHRSTEIRIDKTQLVQPCETYRAHIGYVDNSQIHDFQNMEMNFNGQINNEEMFMDNWEQESVLSKEPVPPPETPLSSINKVRRRTLPSIMTEPPIQLTRNAYTKLGSQMPNSRRNETTKGSTLSSKLSSIIDDQTVHSAENLPADAAATYIIENGIRKRVQAETHHRQQNQRDRTSTGPTGLPQKASETNYLEGSRPEWTTAYDPYRPAMENTGVITVNRSGTNKQHHDPESPDLLPLPKSYVIESIVHLPGAVKEASMPDISINRGHTAGRYDSPSRCTAAQQPVSGVLTREEVARLSQARRQELYHEMERRKRGEIVIRLADIKDWINANFVIVFVLLINASLAFFFFNLL 1082          
BLAST of Junctophilin-1 vs. TrEMBL
Match: A0A0X3NXT2 (Junctophilin-3 OS=Schistocephalus solidus OX=70667 GN=JPH3 PE=4 SV=1)

HSP 1 Score: 530.02 bits (1364), Expect = 6.518e-167
Identity = 282/489 (57.67%), Postives = 354/489 (72.39%), Query Frame = 2
Query:  467 MSVIEGGRFDFDDGGSYVGEWCDGRAHGLGIATGPENQGEFSGEWVMGFESRGVYIWPSGNIYAGGWMKGKRHGEGVQMKGKWIYKGEFTTGFCGRYGVKESLSSASKFEGSWHLNLFDGFGVETNADGSTYSGAWSKGVRQGLGVRKSAAYSKAATHKDPSSVRAATSQNSLLSANDSDRQAFV------------DDARRPIDHRSGFVLVTTNNNADINANK-----------EKKPSFRKALFRKLRKQKSTGDLRSA------------------------RMGGSLRSTLSSNSAASQATNHSLPD----------SLPIPSR--ESIDPNVIETYSGQWKEDKRAGYGVAERTDGAKYEGEWFNNKKDGYGVTHFPNGTKEEGRYKENVLVQTLHKRHKIFALRHSRLKDSXXXXXXXXXXXXXXXXXXXXXXXNQRAQTAKNSAETAEIKAKEAQKLSNHAREVAKEFAPDFIQLGVLWLK 1756
            M+  EGGRFDFDDGGSYVGEWC+GRAHGLGIATGP+NQGE+SGEW+MGFESRGVY+WPSGNIYAGGW+KGKRHGEGVQ+KG+WIY+G FT GFCGRYG+KESL++ +++EGSWHLN FDGFGVETN+DGSTY+G WSKG+RQGLGVRKSA Y  A+  ++  +VRA+ SQ+SL SA DS+R                D +R  +  RSGFVL +++     +  +           +KK SFRK L RKLRK KSTGDL S                         R GGSLRS +   S  SQ T++S+ D            PI     E + PNV ETYSGQW ED+R+GYGVAER+DG +YEGEWFNNKKDG+GVT+ P+GTKEEGRYKEN+LVQ+L KR+K++ LRHS+LK+S+EEAV+ A EAA +A+E++ E A+QRAQ+A++ A ++E KA+EA++LS  AR +A+EFA DFIQ+G+ W K
Sbjct:    1 MAGAEGGRFDFDDGGSYVGEWCEGRAHGLGIATGPDNQGEYSGEWIMGFESRGVYVWPSGNIYAGGWLKGKRHGEGVQVKGRWIYRGAFTAGFCGRYGIKESLTTCARYEGSWHLNQFDGFGVETNSDGSTYAGGWSKGMRQGLGVRKSAPYGLAS--ENNRAVRASQSQSSLPSAQDSERGWRGVGSSGSGNGDQPDRSRSELAIRSGFVLRSSSQPIGGSPPRGMRDFRSPSPSDKKTSFRKFLMRKLRKPKSTGDLSSVGPHTVGGLSATGTPSLGRFHLGIPRPGGSLRSNI---SGGSQLTSNSVLDHQSRYFAASGGTPIVDTLDEPLTPNVTETYSGQWNEDRRSGYGVAERSDGLRYEGEWFNNKKDGFGVTYHPDGTKEEGRYKENILVQSLSKRNKLYLLRHSKLKESLEEAVRKANEAAKEAQEKSAEVAHQRAQSARSVATSSEGKAEEARRLSEQARTIAREFASDFIQMGIQWEK 484          

HSP 2 Score: 110.923 bits (276), Expect = 7.964e-21
Identity = 84/253 (33.20%), Postives = 127/253 (50.20%), Query Frame = 2
Query: 2522 SKATRLEERRRSVPSI-MTSKPVTANLT-------SSVKYPDNKYDIVHSSE-ILNSTTSVYIIENGIRKRMKADEN----ILP-------RQP--------PLSP---------KSNRLMGKRIQNPL----NIEPEADELTPLPRNYKIESSHNPHRKLEGSLPDVS--YCNEIKTKTGT------LMSRQEASQLSQQRRQEILHEQERQRRGEIVIRMADIKDWFKQNFTIVLILLLNCVIAVGFLHIL 3133
            S ATR   R  S+P    TS P TA LT       S++       +  HS+E +       YIIE+GIRKR++   +    + P       R P         L P         +     G+R+ N       ++ ++ ++  +P  Y IE   N    ++ S+PDVS    + +    GT      L++R E S+LSQQRRQEIL E ER++RGEI+IR+ADIKDW + NF +V++LL+N  +A  F++++
Sbjct:  722 SNATR-SSREASIPQARFTSSPKTAMLTGRPGDKRSTLPSRGASLETTHSTENLAEEELERYIIEDGIRKRVQPTRSPQRQLNPGTVVTGYRHPRAGTLERRDLGPTRLHDLDETRQGSFTGRRLGNGFPEVSQVDYDSRDVADMPDAYIIEPVPNAATCVDTSMPDVSKHLVDGLGGIGGTRLGISGLLTRDEVSRLSQQRRQEILLEMERKKRGEIIIRLADIKDWVRANFVVVIVLLINACLAFLFINLV 973          
BLAST of Junctophilin-1 vs. TrEMBL
Match: A0A0R3W685 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS5689 PE=4 SV=2)

HSP 1 Score: 521.546 bits (1342), Expect = 8.062e-164
Identity = 281/489 (57.46%), Postives = 351/489 (71.78%), Query Frame = 2
Query:  467 MSVIEGGRFDFDDGGSYVGEWCDGRAHGLGIATGPENQGEFSGEWVMGFESRGVYIWPSGNIYAGGWMKGKRHGEGVQMKGKWIYKGEFTTGFCGRYGVKESLSSASKFEGSWHLNLFDGFGVETNADGSTYSGAWSKGVRQGLGVRKSAAYSKAATHKDPSSVRAATSQNSLLSANDSDR-----QAFVDDARRPIDH---------RSGFVLVTTNNNADI--------------NANKEKKPSFRKALFRKLRKQKSTGDLRSA----------------------RMGGSLRSTLSSNSAASQATNH-SLPDSLPIPSRESID----PNVIETYSGQWKEDKRAGYGVAERTDGAKYEGEWFNNKKDGYGVTHFPNGTKEEGRYKENVLVQTLHKRHKIFALRHSRLKDSXXXXXXXXXXXXXXXXXXXXXXXNQRAQTAKNSAETAEIKAKEAQKLSNHAREVAKEFAPDFIQLGVLWLKTRNN 1768
            M+  EGGRFDFDDGGSYVGEWC+ RAHG GIATGP+NQGE+SGEW MGFESRGVY+WPSGN+YAGGW+KGKRHGEGVQ+KG+WIY+G FT+GF GRYGVKESL++ +++EGSWHLN FDGFGVETN+DGS Y+GAWSKG+RQGLGVRKSA +  AA H   S+VRAA SQ+SL S +DSDR           +   +DH         RSGFVL  T+                   +++ +++ S ++ L RKLRK KSTGDL S                       R GGSLRS +S  +  S    H S  DS  I   +++D    PNV ETYSGQW ED+R+GYGVAER+DG +YEGEWFNNKKDGYGVT+ P+G++EEGRYKEN++VQ L KR K++ LRHS+LKD+VEEAV+ A E+A +A+E++ ETA+QRAQTA++ A+TAEI+A+EA+ +S+ AR +A EFA DFIQ+GV W   RNN
Sbjct:    1 MATAEGGRFDFDDGGSYVGEWCENRAHGFGIATGPDNQGEYSGEWNMGFESRGVYVWPSGNLYAGGWLKGKRHGEGVQIKGRWIYRGAFTSGFYGRYGVKESLTTCARYEGSWHLNQFDGFGVETNSDGSIYAGAWSKGMRQGLGVRKSAPWGLAAEHH--STVRAAQSQSSLPSTHDSDRGGWRGPGSSGGSAGSVDHIHGGRFETFRSGFVLKATSYPPGATPPPSRSQSAAPFRSSSNDRRTSLKQFLLRKLRKPKSTGDLSSVGPHTIGGPGSAGSGRFGGMHGPRTGGSLRSNISGVTGNSMFVEHQSRADSAGIGVTDTLDEPLGPNVTETYSGQWNEDRRSGYGVAERSDGLRYEGEWFNNKKDGYGVTYHPDGSREEGRYKENIIVQPLMKRTKLYLLRHSKLKDNVEEAVRKARESAKEAQEKSAETAHQRAQTARSVAKTAEIRAEEAKNISDQARSIATEFASDFIQMGVQW--ERNN 485          

HSP 2 Score: 95.5153 bits (236), Expect = 5.592e-16
Identity = 70/188 (37.23%), Postives = 96/188 (51.06%), Query Frame = 2
Query: 2624 NKYDIVHSSEILNSTTSVYIIENGIRKRM---KADE--------------NILPRQPPLSP--------KSNRLMGKR-IQNPLNIEPEADELTPLPRNYKIESSHNPHRK-LEGSLPDVSYCNE-----------IKTKTGTLMSRQEASQLSQQRRQEILHEQERQRRGEIVIRMADIKDWFKQNF 3073
            N  D+ HSSE L  T   YIIE+G++KR+   +A E                L R   +SP        ++ RL G   + + L  + +  EL PLP  YKIES  N     LE S+PDVS   E           ++   G L++R E  +L QQRR E+L ++ER++RGEI+IR+ADIKDW   N 
Sbjct:  755 NLDDVHHSSENLVET---YIIEDGVKKRVQPTRASEASGLLAKGNAPSAAGTLRRGHAVSPDRRLKSGDEARRLAGGTGVPHRLETDFDTGELLPLPDAYKIESVGNLRTGGLETSMPDVSKGVEGMLLSKGGPGSVRLGIGGLLTRDEVCRLGQQRRHELLLDRERKKRGEIIIRLADIKDWLCANI 939          
BLAST of Junctophilin-1 vs. TrEMBL
Match: A0A4Z2CXS7 (Junctophilin-1 OS=Schistosoma japonicum OX=6182 GN=EWB00_006522 PE=4 SV=1)

HSP 1 Score: 523.472 bits (1347), Expect = 2.762e-163
Identity = 278/492 (56.50%), Postives = 347/492 (70.53%), Query Frame = 2
Query:  476 IEGGRFDFDDGGSYVGEWCDGRAHGLGIATGPENQGEFSGEWVMGFESRGVYIWPSGNIYAGGWMKGKRHGEGVQMKGKWIYKGEFTTGFCGRYGVKESLSSASKFEGSWHLNLFDGFGVETNADGSTYSGAWSKGVRQGLGVRKSAAYSKAATHKDPSSVRAATSQNSLLSANDSDR---------QAFVDDAR------RPIDHRSGFVLVTTN----------------NNADINANKEKKPSFRKALFRKLRKQKSTGDL-----------------------RSARMGGSLRSTLSSNSAASQATNHSL-----------PDSLPIPSRESIDPNVIETYSGQWKEDKRAGYGVAERTDGAKYEGEWFNNKKDGYGVTHFPNGTKEEGRYKENVLVQTLHKRHKIFALRHSRLKDSXXXXXXXXXXXXXXXXXXXXXXXNQRAQTAKNSAETAEIKAKEAQKLSNHAREVAKEFAPDFIQLGVLWLK 1756
            +EGGRFDFDDGGSYVGEWC+GRAHGLGIATGPENQGE+SGEW MGFESRGVYIWPSGNIY+G W+KGKRHGEGVQ+KG+W+Y+G FTTGFCGRYG+KESL+S +K+EGSWHLN FDGFGVETN+DGS Y+GAWSKG+RQGLGVR+SA Y+ AA      +VRA+ SQNSL S  DS+R              D R      RP + RSGFVL +T+                          KK  F++++F+KLRKQKSTGDL                       R  R GGSLRS +S+   +SQ T +S               L     E++ PNV ETYSGQW ED+R+GYGVAER+DG +Y GEWFNNKKDGYGVT+  +GTKEEGRYKEN+L+Q L+++ K+F LRH++L+D++EEAVKNA +AA  A+E + E+A QRAQTA+  A TA+++A+EA+KLS  AR +A+EF+P+F+QLG++W K
Sbjct:    6 LEGGRFDFDDGGSYVGEWCEGRAHGLGIATGPENQGEYSGEWNMGFESRGVYIWPSGNIYSGTWLKGKRHGEGVQIKGRWVYRGSFTTGFCGRYGIKESLTSCAKYEGSWHLNQFDGFGVETNSDGSVYAGAWSKGMRQGLGVRRSAPYALAAEFS--RTVRASQSQNSLPSGTDSERGWRGTNSSGGGSGGDVRNSVERGRPDERRSGFVLRSTSCPLPSPLSNNSRSSSSGYRSATPTTGKKSIFKRSIFKKLRKQKSTGDLSMVGGRAVGTFSTGGGSGGLFHGRGRRPGGSLRSNIST---SSQITTNSFGRNDVKAVGNGGQGLHEFMEETLGPNVTETYSGQWNEDRRSGYGVAERSDGLRYAGEWFNNKKDGYGVTYRTDGTKEEGRYKENILIQALNRKSKLFMLRHTKLRDAIEEAVKNAEDAAKKAQESSYESAYQRAQTARTVAGTADLRAREARKLSEEARAIAREFSPEFVQLGLMWEK 492          

