tRNA_int_endo domain-containing protein

Overview
NametRNA_int_endo domain-containing protein
Smed IDSMED30019117
Length (bp)2520
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of tRNA_int_endo domain-containing protein (SMED30019117) t-SNE clustered cells

Violin plots show distribution of expression levels for tRNA_int_endo domain-containing protein (SMED30019117) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of tRNA_int_endo domain-containing protein (SMED30019117) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for tRNA_int_endo domain-containing protein (SMED30019117) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019117

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30019117SMESG000049881.1 dd_Smed_v4_4610_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30019117SMESG000049881.1 dd_Smed_v4_4610_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30019117SMESG000049881.1 dd_Smed_v4_4610_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30019117SMESG000049882.1 dd_Smed_v4_4610_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of tRNA_int_endo domain-containing protein vs. Ensembl Fly
Match: CG33260 (gene:FBgn0053260 transcript:FBtr0302436)

HSP 1 Score: 65.4698 bits (158), Expect = 3.465e-11
Identity = 38/104 (36.54%), Postives = 57/104 (54.81%), Query Frame = 1
Query: 1603 VKTAVFYNLWSRGHCVTVSCKKMGGDYLLYPGDPWFHHATHVVRILPQTLEIKPSQLISKIRLINSLKKTYLIAWYDDNAVAKSSNLSSIVEHLNISFNCLGWC 1914
            +K  VF +LW RG  VT S    G D+L+YPGDP  +HA+H+V IL +   IKP +LI+K+RL   + K+ + A+  +N   +            I +  + WC
Sbjct:  183 LKYRVFKDLWRRGKYVT-SGDAFGADFLVYPGDPMIYHASHIV-ILHEQPVIKPLELIAKVRLSVIVNKSCVFAYEMENNEEE------------IHYQTVAWC 272          
BLAST of tRNA_int_endo domain-containing protein vs. Ensembl Zebrafish
Match: tsen34 (TSEN34 tRNA splicing endonuclease subunit [Source:ZFIN;Acc:ZDB-GENE-050419-115])

HSP 1 Score: 50.8322 bits (120), Expect = 3.166e-6
Identity = 31/93 (33.33%), Postives = 53/93 (56.99%), Query Frame = 1
Query: 1585 LPLD--LVVKTAVFYNLWSRGHCVTVSCKKMGGDYLLYPGDPWFHHATHVVRILPQTLEIKPSQLISKIRLINSLKKTYLIAWYDDNAVAKSS 1857
            +P D  L  + +V+ +L ++G+ +T S  K GGD+L+YPGDP   HA ++   +    E+    +++  RL +++KKT L+    D  V  SS
Sbjct:  210 MPRDEHLNTRFSVYRDLRNKGYYLT-SAGKFGGDFLVYPGDPLRFHAHYIALCVSLDEEMPVCDILAIARLGSNVKKTVLLCSPQDGDVVYSS 301          
BLAST of tRNA_int_endo domain-containing protein vs. Ensembl Zebrafish
Match: tsen34 (TSEN34 tRNA splicing endonuclease subunit [Source:ZFIN;Acc:ZDB-GENE-050419-115])

HSP 1 Score: 50.8322 bits (120), Expect = 3.166e-6
Identity = 31/93 (33.33%), Postives = 53/93 (56.99%), Query Frame = 1
Query: 1585 LPLD--LVVKTAVFYNLWSRGHCVTVSCKKMGGDYLLYPGDPWFHHATHVVRILPQTLEIKPSQLISKIRLINSLKKTYLIAWYDDNAVAKSS 1857
            +P D  L  + +V+ +L ++G+ +T S  K GGD+L+YPGDP   HA ++   +    E+    +++  RL +++KKT L+    D  V  SS
Sbjct:  210 MPRDEHLNTRFSVYRDLRNKGYYLT-SAGKFGGDFLVYPGDPLRFHAHYIALCVSLDEEMPVCDILAIARLGSNVKKTVLLCSPQDGDVVYSS 301          
BLAST of tRNA_int_endo domain-containing protein vs. Ensembl Xenopus
Match: TSEN34 (tRNA splicing endonuclease subunit 34 [Source:NCBI gene;Acc:100380139])

