Tetraspanin

Overview
NameTetraspanin
Smed IDSMED30019103
Length (bp)972
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tetraspanin (SMED30019103) t-SNE clustered cells

Violin plots show distribution of expression levels for Tetraspanin (SMED30019103) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tetraspanin (SMED30019103) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tetraspanin (SMED30019103) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019103

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30019103SMESG000021627.1 dd_Smed_v4_1650_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30019103SMESG000021627.1 dd_Smed_v4_1650_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30019103SMESG000021627.1 dd_Smed_v4_1650_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30019103SMESG000021627.1 dd_Smed_v4_1650_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30019103SMESG000021627.1 dd_Smed_v4_1650_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30019103SMESG000021627.1 dd_Smed_v4_1650_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior sideSMED30019103SMESG000021627.1 dd_Smed_v4_1650_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30019103SMESG000021627.1 dd_Smed_v4_1650_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30019103SMESG000021627.1 dd_Smed_v4_1650_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019103SMESG000021627.1 Contig50076newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019103SMESG000021627.1 Contig50076uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
enteric muscle cellSMED30019103SMESG000021627.1 dd_Smed_v4_1650_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tetraspanin vs. Ensembl Human
Match: TSPAN7 (tetraspanin 7 [Source:HGNC Symbol;Acc:HGNC:11854])

HSP 1 Score: 94.3597 bits (233), Expect = 5.040e-22
Identity = 62/235 (26.38%), Postives = 113/235 (48.09%), Query Frame = 3
Query:  177 KCLLIIFNVVFWLSGLILIVIP---SIYLSNEKTKIVEKLDKFNSRXXXXXXXXXXXXXXXXXXCGCCGAVRESKLLLGMYIVFLMLIIFIQVALGIFAIFYKQKIEKSVSKTLKTAITELYGYDKDNDKITDNIQQILSCCGIEGPQDWEKSKWYIEKMNKSQMFPKSCCRDNAECYDK------ISGATAFSEGCVSRLREYLQRIFPIFIGVILGIAFFEIFVVICAFCLCR 854
            K LLII++ VFW++G+IL+ +     + L    + I E     NS      ++  G  I V    GC    R S  +L +Y +FL L+   ++  GI    ++ +I+ +  +T   A+ + Y  + +  +  D++Q+ LSCCG++   +W  S +++E        P SCC +  +C  +      ++      +GC   +  +++    I  GV  GIAF ++  ++ A CL R
Sbjct:   16 KTLLIIYSFVFWITGVILLAVGVWGKLTLGTYISLIAE-----NSTNAPYVLIGTGTTIVVFGLFGCFATCRGSPWMLKLYAMFLSLVFLAELVAGISGFVFRHEIKDTFLRTYTDAM-QTYNGNDERSRAVDHVQRSLSCCGVQNYTNWSTSPYFLE-----HGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMETNMGIIAGVAFGIAFSQLIGMLLACCLSR 239          
BLAST of Tetraspanin vs. Ensembl Human
Match: TSPAN6 (tetraspanin 6 [Source:HGNC Symbol;Acc:HGNC:11858])

HSP 1 Score: 90.5077 bits (223), Expect = 1.162e-20
Identity = 58/238 (24.37%), Postives = 113/238 (47.48%), Query Frame = 3
Query:  177 KCLLIIFNVVFWLSGLILIVIP---SIYLSNEKTKIVEKLDKFNSRXXXXXXXXXXXXXXXXXXCGCCGAVRESKLLLGMYIVFLMLIIFIQVALGIFAIFYKQKIEKSVSKTLKTAITELYGYDKDNDKITDNIQQILSCCGIEGPQDWEKSKWYIEKMNKSQMFPKSCCRDNAECYDKISGATAFSEGCVSRLREYLQRIFPIFIGVILGIAFFEIFVVICAFCLCRNTGSHVQEV 881
            K +L+I+  +FW++G+IL+ +     + L N  + + EK     +  +   ++  G +I ++   GC    R S  +L +Y +FL L+  +++   I    ++ +I+ S     + A+ +            D IQ  L CCG+   +DW  + +Y EK      FPKSCC+   +C  +       +EGC  ++   ++    +  G+  G+A F++  +  A+CL R   ++  E+
Sbjct:   18 KSVLLIYTFIFWITGVILLAVGIWGKVSLENYFSLLNEK-----ATNVPFVLIATGTVIILLGTFGCFATCRASAWMLKLYAMFLTLVFLVELVAAIVGFVFRHEIKNSFKNNYEKALKQYNSTGDYRSHAVDKIQNTLHCCGVTDYRDWTDTNYYSEK-----GFPKSCCKLE-DCTPQRDADKVNNEGCFIKVMTIIESEMGVVAGISFGVACFQLIGIFLAYCLSRAITNNQYEI 244          
BLAST of Tetraspanin vs. Ensembl Human
Match: TSPAN17 (tetraspanin 17 [Source:HGNC Symbol;Acc:HGNC:13594])

HSP 1 Score: 92.0485 bits (227), Expect = 1.170e-20
Identity = 77/258 (29.84%), Postives = 124/258 (48.06%), Query Frame = 3
Query:  174 AKCLLIIFNVVFWLSGLILIVIPSIYLSNEKTKI--VEKLDKFNSRXXXXXXXXXXXXXXXXXXCGCCGAVRESKLLLGMYIVFLMLIIFIQVALGIFAIFYKQKIEKSVSKTLKTAITELYGYDKDNDKITDNIQQILSCCGIEGPQDWEKSKWY-IEKMNKSQM---FPKSCC-RDNAECYDKISGATAF---------------SEGCVSRLREYLQRIFPIFIGVILGIAFFEIFVVICAFCLCRNTGSHVQEV 881
             K  L  FN+VFW+ G + + I  ++   EK  +  +  L            +V+G ++ V+ F GC GA+RE+  LL  + VFL LI F+++A GI A  +K  I   ++  +   + + Y  D D   + D  Q+  SCCG  GP DW  + ++    +N S+     P SCC RD AE  D ++    +               ++GCV +  ++LQ    +  GV +GIA  +IF +    CL +N  S ++ V
Sbjct:   17 GKYFLFGFNIVFWVLGALFLAI-GLWAWGEKGVLSNISALTDLGGLDPVWLFVVVGGVMSVLGFAGCIGALRENTFLLKFFSVFLGLIFFLELATGILAFVFKDWIRDQLNLFINNNV-KAYRDDIDLQNLIDFAQEYWSCCGARGPNDWNLNIYFNCTDLNPSRERCGVPFSCCVRDPAE--DVLNTQCGYDVRLKLELEQQGFIHTKGCVGQFEKWLQDNLIVVAGVFMGIALLQIFGI----CLAQNLVSDIKAV 266          
BLAST of Tetraspanin vs. Ensembl Human
Match: TSPAN17 (tetraspanin 17 [Source:HGNC Symbol;Acc:HGNC:13594])

HSP 1 Score: 91.6633 bits (226), Expect = 1.972e-20
Identity = 80/261 (30.65%), Postives = 125/261 (47.89%), Query Frame = 3
Query:  174 AKCLLIIFNVVFWLSGLILIVIPSIYLSNEKTKI--VEKLDKFNSRXXXXXXXXXXXXXXXXXXCGCCGAVRESKLLLGMYIVFLMLIIFIQVALGIFAIFYKQKIEKSVSKTLKTAITELYGYDKDNDKITDNIQQILSCCGIEGPQDWEKSKWY-IEKMNKSQM---FPKSCC-RDNAE-------CYDK----ISGATA-----FSEGCVSRLREYLQRIFPIFIGVILGIAFFEIFVVICAFCLCRNTGSHVQEV*A 887
             K  L  FN+VFW+ G + + I  ++   EK  +  +  L            +V+G ++ V+ F GC GA+RE+  LL  + VFL LI F+++A GI A  +K  I   ++  +   + + Y  D D   + D  Q+  SCCG  GP DW  + ++    +N S+     P SCC RD AE        YD     + G         ++GCV +  ++LQ    +  GV +GIA  +IF +    CL +N  S ++ V A
Sbjct:   17 GKYFLFGFNIVFWVLGALFLAI-GLWAWGEKGVLSNISALTDLGGLDPVWLFVVVGGVMSVLGFAGCIGALRENTFLLKFFSVFLGLIFFLELATGILAFVFKDWIRDQLNLFINNNV-KAYRDDIDLQNLIDFAQEYWSCCGARGPNDWNLNIYFNCTDLNPSRERCGVPFSCCVRDPAEDVLNTQCGYDVRLKLVRGELEQQGFIHTKGCVGQFEKWLQDNLIVVAGVFMGIALLQIFGI----CLAQNLVSDIKAVKA 271          
BLAST of Tetraspanin vs. Ensembl Human
Match: TSPAN17 (tetraspanin 17 [Source:HGNC Symbol;Acc:HGNC:13594])

HSP 1 Score: 89.7373 bits (221), Expect = 3.708e-20
Identity = 75/250 (30.00%), Postives = 120/250 (48.00%), Query Frame = 3
Query:  174 AKCLLIIFNVVFWLSGLILIVIPSIYLSNEKTKI--VEKLDKFNSRXXXXXXXXXXXXXXXXXXCGCCGAVRESKLLLGMYIVFLMLIIFIQVALGIFAIFYKQKIEKSVSKTLKTAITELYGYDKDNDKITDNIQQILSCCGIEGPQDWEKSKWY-IEKMNKSQM---FPKSCC-RDNAECYDKISGATAF---------------SEGCVSRLREYLQRIFPIFIGVILGIAFFEIFVVICAFCLCRN 857
             K  L  FN+VFW+ G + + I  ++   EK  +  +  L            +V+G ++ V+ F GC GA+RE+  LL  + VFL LI F+++A GI A  +K  I   ++  +   + + Y  D D   + D  Q+  SCCG  GP DW  + ++    +N S+     P SCC RD AE  D ++    +               ++GCV +  ++LQ    +  GV +GIA  +IF +    CL +N
Sbjct:   17 GKYFLFGFNIVFWVLGALFLAI-GLWAWGEKGVLSNISALTDLGGLDPVWLFVVVGGVMSVLGFAGCIGALRENTFLLKFFSVFLGLIFFLELATGILAFVFKDWIRDQLNLFINNNV-KAYRDDIDLQNLIDFAQEYWSCCGARGPNDWNLNIYFNCTDLNPSRERCGVPFSCCVRDPAE--DVLNTQCGYDVRLKLELEQQGFIHTKGCVGQFEKWLQDNLIVVAGVFMGIALLQIFGI----CLAQN 258          
BLAST of Tetraspanin vs. Ensembl Celegans
Match: tsp-17 (Tetraspanin-17 [Source:UniProtKB/Swiss-Prot;Acc:Q11098])

HSP 1 Score: 79.337 bits (194), Expect = 7.650e-17
Identity = 67/249 (26.91%), Postives = 102/249 (40.96%), Query Frame = 3
Query:  192 IFNVVFWLSGLILIVIPSIYLSNEKTKIVEKLDKFNSRXXXXXXXXXXXXXXXXXXCGC----------CGAVRESKLLLGMYIVFLMLIIFIQVALGIFAIFYKQKIEKS-VSKTLKTAITELYGYDKDNDKITDNIQQILSCCGIEGPQDWEKSKWYI-EKMNKSQMF-PKSCCRD------------NAECYDKISGATAFSE-----GCVSRLREYLQRIFPIFIGVILGIAFFEIFVVICAFCL 848
            IF++ +WLS L  + +    L + K   +  L  F+     +       ++     CGC          CGAV  S+ LL  +++FL+      VA+G  ++FYK K   + +   LK      Y  D+    + D IQ    CCG EGP D++ S WYI   +  ++ F P SCC+             +  C       TAF       GC  RL  +      IF+G   G A   +  +  + CL
Sbjct:   17 IFSIYYWLSALGHVFLGLWMLLDPKRNYILDLVHFSENDPLLKASAYVSLV-----CGCAQLLVGFLGLCGAVNRSRFLLLAFVMFLIGTFLADVAMGTLSLFYKDKFSNNYMGVYLKNLTYNRYSRDRWVLPLMDTIQFYHQCCGGEGPLDYKDSFWYITNTLRGTRSFVPPSCCKQAQVGRAWAPVPIDPMCTTYRYLTTAFDTSVNTVGCSERLMSWFNEQIWIFVGFGFGSALTMMLGICLSCCL 260          
BLAST of Tetraspanin vs. Ensembl Celegans
Match: tsp-17 (Tetraspanin-17 [Source:UniProtKB/Swiss-Prot;Acc:Q11098])