HSP 2 Score: 129.413 bits (324), Expect = 1.828e-26
Identity = 105/340 (30.88%), Postives = 158/340 (46.47%), Query Frame = 2
Query: 2390 LVKEFDTGNDFFDYYSNNQN------------ELNDGNFIDYEYEERRKIENEVLESKATRLEE----RRRSVPSIMTSKPV----TANLTSSVKYPDNKYD-------------------IVHSSEILNSTTS-VYIIENGIRKRMKAD--------ENILPRQPPLSP----KSNRLMGKRIQ-------------------------NPLNIEPEADELTPLPRNYKIESS-HNPHRKLEGSLPDVSY--------CNEI-KTKTGTL-----MSRQEASQLSQQRRQEILHEQERQRRGEIVIRMADIKDWFKQNFTIVLILLLNCVIAVGFLHIL 3133
            LV+  +T      Y +N+Q             + N+   I   +E+   +  E +    T L      RRR++PSIMT  P+     A   + ++ P+ + +                    VHS+E L +  +  YIIENGIRKR++A+         N +   P  SP    ++N   G R +                         N  + +PE  +L+PLP++Y IES  H P    E S+PD+S         C+   K +TG       ++R+E ++LSQ RRQEI HE ER++RGEIVIR+ADIKDW + NF IV +LL+N  +A  F ++L
Sbjct:  740 LVQPLETHRAHISYVNNSQTHNYQQLEVNINGQFNNDEAIGDNWEQESVLSKEPVSPSGTILTAVSKVRRRTLPSIMTEPPIQTTRNACNKAGLQLPNTRINSTTKGSTHNSNLGCIIDDQTVHSAENLPADAADTYIIENGIRKRVQAETHHRQQNQRNRITTGPTGSPIKASENNYSEGSRPEWTTAYDPYRPAMENTGVVTANRYGINNQHSDPETSDLSPLPKSYLIESIIHLPGDVKEASMPDISMTHGHASGQCDSSSKRRTGQYPVSGELTREEIARLSQARRQEIYHEMERRKRGEIVIRLADIKDWIRANFVIVFVLLINASLAFFFFNLL 1079          
BLAST of Junctophilin-1 vs. Ensembl Cavefish
Match: jph1b (junctophilin-1 [Source:NCBI gene;Acc:103024555])

HSP 1 Score: 318.161 bits (814), Expect = 7.574e-95
Identity = 191/446 (42.83%), Postives = 274/446 (61.43%), Query Frame = 2
Query:  476 IEGGRFDFDDGGSYVGEWCDGRAHGLGIATGPENQGEFSGEWVMGFESRGVYIWPSGNIYAGGWMKGKRHGEGVQMKGKWIYKGEFTTGFCGRYGVKESLSSASKFEGSWHLNLFDGFGVETNADGSTYSGAWSKGVRQGLGVRKSAAYSKAATHKDP-----SSVRAATSQNSLLSANDSDRQAFVDDARRPIDHRSGFVLVTTNNNADINANKEKKPSFRK-ALF---RKLRKQKSTGDLRSARMGGSLRSTLSSNSAASQATNHSLPDSLP----IPSRESIDPNVIETYSGQWKEDKRAGYGVAERTDGAKYEGEWFNNKKDGYGVTHFPNGTKEEGRYKENVLVQTLHKRHKIFALRHSRLKDSXXXXXXXXXXXXXXXXXXXXXXXNQRAQTAKNSAETAEIKAKEAQKLSNHAREVAKEFAPDFIQLGVLWLKTRNNIE 1774
            + GGRFDFDDGG+Y G W DG+AHG GI TGP+ QGE+SG W  GFE  GVY WPSGN Y G W +GKRHG GV+ KG+W+Y+GE+T GF GRYGV++SL++ +++EG+W   L DG+GVET  DG TY G W  G+R G GVR+S  Y  A   + P     +S+R+  S  S+L    +D          P   R GFVL   ++++++     KK  FR+ +LF   ++LRK  S   + S R      +T+S  S++   +  S  +        P  +++D    E Y G+WK DKR G+GV+ER++G KYEGEW NNK+ GYG T FP+GT+EEG+YK NVLV+ + K  ++  L++++ K  V+ AV+ A+ AAA AK +     ++ A  A+   E A+  +  A + S+ AR VA++ +P+F Q G  ++K R + E
Sbjct:    1 MTGGRFDFDDGGTYCGGWEDGKAHGHGICTGPKGQGEYSGSWSSGFEVVGVYTWPSGNTYQGHWAQGKRHGLGVESKGRWLYRGEWTHGFKGRYGVRQSLNTPARYEGTWSNGLQDGYGVETYGDGGTYQGQWMGGMRHGYGVRQSVPYGMATVIRSPLRTSLASLRSEQSNGSVLHERLTD---------SPAGTRGGFVL-NFHSDSELGGPARKKGLFRRGSLFGSLKQLRKSDSRSSISSKRSSARSDATMSRISSSDANSTISFGEGEGADEYTPMEDNVDATTTEAYMGEWKNDKRNGFGVSERSNGMKYEGEWTNNKRHGYGCTMFPDGTREEGKYKNNVLVRGIKK--QLIPLKNTKTKQKVDRAVEGAIRAAAIAKTKVEIATSRTAH-ARAKGEAADQASLSACQNSDVARAVARDLSPNFHQPGPDYIKQRFSSE 433          
BLAST of Junctophilin-1 vs. Ensembl Cavefish
Match: jph3 (junctophilin 3 [Source:NCBI gene;Acc:103038422])

HSP 1 Score: 317.005 bits (811), Expect = 7.025e-94
Identity = 205/495 (41.41%), Postives = 287/495 (57.98%), Query Frame = 2
Query:  482 GGRFDFDDGGSYVGEWCDGRAHGLGIATGPENQGEFSGEWVMGFESRGVYIWPSGNIYAGGWMKGKRHGEGVQMKGKWIYKGEFTTGFCGRYGVKESLSSASKFEGSWHLNLFDGFGVETNADGSTYSGAWSKGVRQGLGVRKSAAYSKAATHKDP-----SSVRAATSQNSLLSANDSDRQAFVDDAR----RPIDHRSGFVLVTTNNNADINANKEKKPSFRKALFR--KLRKQKSTGDLRSARMG-GSLRSTLSSNSAASQATNHSLPDSL-----PIPS-RESIDPNVIETYSGQWKEDKRAGYGVAERTDGAKYEGEWFNNKKDGYGVTHFPNGTKEEGRYKENVLVQTLHKRHKIFALRHSRLKDSXXXXXXXXXXXXXXXXXXXXXXXNQRAQTAKNSAETAEIKAKEAQKLSNHAREVAKEFAPDFIQL--GVLWLKTRNNIEGKLTGSVVFNNNFSLLDNQKYLNQNYKPQQMDQLQPNLLNPSDP 1906
            GGRF+FDDGGSY G W +G+AHG GI TGP+ QGE++G W  GFE  GVY WPSGN Y G W +GKRHG G++ KGKW+YKGE+T GF GRYGV+ES  ++ K+EG+W+  L DG+G ET +DG TY G W  G+R G G+R+S  Y  AA  + P     +S+R+  S  + L A +                P   R GFVL T ++ A++   K+ K  FR++L    KLRK +S   L S R    S RS    ++ +S A++ +   SL      +P+  E +D    E+Y+G+WK DKR G GV+ R+DG  Y+GEW  NK+ GYG T FP+GTKEEG+YK+NVLV    KR  +  LR S++++ V+ AV+ A +AA  AK+++    ++ A  A+  AE A   A++AQ+    AR  AKEF+P F     GV   + ++    +  G V+ +      D   Y+  +  P     + P    PS P
Sbjct:    4 GGRFNFDDGGSYCGGWEEGKAHGHGICTGPKGQGEYAGSWSHGFEVLGVYTWPSGNTYQGTWAQGKRHGIGLENKGKWVYKGEWTHGFKGRYGVRESTGASGKYEGTWNNGLQDGYGTETYSDGGTYQGQWVGGMRHGYGIRQSVPYGMAAVIRSPLRTSINSLRSEHSNGTALLAGERAGVGPGVGPGSLVASPAVSRGGFVL-TAHSEAELLKGKKNKGLFRRSLLSGLKLRKSESKSSLASQRSKQSSFRSEAGMSTVSSAASDINSTISLGEGESELPAGEEDVDATATESYAGEWKNDKRTGCGVSRRSDGLCYQGEWMGNKRHGYGCTTFPDGTKEEGKYKQNVLVSG--KRKHLIPLRASKIREKVDRAVEGAEKAADIAKQKSEIALSRTAH-ARGKAEAAIAAAQKAQEECRLARVAAKEFSPSFQHRGNGVECQRPKHQHSSENDGEVISSGTPDSTD--LYMKGSTPPDLTPDISPVPSRPSTP 492          
BLAST of Junctophilin-1 vs. Ensembl Cavefish
Match: si:ch211-146m13.3 (junctophilin-3-like [Source:NCBI gene;Acc:103045469])

HSP 1 Score: 316.235 bits (809), Expect = 1.585e-93
Identity = 190/430 (44.19%), Postives = 261/430 (60.70%), Query Frame = 2
Query:  482 GGRFDFDDGGSYVGEWCDGRAHGLGIATGPENQGEFSGEWVMGFESRGVYIWPSGNIYAGGWMKGKRHGEGVQMKGKWIYKGEFTTGFCGRYGVKESLSSASKFEGSWHLNLFDGFGVETNADGSTYSGAWSKGVRQGLGVRKSAAYSKAATHKDP--SSVRAATSQNSLLSANDSDRQAFVDDARRPIDHRSGFVLVTTNNNADINANKEKKPSFRKALFR--KLRKQKSTGDL------RSARMGGSLRSTLSSNSAASQATNHSLPDSLPIPSRESIDPNVIETYSGQWKEDKRAGYGVAERTDGAKYEGEWFNNKKDGYGVTHFPNGTKEEGRYKENVLVQTLHKRHKIFALRHSRLKDSXXXXXXXXXXXXXXXXXXXXXXXNQRAQTAKNSAETAEIKAKEAQKLSNHAREVAKEFAPDFIQLG 1741
            GGRFDFDDGGSY G W  G+AHG G+ TGP+ QGE++G W  GFE  G Y WPSGN Y G W +GKRHG GV+ KG+W YKGE+T GF GRYG  ES  S +++EG+W   L DG+G ET +DG T+ G W  G+R G GVR+S  Y  AA    P  +S+ +  S++S  +    D  A    A  P+  R GFVL      +D    +++K  FR+++    KLR+ +S   L      +S+    +  ST+SS +A+   +N SL D   +    S+D  V ETY G+W+ D R G+G++ R+DG +YEGEWF NK+ GYG T FP+GTKEEG+YK+NVLV    KR  +  LR S++++ V+ AV+ A +AA  AK+++    + R   A+  AE AE  A+ A +    AR +AKE +P F   G
Sbjct:    4 GGRFDFDDGGSYCGGWEQGKAHGQGVCTGPQGQGEYAGAWSHGFEVLGAYTWPSGNSYQGTWAQGKRHGIGVETKGRWEYKGEWTQGFKGRYGRLESTGSGARYEGTWSNGLQDGYGSETYSDGGTFQGQWLSGMRHGYGVRQSVPYGMAAVIFSPLRTSINSLRSEHSEGAPKPDDGSAVSGVAGSPVG-RGGFVLCA---QSDAERQRKRKGRFRQSILSGLKLRRSESKSSLASQLSKQSSFCSEAGMSTVSS-AASDINSNVSLGD---VEMGGSVDATVTETYVGEWRNDMRTGWGISHRSDGLRYEGEWFGNKRHGYGCTTFPDGTKEEGKYKQNVLVSG--KRKNLIPLRTSKIREKVDRAVEAAEKAAEIAKQKSEIALS-RTSHARGKAEAAEGVAQRALEECRLARIIAKELSPSFHHYG 422          
BLAST of Junctophilin-1 vs. Ensembl Cavefish
Match: jph1a (junctophilin-1-like [Source:NCBI gene;Acc:103033137])