HSP 1 Score: 62.003 bits (149), Expect = 1.239e-9
Identity = 35/105 (33.33%), Postives = 52/105 (49.52%), Query Frame = 1
Query: 1603 VKTAVFYNLWSRGHCVTVSCKKMGGDYLLYPGDPWFHHATHVVRILPQTLEIKPSQLISKIRLINSLKKTYLIAWYDDNAVAKSSNLSSIVEHLNISFNCLGWCG 1917
            V+  VF +LW +G+ +T S  K GGD+L+YPGDP   HA  +    P   EI  S +++  RL  ++KKT L+   D+                 ++F  L W G
Sbjct:  217 VRYKVFKSLWQKGYFLT-SGSKFGGDFLVYPGDPMRFHAHFIAICFPYKEEIPLSDIVTAGRLGTNVKKTVLLCSADEGG--------------EVTFTSLQWSG 306          
BLAST of tRNA_int_endo domain-containing protein vs. Ensembl Mouse
Match: Tsen34 (tRNA splicing endonuclease subunit 34 [Source:MGI Symbol;Acc:MGI:1913328])

HSP 1 Score: 51.2174 bits (121), Expect = 2.945e-6
Identity = 25/73 (34.25%), Postives = 43/73 (58.90%), Query Frame = 1
Query: 1603 VKTAVFYNLWSRGHCVTVSCKKMGGDYLLYPGDPWFHHATHVVRILPQTLEIKPSQLISKIRLINSLKKTYLI 1821
            ++ +++ +LW RG  ++ + K  GGD+L+YPGDP   HA ++ +       I    L+S  RL  S++KT L+
Sbjct:  221 LRYSIYRDLWERGFFLSAAGK-FGGDFLVYPGDPLRFHAHYIAQCWSAEDPIPLQDLVSAGRLGTSVRKTLLL 292          
BLAST of tRNA_int_endo domain-containing protein vs. Ensembl Mouse
Match: Tsen34 (tRNA splicing endonuclease subunit 34 [Source:MGI Symbol;Acc:MGI:1913328])

HSP 1 Score: 51.2174 bits (121), Expect = 3.004e-6
Identity = 25/73 (34.25%), Postives = 43/73 (58.90%), Query Frame = 1
Query: 1603 VKTAVFYNLWSRGHCVTVSCKKMGGDYLLYPGDPWFHHATHVVRILPQTLEIKPSQLISKIRLINSLKKTYLI 1821
            ++ +++ +LW RG  ++ + K  GGD+L+YPGDP   HA ++ +       I    L+S  RL  S++KT L+
Sbjct:  225 LRYSIYRDLWERGFFLSAAGK-FGGDFLVYPGDPLRFHAHYIAQCWSAEDPIPLQDLVSAGRLGTSVRKTLLL 296          
BLAST of tRNA_int_endo domain-containing protein vs. Ensembl Mouse
Match: Tsen34 (tRNA splicing endonuclease subunit 34 [Source:MGI Symbol;Acc:MGI:1913328])