HSP 1 Score: 74.7146 bits (182), Expect = 3.552e-15
Identity = 66/261 (25.29%), Postives = 107/261 (41.00%), Query Frame = 3
Query:  192 IFNVVFWLSGLILIVIPSIYLSNEKTKIVEKLDKFNSRXXXXXXXXXXXXXXXXXXCGC----------CGAVRESKLLLGMYIVFLMLIIFIQVALGIFAIFYKQKIEKSVSKTLKTAITELYGY---DKDNDKIT---DNIQQILSCCGIEGPQDWEKSKWYIEKMNKSQ-----MFPKSCCRDNAECYDKISGATAFSE---------------------GCVSRLREYLQRIFPIFIGVILGIAFFEIFVVICAFCL 848
            IF++ +WLS L  + +    L + K   +  L  F+     +       ++     CGC          CGAV  S+ LL  +++FL+      VA+G  ++FYK K+  SV + ++  +   YG    + +N  +T   D +Q    CCG  GP D+  S+W       S+     +FP SCC        +I+GA+A +                      GC  RL  +      IF+G   G A   +  +  + CL
Sbjct:   17 IFSIYYWLSALGHVFLGLWMLLDPKRNYILDLVHFSENDPLLKASAYVSLV-----CGCAQLLVGFLGLCGAVNRSRFLLLAFVMFLIGTFLADVAMGTLSLFYKDKV-YSVKENVREIVKSKYGVMTSEPENKMVTEFIDKLQFYEKCCGSLGPTDYISSRWSQSTNQDSEEIESPLFPVSCC-------TQITGASALNPLAKSYARCQQIGANRQWRHAVGCSERLMSWFNEQIWIFVGFGFGSALTMMLGICLSCCL 264          
BLAST of Tetraspanin vs. Ensembl Celegans
Match: tsp-11 (Tetraspanin [Source:UniProtKB/TrEMBL;Acc:Q17526])

HSP 1 Score: 70.4774 bits (171), Expect = 1.316e-13
Identity = 75/280 (26.79%), Postives = 122/280 (43.57%), Query Frame = 3
Query:  144 SMAIGCGPKLAKCLLIIFNVVFWLSGLILIVIPSIYLSNEKTKI------VEKLDKFNS--------------RXXXXXXXXXXXXXXXXXXCGCCGAVRESKLLLGMYIVFLMLIIFIQVALGIFAIFYKQKIEKSVSKTLKTAITELYGYDKDNDKITDNIQQIL-------------SCCGIEGP-QDWEKSKWYIEKMNKSQMFPKSCC--RDNAECYDKISGATAFSEGCVSRLREYLQRI---FPIFIGVILGIAFFEIFVVICAFCLCRNTGS 866
            +M + C  +  K  L IFN+VF L GLI + I  ++L  +K  I        K+  ++               R     + V G I+ V+AF GCCGA +E + LL  Y   LMLI+ IQ+A  I+A  +    E      L +++    G   DN K+++N Q  L             SCCG++    ++  S WY     + Q FP +CC   ++       +     S GC +++ E  + +   F I    ++  A  ++  ++  F LC +  S
Sbjct:    8 TMPLSCTARALKFSLFIFNLVFLLCGLICLGI-GLWLVLDKYAIDNLAFATAKVQGYDQDAGLRDLATKPTAVRQFGYLLFVGGFIVIVVAFLGCCGAAKEWRPLLCCYSSCLMLILAIQIAATIYAFLHSHMFENDFRDILHSSLKMYNG--TDNMKVSNNPQDGLLVKTAWDKIMIEKSCCGVDSKIGEFNNSGWYQLNHGRYQ-FPPACCPPDEHGRLRPYCNTIMRHSHGCYAKIAESFEEVTSHFKIVSWTVVLFALIQVVGIVVGFWLCDSITS 283          
BLAST of Tetraspanin vs. Ensembl Celegans
Match: tsp-11 (Tetraspanin [Source:UniProtKB/TrEMBL;Acc:Q17526])

HSP 1 Score: 70.4774 bits (171), Expect = 1.316e-13
Identity = 75/280 (26.79%), Postives = 122/280 (43.57%), Query Frame = 3
Query:  144 SMAIGCGPKLAKCLLIIFNVVFWLSGLILIVIPSIYLSNEKTKI------VEKLDKFNS--------------RXXXXXXXXXXXXXXXXXXCGCCGAVRESKLLLGMYIVFLMLIIFIQVALGIFAIFYKQKIEKSVSKTLKTAITELYGYDKDNDKITDNIQQIL-------------SCCGIEGP-QDWEKSKWYIEKMNKSQMFPKSCC--RDNAECYDKISGATAFSEGCVSRLREYLQRI---FPIFIGVILGIAFFEIFVVICAFCLCRNTGS 866
            +M + C  +  K  L IFN+VF L GLI + I  ++L  +K  I        K+  ++               R     + V G I+ V+AF GCCGA +E + LL  Y   LMLI+ IQ+A  I+A  +    E      L +++    G   DN K+++N Q  L             SCCG++    ++  S WY     + Q FP +CC   ++       +     S GC +++ E  + +   F I    ++  A  ++  ++  F LC +  S
Sbjct:    8 TMPLSCTARALKFSLFIFNLVFLLCGLICLGI-GLWLVLDKYAIDNLAFATAKVQGYDQDAGLRDLATKPTAVRQFGYLLFVGGFIVIVVAFLGCCGAAKEWRPLLCCYSSCLMLILAIQIAATIYAFLHSHMFENDFRDILHSSLKMYNG--TDNMKVSNNPQDGLLVKTAWDKIMIEKSCCGVDSKIGEFNNSGWYQLNHGRYQ-FPPACCPPDEHGRLRPYCNTIMRHSHGCYAKIAESFEEVTSHFKIVSWTVVLFALIQVVGIVVGFWLCDSITS 283          
BLAST of Tetraspanin vs. Ensembl Celegans
Match: tsp-7 (Tetraspanin [Source:UniProtKB/TrEMBL;Acc:Q9XVI4])

HSP 1 Score: 64.6994 bits (156), Expect = 6.804e-12
Identity = 59/234 (25.21%), Postives = 96/234 (41.03%), Query Frame = 3
Query:  162 GPKLAKCLLIIFNVVFWLSGLILIVIPSIYLSNEKTKIVEKLDKFNSRXXXXXXXXXXXXXXXXXX--CGCCGAVRESKLLLGMYIVFLMLIIFIQVALGIFAIFYKQKIEKSVSKTLKTAITELYGYDKDNDKITDNIQQILSCCGIEGPQDWEKSKWYIEKMNKSQMFPKSCCRDNAECYDKISGATAFSEGCVSRLREYLQRIFPIFIGVILGIAFFEIFVVICAFCLCRN 857
            G  + K LL + N+V W+ GL LI++ SI     + K    LD      L   +L+L I          GCCGA+RE+  L   + V L L+I  ++A  I            +   L+T +   Y   +  +   D   Q+  CCG+    DW                P SCC +  E   +   A  F  GC+  + +++ +   +  G+   +A  ++  V  A CL ++
Sbjct:    5 GVTIVKYLLFLANLVLWVGGLSLIIVGSIL----QLKFDNVLDILGDERLATPILLLVIGSLCTLLGFLGCCGAIRENYCLTVSFAVLLALLITCEIAAVIIGYALHDSFRLGIGNQLQTGMVR-YHESRGVESAWDKTHQLFECCGVTNSSDWLTFT----------TIPDSCCIEEIEGCAR-ENAPLFEPGCIHSVEQWVLKNGAMVGGICAVLAAIQLVGVCFACCLSKS 222          
BLAST of Tetraspanin vs. Ensembl Fly
Match: Tsp96F (gene:FBgn0027865 transcript:FBtr0330164)

HSP 1 Score: 97.4413 bits (241), Expect = 2.437e-23
Identity = 70/249 (28.11%), Postives = 120/249 (48.19%), Query Frame = 3
Query:  177 KCLLIIFNVVFWLSGLILIVIPSIYLSNEKTKIVEKLDKFNS-RXXXXXXXXXXXXXXXXXXCGCCGAVRESKLLLGMYIVFLMLIIFIQVALGIFAIFYKQKIEKSVSKTLKTAITELYGYDKDNDKIT--DNIQQILSCCGIEGPQDWEKSKW-----------YIEKMNKSQMFPKSCCRDN---AEC-------YDKISGATAFSEGCVSRLREYLQRIFPIFIGVILGIAFFEIFVVICAFCLC 851
            K L+++ N++FWL GL  IV+ S+++  + T ++     +N         L +GI+I + AF GCCG  RES+ LL  +   +++++  Q+A G +A   K K++  V   +K+++ E YG    + +    D +Q+ L CCG +GP DW  S++            +  MN     P+SCC+DN    EC       +        + +GCV +L E +   +     V   +   E+  +  A  LC
Sbjct:   11 KYLMVLINILFWLIGLT-IVVTSVWMLTDPTFMLSMTQNYNHYHIALYVFLAIGILITLGAFFGCCGVCRESQCLLVSFFCVILIVMVAQIAAGAWAFHNKDKLDDIVRAAVKSSVQEEYGQSTMSSRTVTFDTLQKNLKCCGADGPGDWATSRFNNVDRTNIVEIAVSSMNVFYNIPESCCKDNLKDNECELSRRLKFGGPLNNAIYQQGCVDKLIEIIYENWVTIFAVTAAVILLELLSLTFALSLC 258          
BLAST of Tetraspanin vs. Ensembl Fly
Match: Tsp96F (gene:FBgn0027865 transcript:FBtr0084912)

HSP 1 Score: 97.4413 bits (241), Expect = 2.437e-23
Identity = 70/249 (28.11%), Postives = 120/249 (48.19%), Query Frame = 3
Query:  177 KCLLIIFNVVFWLSGLILIVIPSIYLSNEKTKIVEKLDKFNS-RXXXXXXXXXXXXXXXXXXCGCCGAVRESKLLLGMYIVFLMLIIFIQVALGIFAIFYKQKIEKSVSKTLKTAITELYGYDKDNDKIT--DNIQQILSCCGIEGPQDWEKSKW-----------YIEKMNKSQMFPKSCCRDN---AEC-------YDKISGATAFSEGCVSRLREYLQRIFPIFIGVILGIAFFEIFVVICAFCLC 851
            K L+++ N++FWL GL  IV+ S+++  + T ++     +N         L +GI+I + AF GCCG  RES+ LL  +   +++++  Q+A G +A   K K++  V   +K+++ E YG    + +    D +Q+ L CCG +GP DW  S++            +  MN     P+SCC+DN    EC       +        + +GCV +L E +   +     V   +   E+  +  A  LC
Sbjct:   11 KYLMVLINILFWLIGLT-IVVTSVWMLTDPTFMLSMTQNYNHYHIALYVFLAIGILITLGAFFGCCGVCRESQCLLVSFFCVILIVMVAQIAAGAWAFHNKDKLDDIVRAAVKSSVQEEYGQSTMSSRTVTFDTLQKNLKCCGADGPGDWATSRFNNVDRTNIVEIAVSSMNVFYNIPESCCKDNLKDNECELSRRLKFGGPLNNAIYQQGCVDKLIEIIYENWVTIFAVTAAVILLELLSLTFALSLC 258          
BLAST of Tetraspanin vs. Ensembl Fly
Match: Tsp96F (gene:FBgn0027865 transcript:FBtr0330163)