HSP 1 Score: 314.309 bits (804), Expect = 1.588e-93
Identity = 184/433 (42.49%), Postives = 264/433 (60.97%), Query Frame = 2
Query:  476 IEGGRFDFDDGGSYVGEWCDGRAHGLGIATGPENQGEFSGEWVMGFESRGVYIWPSGNIYAGGWMKGKRHGEGVQMKGKWIYKGEFTTGFCGRYGVKESLSSASKFEGSWHLNLFDGFGVETNADGSTYSGAWSKGVRQGLGVRKSAAYSKAATHKDPSSVRAATSQNSLLSANDSDRQAFVDDARRPIDHRSGFVLVTTNNNADINANKEKKPSF--RKALFRKLRKQKSTGDLRSARMGGSLRSTLSSNSAASQATNHSLPDSLP--IPSRESIDPNVIETYSGQWKEDKRAGYGVAERTDGAKYEGEWFNNKKDGYGVTHFPNGTKEEGRYKENVLVQTLHKRHKIFALRHSRLKDSXXXXXXXXXXXXXXXXXXXXXXXNQRAQTAKNSAETAEIKAKEAQKLSNHAREVAKEFAPDFIQLGVLWLKTR 1762
            + GGRFDFDDGG+Y G W DG+AHG GI TGP+ QGE++G W  GFE  GVY WPSGN Y G W +GKRHG GV+ KG+W+Y+GE++ GF GRYGV++  ++ ++++G+W   L DG+GVET ADG TY G W  G+R G GVR+S  Y  A   + P      TS  SL S   +          +P+  R GFVL   ++ A+  A  +KKP    R +LF  LR+ + +    S     S   +  S+S  + + ++   ++    +P  +++D    ETY G+WK DKR G+G++ER++G KYEGEW NNK++GYG T FP+GT+EEG+YK NVLV+ +  R +I  L++ + K+ VE AV+ A   AA A+ +     + R   A+  +E A+  A  A   S+ AR VA+E +P F Q G  ++K +
Sbjct:    1 MTGGRFDFDDGGTYCGGWEDGKAHGHGICTGPQGQGEYAGAWSHGFEIVGVYTWPSGNTYQGYWSQGKRHGLGVETKGRWMYRGEWSHGFKGRYGVRQGSNTPARYDGTWSNGLQDGYGVETYADGGTYQGQWMGGMRHGYGVRQSVPYGMAMVIRSP----LRTSLASLRSVQSNGVVMPDTTGEQPVSTRGGFVL-NFHSEAEAQAGGKKKPGLFRRGSLFGSLRQLRKSESKSSISSKRSSAMSRISSSDGNSSISYGEGEAQEEFLPMEDNVDATTTETYMGEWKNDKRNGFGISERSNGMKYEGEWLNNKRNGYGCTIFPDGTREEGKYKNNVLVRGI--RKQIIPLKNPKTKEKVERAVEGARRGAAIARMKVEIATS-RTTHARAKSEAADQAAVAAGHESDLARAVARELSPSFHQPGPDYIKQK 425          
BLAST of Junctophilin-1 vs. Ensembl Cavefish
Match: jph3 (junctophilin 3 [Source:NCBI gene;Acc:103038422])

HSP 1 Score: 317.39 bits (812), Expect = 3.484e-93
Identity = 205/495 (41.41%), Postives = 287/495 (57.98%), Query Frame = 2
Query:  482 GGRFDFDDGGSYVGEWCDGRAHGLGIATGPENQGEFSGEWVMGFESRGVYIWPSGNIYAGGWMKGKRHGEGVQMKGKWIYKGEFTTGFCGRYGVKESLSSASKFEGSWHLNLFDGFGVETNADGSTYSGAWSKGVRQGLGVRKSAAYSKAATHKDP-----SSVRAATSQNSLLSANDSDRQAFVDDAR----RPIDHRSGFVLVTTNNNADINANKEKKPSFRKALFR--KLRKQKSTGDLRSARMG-GSLRSTLSSNSAASQATNHSLPDSL-----PIPS-RESIDPNVIETYSGQWKEDKRAGYGVAERTDGAKYEGEWFNNKKDGYGVTHFPNGTKEEGRYKENVLVQTLHKRHKIFALRHSRLKDSXXXXXXXXXXXXXXXXXXXXXXXNQRAQTAKNSAETAEIKAKEAQKLSNHAREVAKEFAPDFIQL--GVLWLKTRNNIEGKLTGSVVFNNNFSLLDNQKYLNQNYKPQQMDQLQPNLLNPSDP 1906
            GGRF+FDDGGSY G W +G+AHG GI TGP+ QGE++G W  GFE  GVY WPSGN Y G W +GKRHG G++ KGKW+YKGE+T GF GRYGV+ES  ++ K+EG+W+  L DG+G ET +DG TY G W  G+R G G+R+S  Y  AA  + P     +S+R+  S  + L A +                P   R GFVL T ++ A++   K+ K  FR++L    KLRK +S   L S R    S RS    ++ +S A++ +   SL      +P+  E +D    E+Y+G+WK DKR G GV+ R+DG  Y+GEW  NK+ GYG T FP+GTKEEG+YK+NVLV    KR  +  LR S++++ V+ AV+ A +AA  AK+++    ++ A  A+  AE A   A++AQ+    AR  AKEF+P F     GV   + ++    +  G V+ +      D   Y+  +  P     + P    PS P
Sbjct:    4 GGRFNFDDGGSYCGGWEEGKAHGHGICTGPKGQGEYAGSWSHGFEVLGVYTWPSGNTYQGTWAQGKRHGIGLENKGKWVYKGEWTHGFKGRYGVRESTGASGKYEGTWNNGLQDGYGTETYSDGGTYQGQWVGGMRHGYGIRQSVPYGMAAVIRSPLRTSINSLRSEHSNGTALLAGERAGVGPGVGPGSLVASPAVSRGGFVL-TAHSEAELLKGKKNKGLFRRSLLSGLKLRKSESKSSLASQRSKQSSFRSEAGMSTVSSAASDINSTISLGEGESELPAGEEDVDATATESYAGEWKNDKRTGCGVSRRSDGLCYQGEWMGNKRHGYGCTTFPDGTKEEGKYKQNVLVSG--KRKHLIPLRASKIREKVDRAVEGAEKAADIAKQKSEIALSRTAH-ARGKAEAAIAAAQKAQEECRLARVAAKEFSPSFQHRGNGVECQRPKHQHSSENDGEVISSGTPDSTD--LYMKGSTPPDLTPDISPVPSRPSTP 492          
BLAST of Junctophilin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009496.1 (pep scaffold:Pmarinus_7.0:GL480437:14153:18284:1 gene:ENSPMAG00000008588.1 transcript:ENSPMAT00000009496.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 120.553 bits (301), Expect = 2.471e-30
Identity = 84/257 (32.68%), Postives = 131/257 (50.97%), Query Frame = 2
Query:  857 TYSGAWSKGVRQGLGVRKSAAYSKAATHKDP-----SSVRAATSQNSLLSANDSDRQAFV---DDARRPIDHRSGFVLVTTNNN-----------ADINANKEKKPSFRKALFRKLRKQKSTGDLRSARMGGSLRSTLSS-------NSAASQATNHSL----PDSLPIPSRESIDPNVIETYSGQWKEDKRAGYGVAERTDGAKYEGEWFNNKKDGYGVTHFPNGTKEEGRYKENVLVQTLHKRHKIFALRHSRLK 1537
            TY G W+ G+R G GVR S  Y  A+  + P     SS+R+  +  S++          +   DDA   +  R GFVL   +++                   ++ S   +L  K R+  S   L S R   S RS+  S       +SAAS  T+ ++    P++    S + ++ N  ETY+G+WK DKR+G+GV++R+DG +YEGEW  N+++GYG T +P+G  EEG+Y++  L  T  KR  +  LR S+ +
Sbjct:    2 TYQGQWAGGMRHGYGVRNSVPYGLASVVRSPLRTSLSSLRSEQTNGSIVGPVGGGAGGSLRSGDDAGSAVGSRGGFVLTGVHHSDSEQQGGKAGGKRGGGGLFRRGSLLGSL--KFRRSDSKASLSSER---SKRSSFRSEAGMSAISSAASDGTSLAVSLGEPETELFDSEDLVEANTTETYTGEWKGDKRSGFGVSQRSDGLRYEGEWLANRRNGYGRTSYPDGRSEEGKYRQGTL--TRGKRRSLVPLRASKTR 251          
BLAST of Junctophilin-1 vs. Ensembl Sea Lamprey
Match: RSPH10B2 (radial spoke head 10 homolog B2 [Source:HGNC Symbol;Acc:HGNC:34385])

HSP 1 Score: 57.7658 bits (138), Expect = 1.083e-8
Identity = 44/149 (29.53%), Postives = 59/149 (39.60%), Query Frame = 2
Query:  497 FDDGGSYVGEWCDGRAHGLG---IATGPENQGEFSGEWVMGFESRGVYIWPSGNIYAGGWMKGKRHGEG--------VQMKGKWIYKGEFTTGFCGRYGVKESLSSASKFEGSWHLNLFDGFGVETNADGSTYSGAWSKGVRQGLGVRK 910
            ++ G  Y G +C+   HG G    A G E +G+F   W+      G Y WP G+ Y G    G RHG+G        V   G W        G      V       S + G WH N+  G+G+     G+ Y G W    R G G  +
Sbjct:    2 YEGGNVYSGSFCNNMMHGKGKYVWADGVEFEGDF---WLNAMVGHGTYQWPDGSKYTGNVENGVRHGQGTLTVSKPFVSYSGHWYASERHGKGI-----VYYDEKRESWYCGEWHHNMRHGWGIRRYPSGNIYEGQWLNNERHGEGCMR 142          

HSP 2 Score: 50.8322 bits (120), Expect = 1.382e-6
Identity = 44/148 (29.73%), Postives = 60/148 (40.54%), Query Frame = 2
Query:  512 SYVGEWCDGRAHGLGIATGPEN-QGEFSGEWVMGF-ESRGVYIWPSGNIYAGGWMKGKRHGEGVQMKGKWI-----YKGEFTTG----------FCGRYGVKESLSSASKFEGSWHLNLFDGFGVETNADGSTYSGAWSKGVRQGLGV 904
            SY G W     HG GI    E  +  + GEW        G+  +PSGNIY G W+  +RHGEG     +WI     Y G++  G             R G  +     +++ G W      G G    A G+ Y G W +  + G G 
Sbjct:   77 SYSGHWYASERHGKGIVYYDEKRESWYCGEWHHNMRHGWGIRRYPSGNIYEGQWLNNERHGEGCM---RWITLMQEYNGQWKHGKPDGRGAHKWLVKRVGCSQ-YPMCNEYHGEWAAGHRHGQGEFLYASGAQYKGEWRQDRKHGSGT 220          
BLAST of Junctophilin-1 vs. Ensembl Sea Lamprey
Match: RSPH10B2 (radial spoke head 10 homolog B2 [Source:HGNC Symbol;Acc:HGNC:34385])

HSP 1 Score: 51.9878 bits (123), Expect = 5.995e-7
Identity = 44/148 (29.73%), Postives = 60/148 (40.54%), Query Frame = 2
Query:  512 SYVGEWCDGRAHGLGIATGPEN-QGEFSGEWVMGFES-RGVYIWPSGNIYAGGWMKGKRHGEGVQMKGKWI-----YKGEFTTG----------FCGRYGVKESLSSASKFEGSWHLNLFDGFGVETNADGSTYSGAWSKGVRQGLGV 904
            SY G W     HG GI    E  +  + GEW        G+  +PSGNIY G W+  +RHGEG     +WI     Y G++  G             R G  +     +++ G W      G G    A G+ Y G W +  + G G 
Sbjct:   38 SYSGHWYASERHGKGIVYYDEKRESWYCGEWHHNMRHGWGIRRYPSGNIYEGQWLNNERHGEGCM---RWITLMQEYNGQWKHGKPDGRGAHKWLVKRVGCSQ-YPMCNEYHGEWAAGHRHGQGEFLYASGAQYKGEWRQDRKHGSGT 181          
BLAST of Junctophilin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003398.1 (pep scaffold:Pmarinus_7.0:GL476560:333524:339285:-1 gene:ENSPMAG00000003108.1 transcript:ENSPMAT00000003398.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.521 bits (114), Expect = 9.342e-7
Identity = 23/55 (41.82%), Postives = 32/55 (58.18%), Query Frame = 2
Query: 1307 ETYSGQWKEDKRAGYGVAERTDGAKYEGEWFNNKKDGYGVTHFPNGTKEEGRYKE 1471
            E Y G+WKE +R G G    TDG  Y G++ N    G GV  FP+G++ EG + +
Sbjct:   14 EEYQGEWKEGRRHGLGQLRFTDGTHYLGQFENGLFSGCGVLAFPDGSRFEGEFSQ 68          