HSP 1 Score: 51.2174 bits (121), Expect = 3.004e-6
Identity = 25/73 (34.25%), Postives = 43/73 (58.90%), Query Frame = 1
Query: 1603 VKTAVFYNLWSRGHCVTVSCKKMGGDYLLYPGDPWFHHATHVVRILPQTLEIKPSQLISKIRLINSLKKTYLI 1821
            ++ +++ +LW RG  ++ + K  GGD+L+YPGDP   HA ++ +       I    L+S  RL  S++KT L+
Sbjct:  225 LRYSIYRDLWERGFFLSAAGK-FGGDFLVYPGDPLRFHAHYIAQCWSAEDPIPLQDLVSAGRLGTSVRKTLLL 296          
BLAST of tRNA_int_endo domain-containing protein vs. TrEMBL
Match: A0A3P7L0I8 (tRNA_int_endo domain-containing protein OS=Dibothriocephalus latus OX=60516 GN=DILT_LOCUS6015 PE=4 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 3.775e-17
Identity = 39/77 (50.65%), Postives = 58/77 (75.32%), Query Frame = 1
Query: 1594 DLVVKTAVFYNLWSRGHCVTVSCKKMGGDYLLYPGDPWFHHATHVVRILPQTLEIKPSQLISKIRLINSLKKTYLIA 1824
            + ++K  VF +LWS+G CVT S  KMGGD+LLYPGDP F+HA+H+V + P T ++K +QL + +R+ NS++K  L+A
Sbjct:  128 ETILKCRVFADLWSKGFCVTGSAMKMGGDFLLYPGDPLFYHASHIVCVAPPTSQLKLAQLSTSLRIANSVRKVLLLA 204          
BLAST of tRNA_int_endo domain-containing protein vs. TrEMBL
Match: A0A183TSN8 (tRNA_int_endo domain-containing protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS19486 PE=4 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 1.275e-14
Identity = 38/75 (50.67%), Postives = 56/75 (74.67%), Query Frame = 1
Query: 1600 VVKTAVFYNLWSRGHCVTVSCKKMGGDYLLYPGDPWFHHATHVVRILPQTLEIKPSQLISKIRLINSLKKTYLIA 1824
            ++K  VF +LWS+G CVT S  KMGG +LLYPGDP F+HA+H+V + P T ++K +QL + +R+ NS++K  L+A
Sbjct:  191 LLKCRVFMDLWSKGFCVTGSAMKMGGHFLLYPGDPLFYHASHIVCVAPATSQLKLAQLSTSLRIANSVRKVLLLA 265          
BLAST of tRNA_int_endo domain-containing protein vs. TrEMBL
Match: A0A068WPA3 (Putative zinc finger protein OS=Echinococcus granulosus OX=6210 GN=EgrG_000111220 PE=4 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 5.944e-13
Identity = 40/91 (43.96%), Postives = 61/91 (67.03%), Query Frame = 1
Query: 1594 DLVVKTAVFYNLWSRGHCVTVSCKKMGGDYLLYPGDPWFHHATHVVRILPQTLEIKPSQLISKIRLINSLKKTYLIAWY---DDNAVAKSS 1857
            D++V+  VF +LWSRG  +T S  KMGGD+L+Y GDP F+HA+H+V + P    I  S+L + +R+ NS++K  ++A     DD+ VA +S
Sbjct:  303 DVIVRCRVFDDLWSRGFYITCSASKMGGDFLVYQGDPLFYHASHIVMVNPPQAPIFLSRLSASLRIANSVRKALVLATTAADDDHGVAYTS 393          
BLAST of tRNA_int_endo domain-containing protein vs. TrEMBL
Match: W6UEM8 (tRNA-splicing endonuclease subunit Sen34 OS=Echinococcus granulosus OX=6210 GN=EGR_05658 PE=4 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 1.475e-12
Identity = 40/91 (43.96%), Postives = 61/91 (67.03%), Query Frame = 1
Query: 1594 DLVVKTAVFYNLWSRGHCVTVSCKKMGGDYLLYPGDPWFHHATHVVRILPQTLEIKPSQLISKIRLINSLKKTYLIAWY---DDNAVAKSS 1857
            D++V+  VF +LWSRG  +T S  KMGGD+L+Y GDP F+HA+H+V + P    I  S+L + +R+ NS++K  ++A     DD+ VA +S
Sbjct:  303 DVIVRCRVFDDLWSRGFYITCSASKMGGDFLVYQGDPLFYHASHIVMVNPPQAPIFLSRLSASLRIANSVRKALVLATTAADDDHGVAYTS 393          
BLAST of tRNA_int_endo domain-containing protein vs. TrEMBL
Match: A0A564YTG7 (tRNA_int_endo domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS9360 PE=4 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 1.158e-11
Identity = 42/107 (39.25%), Postives = 64/107 (59.81%), Query Frame = 1
Query: 1600 VVKTAVFYNLWSRGHCVTVSCKKMGGDYLLYPGDPWFHHATHVVRILPQTLEIKPSQLISKIRLINSLKKTYLIAWYDDNAVAKSSNLSSIVEHLNISFNCLGWCGS 1920
            +++  VF +LWS+G  VT S  KMGGD+L+Y GDP F+HA+H+V   P    I  S+L + +R+ NS++K  +IA    N   +S +  +IV     ++  L W GS
Sbjct:  282 IIRCRVFEDLWSKGFYVTCSAAKMGGDFLVYQGDPLFYHASHIVIANPPQAPIHLSRLAASLRIANSVRKALVIATSKSN--KESQDGPTIV-----TYTSLYWMGS 381          
BLAST of tRNA_int_endo domain-containing protein vs. Ensembl Nematostella
Match: EDO32072 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SW35])