HSP 1 Score: 97.4413 bits (241), Expect = 3.631e-23
Identity = 70/249 (28.11%), Postives = 120/249 (48.19%), Query Frame = 3
Query:  177 KCLLIIFNVVFWLSGLILIVIPSIYLSNEKTKIVEKLDKFNS-RXXXXXXXXXXXXXXXXXXCGCCGAVRESKLLLGMYIVFLMLIIFIQVALGIFAIFYKQKIEKSVSKTLKTAITELYGYDKDNDKIT--DNIQQILSCCGIEGPQDWEKSKW-----------YIEKMNKSQMFPKSCCRDN---AEC-------YDKISGATAFSEGCVSRLREYLQRIFPIFIGVILGIAFFEIFVVICAFCLC 851
            K L+++ N++FWL GL  IV+ S+++  + T ++     +N         L +GI+I + AF GCCG  RES+ LL  +   +++++  Q+A G +A   K K++  V   +K+++ E YG    + +    D +Q+ L CCG +GP DW  S++            +  MN     P+SCC+DN    EC       +        + +GCV +L E +   +     V   +   E+  +  A  LC
Sbjct:   11 KYLMVLINILFWLIGLT-IVVTSVWMLTDPTFMLSMTQNYNHYHIALYVFLAIGILITLGAFFGCCGVCRESQCLLVSFFCVILIVMVAQIAAGAWAFHNKDKLDDIVRAAVKSSVQEEYGQSTMSSRTVTFDTLQKNLKCCGADGPGDWATSRFNNVDRTNIVEIAVSSMNVFYNIPESCCKDNLKDNECELSRRLKFGGPLNNAIYQQGCVDKLIEIIYENWVTIFAVTAAVILLELLSLTFALSLC 258          
BLAST of Tetraspanin vs. Ensembl Fly
Match: Tsp47F (gene:FBgn0033629 transcript:FBtr0088151)

HSP 1 Score: 89.7373 bits (221), Expect = 9.493e-21
Identity = 78/237 (32.91%), Postives = 127/237 (53.59%), Query Frame = 3
Query:  159 CGPKLAKCLLIIFNVVFWLSGLILIVIPSIYLS--NEKTKIVEKLDKFNSRXXXXXXXXXXXXXXXXXXCGCCGAVRESKLLLGMYIVFLMLIIFIQVALGIFAIFYKQKIEKSVSKTLKTAITELYGYDKDNDKITDNIQQILSCCGIEGPQDWEKSKWYIEKMNKSQMFPKSCCRDN------AECYDK--ISGATAFSEGCVSRLREYLQRIFPIFIGVILGIAFFEIFVVICA 839
            CGP L K +L  FNV+F +SGL +++  ++ L+  NE    VE           I ++V G+IIF+IA  GC GA++ES  LL  + V L +I  +++A+GI A  +K+ +E  V  +L+ +I      + ++    DNIQQ L CCG++ P DW         ++ ++  P SCC+          C +   +     F  GCV +L++ +++   I IGV +GIAF +I  ++ A
Sbjct:    4 CGPSLIKYVLFAFNVLFAISGLGILIAGAVVLADVNEFNHFVEG----RVLAPPIVLIVTGLIIFLIASLGCFGAIKESPTLLITFAVLLAVIFIVELAVGIAASVFKKDLEGMVKNSLQESIKR---SNSEDTMAWDNIQQKLMCCGVDSPADW-------RTLSANKTLPGSCCQPQYIDSTVGHCLESPALGKDKYFQVGCVGKLKDRIEKNAIILIGVGIGIAFIQILGIVLA 226          
BLAST of Tetraspanin vs. Ensembl Fly
Match: Tsp66E (gene:FBgn0035936 transcript:FBtr0076507)

HSP 1 Score: 76.2554 bits (186), Expect = 1.008e-15
Identity = 75/263 (28.52%), Postives = 128/263 (48.67%), Query Frame = 3
Query:  147 MAIGCGPKLAKCLLIIFNVVFWLSGLILIVIPSIYLSNEKTKIV--------EKLDKFNS----RXXXXXXXXXXXXXXXXXXCGCCGAVRESKLLLGMYIVFLMLIIFIQVALGIFAIFYKQKIEKSVSKTLKTAITELYGYDKDNDKITDNIQQIL---SCCGIEGPQDWEKS-KWYIEKMNKSQMFPKSCC----------RDNAECYDKISGATAF-SEGCVSRLREYLQRIFPIFIGVILGIAFFEIFVVICAFCLCR 854
            M   CG   AK LL IFN +F++ G I+  +  ++L+ +K  ++        E++++F        L   +LV+G ++F ++F G  GA+RES+ LL  Y  FL+L++  ++  G    F+K K+       L+T IT  Y   ++ D  +    Q++    CCGI    D++ S  W   K N++   P +CC          RD  +C    S + +F  +GC     E+L R   + I V + +    + ++I AF LC+
Sbjct:    1 MVFDCGVWCAKYLLCIFNFIFFVLGTIIFGV-GLWLAVDKHSLIALLKLVESERIEQFTQPQAIEQLAYVLLVIGAVMFFMSFLGYLGAMRESRCLLSTYGTFLILLLIAEIVAGGLGAFFKDKVRAESKNFLQTTITS-YSLGENVDATSLMWNQLMGNFGCCGINDYHDFDASPAWVNGKGNRT--IPDACCILKDVAKLVPRDE-DCTTNPSDSNSFYKKGCYEVFTEWLIRQRELVI-VAIAVGIVHLVLIILAFALCK 257          
BLAST of Tetraspanin vs. Ensembl Zebrafish
Match: tspan36 (tetraspanin 36 [Source:NCBI gene;Acc:437021])

HSP 1 Score: 100.908 bits (250), Expect = 1.006e-24
Identity = 60/224 (26.79%), Postives = 118/224 (52.68%), Query Frame = 3
Query:  159 CGPKLAKCLLIIFNVVFWLSGLILIVIPSIYLSNEKTKIVEKLDKFNSRXXXXXXXXXXXXXXXXXXCGCCGAVRESKLLLGMYIVFLMLIIFIQVALGIFAIFYKQKIEKSVSKTLKTAITELYGYDKDNDKITDNIQQILSCCGIEGPQDWEKSKWYIEKMNKSQMFPKSCCRDN-AECYDKISGATAF-SEGCVSRLREYLQRIFPIFIGVILGIAFFEIF 824
            CG   +K +L++ +++FW +G  L  + S Y+        + +   ++      ++ + +++F+I F GCC  +RESK+ LG++++ +MLI   +V   +F I Y+ +I   + K++     +  G + +   + D +Q  L CCG++   DW  + W+ +  N     P+SCC+ N  +C  ++S      ++GC ++L + LQ +    + VILG A  + F
Sbjct:    3 CGIITSKTILLLLSLIFWAAGAALAYVGS-YVIKSYNNFEDFMSDRHTLIPAAIIIGVAVVMFIIGFVGCCATLRESKVGLGLFLIIIMLIFAAEVTAFVFGIIYRGRIRGDLEKSMNDVFLKYDGLNSETHAV-DYLQSQLECCGVKNQTDWTLTSWFAQHNNT---VPQSCCKANMTQCTGQLSQPDLLNTQGCEAKLEQVLQDVLSYAMLVILGFAIIKFF 221          
BLAST of Tetraspanin vs. Ensembl Zebrafish
Match: tspan36 (tetraspanin 36 [Source:NCBI gene;Acc:437021])

HSP 1 Score: 100.908 bits (250), Expect = 1.006e-24
Identity = 60/224 (26.79%), Postives = 118/224 (52.68%), Query Frame = 3
Query:  159 CGPKLAKCLLIIFNVVFWLSGLILIVIPSIYLSNEKTKIVEKLDKFNSRXXXXXXXXXXXXXXXXXXCGCCGAVRESKLLLGMYIVFLMLIIFIQVALGIFAIFYKQKIEKSVSKTLKTAITELYGYDKDNDKITDNIQQILSCCGIEGPQDWEKSKWYIEKMNKSQMFPKSCCRDN-AECYDKISGATAF-SEGCVSRLREYLQRIFPIFIGVILGIAFFEIF 824
            CG   +K +L++ +++FW +G  L  + S Y+        + +   ++      ++ + +++F+I F GCC  +RESK+ LG++++ +MLI   +V   +F I Y+ +I   + K++     +  G + +   + D +Q  L CCG++   DW  + W+ +  N     P+SCC+ N  +C  ++S      ++GC ++L + LQ +    + VILG A  + F
Sbjct:    3 CGIITSKTILLLLSLIFWAAGAALAYVGS-YVIKSYNNFEDFMSDRHTLIPAAIIIGVAVVMFIIGFVGCCATLRESKVGLGLFLIIIMLIFAAEVTAFVFGIIYRGRIRGDLEKSMNDVFLKYDGLNSETHAV-DYLQSQLECCGVKNQTDWTLTSWFAQHNNT---VPQSCCKANMTQCTGQLSQPDLLNTQGCEAKLEQVLQDVLSYAMLVILGFAIIKFF 221          
BLAST of Tetraspanin vs. Ensembl Zebrafish
Match: cd151l (CD151 antigen, like [Source:ZFIN;Acc:ZDB-GENE-040426-1868])

HSP 1 Score: 93.9745 bits (232), Expect = 5.515e-22
Identity = 62/243 (25.51%), Postives = 108/243 (44.44%), Query Frame = 3
Query:  159 CGPKLAKCLLIIFNVVFWLSGLILIVIPSIYLSNEKTKIVEKLDKFNSRXXXXXXXXXXXXXXXXXXCGCCGAVRESKLLLGMYIVFLMLIIFIQVALGIFAIFYKQKIEKSVSKTLKTAITELYGYDKDND--KITDNIQQILSCCGIEGPQDWEKSKWYIEKMNKSQMFPKSCCRDNAECY----DKISGATAFSEGCVSRLREYLQRIFPIFIGVILGIAFFEIFVVICAFCLCRNTGSH 869
            CG    K LL  FN +FWL+G+ ++ +  I+   EK+  +  L           +++ G+I+ +    GCC   +E + LL +Y V L+ I  +++  G+ A  Y Q++   + + L+  + + Y   +     K  D +QQ   CCG     DW  S W        ++ P SCC+     +    D  S       GC+++L  ++     I   V +G+A  +I  +    CL R+  S 
Sbjct:   11 CGTICLKYLLFTFNFLFWLAGVAVMAV-GIWTVIEKSDYISLLSSKIYAVSAYILIMAGVIVMITGVLGCCATFKEQRRLLRVYFVLLLCIFLLEILAGVLAYIYYQQLNDELKENLRETMVQKYNQSEQEHVTKAVDKLQQEFKCCGSNSSSDWVDSAWIRSSEADGRLVPDSCCKSPVRKFCGRRDHPSNIYKVEGGCITKLENFILNHLQIIGAVGVGVASVQIVGMFFTCCLYRSLKSE 252          
BLAST of Tetraspanin vs. Ensembl Zebrafish
Match: cd151 (CD151 molecule [Source:ZFIN;Acc:ZDB-GENE-041010-137])

HSP 1 Score: 90.5077 bits (223), Expect = 9.993e-21
Identity = 70/239 (29.29%), Postives = 114/239 (47.70%), Query Frame = 3
Query:  159 CGPKLAKCLLIIFNVVFWLSGLILIVIPSIYLSNEKTKIVEKLDKFNSRXXXXXXXXXXXXXXXXXXCGCCGAVRESKLLLGMYIVFLMLIIFIQVALGIFAIFYKQKIEKSVSKTLKTAITELYGYDKDNDKIT---DNIQQILSCCGIEGPQDWEKSKWYIEKMNKSQMFPKSCCRDNA---ECYDKISGATAFSEGCVSRLREYLQRIFPIFIGVILGIAFFEIFVVICAFCLCRN 857
            CG    K LL +FN++FWL+G  ++ +  I+   +K+  +  L           ++  G ++      GCC  +RE + LL ++++ L+LI  +++  G+ A  Y Q++   +   LK  + E Y      + IT   DN+QQ L CCG     DW    W I      ++ P SCC+  +      D  S       GC+S+L E++ +   I   V LGIAF +I  +I   CL R+
Sbjct:   11 CGTVCLKYLLFVFNLLFWLAGGAVMAV-GIWTLLDKSDYISLLSSNTYMVAAFILIGAGAVVVFTGILGCCATIREQRSLLIVFLILLLLIFLLEITAGVLAYVYYQELNAELRADLKERMVENY-QQPGQEHITRAIDNLQQDLKCCGSNSSADWRDGAW-IRNYADRRLVPDSCCKTPSVGCGVRDHPSNIYKVEGGCISKLEEFILQHLLILGSVGLGIAFVQIVGMIFTCCLYRS 246          
BLAST of Tetraspanin vs. Ensembl Zebrafish
Match: cd82a (CD82 molecule a [Source:ZFIN;Acc:ZDB-GENE-030131-2818])