HSP 2 Score: 46.595 bits (109), Expect = 3.402e-6
Identity = 30/96 (31.25%), Postives = 48/96 (50.00%), Query Frame = 2
Query:  620 RGVYIWPSGNIYAGGWMKGKRHGEG-VQMKGKWIYKGEFTTGFCGRYGVKESLSSASKFEGSWHLNLFDGFGVETNADGSTYSGAWSKGVRQGLGV 904
            +G + + +G  Y G W +G+RHG G ++      Y G+F  G     GV  +    S+FEG +    F G GV + +DG  + G +  G  +G G+
Sbjct:    5 KGSFTYATGEEYQGEWKEGRRHGLGQLRFTDGTHYLGQFENGLFSGCGVL-AFPDGSRFEGEFSQGKFHGVGVFSRSDGMMFEGEFKNGHVEGYGL 99          

HSP 3 Score: 46.2098 bits (108), Expect = 4.620e-6
Identity = 35/103 (33.98%), Postives = 52/103 (50.49%), Query Frame = 2
Query:  467 MSVIEGGRFDFDDGGSYVGEWCDGRAHGLG---IATGPENQGEFSGEWVMGFESRGVYIWPSGNIYAGGWMKGKRHGEGVQMKGK-WIYKGEFTTGFCGRYGV 763
            M++++G  F +  G  Y GEW +GR HGLG      G    G+F       F   GV  +P G+ + G + +GK HG GV  +    +++GEF  G    YG+
Sbjct:    1 MTLMKG-SFTYATGEEYQGEWKEGRRHGLGQLRFTDGTHYLGQFENGL---FSGCGVLAFPDGSRFEGEFSQGKFHGVGVFSRSDGMMFEGEFKNGHVEGYGL 99          
BLAST of Junctophilin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001977.1 (pep scaffold:Pmarinus_7.0:GL478223:216506:238429:-1 gene:ENSPMAG00000001779.1 transcript:ENSPMAT00000001977.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.8322 bits (120), Expect = 2.253e-6
Identity = 41/137 (29.93%), Postives = 52/137 (37.96%), Query Frame = 2
Query:  506 GGSYVGEWCDGRAHGLGIATGPENQGEFSGEWVMGFESRGVYIWPSGNIYAGGWMKGKRHGEGVQMKGKWIYKGEFTTGFCGRYGVKESLSSASKFEGSWHLNLFDGFGVETNADGSTYSGAWSKGVRQGLGVRKSA 916
            G  Y G+WCDG+ HG G  T                       WP G  Y G +  G  HG      GK+      T       G KE      K+ G W     +G+G+  +ADG  Y G    GVR G G+  S+
Sbjct: 1042 GAHYYGQWCDGKPHGWGRMT-----------------------WPDGRTYIGNFKFGSEHG-----YGKYTVANAST-------GKKE------KYCGEWREGKINGYGLYKHADGEVYEGYLVGGVRHGHGMLLSS 1137          
BLAST of Junctophilin-1 vs. Ensembl Nematostella
Match: EDO41562 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3X5])

HSP 1 Score: 222.246 bits (565), Expect = 5.542e-64
Identity = 129/349 (36.96%), Postives = 183/349 (52.44%), Query Frame = 2
Query:  476 IEGGRFDFDDGGSYVGEWCDGRAHGLGIATGPENQGEFSGEWVMGFESRGVYIWPSGNIYAGGWMKGKRHGEGVQMKGKWIYKGEFTTGFCGRYGVKESLSSASKFEGSWHLNLFDGFGVETNADGSTYSGAWSKGVRQGLGVRKSAAYSKAATHKDPSSV-RAATSQNSLLSANDSDRQAFVDDARRPIDHRSGFVLVTTNNNADINANKEKKPSFRKALFRKLRKQKSTGDLRSARMGGSLRSTLSSNSAASQATNHSLPDSLPIPSRESIDPNVIETYSGQWKEDKRAGYGVAERTDGAKYEGEWFNNKKDGYGVTHFPNGTKEEGRYKENVLVQTLHKRHKIFAL 1519
            + GGRFDF+DGG+Y GEW +G+AHG GI TGP+ Q  + G W  GFE  GVY+WP+G+ Y G W  GKRHG GV+ +GKWIY+GE+  GF  RYGV+ S S A ++EGSW   L +G+G+E  A+G  Y G W  G+R G G+R +    K        S+ R + ++++ +      RQ        P   +SG      +N   +N+                    + G   +    GSL ST+        A   + P++ P+         V E Y G WK DKR GYG+ E +DG KY G+W  N + G GV  +P+ +K EG ++ + LV  + K+  I  L
Sbjct:    1 MSGGRFDFEDGGTYCGEWRNGKAHGYGICTGPKGQARYEGSWHNGFELSGVYVWPNGHRYEGEWYCGKRHGLGVEYRGKWIYQGEWEDGFKARYGVQRSQSGA-RYEGSWTSGLQEGYGIEVYANGGYYYGQWKTGMRSGYGIRSAKRDPKVTITNYARSISRQSNAESNGVIPTKQKRQGGELPPAEPHSPKSGSESDNASNTGSVNS--------------------TVGSGSTQLADGSLDSTV--------AVTQTEPEAEPVKP-------VRELYKGDWKNDKRHGYGILEASDGYKYIGQWHENMRHGLGVACYPDSSKYEGEFENDNLVVDIKKKGPIKTL 313          
BLAST of Junctophilin-1 vs. Ensembl Nematostella
Match: EDO49962 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RER8])

HSP 1 Score: 55.8398 bits (133), Expect = 3.491e-8
Identity = 39/134 (29.10%), Postives = 64/134 (47.76%), Query Frame = 2
Query:  503 DGGSYVGEWCDGRAHGLGIATGPENQGEFSGEWVMG-FESRGVYIWPSGNIYAGGWMKGKRHGEGVQMKGKWIYKGEFTTGFCGRYGVKESLSSASKFEGSWHLNLFDGFGVETNADGSTYSGAWSKGVRQGLG 901
            +G  Y G+W + + HG+G    P+    + GEW     + RG  I+P+ + Y G W +  R G+G+    + IY+G+F       +G+    +  S+++G W  +     G      G+TY G W    R GLG
Sbjct:  151 NGALYKGQWENSQRHGVGTYEAPDGT-MYEGEWSADHIQGRGRMIYPNKDSYDGSWFRNMRFGKGIYCFHEGIYEGQFEYDLRHGHGLMR-YNDGSEYDGEWQNDQVKSLGSMDYLGGATYDGPWELDRRHGLG 282          

HSP 2 Score: 49.6766 bits (117), Expect = 3.689e-6
Identity = 71/293 (24.23%), Postives = 114/293 (38.91%), Query Frame = 2
Query:  485 GRFDFDDGGSYVGEWCDGRAHGLGIATGPENQGEFSGEWVMG-FESRGVYIWPSGNIYAGGWMKGKRHGEG-VQMKGKWIYKGEFTTG-FCGRYGVKESLSSASKFEGSWHLNLFDGFGVETNADGSTYSGAWSKGVRQGLGVRKSAAYSKAATHKDPSSVRAATSQNSLLSANDSDRQAFVDDARRPIDHRSGFVLVTTNNNADINANKEKKPSFRKALFRKLRKQKSTGDLRSARMGGSLRSTLSSNSAASQATNHSLPDSLPIPSRESIDPNVIETYSGQWKEDKRAGYG 1354
            G   + +G  Y GEW +G  HG G+     N+    G +V G  +S G     +G  Y G W K K+HG+G + M     Y G F     CG  G      + + ++G W  +   G G     DG+ Y G WS    QG   R    Y    ++ D S  R       +   ++      + + +   D R G  L+  N+ ++ +   +              + KS G +    +GG+     + +        H L        RE++    +  Y G+WKED++ G G
Sbjct:   52 GTLKYPNGDYYHGEWREGEMHGKGVIV-FNNKDSLEGVFVKGDIQSEGTLKCTNGLTYVGTWHKSKKHGKGRLVMANGDTYNGNFVNDRMCGE-GEMLYAKNGALYKGQWENSQRHGVGTYEAPDGTMYEGEWSADHIQG---RGRMIYPNKDSY-DGSWFRNMRFGKGIYCFHEG-----IYEGQFEYDLRHGHGLMRYNDGSEYDGEWQND------------QVKSLGSM--DYLGGA-----TYDGPWELDRRHGL-------GRETLKCGTV--YEGRWKEDRKCGEG 305          
BLAST of Junctophilin-1 vs. Ensembl Nematostella
Match: EDO43658 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RY90])

HSP 1 Score: 55.0694 bits (131), Expect = 8.011e-8
Identity = 43/151 (28.48%), Postives = 62/151 (41.06%), Query Frame = 2
Query:  485 GRFDFDDGGSYVGEWCDGRAHGLGIAT----GPENQGEFSGEWVMG-FESRGVYIWPSGNIYAGGWMKGKRHGEGVQMKGKW------IYKGEFTTGFCGRYGVKESLSSASKFEGSWHLNLFDGFGVETNADGSTYSGAWSKGVRQGLGV 904
            G   + D   Y+GE+  G  HG G+       P+N   + GEW  G     G   +  G+ Y G W    RHG GV   G        +Y GE++      YG  + +    K+ G W  ++  G GV    DG    G + +G   G G+
Sbjct:   11 GEMRWPDKRVYMGEFKQGEHHGHGVMVFPPNSPDNADRYEGEWSHGKISGFGKMKYMHGDTYTGHWRDNTRHGHGVMSYGAMSSSAASVYIGEWSADRKNGYGTMDDVIRGEKYMGMWDNDIRQGAGVIVTLDGVYTQGTFVQGKLTGHGL 161          

HSP 2 Score: 50.0618 bits (118), Expect = 3.102e-6
Identity = 34/95 (35.79%), Postives = 44/95 (46.32%), Query Frame = 2
Query:  665 WMKGKRHGEG-VQMKGKWIYKGEFTTGFCGRYGVK----ESLSSASKFEGSWHLNLFDGFGVETNADGSTYSGAWSKGVRQGLGVRKSAAYSKAA 934
            W+ GK HG G ++   K +Y GEF  G    +GV      S  +A ++EG W      GFG      G TY+G W    R G GV    A S +A
Sbjct:    2 WLTGKPHGHGEMRWPDKRVYMGEFKQGEHHGHGVMVFPPNSPDNADRYEGEWSHGKISGFGKMKYMHGDTYTGHWRDNTRHGHGVMSYGAMSSSA 96          
BLAST of Junctophilin-1 vs. Ensembl Nematostella
Match: EDO41170 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S530])

HSP 1 Score: 53.1434 bits (126), Expect = 1.462e-7
Identity = 24/58 (41.38%), Postives = 38/58 (65.52%), Query Frame = 2
Query: 1304 IETYSGQWKEDKRAGYGVAERTDGAKYEGEWFNNKKDGYGVTHFPNGTKEEGRYKENV 1477
             E Y G+W  DKR+G+G    +DGA YEGEW+++K++G G+    N  + EG +K+ +
Sbjct:  109 TEYYEGEWYADKRSGWGRMYYSDGAVYEGEWYDDKQNGEGMLRLANENRYEGEWKDGL 166          
BLAST of Junctophilin-1 vs. Ensembl Nematostella
Match: EDO27248 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T9S6])

HSP 1 Score: 50.8322 bits (120), Expect = 3.921e-7
Identity = 24/56 (42.86%), Postives = 37/56 (66.07%), Query Frame = 2
Query: 1307 ETYSGQWKEDKRAGYGVAERTDGAKYEGEWFNNKKDGYGVTHFPNGTKEEGRYKEN 1474
            +TY G +   KR GYG+    + A+YEGE+ NNK++G G  +FP+G+  +G +K N
Sbjct:   25 DTYQGLYNNGKRHGYGIYRFVNKARYEGEYVNNKREGTGTMYFPDGSMYKGEWKNN 80          
BLAST of Junctophilin-1 vs. Ensembl Medaka
Match: jph1a (junctophilin 1 [Source:NCBI gene;Acc:101173340])