HSP 1 Score: 57.3806 bits (137), Expect = 3.413e-10
Identity = 34/92 (36.96%), Postives = 50/92 (54.35%), Query Frame = 1
Query: 1603 VKTAVFYNLWSRGHCVTVSCKKMGGDYLLYPGDPWFHHATHVVRILPQTLEIKPSQLISKIRLINSLKKTYLIAWYDD--NAVAKSSNLSSI 1872
            ++ ++F NLW RG  +T  CK  GGD+L YPGDP   H+ ++V ++P         ++S  RL  ++KKT + A  D   N V  S   S I
Sbjct:   11 LRYSIFKNLWERGLYITSGCK-FGGDFLAYPGDPVKFHSFYIVVVVPYDKRTGMLDVVSMGRLGATVKKTAVFASMDSGGNVVYMSVKWSGI 101          
BLAST of tRNA_int_endo domain-containing protein vs. Planmine SMEST
Match: SMESG000049881.1 (SMESG000049881.1)

HSP 1 Score: 370.163 bits (949), Expect = 1.976e-177
Identity = 183/184 (99.46%), Postives = 184/184 (100.00%), Query Frame = 2
Query:  938 MVEITINSAAEIAVWDPDSVRFLRDECRIFGKFIGSVARLPHKTVFKGLPLMLAVEEFVVLLKEHSERVRLVRSISLVSPLIPESSSASVDQYKSDIEHNYNEISDIIQEMRLDRSNLHFDSVGDSQIQGRKRKADGARVSIAPSVAPDLEKVSVHLPTSTPTDWLRVGEKETIDIPKLLSLAE 1489
            MVEITIN+AAEIAVWDPDSVRFLRDECRIFGKFIGSVARLPHKTVFKGLPLMLAVEEFVVLLKEHSERVRLVRSISLVSPLIPESSSASVDQYKSDIEHNYNEISDIIQEMRLDRSNLHFDSVGDSQIQGRKRKADGARVSIAPSVAPDLEKVSVHLPTSTPTDWLRVGEKETIDIPKLLSLAE
Sbjct:    1 MVEITINNAAEIAVWDPDSVRFLRDECRIFGKFIGSVARLPHKTVFKGLPLMLAVEEFVVLLKEHSERVRLVRSISLVSPLIPESSSASVDQYKSDIEHNYNEISDIIQEMRLDRSNLHFDSVGDSQIQGRKRKADGARVSIAPSVAPDLEKVSVHLPTSTPTDWLRVGEKETIDIPKLLSLAE 184          