HSP 1 Score: 90.1225 bits (222), Expect = 1.341e-20
Identity = 52/186 (27.96%), Postives = 91/186 (48.92%), Query Frame = 3
Query:  363 GCCGAVRESKLLLGMYIVFLMLIIFIQVALGIFAIFYKQKIEKSVSKTLKTAITELYGYDKDNDKITDNIQQILSCCGIEGPQDWEKSKWYIEKMNKSQMFPKSCCR---------DNAECYDKISGATAFSEGCVSRLREYLQRIFPIFIGVILGIAFFEIFVVICAFCLCRNTGSHVQEV*ALP 893
            GC GA+ E + LLG+Y   L+LI+  QVA+ I   F +  ++    K +   +    G +K  ++  D +Q+ + CCG  G  DW+++  +I K N   ++P SC           DN  C    S    +  GC+  +  +L   + I +G+ LG+A  E+  +I +  LC++   H ++   +P
Sbjct:   73 GCLGAIYEIRCLLGLYFTCLLLILLAQVAVSILIYFQRDLLKTEADKIVSQVVANYPGQNKTAEQAWDYLQRTMQCCGWNGRMDWDEN--HIIKNNTVPLYPCSCHNYSIQAPIVPDNGFCQASSSDWPIYQTGCLEHVGSWLFTNYGIILGICLGVAVIELLGMILSMGLCKSV--HQEDYTKVP 254          
BLAST of Tetraspanin vs. Ensembl Xenopus
Match: cd151 (CD151 molecule (Raph blood group) [Source:NCBI gene;Acc:100144686])

HSP 1 Score: 100.138 bits (248), Expect = 4.574e-24
Identity = 69/243 (28.40%), Postives = 115/243 (47.33%), Query Frame = 3
Query:  159 CGPKLAKCLLIIFNVVFWLSGLILIVIPSIYLSNEKTKIVEKLDKFNSRXXXXXXXXXXXXXXXXXXCGCCGAVRESKLLLGMYIVFLMLIIFIQVALGIFAIFYKQKIEKSVSKTLKTAITELY---GYDKDNDKITDNIQQILSCCGIEGPQDWEKSKWYIEKMNKSQMFPKSCCRDNAE---CYDKISGATAFSEGCVSRLREYLQRIFPIFIGVILGIAFFEIFVVICAFCLCRNTGSH 869
            CG    K LL  FN  FWL+GL ++ +  I+   +K+  +  L           +++ G I+ +    GCC   +E K LL +Y + L+ I  ++V  GI A  Y Q++   + ++LK  +T  Y   G +K  + + D +QQ   CCG    +DW  S W      + ++ P SCC+   +     D  S       GC+++L  +++    I   V +GIA  ++F +I   CL R+  S 
Sbjct:   11 CGTICLKYLLFTFNFFFWLAGLAVMAV-GIWTLIQKSDYISLLPSNTYAATAYILVIAGAIVMITGILGCCATFKERKSLLKVYFILLLCIFILEVLAGILAYIYYQQLNAELKQSLKQTMTTKYKQPGEEKVTNAV-DKLQQEFKCCGSNNSEDWRDSIWINSPEAEKRLVPDSCCKTVTQRCGIRDHPSNIYKTEGGCITKLETFIRAHLLIIGAVGIGIACVQLFGMIFTCCLYRSLKSE 251          
BLAST of Tetraspanin vs. Ensembl Xenopus
Match: cd151 (CD151 molecule (Raph blood group) [Source:NCBI gene;Acc:100144686])

HSP 1 Score: 93.2041 bits (230), Expect = 1.533e-21
Identity = 70/250 (28.00%), Postives = 118/250 (47.20%), Query Frame = 3
Query:  159 CGPKLAKCLLIIFNVVFWLSGLILIVIPSIYLSNEKTKIVEKLDKFNSRXXXXXXXXXXXXXXXXXXCGCCGAVRESKLLLGMYIVFLMLIIFIQVALGIFA-IFYKQ------KIEKSVSKTLKTAITELY---GYDKDNDKITDNIQQILSCCGIEGPQDWEKSKWYIEKMNKSQMFPKSCCRDNAE---CYDKISGATAFSEGCVSRLREYLQRIFPIFIGVILGIAFFEIFVVICAFCLCRNTGSH 869
            CG    K LL  FN  FWL+GL ++ +  I+   +K+  +  L           +++ G I+ +    GCC   +E K LL +Y + L+ I  ++V  GI A I+Y+Q      ++   + ++LK  +T  Y   G +K  + + D +QQ   CCG    +DW  S W      + ++ P SCC+   +     D  S       GC+++L  +++    I   V +GIA  ++F +I   CL R+  S 
Sbjct:   11 CGTICLKYLLFTFNFFFWLAGLAVMAV-GIWTLIQKSDYISLLPSNTYAATAYILVIAGAIVMITGILGCCATFKERKSLLKVYFILLLCIFILEVLAGILAYIYYQQCTPFCLQLNAELKQSLKQTMTTKYKQPGEEKVTNAV-DKLQQEFKCCGSNNSEDWRDSIWINSPEAEKRLVPDSCCKTVTQRCGIRDHPSNIYKTEGGCITKLETFIRAHLLIIGAVGIGIACVQLFGMIFTCCLYRSLKSE 258          
BLAST of Tetraspanin vs. Ensembl Xenopus
Match: sertad4 (SERTA domain containing 4 [Source:Xenbase;Acc:XB-GENE-943347])

HSP 1 Score: 90.1225 bits (222), Expect = 1.796e-20
Identity = 56/232 (24.14%), Postives = 109/232 (46.98%), Query Frame = 3
Query:  177 KCLLIIFNVVFWLSGLILIVIPSIYLSNEKTKIVEKLDKFNSRXXXXXXXXXXXXXXXXXXCGCCGAVRESKLLLGMYIVFLMLIIFIQVALGIFAIFYKQKIEKSVSKTLKTAITELYGYDKDNDKITDNIQQILSCCGIEGPQDWEKSKWYIEKMNKSQMFPKSCCRDNAECYDK------ISGATAFSEGCVSRLREYLQRIFPIFIGVILGIAFFEIFVVICAFCLCR 854
            K +L+I+  +FW++G+IL+ +           I   L   N+  +   ++  G +I ++   GC    R S  +L +Y +FL +I  +++   I  + ++ +I+ S  +    A+ +         +  D IQ+ L CCG+    +W ++++Y     K+   P+SCCR    C +        +G   F +GC+S +   ++    +  G+  GIA F++  +  A CL R
Sbjct:   18 KSVLLIYTFIFWITGVILLTVG--VWGKVSLDIYFSLLNENATNVPYVLIGTGAVIILLGTFGCFATCRASTWMLKLYAMFLSIIFLVELIAAIVGLVFRHEIKNSFEQGYLQALKQYNATGDPRSQAVDTIQRTLQCCGVNSYNEWGQTQYY-----KTHGIPQSCCRVPGNCSEADMKDLGKAGGKVFKQGCISLVTTVMESRMGVVAGISFGIACFQLVGMFLACCLSR 242          
BLAST of Tetraspanin vs. Ensembl Xenopus
Match: tspan7 (tetraspanin 7 [Source:NCBI gene;Acc:394976])

HSP 1 Score: 89.7373 bits (221), Expect = 2.123e-20
Identity = 64/235 (27.23%), Postives = 111/235 (47.23%), Query Frame = 3
Query:  177 KCLLIIFNVVFWLSGLILIVI---PSIYLSNEKTKIVEKLDKFNSRXXXXXXXXXXXXXXXXXXCGCCGAVRESKLLLGMYIVFLMLIIFIQVALGIFAIFYKQKIEKSVSKTLKTAITELYGYDKDNDKITDNIQQILSCCGIEGPQDWEKSKWYIEKMNKSQMFPKSCCRDNAECYDK------ISGATAFSEGCVSRLREYLQRIFPIFIGVILGIAFFEIFVVICAFCLCR 854
            K LLII++ VFW++G+IL+ +     + L    + I E     NS      ++  G  I V    GC    R S  +L +Y +FL L+   ++  GI    ++ +I+ +  +T   AI    G D+ +  + D++Q+ L CCG++   +W  S ++         FP SCC + ++C  +      I+       GC   +  +++    I  GV  GIAF ++  ++ A CL R
Sbjct:   16 KTLLIIYSFVFWITGVILLAVGVWGKLTLGTYISLIAE-----NSTNAPYVLIGTGTTIIVFGLFGCFATCRGSPWMLKLYAMFLSLVFLAELIAGISGFVFRHEIKDTFLRTYTEAIQNYNGNDERSQAV-DDVQRSLRCCGVQYYTNWTTSLYW-----HDHGFPSSCCANTSDCNPQDLRNMTINFTKVNQRGCYELVTSFMETNMGIIAGVAFGIAFSQLIGMLLACCLSR 239          
BLAST of Tetraspanin vs. Ensembl Xenopus
Match: cd82 (CD82 molecule [Source:NCBI gene;Acc:394799])

HSP 1 Score: 87.8113 bits (216), Expect = 1.693e-19
Identity = 56/180 (31.11%), Postives = 87/180 (48.33%), Query Frame = 3
Query:  363 GCCGAVRESKLLLGMYIVFLMLIIFIQVALGIFAIFYKQKIEKSVSKTLKTAITELYGYDKDNDKIT------DNIQQILSCCGIEGPQDWEKSKWYIEKMNKSQMFPKSCCRD----NAEC-YDKISGATAFSEGCVSRLREYLQRIFPIFIGVILGIAFFEIFVVICAFCLCRNTGSH 869
            GC GAV E + LLG+Y  FL++I+  QVA GI     +  ++  +S  +   I     YD ++ K T      D IQ  L CCG    Q+W  +       N +  +P SC ++    N  C Y+    +  +  GC+  +  +LQ    I +GV +G+A  E+  +I + CLCR+  S 
Sbjct:   87 GCLGAVNEIRCLLGLYFSFLLIILIAQVAAGILIYLQRDTLKTEMSSIIHELIVT---YDYEDGKNTSAETTWDYIQTNLRCCGWTNYQNWTANT---VVQNSTNQYPCSCMKNQSSPNGFCQYNGTVESAVYQTGCMQGVESWLQDNLGIILGVCVGVAVIELLGLILSMCLCRSIQSE 260          
BLAST of Tetraspanin vs. Ensembl Mouse
Match: Tspan17 (tetraspanin 17 [Source:MGI Symbol;Acc:MGI:1921507])

HSP 1 Score: 95.1301 bits (235), Expect = 2.700e-22
Identity = 79/256 (30.86%), Postives = 126/256 (49.22%), Query Frame = 3
Query:  174 AKCLLIIFNVVFWLSGLILIVIPSIYLSNEKTKI--VEKLDKFNSRXXXXXXXXXXXXXXXXXXCGCCGAVRESKLLLGMYIVFLMLIIFIQVALGIFAIFYKQKIEKSVSKTLKTAITELYGYDKDNDKITDNIQQILSCCGIEGPQDWEKSKWY-IEKMNKSQM---FPKSCC-RDNAE-------CYD---KI---SGATAFSEGCVSRLREYLQRIFPIFIGVILGIAFFEIFVVICAFCLCRNTGSHVQEV 881
             K  L  FN+VFW+ G + + I  ++   EK  +  +  L            +V+G ++ V+ F GC GA+RE+  LL  + VFL LI F+++A GI A  +K  I   ++  +   + + Y  D D   + D  Q+  SCCG  GP DW  + ++    +N S+     P SCC RD AE        YD   K+      + +++GCV +  ++LQ    +  GV++GIA  +IF      CL +N  S ++ V
Sbjct:   17 GKYFLFGFNIVFWVLGALFLAI-GLWAWGEKGVLSNISALTDLGGLDPVWLFVVVGGVMSVLGFAGCIGALRENTFLLKFFSVFLGLIFFLELAAGILAFVFKDWIRDQLNLFINNNV-KAYRDDLDLQNLIDFAQEYWSCCGARGPNDWNLNIYFNCTDLNPSRERCGVPFSCCVRDPAEDVLNTQCGYDIRLKLELEQQGSIYTKGCVGQFEKWLQDNLIVVAGVLVGIALLQIF----GLCLAQNLVSDIKAV 266          
BLAST of Tetraspanin vs. Ensembl Mouse
Match: Tspan17 (tetraspanin 17 [Source:MGI Symbol;Acc:MGI:1921507])