HSP 1 Score: 332.028 bits (850), Expect = 9.583e-100
Identity = 202/490 (41.22%), Postives = 281/490 (57.35%), Query Frame = 2
Query:  476 IEGGRFDFDDGGSYVGEWCDGRAHGLGIATGPENQGEFSGEWVMGFESRGVYIWPSGNIYAGGWMKGKRHGEGVQMKGKWIYKGEFTTGFCGRYGVKESLSSASKFEGSWHLNLFDGFGVETNADGSTYSGAWSKGVRQGLGVRKSAAYSKAATHKDPSSVRAATSQNSLLS--ANDSDRQAFVDDARRPIDHRSGFVLVTTNNNADINANKEKKPSFRKALF---RKLRKQKSTGDLRSARMGGSLRSTLS------SNSAASQATNHSLPDSLPIPSRESIDPNVIETYSGQWKEDKRAGYGVAERTDGAKYEGEWFNNKKDGYGVTHFPNGTKEEGRYKENVLVQTLHKRHKIFALRHSRLKDSXXXXXXXXXXXXXXXXXXXXXXXNQRAQTAKNSAETAEIKAKEAQKLSNHAREVAKEFAPDFIQLGVLWLKTRNNIEGKLTGSVVFNNNFSLLDNQKYLNQNYKPQQMDQLQPNLLNPSDPEC 1912
            + GGRFDFDDGG+Y G W DG+AHG GI TGP+ QGE++G W  GFE  GVY WPSGN Y G W +GKRHG GV+ KGKWIY+GE++ GF GRYGV++S ++ +++EG+W   L DG+G+ET  DG TY G W  G+R G GVR+S  Y  A   + P      TS  SL S  +N +  Q     A  P   R GFVL   ++++++   K+K    R +LF   R+LRK  S   + S R      +T+S      +NS  S        D L +   + +D    ETY G+WK DKR G+GV+ER++G KYEGEW NNK+ GYG T FP+ TKEEG+YK NVLV+ +  R ++  L++ + K+ V+ AV+ A  AAA A+ +    A++ A  A+  +E AE  A  A   S  AR VA+E +P+F Q G  ++K +     ++    V   + S  D+  +  +   P       P    P  P+ 
Sbjct:    1 MTGGRFDFDDGGTYCGGWEDGKAHGHGICTGPKGQGEYAGSWSHGFEIVGVYTWPSGNTYKGYWSQGKRHGLGVENKGKWIYRGEWSHGFKGRYGVRQSHNTPARYEGTWSNGLQDGYGIETYGDGGTYQGQWMGGMRHGYGVRQSVPYGMATVIRSP----LRTSMASLRSEQSNGTVLQDLSSPADTPTGSRGGFVL-NFHSDSEVVTGKKKGLFRRGSLFGSLRQLRKSDSRTSISSKRSSARSDATMSRISSSDANSTISIGDGELADDDLHL--EDHVDATTTETYMGEWKNDKRNGFGVSERSNGMKYEGEWLNNKRHGYGCTVFPDATKEEGKYKNNVLVRGI--RKQLIPLKNPKTKEKVDRAVEGAQRAAAIARSKVEIAASRTAH-ARTKSEAAEQAAISAVHDSEIARAVARELSPNFYQPGPDYIKQQFKEPVEIKEVPVEKKDPSPKDSPHFYRKGTTPPVSPVASPEATPPPSPDS 480          
BLAST of Junctophilin-1 vs. Ensembl Medaka
Match: jph3 (junctophilin 3 [Source:NCBI gene;Acc:101163737])

HSP 1 Score: 320.857 bits (821), Expect = 4.585e-95
Identity = 195/432 (45.14%), Postives = 270/432 (62.50%), Query Frame = 2
Query:  482 GGRFDFDDGGSYVGEWCDGRAHGLGIATGPENQGEFSGEWVMGFESRGVYIWPSGNIYAGGWMKGKRHGEGVQMKGKWIYKGEFTTGFCGRYGVKESLSSASKFEGSWHLNLFDGFGVETNADGSTYSGAWSKGVRQGLGVRKSAAYSKAATHKDPSSVRAATSQNSLLSAND-SDRQAFV------DDARRPIDHRSGFVLVTTNNNADINANKEKKPSFRKALFR--KLRKQKSTGDLRSARMG-GSLRST--LSSNSAASQATNHSL----PDSLPIPSRESIDPNVIETYSGQWKEDKRAGYGVAERTDGAKYEGEWFNNKKDGYGVTHFPNGTKEEGRYKENVLVQTLHKRHKIFALRHSRLKDSXXXXXXXXXXXXXXXXXXXXXXXNQRAQTAKNSAETAEIKAKEAQKLSNHAREVAKEFAPDF 1729
            GGRF+FDDGGSY G W +G+AHG GI TGP+ QGE+ G W  GFE  GVY WPSGN Y G W +GKRHG G++ KG+W+YKGE+T GF GRYG++ES  ++ K+EG+W+  L DG+G ET +DG T+ G W  G+R G GVR+S  Y  AA  + P      TS NSL S ++ S+  A V           P   R GFVL T ++ A++   K K   FR+++    KLRK +S   L S R    S RS   +S+ S+A+   N ++     D+    + + +D    ETY G+WK DKR G+GV+ R+DG +YEGEW +NK+ GYG T FP+GTKEEG+YK+N+LV    KR  +  LR S++++ V+ AV+ A +AA  A+++A    ++ A  A+  AE A   A++AQ+ S  AR  AK+F+P F
Sbjct:    4 GGRFNFDDGGSYCGGWEEGKAHGYGICTGPKGQGEYCGSWAHGFELLGVYTWPSGNTYQGTWAQGKRHGVGIENKGRWVYKGEWTHGFKGRYGLRESTGTSGKYEGTWNNGLQDGYGTETYSDGGTFQGQWVGGMRHGYGVRQSVPYGMAAVIRSP----LRTSINSLRSGSEHSNGTALVSMCSTGSSGSSPAVSRGGFVL-TAHSEAELLKGKRKSGLFRRSILSGLKLRKSESRSSLASQRSKQSSFRSEAGMSTVSSAASDVNSTISLGDADAELAVADDDVDATTTETYCGEWKNDKRTGFGVSRRSDGLQYEGEWLSNKRHGYGCTTFPDGTKEEGKYKQNILVSG--KRKNLIPLRASKIREKVDRAVEGAQKAADIARQKAEIALSRTAH-AQGKAEAAVAAAQKAQEESRMARVTAKQFSPSF 427          
BLAST of Junctophilin-1 vs. Ensembl Medaka
Match: jph3 (junctophilin 3 [Source:NCBI gene;Acc:101163737])

HSP 1 Score: 314.694 bits (805), Expect = 2.522e-92
Identity = 195/453 (43.05%), Postives = 271/453 (59.82%), Query Frame = 2
Query:  482 GGRFDFDDGGSYVGEWCDGRAHGLGIATGPENQGEFSGEWVMGFESRGVYIWPSGNIYAGGWMKGKRHGEGVQMKGKWIYKGEFTTGFCGRYGVKESLSSASKFEGSWHLNLFDGFGVETNADGSTYSGAWSKGVRQGLGVRKSAAYSKAATHKDPSSVRAATSQNSLLSAND-SDRQAFVD---------------------------DARRPIDHRSGFVLVTTNNNADINANKEKKPSFRKALFR--KLRKQKSTGDLRSARMG-GSLRST--LSSNSAASQATNHSL----PDSLPIPSRESIDPNVIETYSGQWKEDKRAGYGVAERTDGAKYEGEWFNNKKDGYGVTHFPNGTKEEGRYKENVLVQTLHKRHKIFALRHSRLKDSXXXXXXXXXXXXXXXXXXXXXXXNQRAQTAKNSAETAEIKAKEAQKLSNHAREVAKEFAPDF 1729
            GGRF+FDDGGSY G W +G+AHG GI TGP+ QGE+ G W  GFE  GVY WPSGN Y G W +GKRHG G++ KG+W+YKGE+T GF GRYG++ES  ++ K+EG+W+  L DG+G ET +DG T+ G W  G+R G GVR+S  Y  AA  + P      TS NSL S ++ S+  A +D                               P   R GFVL T ++ A++   K K   FR+++    KLRK +S   L S R    S RS   +S+ S+A+   N ++     D+    + + +D    ETY G+WK DKR G+GV+ R+DG +YEGEW +NK+ GYG T FP+GTKEEG+YK+N+LV    KR  +  LR S++++ V+ AV+ A +AA  A+++A    ++ A  A+  AE A   A++AQ+ S  AR  AK+F+P F
Sbjct:    4 GGRFNFDDGGSYCGGWEEGKAHGYGICTGPKGQGEYCGSWAHGFELLGVYTWPSGNTYQGTWAQGKRHGVGIENKGRWVYKGEWTHGFKGRYGLRESTGTSGKYEGTWNNGLQDGYGTETYSDGGTFQGQWVGGMRHGYGVRQSVPYGMAAVIRSP----LRTSINSLRSGSEHSNGTALLDRTGAIVPGPPTVPGTLTTSVSMCSTGSSGSSPAVSRGGFVL-TAHSEAELLKGKRKSGLFRRSILSGLKLRKSESRSSLASQRSKQSSFRSEAGMSTVSSAASDVNSTISLGDADAELAVADDDVDATTTETYCGEWKNDKRTGFGVSRRSDGLQYEGEWLSNKRHGYGCTTFPDGTKEEGKYKQNILVSG--KRKNLIPLRASKIREKVDRAVEGAQKAADIARQKAEIALSRTAH-AQGKAEAAVAAAQKAQEESRMARVTAKQFSPSF 448          
BLAST of Junctophilin-1 vs. Ensembl Medaka
Match: jph2 (junctophilin 2 [Source:NCBI gene;Acc:101175160])

HSP 1 Score: 311.612 bits (797), Expect = 1.470e-91
Identity = 203/451 (45.01%), Postives = 267/451 (59.20%), Query Frame = 2
Query:  476 IEGGRFDFDDGGSYVGEWCDGRAHGLGIATGPENQGEFSGEWVMGFESRGVYIWPSGNIYAGGWMKGKRHGEGVQMKGKWIYKGEFTTGFCGRYGVKESLSSASKFEGSWHLNLFDGFGVETNADGSTYSGAWSKGVRQGLGVRKSAAYSKAATHKDP-----SSVRAATSQNSLL--------SANDSDRQAFVDDARRPIDHRSGFVLVTTNNNADINANKEKKPSF--RKALFRKLRKQKSTGDLRSARMGGS-LR--STLSSNSAASQAT---NHSLPDSLPIPSRES-IDPNVIETYSGQWKEDKRAGYGVAERTDGAKYEGEWFNNKKDGYGVTHFPNGTKEEGRYKENVLVQTLHKRHKIFALRHSRLKDSXXXXXXXXXXXXXXXXXXXXXXXNQRAQTAKNSAETAEIKAKEAQKLSNHAREVAKEFAPDFIQLGVLWLKTR 1762
            + GGRF+FDDGG+Y G W  G+AHG GI TGP+ QGE+SG W  GFE  GVY WPSGN Y G W +GKRHG GV+ KG WIYKGE+T GF GRYG + S+ S +K+EG+W+  L DG+G ET ADG T+ G ++ G+R G GVR+S  Y  AA  + P     +S+R+  S  ++L        + N S  +  V         R GF L       D  A K KK     R +L  KL+K  S+  L S +   S LR  S LSSN++ + +T   + SL      P  ES ID    E Y G+WK DKR+GYG++ER+ G KYEGEW NN++ GYG T F  G KEEG+Y  N+LV+ + KR  +  L+ +++K  VE AV+ A  AAA AK++A   A+ R   AK  ++ AE  A  A   S+ AR VAKE +P F Q G  +LK +
Sbjct:    1 MSGGRFEFDDGGAYCGGWEGGKAHGHGICTGPKGQGEYSGSWNYGFEVVGVYTWPSGNTYEGYWSQGKRHGLGVESKGHWIYKGEWTHGFKGRYGTRVSVGSGAKYEGTWNNGLQDGYGTETYADGGTFQGQFTGGMRHGYGVRQSVPYGMAAVVRSPLRTSLTSLRSEHSNGTVLQQDIPVITTTNTSGEETPVATPTHLGPSRGGFALTL---QVDPEAVKPKKKGLFRRSSLLGKLKKSDSSVSLSSQKSKTSFLRPDSALSSNASDTNSTISGDESLLGVEDFPPVESDIDATTTEVYMGEWKNDKRSGYGISERSSGLKYEGEWLNNQRHGYGCTTFAEGGKEEGKYMNNMLVKAMKKR--MIQLKGNKIKQKVERAVEGAQRAAAIAKQKAEIAAS-RTTHAKAKSDGAEQAAHAANGESSIARLVAKELSPSFYQPGPEYLKKK 445          
BLAST of Junctophilin-1 vs. Ensembl Medaka
Match: jph2 (junctophilin 2 [Source:NCBI gene;Acc:101175160])