HSP 2 Score: 273.478 bits (698), Expect = 1.976e-177
Identity = 130/134 (97.01%), Postives = 131/134 (97.76%), Query Frame = 1
Query: 1525 ALVLVTDFVISLLQRKFEQKLPLDLVVKTAVFYNLWSRGHCVTVSCKKMGGDYLLYPGDPWFHHATHVVRILPQTLEIKPSQLISKIRLINSLKKTYLIAWYDDNAVAKSSNLSSIVEHLNISFNCLGWCGSVP 1926
            +L  VTDFVISLLQRKFEQKLPLD VVKTAVFYNLWSRGHCVTVSCKKMGGDYLLYPGDPWFHHATHVVRILPQTLEIKPSQLISKIRLINSLKKTYLIAWYDDNAVAKSSNLSSIVEHLNISFNCLGWCGSVP
Sbjct:  181 SLAEVTDFVISLLQRKFEQKLPLDHVVKTAVFYNLWSRGHCVTVSCKKMGGDYLLYPGDPWFHHATHVVRILPQTLEIKPSQLISKIRLINSLKKTYLIAWYDDNAVAKSSNLSSIVEHLNISFNCLGWCGSVP 314          
BLAST of tRNA_int_endo domain-containing protein vs. Planmine SMEST
Match: SMESG000049882.1 (SMESG000049882.1)

HSP 1 Score: 473.011 bits (1216), Expect = 1.006e-162
Identity = 246/248 (99.19%), Postives = 247/248 (99.60%), Query Frame = 1
Query:   97 MSKHKCPECNKCFQNRSRKSLCMRRHNNKNLVFQCPCCPRVYRDPSSLRRHKRLYEHKKNXXXXXXXXXXXXXXXXMNLSCEIPQSRKIITTQEEVIIKTTLPSIDTFAFNHSAIDCRINNSKDNQACPMFPERALDLTSTFRPKVFINPCSALSFGPSQMATGDSDSFQCQYPINLTIHHHSNGYYAYDSPVPIDLSYQTFWNSNHSSQPINFTNLLNSTSCPLDLTLDQSYSHEYDSNSTEIGWIC 840
            MSKHKCPECNKCFQNRSRKSLCMRRHNNKNLVFQCPCCPRVYRDPSSLRRHKRLYEHKKNIEQEPEIPTPETVVIPMNLSCEI QSRKIITTQEEVIIKTTLPSIDTFAFNHSAIDCRINNSKDNQACPMFPERALDLTSTFRPKVFINPCSALSFGPSQMATGDSDSFQCQYPINLTIHHHSNGYYAYDSPVPIDLSYQTFWNSNHSSQPINFTNLLNSTSCPLDLTLDQSYSHEYDSNS+EIGWIC
Sbjct:    1 MSKHKCPECNKCFQNRSRKSLCMRRHNNKNLVFQCPCCPRVYRDPSSLRRHKRLYEHKKNIEQEPEIPTPETVVIPMNLSCEITQSRKIITTQEEVIIKTTLPSIDTFAFNHSAIDCRINNSKDNQACPMFPERALDLTSTFRPKVFINPCSALSFGPSQMATGDSDSFQCQYPINLTIHHHSNGYYAYDSPVPIDLSYQTFWNSNHSSQPINFTNLLNSTSCPLDLTLDQSYSHEYDSNSSEIGWIC 248          
BLAST of tRNA_int_endo domain-containing protein vs. Planmine SMEST
Match: SMESG000049882.1 (SMESG000049882.1)