HSP 1 Score: 95.1301 bits (235), Expect = 3.910e-22
Identity = 79/256 (30.86%), Postives = 126/256 (49.22%), Query Frame = 3
Query:  174 AKCLLIIFNVVFWLSGLILIVIPSIYLSNEKTKI--VEKLDKFNSRXXXXXXXXXXXXXXXXXXCGCCGAVRESKLLLGMYIVFLMLIIFIQVALGIFAIFYKQKIEKSVSKTLKTAITELYGYDKDNDKITDNIQQILSCCGIEGPQDWEKSKWY-IEKMNKSQM---FPKSCC-RDNAE-------CYD---KI---SGATAFSEGCVSRLREYLQRIFPIFIGVILGIAFFEIFVVICAFCLCRNTGSHVQEV 881
             K  L  FN+VFW+ G + + I  ++   EK  +  +  L            +V+G ++ V+ F GC GA+RE+  LL  + VFL LI F+++A GI A  +K  I   ++  +   + + Y  D D   + D  Q+  SCCG  GP DW  + ++    +N S+     P SCC RD AE        YD   K+      + +++GCV +  ++LQ    +  GV++GIA  +IF      CL +N  S ++ V
Sbjct:   17 GKYFLFGFNIVFWVLGALFLAI-GLWAWGEKGVLSNISALTDLGGLDPVWLFVVVGGVMSVLGFAGCIGALRENTFLLKFFSVFLGLIFFLELAAGILAFVFKDWIRDQLNLFINNNV-KAYRDDLDLQNLIDFAQEYWSCCGARGPNDWNLNIYFNCTDLNPSRERCGVPFSCCVRDPAEDVLNTQCGYDIRLKLELEQQGSIYTKGCVGQFEKWLQDNLIVVAGVLVGIALLQIF----GLCLAQNLVSDIKAV 266          
BLAST of Tetraspanin vs. Ensembl Mouse
Match: Tspan17 (tetraspanin 17 [Source:MGI Symbol;Acc:MGI:1921507])

HSP 1 Score: 93.9745 bits (232), Expect = 6.929e-22
Identity = 79/259 (30.50%), Postives = 126/259 (48.65%), Query Frame = 3
Query:  174 AKCLLIIFNVVFWLSGLILIVIPSIYLSNEKTKI--VEKLDKFNSRXXXXXXXXXXXXXXXXXXCGCCGAVRESKLLLGMYIVFLMLIIFIQVALGIFAIFYKQKIEKSVSKTLKTAITELYGYDKDNDKITDNIQQILSCCGIEGPQDWEKSKWY-IEKMNKSQM---FPKSCC-RDNAE-------CYD---KI------SGATAFSEGCVSRLREYLQRIFPIFIGVILGIAFFEIFVVICAFCLCRNTGSHVQEV 881
             K  L  FN+VFW+ G + + I  ++   EK  +  +  L            +V+G ++ V+ F GC GA+RE+  LL  + VFL LI F+++A GI A  +K  I   ++  +   + + Y  D D   + D  Q+  SCCG  GP DW  + ++    +N S+     P SCC RD AE        YD   K+         + +++GCV +  ++LQ    +  GV++GIA  +IF      CL +N  S ++ V
Sbjct:   17 GKYFLFGFNIVFWVLGALFLAI-GLWAWGEKGVLSNISALTDLGGLDPVWLFVVVGGVMSVLGFAGCIGALRENTFLLKFFSVFLGLIFFLELAAGILAFVFKDWIRDQLNLFINNNV-KAYRDDLDLQNLIDFAQEYWSCCGARGPNDWNLNIYFNCTDLNPSRERCGVPFSCCVRDPAEDVLNTQCGYDIRLKLVRRELEQQGSIYTKGCVGQFEKWLQDNLIVVAGVLVGIALLQIF----GLCLAQNLVSDIKAV 269          
BLAST of Tetraspanin vs. Ensembl Mouse
Match: Tspan7 (tetraspanin 7 [Source:MGI Symbol;Acc:MGI:1298407])

HSP 1 Score: 93.2041 bits (230), Expect = 8.990e-22
Identity = 64/235 (27.23%), Postives = 114/235 (48.51%), Query Frame = 3
Query:  177 KCLLIIFNVVFWLSGLILIVIP---SIYLSNEKTKIVEKLDKFNSRXXXXXXXXXXXXXXXXXXCGCCGAVRESKLLLGMYIVFLMLIIFIQVALGIFAIFYKQKIEKSVSKTLKTAITELYGYDKDNDKITDNIQQILSCCGIEGPQDWEKSKWYIEKMNKSQMFPKSCCRDNAEC-----YDKISGATAFSE-GCVSRLREYLQRIFPIFIGVILGIAFFEIFVVICAFCLCR 854
            K LLII++ VFW++G+IL+ +     + L    + I E     NS      ++  G  I V    GC    R S  +L +Y +FL L+   ++  GI    ++ +I+ +  +T   A+    G D +  +  D++Q+ LSCCG++   +W  S ++++        P SCC +  +C     ++    AT  ++ GC   +  +++    I  GV  GIAF ++  ++ A CL R
Sbjct:   16 KTLLIIYSFVFWITGVILLAVGVWGKLTLGTYISLIAE-----NSTNAPYVLIGTGTTIVVFGLFGCFATCRGSPWMLKLYAMFLSLVFLAELVAGISGFVFRHEIKDTFLRTYTDAMQNYNGND-ERSRAVDHVQRSLSCCGVQNYTNWSSSPYFLD-----HGIPPSCCMNETDCNPLDLHNLTVAATKVNQKGCYDLVTSFMETNMGIIAGVAFGIAFSQLIGMLLACCLSR 239          
BLAST of Tetraspanin vs. Ensembl Mouse
Match: Tspan6 (tetraspanin 6 [Source:MGI Symbol;Acc:MGI:1926264])

HSP 1 Score: 92.0485 bits (227), Expect = 2.416e-21
Identity = 60/238 (25.21%), Postives = 112/238 (47.06%), Query Frame = 3
Query:  177 KCLLIIFNVVFWLSGLILIVIP---SIYLSNEKTKIVEKLDKFNSRXXXXXXXXXXXXXXXXXXCGCCGAVRESKLLLGMYIVFLMLIIFIQVALGIFAIFYKQKIEKSVSKTLKTAITELYGYDKDNDKITDNIQQILSCCGIEGPQDWEKSKWYIEKMNKSQMFPKSCCRDNAECYDKISGATAFSEGCVSRLREYLQRIFPIFIGVILGIAFFEIFVVICAFCLCRNTGSHVQEV 881
            K +L+I+  +FW++G+IL+ +     + L N  + + EK     +  +   ++  G +I ++   GC    R S  +L +Y +FL LI  +++   I    ++ +I+ S     + A+ E         +  D IQ  L CCG+    DW+ + +Y E       FPKSCC+    CY +        EGC  ++   ++    +  G+  G+A F++  +  A+CL R   ++  E+
Sbjct:   18 KSVLLIYTFIFWITGVILLAVGIWGKVSLENYFSLLNEK-----ATNVPFVLIGTGTVIILLGTFGCFATCRASAWMLKLYAMFLTLIFLVELVAAIVGFVFRHEIKNSFKSNYENALKEYNSTGDYRSEAVDKIQSTLHCCGVTNYGDWKGTNYYSE-----TGFPKSCCKLEG-CYPQRDADKVNEEGCFIKVMTTIESEMGVVAGISFGVACFQLIGIFLAYCLSRAITNNQYEI 244          
BLAST of Tetraspanin vs. UniProt/SwissProt
Match: sp|Q6NWG0|TSN36_DANRE (Tetraspanin-36 OS=Danio rerio OX=7955 GN=tspan36 PE=1 SV=2)

HSP 1 Score: 100.908 bits (250), Expect = 7.593e-24
Identity = 60/224 (26.79%), Postives = 118/224 (52.68%), Query Frame = 3
Query:  159 CGPKLAKCLLIIFNVVFWLSGLILIVIPSIYLSNEKTKIVEKLDKFNSRXXXXXXXXXXXXXXXXXXCGCCGAVRESKLLLGMYIVFLMLIIFIQVALGIFAIFYKQKIEKSVSKTLKTAITELYGYDKDNDKITDNIQQILSCCGIEGPQDWEKSKWYIEKMNKSQMFPKSCCRDN-AECYDKISGATAF-SEGCVSRLREYLQRIFPIFIGVILGIAFFEIF 824
            CG   +K +L++ +++FW +G  L  + S Y+        + +   ++      ++ + +++F+I F GCC  +RESK+ LG++++ +MLI   +V   +F I Y+ +I   + K++     +  G + +   + D +Q  L CCG++   DW  + W+ +  N     P+SCC+ N  +C  ++S      ++GC ++L + LQ +    + VILG A  + F
Sbjct:    3 CGIITSKTILLLLSLIFWAAGAALAYVGS-YVIKSYNNFEDFMSDRHTLIPAAIIIGVAVVMFIIGFVGCCATLRESKVGLGLFLIIIMLIFAAEVTAFVFGIIYRGRIRGDLEKSMNDVFLKYDGLNSETHAV-DYLQSQLECCGVKNQTDWTLTSWFAQHNNT---VPQSCCKANMTQCTGQLSQPDLLNTQGCEAKLEQVLQDVLSYAMLVILGFAIIKFF 221          
BLAST of Tetraspanin vs. UniProt/SwissProt
Match: sp|Q7YQK9|TSN7_PONPY (Tetraspanin-7 OS=Pongo pygmaeus OX=9600 GN=TSPAN7 PE=2 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 1.431e-21
Identity = 64/235 (27.23%), Postives = 112/235 (47.66%), Query Frame = 3
Query:  177 KCLLIIFNVVFWLSGLILIVIP---SIYLSNEKTKIVEKLDKFNSRXXXXXXXXXXXXXXXXXXCGCCGAVRESKLLLGMYIVFLMLIIFIQVALGIFAIFYKQKIEKSVSKTLKTAITELYGYDKDNDKITDNIQQILSCCGIEGPQDWEKSKWYIEKMNKSQMFPKSCCRDNAECYDK------ISGATAFSEGCVSRLREYLQRIFPIFIGVILGIAFFEIFVVICAFCLCR 854
            K LLII++ VFW++G+IL+ +     + L    + I E     NS      ++  G  I V    GC    R S  +L +Y +FL L+   ++  GI    ++ +I+ +  +T   A+    G D D  +  D++Q+ LSCCG++   +W  S +++E        P SCC +  +C  +      ++      +GC   +  +++    I  GV  GIAF ++  ++ A CL R
Sbjct:   11 KTLLIIYSFVFWITGVILLAVGVWGKLTLGTYISLIAE-----NSTNAPYVLIGTGTTIVVFGLFGCFATCRGSPWMLKLYAMFLSLVFLAELVAGISGFVFRHEIKDTFLRTYTDAMQTYDGKD-DRSQAVDHVQRSLSCCGVQNYTNWSTSPYFLE-----HGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMETNMGIIAGVAFGIAFSQLIGMLLACCLSR 234          
BLAST of Tetraspanin vs. UniProt/SwissProt
Match: sp|Q9D7W4|TSN17_MOUSE (Tetraspanin-17 OS=Mus musculus OX=10090 GN=Tspan17 PE=1 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 2.154e-21
Identity = 79/256 (30.86%), Postives = 126/256 (49.22%), Query Frame = 3
Query:  174 AKCLLIIFNVVFWLSGLILIVIPSIYLSNEKTKI--VEKLDKFNSRXXXXXXXXXXXXXXXXXXCGCCGAVRESKLLLGMYIVFLMLIIFIQVALGIFAIFYKQKIEKSVSKTLKTAITELYGYDKDNDKITDNIQQILSCCGIEGPQDWEKSKWY-IEKMNKSQM---FPKSCC-RDNAE-------CYD---KI---SGATAFSEGCVSRLREYLQRIFPIFIGVILGIAFFEIFVVICAFCLCRNTGSHVQEV 881
             K  L  FN+VFW+ G + + I  ++   EK  +  +  L            +V+G ++ V+ F GC GA+RE+  LL  + VFL LI F+++A GI A  +K  I   ++  +   + + Y  D D   + D  Q+  SCCG  GP DW  + ++    +N S+     P SCC RD AE        YD   K+      + +++GCV +  ++LQ    +  GV++GIA  +IF      CL +N  S ++ V
Sbjct:   17 GKYFLFGFNIVFWVLGALFLAI-GLWAWGEKGVLSNISALTDLGGLDPVWLFVVVGGVMSVLGFAGCIGALRENTFLLKFFSVFLGLIFFLELAAGILAFVFKDWIRDQLNLFINNNV-KAYRDDLDLQNLIDFAQEYWSCCGARGPNDWNLNIYFNCTDLNPSRERCGVPFSCCVRDPAEDVLNTQCGYDIRLKLELEQEGSIYTKGCVGQFEKWLQDNLIVVAGVLVGIALLQIF----GLCLAQNLVSDIKAV 266          
BLAST of Tetraspanin vs. UniProt/SwissProt
Match: sp|Q7YQL0|TSN7_PANTR (Tetraspanin-7 OS=Pan troglodytes OX=9598 GN=TSPAN7 PE=2 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 2.218e-21
Identity = 62/235 (26.38%), Postives = 113/235 (48.09%), Query Frame = 3
Query:  177 KCLLIIFNVVFWLSGLILIVIP---SIYLSNEKTKIVEKLDKFNSRXXXXXXXXXXXXXXXXXXCGCCGAVRESKLLLGMYIVFLMLIIFIQVALGIFAIFYKQKIEKSVSKTLKTAITELYGYDKDNDKITDNIQQILSCCGIEGPQDWEKSKWYIEKMNKSQMFPKSCCRDNAECYDK------ISGATAFSEGCVSRLREYLQRIFPIFIGVILGIAFFEIFVVICAFCLCR 854
            K LLII++ VFW++G+IL+ +     + L    + I E     NS      ++  G  I V    GC    R S  +L +Y +FL L+   ++  GI    ++ +I+ +  +T   A+ + Y  + +  +  D++Q+ LSCCG++   +W  S +++E        P SCC +  +C  +      ++      +GC   +  +++    I  GV  GIAF ++  ++ A CL R
Sbjct:   11 KTLLIIYSFVFWITGVILLAVGVWGKLTLGTYISLIAE-----NSTNAPYVLIGTGTTIVVFGLFGCFATCRGSPWMLKLYAMFLSLVFLAELVAGISGFVFRHEIKDTFLRTYTDAM-QTYNGNDERSRAVDHVQRSLSCCGVQNYTNWSTSPYFLE-----HGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMETNMGIIAGVAFGIAFSQLIGMLLACCLSR 234          
BLAST of Tetraspanin vs. UniProt/SwissProt
Match: sp|P41732|TSN7_HUMAN (Tetraspanin-7 OS=Homo sapiens OX=9606 GN=TSPAN7 PE=1 SV=2)