HSP 1 Score: 310.842 bits (795), Expect = 1.565e-91
Identity = 201/442 (45.48%), Postives = 264/442 (59.73%), Query Frame = 2
Query:  476 IEGGRFDFDDGGSYVGEWCDGRAHGLGIATGPENQGEFSGEWVMGFESRGVYIWPSGNIYAGGWMKGKRHGEGVQMKGKWIYKGEFTTGFCGRYGVKESLSSASKFEGSWHLNLFDGFGVETNADGSTYSGAWSKGVRQGLGVRKSAAYSKAATHKDPSSVRAATSQNSLLSANDSDRQAFVDDARRPIDHRSGFVL------VTTNNNADINANKEKKPSFRKALFRKLRKQKSTGDLRSARMGGS-LR--STLSSNSAASQAT---NHSLPDSLPIPSRES-IDPNVIETYSGQWKEDKRAGYGVAERTDGAKYEGEWFNNKKDGYGVTHFPNGTKEEGRYKENVLVQTLHKRHKIFALRHSRLKDSXXXXXXXXXXXXXXXXXXXXXXXNQRAQTAKNSAETAEIKAKEAQKLSNHAREVAKEFAPDFIQLGVLWLKTR 1762
            + GGRF+FDDGG+Y G W  G+AHG GI TGP+ QGE+SG W  GFE  GVY WPSGN Y G W +GKRHG GV+ KG WIYKGE+T GF GRYG + S+ S +K+EG+W+  L DG+G ET ADG T+ G ++ G+R G GVR+S  Y  AA  + P      TS  SL S                 +H +G VL      +TT N ++    K+K    R +L  KL+K  S+  L S +   S LR  S LSSN++ + +T   + SL      P  ES ID    E Y G+WK DKR+GYG++ER+ G KYEGEW NN++ GYG T F  G KEEG+Y  N+LV+ + KR  +  L+ +++K  VE AV+ A  AAA AK++A   A+ R   AK  ++ AE  A  A   S+ AR VAKE +P F Q G  +LK +
Sbjct:    1 MSGGRFEFDDGGAYCGGWEGGKAHGHGICTGPKGQGEYSGSWNYGFEVVGVYTWPSGNTYEGYWSQGKRHGLGVESKGHWIYKGEWTHGFKGRYGTRVSVGSGAKYEGTWNNGLQDGYGTETYADGGTFQGQFTGGMRHGYGVRQSVPYGMAAVVRSP----LRTSLTSLRS-----------------EHSNGTVLQQDIPVITTTNTSEAVKPKKKGLFRRSSLLGKLKKSDSSVSLSSQKSKTSFLRPDSALSSNASDTNSTISGDESLLGVEDFPPVESDIDATTTEVYMGEWKNDKRSGYGISERSSGLKYEGEWLNNQRHGYGCTTFAEGGKEEGKYMNNMLVKAMKKR--MIQLKGNKIKQKVERAVEGAQRAAAIAKQKAEIAAS-RTTHAKAKSDGAEQAAHAANGESSIARLVAKELSPSFYQPGPEYLKKK 418          
BLAST of Junctophilin-1 vs. Planmine SMEST
Match: SMESG000001306.1 (SMESG000001306.1)

HSP 1 Score: 1668.67 bits (4320), Expect = 0.000e+0
Identity = 862/891 (96.75%), Postives = 865/891 (97.08%), Query Frame = 2
Query:  467 MSVIEGGRFDFDDGGSYVGEWCDGRAHGLGIATGPENQGEFSGEWVMGFESRGVYIWPSGNIYAGGWMKGKRHGEGVQMKGKWIYKGEFTTGFCGRYGVKESLSSASKFEGSWHLNLFDGFGVETNADGSTYSGAWSKGVRQGLGVRKSAAYSKAATHKDPSSVRAATSQNSLLSANDSDRQAFVDDARRPIDHRSGFVLVTTNNNADINANKEKKPSFRKALFRKLRKQKSTGDLRSARMGGSLRSTLSSNSAASQATNHSLPDSLPIPSRESIDPNVIETYSGQWKEDKRAGYGVAERTDGAKYEGEWFNNKKDGYGVTHFPNGTKEEGRYKENVLVQTLHKRHKIFALRHSRLKDSXXXXXXXXXXXXXXXXXXXXXXXNQRAQTAKNSAETAEIKAKEAQKLSNHAREVAKEFAPDFIQLGVLWLKTRNNIEGKLTGSVVFNNNFSLLDNQKYLNQNYKPQQMDQLQPNLLNPSDPECLEVXXXXXXXXXXXXXXXXXEKRPNSPDPQNQKQTSSSKPLSGHNPNSNMTPQKPVASPTNVDCYSFEVPKIGHSVSEVAQQTPTTLLTSEPLIQRATATLTRQKAPQKIHSNIINIQPQNPKKEGLHYAIVQSGDVIKPQIAQXXXXXXXXXXXPRNVLVKEFDTGNDFFDYYSNNQNELNDGNFIDYEYEERRKIENEVLESKATRLEERRRSVPSIMTSKPVTANLTSSVKYPDNKYDIVHSSEILNSTTSVYIIENGIRKRMKADENILPRQPPLSPKSNRLMGKRIQNPLNIEPEADELTPLPRNYKIESSHNPHRKLEGSLPDVSYCNEIKTKTGTLMSRQEASQLSQQRRQEILHEQERQRRGEIVIRMADIKDWFKQNFTIVLILLLNCVIAVGFLHILKR 3139
            MSVIEGGRFDFDDGGSYVGEWCDGRAHGLGIATGPENQGEFSGEWVMGFESRGVYIWPSGNIYAGGWMKGKRHGEGVQMKGKWIYKGEFTTGFCGRYGVKESLSSASKFEGSWHLNLFDGFGVETNADGSTYSGAWSKGVRQGLGVRKSAAYSKAATHKDPSSVRAATSQNSLLSANDSDRQAFVDDARRPIDHRSGFVLVTTNNNADINANKEKKPSFRKALFRKLRKQKSTGDLRSARMGGSLRSTLSSNSAASQATNHSLPDSLPIPSRESIDPNVIETYSGQWKEDKRAGYGVAERTDGAKYEGEW+NNKKDGYGVTHFPNGTKEEGRYKENVLVQTLHKRHKIFALRHSRLKDSVEEAVKNAVEAAADAKERAMETANQRAQTAKN             K         K    DFIQLGVLWLKTRNNIEGKLTGSVVFNNNFSLLDNQKYLNQNYKPQQMDQLQPNLLNPSDPECLEVSGGSRRGSFRSSFRRSGEKRPNSPDPQNQKQTSSSKPLSGHNPNSNMTPQKPVASPTNVDCYSFEVPKIGHSVSEVAQQTPTTLLTSEPLIQRATATLTRQKAPQKIHSNIINIQPQNPKKEGLHYAIVQSGDVIKPQIAQIESISSYSEIEPRNVLVKEFDTGNDFFDYYSNNQ+ELNDGNFIDYEYEERRKIENEVLESKATRLEERRRSVPSIMTSKPVTANLTSSVKYPDNKYDIVHSSEILNSTTSVYIIENGIRKRMKADENILPRQPPLSPKSNRL+GKRIQNPLNIEPEADELTPLPRNYKIESSHNPHRKLEGSLPDVSYCNEIKTKTGTLMSRQEASQLSQQRRQEILHEQERQRRGEIVIRMADIKDWFKQNFTIVLILLLNCVIAVGFLHILKR
Sbjct:    1 MSVIEGGRFDFDDGGSYVGEWCDGRAHGLGIATGPENQGEFSGEWVMGFESRGVYIWPSGNIYAGGWMKGKRHGEGVQMKGKWIYKGEFTTGFCGRYGVKESLSSASKFEGSWHLNLFDGFGVETNADGSTYSGAWSKGVRQGLGVRKSAAYSKAATHKDPSSVRAATSQNSLLSANDSDRQAFVDDARRPIDHRSGFVLVTTNNNADINANKEKKPSFRKALFRKLRKQKSTGDLRSARMGGSLRSTLSSNSAASQATNHSLPDSLPIPSRESIDPNVIETYSGQWKEDKRAGYGVAERTDGAKYEGEWYNNKKDGYGVTHFPNGTKEEGRYKENVLVQTLHKRHKIFALRHSRLKDSVEEAVKNAVEAAADAKERAMETANQRAQTAKN-------------KTVQSCTRSGKRICTDFIQLGVLWLKTRNNIEGKLTGSVVFNNNFSLLDNQKYLNQNYKPQQMDQLQPNLLNPSDPECLEVSGGSRRGSFRSSFRRSGEKRPNSPDPQNQKQTSSSKPLSGHNPNSNMTPQKPVASPTNVDCYSFEVPKIGHSVSEVAQQTPTTLLTSEPLIQRATATLTRQKAPQKIHSNIINIQPQNPKKEGLHYAIVQSGDVIKPQIAQIESISSYSEIEPRNVLVKEFDTGNDFFDYYSNNQSELNDGNFIDYEYEERRKIENEVLESKATRLEERRRSVPSIMTSKPVTANLTSSVKYPDNKYDIVHSSEILNSTTSVYIIENGIRKRMKADENILPRQPPLSPKSNRLIGKRIQNPLNIEPEADELTPLPRNYKIESSHNPHRKLEGSLPDVSYCNEIKTKTGTLMSRQEASQLSQQRRQEILHEQERQRRGEIVIRMADIKDWFKQNFTIVLILLLNCVIAVGFLHILKR 878          
BLAST of Junctophilin-1 vs. Planmine SMEST
Match: SMESG000004402.1 (SMESG000004402.1)

HSP 1 Score: 376.326 bits (965), Expect = 1.121e-112
Identity = 229/496 (46.17%), Postives = 297/496 (59.88%), Query Frame = 2
Query:  482 GGRFDFDDGGSYVGEWCDGRAHGLGIATGPENQGEFSGEWVMGFESRGVYIWPSGNIYAGGWMKGKRHGEGVQMKGKWIYKGEFTTGFCGRYGVKESLSSASKFEGSWHLNLFDGFGVETNADGSTYSGAWSKGVRQGLGVRKSAAYSKAATHKDPSSVRAATSQNSLL--SANDSDRQAFVDDARRPIDHRSGFVLVTTNNNADINANKEK------KPSFRKALFRKLRKQKSTG-------------------------DLRSARM------------------GGSLRST--------------LSSNSAASQATNHSLPDSLP-IPSRESIDPNVIETYSGQWKEDKRAGYGVAERTDGAKYEGEWFNNKKDGYGVTHFPNGTKEEGRYKENVLVQTLHKRHKIFALRHSRLKDSXXXXXXXXXXXXXXXXXXXXXXXNQRAQTAKNSAETAEIKAKEAQKLSNHAREVAKEFAPDFIQLGVLW-LKTRNN 1768
            GG+FDF DGG+Y+GEWCDGRAHG GIATGP NQGE+SG+W +GFE+ GVYIWPSGN+Y G WMKGKRHGEGVQ+ G+W+YKG FTTGF GRYGVK SL + S++EG WHLN FDG+G+ET ADGSTY+G W K  R+GLGV  SA +  A   +D    R + S  S+      +S    + D     I  R+GFVL   +N      ++        K SF K        Q ST                          D RSAR                    GSL+ST               SS S+  +A ++S    +P      SI    +ETY+GQW E+ R G GVAER+DG KY GEW NNK+ GYG+T FP+ T EEGRYK+NVL+Q L+++ +IF ++HSRLK+ V++ V+ A++ A DAK +A+ETA QRAQTA  +A +A+ +A +A+ LS  AR +AK+ AP+F Q G +W LK R +
Sbjct:   12 GGKFDFKDGGTYIGEWCDGRAHGFGIATGPNNQGEYSGDWSVGFENCGVYIWPSGNVYEGLWMKGKRHGEGVQVMGRWVYKGSFTTGFFGRYGVKSSLYTQSRYEGCWHLNEFDGYGIETCADGSTYAGMWFKNQRKGLGVSHSAQFGLANDFRDSRDSRPSMSDMSMHFGDCRESSNSIYKDCLANEI--RNGFVLCFHSNKYKSKHHELSEIGNVLKKSFHKHQSSHKSDQTSTPTDQSSKSFKLHKKLLLHLRRKKPILDQRSARSLSRQRTVENNENEFLRNPSGSLKSTNSRDHSNQVASTLPTSSGSSLGKAGSNSFSSVVPGYDILSSIPKETVETYAGQWNENTRTGLGVAERSDGLKYIGEWLNNKRHGYGITCFPDNTIEEGRYKDNVLIQQLNRKSRIFLVKHSRLKNLVDDFVQKALDVAQDAKIKAVETAYQRAQTALAAAISAQARADDARTLSKSARNIAKQIAPNFEQPGPVWELKRRKD 505          
BLAST of Junctophilin-1 vs. Planmine SMEST
Match: SMESG000065993.1 (SMESG000065993.1)