HSP 1 Score: 427.943 bits (1099), Expect = 1.773e-145
Identity = 224/226 (99.12%), Postives = 225/226 (99.56%), Query Frame = 1
Query:  163 MRRHNNKNLVFQCPCCPRVYRDPSSLRRHKRLYEHKKNXXXXXXXXXXXXXXXXMNLSCEIPQSRKIITTQEEVIIKTTLPSIDTFAFNHSAIDCRINNSKDNQACPMFPERALDLTSTFRPKVFINPCSALSFGPSQMATGDSDSFQCQYPINLTIHHHSNGYYAYDSPVPIDLSYQTFWNSNHSSQPINFTNLLNSTSCPLDLTLDQSYSHEYDSNSTEIGWIC 840
            MRRHNNKNLVFQCPCCPRVYRDPSSLRRHKRLYEHKKNIEQEPEIPTPETVVIPMNLSCEI QSRKIITTQEEVIIKTTLPSIDTFAFNHSAIDCRINNSKDNQACPMFPERALDLTSTFRPKVFINPCSALSFGPSQMATGDSDSFQCQYPINLTIHHHSNGYYAYDSPVPIDLSYQTFWNSNHSSQPINFTNLLNSTSCPLDLTLDQSYSHEYDSNS+EIGWIC
Sbjct:    1 MRRHNNKNLVFQCPCCPRVYRDPSSLRRHKRLYEHKKNIEQEPEIPTPETVVIPMNLSCEITQSRKIITTQEEVIIKTTLPSIDTFAFNHSAIDCRINNSKDNQACPMFPERALDLTSTFRPKVFINPCSALSFGPSQMATGDSDSFQCQYPINLTIHHHSNGYYAYDSPVPIDLSYQTFWNSNHSSQPINFTNLLNSTSCPLDLTLDQSYSHEYDSNSSEIGWIC 226          
The following BLAST results are available for this feature:
BLAST of tRNA_int_endo domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of tRNA_int_endo domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of tRNA_int_endo domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG332603.465e-1136.54gene:FBgn0053260 transcript:FBtr0302436[more]
back to top
BLAST of tRNA_int_endo domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tsen343.166e-633.33TSEN34 tRNA splicing endonuclease subunit [Source:... [more]
tsen343.166e-633.33TSEN34 tRNA splicing endonuclease subunit [Source:... [more]
back to top
BLAST of tRNA_int_endo domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
TSEN341.239e-933.33tRNA splicing endonuclease subunit 34 [Source:NCBI... [more]
back to top
BLAST of tRNA_int_endo domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Tsen342.945e-634.25tRNA splicing endonuclease subunit 34 [Source:MGI ... [more]
Tsen343.004e-634.25tRNA splicing endonuclease subunit 34 [Source:MGI ... [more]
Tsen343.004e-634.25tRNA splicing endonuclease subunit 34 [Source:MGI ... [more]
back to top
BLAST of tRNA_int_endo domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of tRNA_int_endo domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3P7L0I83.775e-1750.65tRNA_int_endo domain-containing protein OS=Dibothr... [more]
A0A183TSN81.275e-1450.67tRNA_int_endo domain-containing protein OS=Schisto... [more]
A0A068WPA35.944e-1343.96Putative zinc finger protein OS=Echinococcus granu... [more]
W6UEM81.475e-1243.96tRNA-splicing endonuclease subunit Sen34 OS=Echino... [more]
A0A564YTG71.158e-1139.25tRNA_int_endo domain-containing protein OS=Hymenol... [more]
back to top
BLAST of tRNA_int_endo domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of tRNA_int_endo domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of tRNA_int_endo domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of tRNA_int_endo domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO320723.413e-1036.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of tRNA_int_endo domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of tRNA_int_endo domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000049881.11.976e-17799.46SMESG000049881.1[more]