HSP 1 Score: 94.3597 bits (233), Expect = 2.421e-21
Identity = 62/235 (26.38%), Postives = 113/235 (48.09%), Query Frame = 3
Query:  177 KCLLIIFNVVFWLSGLILIVIP---SIYLSNEKTKIVEKLDKFNSRXXXXXXXXXXXXXXXXXXCGCCGAVRESKLLLGMYIVFLMLIIFIQVALGIFAIFYKQKIEKSVSKTLKTAITELYGYDKDNDKITDNIQQILSCCGIEGPQDWEKSKWYIEKMNKSQMFPKSCCRDNAECYDK------ISGATAFSEGCVSRLREYLQRIFPIFIGVILGIAFFEIFVVICAFCLCR 854
            K LLII++ VFW++G+IL+ +     + L    + I E     NS      ++  G  I V    GC    R S  +L +Y +FL L+   ++  GI    ++ +I+ +  +T   A+ + Y  + +  +  D++Q+ LSCCG++   +W  S +++E        P SCC +  +C  +      ++      +GC   +  +++    I  GV  GIAF ++  ++ A CL R
Sbjct:   16 KTLLIIYSFVFWITGVILLAVGVWGKLTLGTYISLIAE-----NSTNAPYVLIGTGTTIVVFGLFGCFATCRGSPWMLKLYAMFLSLVFLAELVAGISGFVFRHEIKDTFLRTYTDAM-QTYNGNDERSRAVDHVQRSLSCCGVQNYTNWSTSPYFLE-----HGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMETNMGIIAGVAFGIAFSQLIGMLLACCLSR 239          
BLAST of Tetraspanin vs. TrEMBL
Match: A0A1S3ICM9 (Tetraspanin OS=Lingula unguis OX=7574 GN=LOC106163083 PE=3 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 8.331e-29
Identity = 86/265 (32.45%), Postives = 129/265 (48.68%), Query Frame = 3
Query:  147 MAIGCGPKLAKCLLIIFNVVFWLSGLILIVI-------PSIYLSNEKTKIVEKLDKFNSRXXXXXXXXXXXXXXXXXXCGCCGAVRESKLLLGMYIVFLMLIIFIQVALGIFAIFYKQKIEKSVSKTLKTAITELYGYDKDNDKITDNIQQILSCCGIEGPQDWEKSKWYIEKMNKSQMFPKSCCRDNAECYDKI-----------------SGATAFSEGCVSRLREYLQRIFPIFIGVILGIAFFEIFVVICAFCLCRNTGSH 869
            MA+GCG K AK +LI+FN +FWLSG  ++ +       PSI L  ++   ++  D          ++  G  +F++ FCGCCGA+RESK +LGMYI F++LI+ +++A GI A+ YK K+E  +   + T+I   Y  +       + +Q    CCG     D++ SKW     +   + P  C  D  +  DKI                 S     S+GC   ++ +      + I V  GIA  E+F  I A CLCR  G  
Sbjct:    1 MAVGCGAKCAKFMLIVFNTIFWLSGAAVLGVGIWLRIDPSI-LKYQQVVSIDSEDPM-LEYAAYALIAAGAFVFLVGFCGCCGALRESKFMLGMYIFFMVLIMAVELAAGILAVAYKDKVETQLKAYMVTSIKNKYMTNNTIGAAWNLVQYNHECCGANNYTDYQNSKW--SNASGIHVAPTCCKMDPGKDPDKIQPVNYQVCQTEANAGTPSPTQLHSKGCYEAVKAWFLNHAVVVIAVGCGIAGVELFGFIFAICLCRGIGDE 261          
BLAST of Tetraspanin vs. TrEMBL
Match: A0A1S3IDT4 (Tetraspanin OS=Lingula unguis OX=7574 GN=LOC106163083 PE=3 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 1.060e-28
Identity = 86/264 (32.58%), Postives = 128/264 (48.48%), Query Frame = 3
Query:  147 MAIGCGPKLAKCLLIIFNVVFWLSGLILIVI-------PSIYLSNEKTKIVEKLDKFNSRXXXXXXXXXXXXXXXXXXCGCCGAVRESKLLLGMYIVFLMLIIFIQVALGIFAIFYKQKIEKSVSKTLKTAITELYGYDKDNDKITDNIQQILSCCGIEGPQDWEKSKWYIEKMNKSQMFPKSCCRDNAECYDKI-----------------SGATAFSEGCVSRLREYLQRIFPIFIGVILGIAFFEIFVVICAFCLCRNTGS 866
            MA+GCG K AK +LI+FN +FWLSG  ++ +       PSI L  ++   ++  D          ++  G  +F++ FCGCCGA+RESK +LGMYI F++LI+ +++A GI A+ YK K+E  +   + T+I   Y  +       + +Q    CCG     D+  SKW     +   + P  C  D  +  DKI                 S     S+GC   ++ +      + I V  GIA  E+F  I A CLCR  G 
Sbjct:    1 MAVGCGAKCAKFMLIVFNTIFWLSGAAVLGVGIWLRIDPSI-LKYQQVVSIDSEDPM-LEYAAYALIAAGAFVFLVGFCGCCGALRESKFMLGMYIFFMVLIMAVELAAGILAVAYKDKVETQLKAYMVTSIKNKYMTNNTIGAAWNLVQYNHECCGANNYTDYHNSKW--SNASGIHVAPTCCKMDPGKDPDKIQPVNYQVCQTEANAGTPSPTQLHSKGCYEAVKAWFLNHAVVVIAVGCGIAGVELFGFIFAICLCRGIGD 260          
BLAST of Tetraspanin vs. TrEMBL
Match: A0A3S1CDQ5 (Tetraspanin OS=Elysia chlorotica OX=188477 GN=EGW08_002351 PE=3 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 3.258e-28
Identity = 81/248 (32.66%), Postives = 122/248 (49.19%), Query Frame = 3
Query:  153 IGCGPKLAKCLLIIFNVVFWLSG-------LILIVIPSIYLSNEKTKIVEKLDKFNSRXXXXXXXXXXXXXXXXXXCGCCGAVRESKLLLGMYIVFLMLIIFIQVALGIFAIFYKQKIEKSVSKTLKTAITELYGYDKDNDKITDNIQQILSCCGIEGPQDWEKSKWYIEKMNKSQMFPKSCCRDNAECYDK------ISGATAFSEGCVSRLREYLQRIFPIFIGVILGIAFFEIFVVICAFCLCRN 857
            +GC   LA+ LLI FN +FWLSG       + +IV P I    E        D+F        ++  G  +F++ FCGCCGA+R SK L+G+YI+FL+L+   ++A GI+   Y       +   L  +I E Y          D +Q+ L CCG  G  D++ S W   + +  Q+ P SCC    +   K      ++    +++GC  ++ ++L     I IGV  GIA  +I   ICA C CR+
Sbjct:    1 MGCCSGLARMLLITFNFIFWLSGAAILAVGIWIIVDPEIEDYQEVISDATNDDQF-LNTAAYILIGFGAFVFLVGFCGCCGAIRSSKCLIGLYIMFLVLVFAGELAAGIYVAIYSNDASDKLDDGLTKSIQENYKSGSKVASAWDVVQKELECCGGNGYGDYDNSTWMASQTD-GQLMPLSCCVLGTDNIPKNATLCQMAKDYYWTDGCREQIEDWLDEHSRILIGVACGIAALQIIGFICAVCFCRH 246          
BLAST of Tetraspanin vs. TrEMBL
Match: A0A1S3ICX6 (Tetraspanin OS=Lingula unguis OX=7574 GN=LOC106163083 PE=3 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 1.548e-27
Identity = 87/266 (32.71%), Postives = 131/266 (49.25%), Query Frame = 3
Query:  147 MAIGCGPKLAKCLLIIFNVVFWLSGLILIVI-------PSIYLSNEKTKIVEKLDKFNSRXXXXXXXXXXXXXXXXXXCGCCGAVRESKLLLGMYIVFLMLIIFIQVALGIFAIFYKQKIEKSVSKTLKTAITELYGYDKDNDKITDNIQQILSCCGIEGPQDWEKSKWYIEKMNKSQM-FPKSCCRDNAE-------------CYDKISGATA----FSEGCVSRLREYLQRIFPIFIGVILGIAFFEIFVVICAFCLCRNTGSH 869
            MA+GCG K AK +LI+FN +FWLSG  ++ +       PSI L  ++   ++  D          ++  G  +F++ FCGCCGA+RESK +LGMYI F++LI+ +++A GI A+ YK K+E  +   + T+I   Y  +       + +Q    CCG     D++ SKW     N S +    +CC+  A              C  + S  T      S+GC   ++ +      + I V  GIA  E+F  I A CLCR  G  
Sbjct:    1 MAVGCGAKCAKFMLIVFNTIFWLSGAAVLGVGIWLRIDPSI-LKYQQVVSIDSEDPM-LEYAAYALIAAGAFVFLVGFCGCCGALRESKFMLGMYIFFMVLIMAVELAAGILAVAYKDKVETQLKAYMVTSIKNKYMTNNTIGAAWNLVQYNHECCGANNYTDYQNSKW----SNASGIPVAPTCCKMPAGKDPDKIQPVNYQVCRQEASSGTQPTQLHSKGCYEAVKAWFLNHAVVVIAVGCGIAGVELFGFIFAICLCRGIGDE 260          
BLAST of Tetraspanin vs. TrEMBL
Match: A0A2C9JYJ2 (Tetraspanin OS=Biomphalaria glabrata OX=6526 GN=106073085 PE=3 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 4.982e-27
Identity = 82/251 (32.67%), Postives = 129/251 (51.39%), Query Frame = 3
Query:  174 AKCLLIIFNVVFWLSGLILIVIPSIYLSNEKTKIVEKLDKFNS------RXXXXXXXXXXXXXXXXXXCGCCGAVRESKLLLGMYIVFLMLIIFIQVALGIFAIFYKQKIEKSVSKTLKTAITELYGYDKDNDKITDNIQQILSCCGIEGPQDWEKSKWYIEKMNKSQMFPKSCC-------RDNAECYDKISGATAFSEGCVSRLREYLQRIFPIFIGVILGIAFFEIFVVICAFCLCRN----TGSHVQ 875
            ++ LL IFN +FWLSG  ++ +    L + + K   KL K  +      +     ++  G  +F++ FCGCCGA+R SK LLG YI FL+++   ++A GI+   +K  I+  +   L  +I +   Y+ D     D +Q+ L CCG +   D++ S W   K +     P+SCC       R+   C +  +G   +++GC   L +++     I IGV  GIA  EI  +ICA C CR+    +G HVQ
Sbjct:    8 SRALLFIFNFIFWLSGAAILGVGIWILVDPQLKDYMKLIKDGTQDEEFLKTSAYILIGFGSFVFLVGFCGCCGAIRGSKCLLGFYIFFLVVVFAGELAAGIYVAVFKNDIDSKLKTGLVDSIKK--NYEGDMQTTWDLVQKELKCCGGDSYLDYQNSTWS-HKQSSDVKIPESCCELVNGVDRNKTLCMEATAG-YFYTKGCREALLDWVNSHSAILIGVGCGIAGLEIIGLICAICFCRHACPPSGEHVQ 254          
BLAST of Tetraspanin vs. Ensembl Cavefish
Match: cd151 (CD151 antigen-like [Source:NCBI gene;Acc:103041246])