HSP 1 Score: 226.483 bits (576), Expect = 3.915e-61
Identity = 153/465 (32.90%), Postives = 236/465 (50.75%), Query Frame = 2
Query:  470 SVIEGGRFDFDDGGSYVGEWCDGRAHGLGIATGPENQGEFSGEWVMGFESRGVYIWPS--GNIYAGGWMKGKRHGEGVQMKGKWIYKGEFTTGFCGRYGVKESLSSASKFEGSWHLNLFDG---FGVETNADGSTYSGAWSKGVRQGLGVRKSAAYSKAATHKDPSS---VRAATSQNSL---LSANDSDRQAFVDDARRPIDHRSGFVL------VTTNNNADINANKEKKPSFRKA-----LFRKLRKQK--STGDLRSARMGG-------------SLRSTLSSNSAASQATNHSLPDSLPIPSRESIDPNVIETYSGQWKEDKRAGYGVAERTDGAKYEGEWFNNKKDGYGVTHFPNGTKEEGRYKENVLVQTLHKRHKIFALRHSRLKDSXXXXXXXXXXXXXXXXXXXXXXXNQRAQTAKNSAETAEIKAKEAQKLSNHAREVAKEFAPDFIQLGVLWL 1753
            S +  GR++F D G Y+GEW + +A G+G+ T  ++QGEF+G W  G E  GV++WPS  G +Y G W   KR G G+ +K  WI  G+F  GF    GVK    S  KFEG +     DG   FG+ET ADG TY G +  G+R+GLGVR S  Y +            +++AT +NS     ++N  D+      ++ P   + GFVL      +       INA K+ +   +++     +F  L K++  +T ++     G              S  S+L+ N+  S AT       + + + ++I P+V ETYSG+W +D+R G+GV ER+DG  YEG W NNK+ G+G+T F +G+ EEG+Y+   L+    KR+ IF L HS       +        A+   +       ++    + + + A+  A  A++ S   R++ KE  PD+ Q G+  L
Sbjct:   10 SQLPAGRYEFKDSGIYIGEWLNEKAVGIGLLTKDKSQGEFTGLWNSGSEKCGVFLWPSAPGAMYEGEWANSKRDGYGIFIKEDWIVMGKFQEGFI-TLGVKTKEKSIGKFEGEFE----DGCPVFGMETYADGGTYCGDYKSGLREGLGVRTSIPYGEIFAFLPEEKHLLLKSATDENSTNLSFTSNHVDKNG--SASKLPNKFKCGFVLSGKKSDLLIKKLRHINACKKHQKGLKRSKSLTSIFSALTKKELYNTKNIHKNHFGTISVYSVPGNASPKSFHSSLTFNTIQSIAT-------MDMSAGDTIAPDVFETYSGEWVQDQRHGFGVCERSDGVIYEGGWLNNKRHGFGITKFSDGSFEEGQYQNGKLIFLWTKRNPIFFL-HSFRMGLHIKKSVKQARNASKKAQEKDMDCRKKLTEIRETVKKAKEAAALAREYSLETRQLVKEMYPDYEQPGIRIL 459          

HSP 2 Score: 72.0182 bits (175), Expect = 1.940e-12
Identity = 54/200 (27.00%), Postives = 96/200 (48.00%), Query Frame = 2
Query: 2546 RRRSVPSIMTSKPVTANLTSSVKYPDNKYDIVHSSEILNS--TTSVYIIENGIRKRMKADENILPRQPPLSPKSNRLMGKRIQNPLNIEPEADELTPLPRNYKIESSHNPHRKL-EGSLPDVSYCNEIKTKTGTLMSRQEASQLSQQRRQEILHEQERQRRGEIVIRMADIKDWFKQNFTIVLILLLNCVIAVGFLHILK 3136
            RR +VP IMT +PV     +S+       D+    E  NS  + ++ +++ GIRKR             +SP     +  R ++ + +    D L PLP  +   S  N  + L EGSLPDVS      TK    + R+E  +L ++ +  I  ++++ ++G  VIR   + DW + +   ++++ +N  +   F+ I+K
Sbjct:  718 RRFTVPEIMTQEPVHPTPVTSILR-----DLQEEVEDENSEFSDTMILMDGGIRKR-------------VSPVPVNNIKSRTESKITLNQPQDGLRPLPMIFNFTSQLNLSKDLQEGSLPDVS-----ATKRMCGIPREEVIRLGEEYQHAIELDKQKLKQGVFVIRFYKLGDWLRDHAVSLVVIFINLCLLYFFIAIIK 894          
BLAST of Junctophilin-1 vs. Planmine SMEST
Match: SMESG000039153.1 (SMESG000039153.1)

HSP 1 Score: 67.3958 bits (163), Expect = 3.764e-11
Identity = 48/153 (31.37%), Postives = 71/153 (46.41%), Query Frame = 2
Query:  485 GRFD------FDDGGSYVGEWCDGRAHGLGIATGPENQGEFSGEWVMG-FESRGVYIWPSGNIYAGGWMKGKRHGEGV-QMKGKWIYKGEFTTGFCGRYG---VKESLSSASKFEGSWHLNLFDGFGVETNADGSTYSGAWSKGVRQGLGVRK 910
            GRF+      F +G  + G +C+G  HG G          + G+++      +G Y W  G+ Y G  + G RHG G+ +     +Y G +  G   R+G   V       S +EG W+ N+ +GFG      G+TY G W +G R G GV K
Sbjct:   97 GRFEGLGTAFFVNGNIFEGMFCEGTMHGTGRFNWKSTNTSYEGDFLYNEISGKGKYTWQDGSSYEGDVVHGVRHGRGIYKHPSGMMYSGLWVNG--NRHGNGTVNYDTDQRSFYEGDWNKNVIEGFGFRQYRSGNTYEGEWYQGKRHGHGVMK 247          
BLAST of Junctophilin-1 vs. Planmine SMEST
Match: SMESG000039917.1 (SMESG000039917.1)

HSP 1 Score: 58.5362 bits (140), Expect = 2.946e-8
Identity = 69/252 (27.38%), Postives = 103/252 (40.87%), Query Frame = 2
Query:  506 GGSYVGEWCDGRAHGLGIATGPENQGEFSGEWVMGFESR-GVYIWPSGNIYAGGWMKGKRHGEGVQMKGKW----IYKGEFTTGFCGRYGVKESLSSASKFEGSWHLNLFDGFGVETNADGSTYSGAWSKGVRQGLGVRKSAAYSKAATHKDPSSVRAATSQNSLLSANDSDRQAFVDDARRPIDHRSGFVLVTTNN----------NADINANKEKKPSFRKALFRKLRKQKSTGDLRSARMGGSLRSTLS 1216
            G +Y+G   D +  G G  T  +++  F G +  G  ++ G   W  G+ + G +   +RHG G+    KW    IY+G F   F   +G+  S    ++FEG+++ N  +GFGV    +G  + G +    R G G+     YS    H+D         +NSLL     + + F       I   S  +    N           N DIN N E   S    L  +L K  S   L S   G +L S  S
Sbjct:   17 GSTYIGSIKDNQPCGFGKFTWSDDE-YFEGFYQNGIRNKIGFQKWSDGDTFKGEFFNDRRHGWGIY---KWSNNDIYEGSFYQDFRHGFGIYTS-HEGTRFEGTFYENKREGFGVFYYENGDVFQGLYKDNYRCGPGILH---YSDG--HQDV----GLWHRNSLLKLITKNPEVFT------IQLFSDLIATYANQYTEFSYFNSLNEDININSEY--SLDIVLKYRLTKPGSIRVLDSVISGENLTSDCS 246          