SMESG000049882.11.006e-16299.19SMESG000049882.1[more]
SMESG000049882.11.773e-14599.12SMESG000049882.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019117 ID=SMED30019117|Name=tRNA_int_endo domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2520bp
ATTTAAATATGGTAAATATTTGTACAAAAATGTCTCAAATCCTTTTTACT
TAAATTTTATATATTTATTTGTCATAAAAATATTTAAATAATTTTCATGT
CTAAACATAAATGCCCTGAATGCAATAAATGCTTTCAAAATCGCTCAAGG
AAGAGCTTATGTATGAGAAGGCATAATAATAAAAATTTAGTATTCCAGTG
TCCTTGTTGTCCTCGCGTGTATAGAGATCCAAGCAGCTTAAGAAGACACA
AAAGACTCTATGAACATAAAAAAAATATCGAACAGGAACCTGAAATACCT
ACGCCTGAAACTGTTGTAATTCCTATGAATCTCAGTTGTGAAATTCCTCA
ATCTCGTAAAATTATTACAACCCAAGAGGAAGTTATTATTAAAACAACCT
TGCCATCAATTGACACATTTGCTTTTAACCACTCAGCAATTGACTGCAGA
ATTAACAATTCCAAAGACAATCAGGCATGTCCAATGTTCCCCGAACGAGC
TCTAGATCTTACTTCGACGTTCCGGCCGAAAGTCTTCATCAATCCATGCT
CGGCACTCTCATTTGGACCGTCTCAAATGGCAACTGGAGACAGCGACAGT
TTCCAATGCCAATATCCGATCAATTTGACCATTCACCACCATTCCAACGG
CTACTATGCCTACGATTCCCCGGTTCCGATCGATCTGAGCTATCAGACAT
TCTGGAACTCAAATCACAGCTCTCAGCCAATCAACTTCACGAACCTCCTC
AACAGCACTTCCTGTCCGCTCGATCTCACATTGGATCAGTCGTATTCGCA
TGAATACGACAGCAATTCCACCGAGATCGGCTGGATTTGTTGATGGATTT
CTATGAATAAATTGATATCTTGATTTTCATTGGCTGTTGATTTTGATTGG
CTGTTTTATTTTCTGTGAAATTGGCAGGTTTCAGCAGATGGTCGAGATAA
CAATCAATAGTGCAGCCGAGATTGCCGTTTGGGATCCTGATTCCGTCAGA
TTCCTTCGTGACGAATGCCGCATTTTCGGGAAATTTATCGGTTCTGTTGC
TAGGCTGCCACATAAAACAGTTTTCAAGGGGCTCCCGTTAATGCTGGCAG
TTGAGGAGTTTGTGGTACTTCTAAAGGAACATTCGGAACGGGTCAGGCTG
GTGCGCAGCATTAGCTTAGTATCGCCATTAATACCGGAATCGTCATCTGC
CAGTGTAGACCAATACAAATCAGATATCGAGCATAATTATAACGAAATAT
CTGATATCATCCAGGAAATGAGACTAGATAGGTCGAACCTGCATTTCGAC
AGTGTGGGTGACAGCCAGATTCAAGGACGGAAACGGAAAGCAGATGGCGC
CCGTGTTAGCATTGCTCCTTCAGTAGCTCCCGACTTAGAGAAGGTTTCTG
TACATTTGCCCACATCTACCCCGACCGATTGGTTGCGAGTAGGTGAGAAA
GAAACTATTGACATTCCCAAACTGTTGTCATTGGCTGAAGGTATTTTGTG
ATTGGCCTACCAATTGACTGTGATGCTTTGGTATTAGTCACAGATTTCGT
TATAAGCTTATTGCAACGTAAATTTGAACAGAAACTTCCACTAGATCTCG
TGGTCAAAACTGCAGTTTTCTATAATCTTTGGTCTAGAGGCCATTGCGTC
ACTGTATCTTGCAAGAAAATGGGAGGGGATTATCTCCTCTATCCTGGTGA
TCCCTGGTTTCATCACGCCACACATGTCGTCAGGATTCTGCCGCAAACCT
TGGAAATAAAACCGTCTCAATTGATCTCCAAAATCCGACTGATTAACAGC
TTGAAAAAGACATATTTAATTGCTTGGTACGATGACAATGCCGTTGCCAA
GTCATCAAACTTATCAAGCATTGTAGAACATTTGAACATCAGTTTTAATT
GCCTCGGTTGGTGTGGGAGTGTTCCGTGATAATATTGGTATTTTGGGGAT
CATTTAGCAATACATTTTATGTCTTAAATCCCTTTAAATTTGTTGATCTT
GTCGTGAATTATTGCTTGGCTGTGAGTAATGGACTGCTGCAGTGTGATTT
GTGATTTATATTTTACCCTTGACTCCAAGTGGCTCACCGTTCCAGTGACA
CCTCACGATAATATATATATTTAAAATGTAAAAAACCGTCCTATATTGAT
TACATCCGGTCTTATTGGACAAAATTTTCTATAATTAAAAAACACGATTT
AAACACCAAATGGTATTTGACATTAATTAAACATTTCAAAAATATAAATA
ACATCTACCTGCATCAAATGGCAATCAGCAAAGGCTTGAATGATTATAAG
TAAGAGCATCAATTATATAAAAAACTAACCAATAATAAAAGTCATTTCAC
AACAGGAAAATATAGAAAATTTTAATACTAGAAGAAAAATAAATTCTTAC
ATAGAAGCTCGGTGTATAAATTTTCTATAATTAGAAAATACTTTAGACAA
TAAATAAAGGACTTGACAATTGGTAAGGCCATCATATGAAATATAAAAAA
GAAAATTTCGAAGCTTCCAC
back to top