HSP 1 Score: 92.8189 bits (229), Expect = 1.035e-21
Identity = 67/238 (28.15%), Postives = 117/238 (49.16%), Query Frame = 3
Query:  159 CGPKLAKCLLIIFNVVFWLSGLILIVIPSIYLSNEKTKIVEKLDKFNSRXXXXXXXXXXXXXXXXXXCGCCGAVRESKLLLGMYIVFLMLIIFIQVALGIFAIFYKQKIEKSVSKTLKTAITELYGYDKDND--KITDNIQQILSCCGIEGPQDWEKSKWYIEKMNKSQMFPKSCCR---DNAECYDKISGATAFSEGCVSRLREYLQRIFPIFIGVILGIAFFEIFVVICAFCLCRN 857
            CG    K LL  FN++FWLSG  ++ +  ++   +K+  +  L           ++  G I+ +    GCC  ++ES+ LL ++ V L+LI  +++  G+ A  Y Q++ + +   LK  + + Y    ++   +  D +QQ L CCG     DW++  W I      ++ P SCC+   D+    D  S       GC+S+L E++ +   I   V +GIAF +I  ++   CL R+
Sbjct:   10 CGTICLKYLLFTFNLLFWLSGGAVMAV-GLWTLVDKSDYISLLSSSTYSLAAYILIAAGAIVMLTGVLGCCATIKESRALLIVFFVLLLLIFLLEITAGVLAYVYYQELNEELRADLKETMVQKYQQPGEDHVTRAVDKLQQDLKCCGSNSSADWQQGTW-IHTFADGRLVPDSCCKTPTDHCGLRDHPSNIYKVEGGCISKLEEFILQHLQILGAVGIGIAFLQILGMLFTCCLYRS 245          
BLAST of Tetraspanin vs. Ensembl Cavefish
Match: tspan11 (tetraspanin-11-like [Source:NCBI gene;Acc:103024246])

HSP 1 Score: 91.6633 bits (226), Expect = 3.200e-21
Identity = 66/234 (28.21%), Postives = 112/234 (47.86%), Query Frame = 3
Query:  177 KCLLIIFNVVFWLSGLILIVIPSIYLSNEKTKIVEKLDKFNSRXXXXXXXXXXXXXXXXXXCGCCGAVRESKLLLGMYIVFLMLIIFIQVALGIFAIFYKQKIEKSVSKTLKTAITELYGYDK-DNDKIT---DNIQQILSCCGIEGPQDWEKSKWYIEKMNKSQMFPKSCCRD-NAEC--YDKISGATAFSEGCVSRLREYLQRIFPIFIGVILGIAFFEIFVVICAFCLCRN 857
            K LL +FN +FW+ G +++ +  I+   +K + +  L           +++ G ++ V  F GCC  +RE + LL  Y   L+LI  I++  G+ A  Y Q++ + + + L   +TE   YD+   + IT   D +QQ   CCG     DW+ S +      + ++ P SCC+    EC   D  S       GC+++L  +L     I   V +G+A  +I  ++   CL R 
Sbjct:   18 KYLLFVFNFLFWMGGGVVMAV-GIWTLIDKGEYLSLLASSTFAVSAYILILAGALVMVTGFLGCCAVIREQRSLLSTYFSCLLLIFLIELVAGVLAYVYYQRLSEELKQHLSKTMTE--NYDQLGKEGITRAVDRLQQDFKCCGSNNSSDWKHSVYVQSPEAQGRVVPDSCCKTITPECGRRDHPSNIYKVEGGCITKLEHFLADHLLIIGAVGIGVACLQICGMVFTCCLHRQ 248          
BLAST of Tetraspanin vs. Ensembl Cavefish
Match: tspan11 (tetraspanin-11-like [Source:NCBI gene;Acc:103024246])

HSP 1 Score: 89.3521 bits (220), Expect = 2.726e-20
Identity = 63/230 (27.39%), Postives = 109/230 (47.39%), Query Frame = 3
Query:  177 KCLLIIFNVVFWLSGLILIVIPSIYLSNEKTKIVEKLDKFNSRXXXXXXXXXXXXXXXXXXCGCCGAVRESKLLLGMYIVFLMLIIFIQVALGIFAIFYKQKIEKSVSKTLKTAITELYGYDK-DNDKIT---DNIQQILSCCGIEGPQDWEKSKWYIEKMNKSQMFPKSCCRD-NAEC--YDKISGATAFSEGCVSRLREYLQRIFPIFIGVILGIAFFEIFVVICAFC 845
            K LL +FN +FW+ G +++ +  I+   +K + +  L           +++ G ++ V  F GCC  +RE + LL  Y   L+LI  I++  G+ A  Y Q++ + + + L   +TE   YD+   + IT   D +QQ   CCG     DW+ S +      + ++ P SCC+    EC   D  S       GC+++L  +L     I   V +G+A  ++   +   C
Sbjct:   18 KYLLFVFNFLFWMGGGVVMAV-GIWTLIDKGEYLSLLASSTFAVSAYILILAGALVMVTGFLGCCAVIREQRSLLSTYFSCLLLIFLIELVAGVLAYVYYQRLSEELKQHLSKTMTE--NYDQLGKEGITRAVDRLQQDFKCCGSNNSSDWKHSVYVQSPEAQGRVVPDSCCKTITPECGRRDHPSNIYKVEGGCITKLEHFLADHLLIIGAVGIGVACLQLAGAVLTAC 244          
BLAST of Tetraspanin vs. Ensembl Cavefish
Match: cd82b (CD82 antigen-like [Source:NCBI gene;Acc:107197274])

HSP 1 Score: 88.9669 bits (219), Expect = 2.956e-20
Identity = 46/175 (26.29%), Postives = 90/175 (51.43%), Query Frame = 3
Query:  363 GCCGAVRESKLLLGMYIVFLMLIIFIQVALGIFAIFYKQKIEKSVSKTLKTAITELYGYDKDNDKITDNIQQILSCCGIEGPQDWEKSKWYIEKMNKSQ-MFPKSC---------CRDNAECYDKISGATAFSEGCVSRLREYLQRIFPIFIGVILGIAFFEIFVVICAFCLCRN 857
            GC GA+ E + LLG+Y   L+LI+  QV   +   F +  +++ +S  +   +    G +K  +   D +Q+ + CCG  GP +W ++ W     N SQ ++P SC          +++  C   +     +++GC+S + ++L     + +GV +G+A  E+  ++ + CLC++
Sbjct:   73 GCIGAIYEIRCLLGLYFTCLVLILIAQVTAAVLIYFQRDLLKREISTVVNKILVGYTGQNKTTEHAWDYLQKTIQCCGWTGPSNWTENVWI---KNSSQILYPCSCRNESIPGSEVQESGLCQSLVPEWPVYTKGCMSSVEDWLLSNCGVILGVCVGVAVLELLGMMLSMCLCKS 244          
BLAST of Tetraspanin vs. Ensembl Cavefish
Match: tspan36 (tetraspanin 36 [Source:NCBI gene;Acc:437021])

HSP 1 Score: 87.4261 bits (215), Expect = 6.963e-20
Identity = 56/217 (25.81%), Postives = 110/217 (50.69%), Query Frame = 3
Query:  153 IGCGPKLAKCLLIIFNVVFWLSGLILIVIPSIYLSNEKTKIVEKLDKFNSRXXXXXXXXXXXXXXXXXXCGCCGAVRESKLLLGMYIVFLMLIIFIQVALGIFAIFYKQKIEKSVSKTLKTAITELYGYDKDNDKITDNIQQILSCCGIEGPQDWEKSKWYIEKMNKSQMFPKSCCRDNAECYDKISGATAFS-EGCVSRLREYLQRIFPIFIGVIL 800
            + CG   +K +L+I +++FW +G  L  + +  + + +T      DK+ +      ++ + +++F+I   GCC  +RESK+ L  ++V L+L+   +VA  +F   Y+ KI+  + K++     +  G + +   + D +Q  L CCG+    DW    W+    + +   P SCC+ N+ C  +       + +GC ++L + LQ +    + VIL
Sbjct:    1 MDCGILTSKSVLLILSLIFWAAGAALSYVGAYVIKSYRTFDNFLEDKY-TLIPAAIIIGVAVVLFIIGLIGCCATLRESKVGLSFFMVILLLVFAAEVAAFVFGFIYRGKIKGDLEKSMSDVFQKYDGKNAETAAV-DYLQSQLQCCGVNNYTDWSSRPWF---TSHNSTVPVSCCKANSTCTGQFDKPELLNVQGCEAKLEKLLQDVLSYAMLVIL 212          
BLAST of Tetraspanin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005284.1 (pep scaffold:Pmarinus_7.0:GL480552:16638:25636:-1 gene:ENSPMAG00000004798.1 transcript:ENSPMAT00000005284.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 105.145 bits (261), Expect = 6.070e-27
Identity = 81/253 (32.02%), Postives = 128/253 (50.59%), Query Frame = 3
Query:  147 MAIGCGPKLAKCLLIIFNVVFWLSGLILIVIPSIY-LSNEKTKIVEKLDKFNSRXXXXXXXXXXXXXXXXXXCGCCGAVRESKLLLGMYIVFLMLIIFIQVALGIFAIFYKQKIEKSVSKTLKTAITELYGYDKDNDKITDNIQQILSCCGIEGPQDW-EKSKWYIEKMNKSQMFPKSCCRD-NAECYD---KISGATA--FSEGCVSRLREYLQRIFPIFIGVILGIAFFEIFVVICAFCLCRNTGSHVQEV 881
            MA+  G    K L+++FN++FWLSGL LI++ ++  +      +V      N  G    ++ +G++IFV+A  GCCGA +ES  ++  + VFL LI   ++A GI A  +K ++   V    K  I +   Y   N    DN+Q+ L CCG+   QDW   + W     N     P SCC +  + C     +   ATA  +++GCV +L   ++    +  GV +GI F ++  +I A CL R   +  Q V
Sbjct:    9 MALEGGMACIKYLVLLFNLLFWLSGLGLIIVGAMAQMHIGAFSVVTG----NLSGAPYVIIAVGVVIFVVAAFGCCGAHKESYFMVATFSVFLFLIFVAELAAGIGAYIFKDQLRDVVETKAKVVIND---YPTKNKDPVDNMQKELQCCGVVHYQDWFNSTNWVTSDPNNPNSVPDSCCLNVTSGCGQDDIRFKNATAIIYTKGCVEKLEATMKENIVLVGGVAIGIGFAQLIGIILACCLMRGIKNSYQAV 254          
BLAST of Tetraspanin vs. Ensembl Sea Lamprey
Match: CD151 (CD151 molecule (Raph blood group) [Source:HGNC Symbol;Acc:HGNC:1630])