HSP 2 Score: 53.5286 bits (127), Expect = 9.657e-7
Identity = 20/56 (35.71%), Postives = 37/56 (66.07%), Query Frame = 2
Query: 1307 ETYSGQWKEDKRAGYGVAERTDGAKYEGEWFNNKKDGYGVTHFPNGTKEEGRYKEN 1474
            + Y G + +D R G+G+    +G ++EG ++ NK++G+GV ++ NG   +G YK+N
Sbjct:   87 DIYEGSFYQDFRHGFGIYTSHEGTRFEGTFYENKREGFGVFYYENGDVFQGLYKDN 142          
The following BLAST results are available for this feature:
BLAST of Junctophilin-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
JPH34.544e-9546.37junctophilin 3 [Source:HGNC Symbol;Acc:HGNC:14203][more]
JPH11.281e-9242.95junctophilin 1 [Source:HGNC Symbol;Acc:HGNC:14201][more]
JPH25.187e-8841.59junctophilin 2 [Source:HGNC Symbol;Acc:HGNC:14202][more]
JPH42.763e-7140.56junctophilin 4 [Source:HGNC Symbol;Acc:HGNC:20156][more]
JPH42.763e-7140.56junctophilin 4 [Source:HGNC Symbol;Acc:HGNC:20156][more]
back to top
BLAST of Junctophilin-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
jph-11.140e-10237.56JunctoPHilin [Source:UniProtKB/TrEMBL;Acc:Q22667][more]
back to top
BLAST of Junctophilin-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
jp5.091e-9243.52gene:FBgn0032129 transcript:FBtr0079861[more]
jp5.091e-9243.52gene:FBgn0032129 transcript:FBtr0079860[more]
jp5.091e-9243.52gene:FBgn0032129 transcript:FBtr0304056[more]
jp5.091e-9243.52gene:FBgn0032129 transcript:FBtr0304057[more]
Als25.358e-831.25gene:FBgn0037116 transcript:FBtr0078462[more]
back to top
BLAST of Junctophilin-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
jph1a8.038e-9843.25junctophilin 1a [Source:ZFIN;Acc:ZDB-GENE-040724-2... [more]
jph1a7.341e-9545.45junctophilin 1a [Source:ZFIN;Acc:ZDB-GENE-040724-2... [more]
jph1b7.365e-9442.70junctophilin 1b [Source:ZFIN;Acc:ZDB-GENE-060616-3... [more]
jph1b7.365e-9442.70junctophilin 1b [Source:ZFIN;Acc:ZDB-GENE-060616-3... [more]
jph37.255e-9344.37junctophilin 3 [Source:ZFIN;Acc:ZDB-GENE-060503-41... [more]
back to top
BLAST of Junctophilin-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ing28.491e-9742.12inhibitor of growth family member 2 [Source:Xenbas... [more]
ing21.452e-9642.12inhibitor of growth family member 2 [Source:Xenbas... [more]
JPH32.949e-9645.90junctophilin 3 [Source:NCBI gene;Acc:105947054][more]
ing24.315e-9642.12inhibitor of growth family member 2 [Source:Xenbas... [more]
ing26.315e-9642.12inhibitor of growth family member 2 [Source:Xenbas... [more]
back to top
BLAST of Junctophilin-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Jph33.208e-9646.60junctophilin 3 [Source:MGI Symbol;Acc:MGI:1891497][more]
Jph33.208e-9646.60junctophilin 3 [Source:MGI Symbol;Acc:MGI:1891497][more]
Jph11.015e-9343.05junctophilin 1 [Source:MGI Symbol;Acc:MGI:1891495][more]
Jph21.664e-8740.13junctophilin 2 [Source:MGI Symbol;Acc:MGI:1891496][more]
Jph21.664e-8740.13junctophilin 2 [Source:MGI Symbol;Acc:MGI:1891496][more]
back to top
BLAST of Junctophilin-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9ET77|JPH3_MOUSE2.244e-9546.60Junctophilin-3 OS=Mus musculus OX=10090 GN=Jph3 PE... [more]
sp|Q8WXH2|JPH3_HUMAN2.182e-9446.37Junctophilin-3 OS=Homo sapiens OX=9606 GN=JPH3 PE=... [more]
sp|Q9ET80|JPH1_MOUSE7.103e-9343.05Junctophilin-1 OS=Mus musculus OX=10090 GN=Jph1 PE... [more]
sp|Q9HDC5|JPH1_HUMAN6.154e-9242.95Junctophilin-1 OS=Homo sapiens OX=9606 GN=JPH1 PE=... [more]
sp|Q9GKY8|JPH1_RABIT6.772e-9142.50Junctophilin-1 OS=Oryctolagus cuniculus OX=9986 GN... [more]
back to top
BLAST of Junctophilin-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G4VRF70.000e+040.20Putative junctophilin OS=Schistosoma mansoni OX=61... [more]
A0A095BXM50.000e+040.61Junctophilin-1 OS=Schistosoma haematobium OX=6185 ... [more]
A0A0X3NXT26.518e-16757.67Junctophilin-3 OS=Schistocephalus solidus OX=70667... [more]
A0A0R3W6858.062e-16457.46Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
A0A4Z2CXS72.762e-16356.50Junctophilin-1 OS=Schistosoma japonicum OX=6182 GN... [more]
back to top
BLAST of Junctophilin-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
jph1b7.574e-9542.83junctophilin-1 [Source:NCBI gene;Acc:103024555][more]
jph37.025e-9441.41junctophilin 3 [Source:NCBI gene;Acc:103038422][more]
si:ch211-146m13.31.585e-9344.19junctophilin-3-like [Source:NCBI gene;Acc:10304546... [more]
jph1a1.588e-9342.49junctophilin-1-like [Source:NCBI gene;Acc:10303313... [more]
jph33.484e-9341.41junctophilin 3 [Source:NCBI gene;Acc:103038422][more]
back to top
BLAST of Junctophilin-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000009496.12.471e-3032.68pep scaffold:Pmarinus_7.0:GL480437:14153:18284:1 g... [more]
RSPH10B21.083e-829.53radial spoke head 10 homolog B2 [Source:HGNC Symbo... [more]
RSPH10B25.995e-729.73radial spoke head 10 homolog B2 [Source:HGNC Symbo... [more]
ENSPMAT00000003398.19.342e-741.82pep scaffold:Pmarinus_7.0:GL476560:333524:339285:-... [more]
ENSPMAT00000001977.12.253e-629.93pep scaffold:Pmarinus_7.0:GL478223:216506:238429:-... [more]
back to top
BLAST of Junctophilin-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Junctophilin-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO415625.542e-6436.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO499623.491e-829.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO436588.011e-828.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO411701.462e-741.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO272483.921e-742.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Junctophilin-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
jph1a9.583e-10041.22junctophilin 1 [Source:NCBI gene;Acc:101173340][more]
jph34.585e-9545.14junctophilin 3 [Source:NCBI gene;Acc:101163737][more]
jph32.522e-9243.05junctophilin 3 [Source:NCBI gene;Acc:101163737][more]
jph21.470e-9145.01junctophilin 2 [Source:NCBI gene;Acc:101175160][more]
jph21.565e-9145.48junctophilin 2 [Source:NCBI gene;Acc:101175160][more]
back to top
BLAST of Junctophilin-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000001306.10.000e+096.75SMESG000001306.1[more]
SMESG000004402.11.121e-11246.17SMESG000004402.1[more]
SMESG000065993.13.915e-6132.90SMESG000065993.1[more]
SMESG000039153.13.764e-1131.37SMESG000039153.1[more]
SMESG000039917.12.946e-827.38SMESG000039917.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019130 ID=SMED30019130|Name=Junctophilin-1|organism=Schmidtea mediterranea sexual|type=transcript|length=3385bp
TGTGTCACAAATTCATATTATACATCTCCTTGTTAAAGAGACAGACGGTA
ATTTCATCGATTTTGTGCTACACACAAACCCAAGTTCACGTAATCGAATG
TGCTAGTGTTTAGCATTTGTTTCTTGGATTTTGTGTATTATTGACACTGT
ATACTGCAGTTGGATTCTTTAATTTCATTAGTACCAATCTTCAAATTCAT
TTTTCAGTTCCCACTGCCAACAAAACCAATTCATATTCCAAGGAGAAAAA
TTGTTTTGTTTCCTCCTTACCATTTCTTTCGACACCCGTTTGAAATTAAT
CTCAATTCCTTTTCAAGTGAAAAGAGAAAGCTTTTTTGGAACTGTGAAAA
CAAATTTTAATTTTAATCAAGAAAACAACCGGAAAAAACGGTTCATTTTG
TATTCGTAGAAAAGATTATATTGATTTCTATGCTTTATTGTTGAATTAAT
TTGGATTTTAACTAACATGTCAGTAATAGAAGGCGGCCGATTTGATTTCG
ATGATGGAGGAAGTTATGTGGGAGAATGGTGTGATGGTCGTGCTCATGGG
CTGGGTATAGCTACTGGTCCAGAGAATCAGGGAGAATTTTCTGGAGAATG
GGTTATGGGATTTGAAAGCCGAGGGGTTTATATTTGGCCAAGTGGAAATA
TTTATGCCGGCGGTTGGATGAAAGGCAAACGACACGGAGAAGGCGTTCAG
ATGAAAGGTAAATGGATTTATAAAGGAGAATTTACAACCGGGTTCTGTGG
TCGTTATGGCGTTAAAGAATCACTCAGTAGTGCTTCGAAATTCGAAGGAA
GCTGGCATTTGAATTTGTTTGATGGTTTCGGAGTTGAAACTAACGCAGAT
GGAAGCACATATTCTGGCGCTTGGTCAAAAGGCGTCCGGCAAGGTCTGGG
TGTGAGAAAATCCGCTGCTTATTCTAAAGCGGCAACTCATAAAGATCCAT
CATCAGTTCGTGCAGCAACTTCACAGAACAGTTTACTTTCTGCCAATGAT
TCCGACCGTCAAGCTTTTGTTGATGATGCTCGACGTCCGATTGACCATCG
AAGTGGATTCGTGTTGGTGACGACAAACAATAATGCAGATATTAATGCCA
ATAAAGAGAAAAAACCCAGCTTTCGAAAAGCACTATTTCGTAAACTGCGA
AAACAGAAGTCAACCGGTGACTTGCGCAGTGCTCGCATGGGCGGCTCTTT
GCGATCTACATTAAGTTCAAATAGCGCAGCTAGTCAAGCGACAAATCATT
CATTGCCAGACTCTTTACCAATACCGAGCCGGGAATCGATTGATCCAAAT
GTAATTGAAACATATTCTGGTCAATGGAAGGAAGATAAAAGAGCTGGGTA
TGGGGTTGCGGAACGAACCGATGGAGCAAAATACGAAGGTGAATGGTTTA
ATAATAAAAAAGATGGTTATGGTGTTACGCACTTTCCAAATGGAACGAAA
GAAGAAGGTAGATATAAAGAAAATGTTTTAGTACAGACTTTACATAAGCG
ACATAAAATATTTGCTCTGAGACATTCCCGTTTGAAAGATAGTGTTGAAG
AGGCTGTTAAAAATGCTGTAGAAGCTGCTGCAGATGCAAAAGAAAGAGCT
ATGGAAACTGCCAATCAACGAGCCCAGACAGCAAAAAATAGTGCAGAAAC
AGCAGAAATCAAGGCTAAAGAAGCACAGAAACTGTCCAATCATGCACGAG
AAGTGGCAAAAGAATTTGCACCGGATTTCATTCAATTGGGTGTATTATGG
TTAAAAACTCGAAACAATATTGAAGGCAAACTGACAGGAAGCGTCGTGTT
TAATAACAACTTTAGTCTATTGGACAATCAGAAATACCTCAATCAAAATT
ATAAACCACAGCAAATGGATCAGTTACAACCGAATCTACTCAATCCATCC
GATCCTGAATGCCTTGAAGTAAGTGGAGGCAGTCGAAGAGGAAGTTTCAG
ATCAAGTTTTCGGCGTTCAGGAGAGAAAAGACCTAACTCTCCAGACCCTC
AAAATCAAAAACAGACAAGCAGTTCAAAACCTTTAAGTGGTCACAATCCT
AATAGTAACATGACTCCTCAGAAGCCAGTTGCATCACCAACTAATGTCGA
TTGCTATTCCTTTGAGGTGCCAAAAATCGGCCACAGTGTTTCTGAAGTTG
CACAACAAACTCCAACTACTTTACTCACTTCAGAACCTCTTATACAAAGA
GCAACGGCAACTTTAACGAGGCAGAAGGCTCCACAAAAAATACATTCAAA
TATAATAAATATCCAACCACAAAATCCTAAAAAGGAAGGGCTGCATTATG
CAATTGTCCAAAGTGGAGACGTTATTAAGCCCCAAATTGCTCAAATTGAA
TCTATTTCATCGTACTCAGAAATTGAACCGAGAAATGTATTGGTGAAAGA
ATTTGATACTGGAAATGACTTTTTTGACTATTATTCAAACAATCAGAACG
AATTAAATGATGGAAATTTCATTGATTATGAGTACGAAGAACGTCGTAAA
ATAGAAAACGAAGTGCTCGAATCAAAAGCAACACGGCTGGAAGAACGCAG
GCGATCCGTGCCATCTATTATGACCAGTAAACCAGTAACAGCAAATCTGA
CATCTTCCGTGAAATACCCCGATAATAAGTATGACATCGTTCACAGTTCA
GAAATATTAAATTCAACAACGTCAGTTTATATTATTGAAAATGGAATAAG
AAAACGGATGAAAGCCGATGAAAATATCCTGCCTCGCCAGCCTCCTTTAT
CTCCAAAATCAAATCGACTAATGGGCAAAAGAATACAAAATCCATTGAAC
ATTGAACCCGAGGCAGATGAATTGACACCCTTACCTCGGAATTATAAAAT
TGAATCATCACACAATCCTCACCGGAAGTTAGAAGGAAGTCTTCCTGATG
TGTCCTATTGTAATGAAATCAAAACCAAAACTGGAACTTTAATGTCCCGC
CAAGAAGCTTCACAATTGAGTCAACAAAGGCGCCAAGAAATTCTTCATGA
ACAAGAACGACAGCGACGCGGTGAAATCGTTATCAGAATGGCAGATATAA
AAGATTGGTTTAAACAAAACTTCACTATCGTTTTAATTTTGCTGTTGAAC
TGTGTGATCGCCGTTGGTTTCCTGCACATTTTGAAACGATAACTGTGAGA
TTTCAATCCAAATATTCAAGAGTTTAGGAGTTAATCTAGTCGAATTTCCT
TATCCCAAATATCTTTCAACAATCTACCATTATTATAACAATTAAAAAAT
TGAGAAAACTATCATTATGGAGATTAGAATAAAAAATTAATGGTGTTTTG
CAACTTGGAAAATATTAGATTCAGCATGATCAAACATACCTTTTTACAAA
TTTTTTAAGCAAACTTACAAAAACTTATTTGTCAC
back to top

protein sequence of SMED30019130-orf-1

>SMED30019130-orf-1 ID=SMED30019130-orf-1|Name=SMED30019130-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=892bp
MSVIEGGRFDFDDGGSYVGEWCDGRAHGLGIATGPENQGEFSGEWVMGFE
SRGVYIWPSGNIYAGGWMKGKRHGEGVQMKGKWIYKGEFTTGFCGRYGVK
ESLSSASKFEGSWHLNLFDGFGVETNADGSTYSGAWSKGVRQGLGVRKSA
AYSKAATHKDPSSVRAATSQNSLLSANDSDRQAFVDDARRPIDHRSGFVL
VTTNNNADINANKEKKPSFRKALFRKLRKQKSTGDLRSARMGGSLRSTLS
SNSAASQATNHSLPDSLPIPSRESIDPNVIETYSGQWKEDKRAGYGVAER
TDGAKYEGEWFNNKKDGYGVTHFPNGTKEEGRYKENVLVQTLHKRHKIFA
LRHSRLKDSVEEAVKNAVEAAADAKERAMETANQRAQTAKNSAETAEIKA
KEAQKLSNHAREVAKEFAPDFIQLGVLWLKTRNNIEGKLTGSVVFNNNFS
LLDNQKYLNQNYKPQQMDQLQPNLLNPSDPECLEVSGGSRRGSFRSSFRR
SGEKRPNSPDPQNQKQTSSSKPLSGHNPNSNMTPQKPVASPTNVDCYSFE
VPKIGHSVSEVAQQTPTTLLTSEPLIQRATATLTRQKAPQKIHSNIINIQ
PQNPKKEGLHYAIVQSGDVIKPQIAQIESISSYSEIEPRNVLVKEFDTGN
DFFDYYSNNQNELNDGNFIDYEYEERRKIENEVLESKATRLEERRRSVPS
IMTSKPVTANLTSSVKYPDNKYDIVHSSEILNSTTSVYIIENGIRKRMKA
DENILPRQPPLSPKSNRLMGKRIQNPLNIEPEADELTPLPRNYKIESSHN
PHRKLEGSLPDVSYCNEIKTKTGTLMSRQEASQLSQQRRQEILHEQERQR
RGEIVIRMADIKDWFKQNFTIVLILLLNCVIAVGFLHILKR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0030314junctional membrane complex
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000028Category 2 cell
PLANA:0000070intestinal phagocyte
PLANA:0000101muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR003409MORN