protein sequence of SMED30019117-orf-1

>SMED30019117-orf-1 ID=SMED30019117-orf-1|Name=SMED30019117-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=188bp
MVEITINSAAEIAVWDPDSVRFLRDECRIFGKFIGSVARLPHKTVFKGLP
LMLAVEEFVVLLKEHSERVRLVRSISLVSPLIPESSSASVDQYKSDIEHN
YNEISDIIQEMRLDRSNLHFDSVGDSQIQGRKRKADGARVSIAPSVAPDL
EKVSVHLPTSTPTDWLRVGEKETIDIPKLLSLAEGIL*
back to top

protein sequence of SMED30019117-orf-2

>SMED30019117-orf-2 ID=SMED30019117-orf-2|Name=SMED30019117-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=249bp
MSKHKCPECNKCFQNRSRKSLCMRRHNNKNLVFQCPCCPRVYRDPSSLRR
HKRLYEHKKNIEQEPEIPTPETVVIPMNLSCEIPQSRKIITTQEEVIIKT
TLPSIDTFAFNHSAIDCRINNSKDNQACPMFPERALDLTSTFRPKVFINP
CSALSFGPSQMATGDSDSFQCQYPINLTIHHHSNGYYAYDSPVPIDLSYQ
TFWNSNHSSQPINFTNLLNSTSCPLDLTLDQSYSHEYDSNSTEIGWIC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR013087Znf_C2H2_type
IPR036236Znf_C2H2_sf
IPR015880Znf_C2H2-like
IPR007087Znf_C2H2
IPR011856tRNA_endonuc-like_dom_sf
IPR006677tRNA_intron_Endonuc_cat-like
Vocabulary: molecular function
TermDefinition
GO:0046872metal ion binding
GO:0004518nuclease activity
GO:0003676nucleic acid binding
GO:0000213tRNA-intron endonuclease activity
GO:0004519endonuclease activity
Vocabulary: biological process
TermDefinition
GO:0006388tRNA splicing, via endonucleolytic cleavage and ligation
GO:0090305nucleic acid phosphodiester bond hydrolysis
GO:0090501RNA phosphodiester bond hydrolysis
GO:0090502RNA phosphodiester bond hydrolysis, endonucleolytic
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013087Zinc finger C2H2-typeSMARTSM00355c2h2final6coord: 33..57
e-value: 0.063
score: 22.4
coord: 4..26
e-value: 41.0
score: 7.8
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 35..57
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 33..60
score: 10.014
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 1..68
e-value: 1.6E-6
score: 30.0
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 4..53