HSP 1 Score: 95.1301 bits (235), Expect = 3.103e-23
Identity = 66/239 (27.62%), Postives = 112/239 (46.86%), Query Frame = 3
Query:  159 CGPKLAKCLLIIFNVVFWLSGLILIVIPSIYLSNEKTKIVEKLDKFNSRXXXXXXXXXXXXXXXXXXCGCCGAVRESKLLLGMYIVFLMLIIFIQVALGIFAIFYKQKIEKSVSKTLKTAITELYGYDKDNDKIT---DNIQQILSCCGIEGPQDWEKSKWYIEKMNKSQMFPKSCCRD-NAEC--YDKISGATAFSEGCVSRLREYLQRIFPIFIGVILGIAFFEIFVVICAFCLCRN 857
            CG    K +L++FN +FWL+G  ++ +  ++   EK   +  L           +++ G ++ +    GCC  VRE +  L  Y   L+LI  ++V  GI A  Y+Q++ + +   +   I E YG   D  ++T   D +QQ   CCG     DW++S W      + ++ P SCC+     C   D  S       GC+++L   LQ    +   V +G+A  ++  +I   CL R+
Sbjct:   12 CGTVCLKYVLLVFNFIFWLTGAGVMAV-GVWTLVEKGDYLSLLASSTFAATAYILILAGSVVMLTGLLGCCAVVRERRGCLAAYCGLLLLIFLLEVIAGILAYLYRQQLSEELKSHMNKTIVESYG-QPDQQRVTDAMDKLQQEFKCCGSHDWNDWQRSDWVKVAAAEGRLVPDSCCKSPTTRCGRRDHPSNINRVEGGCITKLEVILQEHLLLIGAVGIGVACLQVLGMILTCCLYRS 248          
BLAST of Tetraspanin vs. Ensembl Sea Lamprey
Match: tspan3a (tetraspanin 3a [Source:ZFIN;Acc:ZDB-GENE-030131-7787])

HSP 1 Score: 81.6481 bits (200), Expect = 3.155e-18
Identity = 50/170 (29.41%), Postives = 78/170 (45.88%), Query Frame = 3
Query:  363 GCCGAVRESKLLLGMYIVFLMLIIFIQVALGIFAIFYKQKIEKSVSKTLKTAITELYGYDKDN-DKITDNIQQILSCCGIEGPQDWEKSKWYIEKMNKSQMFPKSCCRDN-AECYDKI-SGATAFSEGC-------VSRLREYLQR---IFPIFIGVILGIAFFEIFVVI 833
            GCC  VRESK  L  + + L++I  ++V   +    Y+ +++  V +T+     E  G D +   +  D +Q  L CCG++   DW+   W+    N S   P SCCR N   C   I      ++EGC       V  +  Y+ R   I+ +  G ILGI    + V +
Sbjct:   73 GCCATVRESKCGLSTFFILLLMIFSLEVVAALLGYAYRGQVKDKVERTISQVFNEYNGTDSNTASRAIDYVQHQLKCCGVKNYLDWKDRPWFNHTGNNS--VPISCCRSNVTHCDGNIKHPGDIYNEGCEAMVEKTVKDILNYVMRVALIYALVQGYILGIKSVRVCVCV 240          
BLAST of Tetraspanin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009492.1 (pep scaffold:Pmarinus_7.0:GL476618:258874:270129:-1 gene:ENSPMAG00000008573.1 transcript:ENSPMAT00000009492.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 81.2629 bits (199), Expect = 3.355e-18
Identity = 55/188 (29.26%), Postives = 92/188 (48.94%), Query Frame = 3
Query:  363 GCCGAVRESKLLLGMYIVFLMLIIFIQVALGIFAIFYKQKIEKSVSKTLKTAITELYGYDKDND-KITDNIQQILSCCGIEGPQDWEKSKWYIEKMNKSQMFPKSCCRDNAE-CYDKIS-GATAFSEGCVSRLREYLQRIFPIFIGVILGIAFFEIFVVICAFCLCRNTGSHVQEV*ALPSCSNGLFA 917
            GC  AVRES+  L  + + L++I  ++VA       Y  K+E  V + +  A     G D D + +  D +Q+ L CCG     DW  ++W   + +K    P SCC+ +A+ C   +S  A  + +GC+ +L + +Q+I    IGV +G AF ++  ++ A  +         E    P  S+G +A
Sbjct:   71 GCWAAVRESRCALASFALLLLIIFSLEVAAVALGYIYHGKVEVEVQQKMHKAFQNYMGPDYDPESRAVDYMQKELQCCGFANYSDWNTTEW--ARRHKYNSVPLSCCKRSAKNCTGLLSLPAKLYQQGCLLKLGDEVQQILTYLIGVAVGFAFLQVMGLVAACVIACRRKHDENERAYEPLLSDGTYA 256          
BLAST of Tetraspanin vs. Ensembl Sea Lamprey
Match: tspan17 (tetraspanin 17 [Source:ZFIN;Acc:ZDB-GENE-030131-3673])

HSP 1 Score: 76.6406 bits (187), Expect = 1.625e-16
Identity = 54/193 (27.98%), Postives = 94/193 (48.70%), Query Frame = 3
Query:  363 GCCGAVRESKLLLGMYIVFLMLIIFIQVALGIFAIFYKQKIEKSVSKTLKTAITELYGYDKDNDKITDNIQQILSCCGIEGPQDWEKSKWY---IEKMNKSQ-MFPKSCC-RD------NAECYDKISGATA-------FSEGCVSRLREYLQRIFPIFIGVILGIAFFEIFVVICAFCLCRNTGSHVQEV*A 887
            GC GA+RE+  LL  +  FL LI F+++  G+ A  +K  +   ++  +   + + Y  D D   + D  Q    CCG  GP DW+++ ++   I+  ++ +   P SCC +D      N +C   +   T        +++GCV++  ++LQ    +  G+ +GIA  +IF      CL +N    V+ V A
Sbjct:   64 GCIGALRENTYLLKFFSTFLGLIFFLELTAGVLAFVFKDWLRDQLNFFIYNNV-KAYRDDIDLQNLIDFAQDYWQCCGAHGPLDWDENIYFNCSIKNRSREKCGVPFSCCVKDPAEDVVNTQCGYDVRLKTELDQQSYIYTKGCVTQFEKWLQNNLILVAGIFIGIALVQIF----GICLAQNLVGDVEAVKA 251          
BLAST of Tetraspanin vs. Ensembl Nematostella
Match: EDO35938 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SK25])

HSP 1 Score: 110.923 bits (276), Expect = 7.446e-29
Identity = 73/245 (29.80%), Postives = 123/245 (50.20%), Query Frame = 3
Query:  159 CGPKLAKCLLIIFNVVFWLSGLILIVIPSIYLSNEKTKIVEKLDKFNSRXXXXXXXXXXXXXXXXXXCGCCGAVRESKLLLGMYIVFLMLIIF-IQVALGIFAIFYK-----QKIEKSVSKTLKTAITELYGYDKDNDKITDNIQQILSCCGIEGPQDWEKSKWYIEKMNKSQMFPKSCCRDNAE---CYDKISGATAFSEGCVSRLREYLQRIFPIFIGVILGIAFFEIFVVI---CAFCLCRN 857
            CG K  K LL +FN  FWLSGL ++ I  I+   +  +    L           ++  G  +  + F GCCGAV+ES+ +L  ++ +L+ I+  +   + +F ++ K      ++++ +   L   I   YGYD + +   +N+Q  L CCG E P DW  SKW    +NK ++ P SCC +NA    CY   +    +S GCV+ L+ ++ +   +   + +GI+  ++  +I   C FC   N
Sbjct:    2 CGIKCMKYLLFVFNFFFWLSGLAVLGI-GIWTKVDAGQFDSFLGSSGYSIPAWTMIGAGAFVTFVGFFGCCGAVKESRCMLATWLKYLLTILLSLSKQVNLFELYLKFFLLWHQVQEEIKINLDEQIRNTYGYDSEVESHINNLQIRLKCCGGERPGDWLGSKWK-RDLNKDKIVPLSCCTENANKTTCYKDDTYKEVYSSGCVNELKTFVDKHMILIGAIAVGISIVQLLGMIFSCCLFCAIDN 244          
BLAST of Tetraspanin vs. Ensembl Nematostella
Match: EDO38288 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDC9])

HSP 1 Score: 94.3597 bits (233), Expect = 1.539e-22
Identity = 76/229 (33.19%), Postives = 119/229 (51.97%), Query Frame = 3
Query:  177 KCLLIIFNVVFWLSGLILIVIPSIYLSNEKTKIVEKLDKFNSRXXXXXXXXXXXXXXXXXXCGCCGAVRESKLLLGMYIVFLMLIIFIQVALGIFAIFYKQKIEKSVSKTLKTAITELYGYDKDNDKITDNIQQILSCCGIEGPQDWEKSKWYIEKMNKSQM--FPKSCC-RD--NAECYDKI--SGATA-------FSEGCVSRLREYLQRIFPIFIGVILGIAFFEI 821
            K LL  FNV FWL G +L+ +  +Y   EKT   E      +   F  ++V GI+  +    GC GA+RE+  LL  + V L +I F+Q+ALG+F   ++ K+E  + + L+TA+T+ Y  + D   + D +QQ   CCG +G  DW+K+ ++      S+    P SCC +D  N +C   I  SG          F  GCV+ ++++ +    I  G  +GIA  +I
Sbjct:   13 KYLLFFFNVFFWLVGCLLVSV-GLYARFEKTAYQEFFSDILTDPAFALIIVGGIMFILGFS-GCIGALRENICLLKFFSVVLAIIFFLQLALGVFVFVFQDKVEAVIVEKLQTAVTK-YRDNADLQNLIDGVQQEFKCCGAKGINDWDKNIYFNCSSPGSEACGVPYSCCIKDTINRQCGYGIRKSGTPTSDQSKIIFIGGCVNAVKDWFKSNMIIIGGAAVGIALLQI 238          
BLAST of Tetraspanin vs. Ensembl Nematostella
Match: EDO35917 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SK24])

HSP 1 Score: 91.2781 bits (225), Expect = 1.139e-21
Identity = 74/238 (31.09%), Postives = 121/238 (50.84%), Query Frame = 3
Query:  159 CGPKLAKCLLIIFNVVFWLSGLILIVIPSIYLSNEKTKIVEKLDKFNSRXXXXXXXXXXXXXXXXXXCGCCGAVRESKLLLGMYIVFLMLIIFIQVALGIFAIFYKQKIEKSVSKTLKTAITELYGYDKDN--DKITDNIQQILSCCG-IEGPQDWEKSKWYIEKMNKSQMFPKSCCRDNAE-CYDKISGA-TAFSEGCVSRLREYLQRIFPIFIGVILGIAFFEIFVVICAFCLCRN 857
            CG +  K LL  FN VFW++G+ ++ +  I+      +    + +         ++  G ++  I F GCCGAV+E+K  L +Y   L++I  +++A GI A   + K+  SV K L  +I+  YG        K  D  Q I  CCG  +GP+DW  + W   K N +Q  P+SCC+  A  C    + + T + +GC   L+++++       G+ LGIA  +I  +I + CL R+
Sbjct:    4 CGMQCMKYLLFAFNFVFWIAGIAVMSV-GIWTRVSANEYASLMGQSGFTAAANIMIAAGALVMFIGFVGCCGAVKENKCFLLLYFFLLLVIFVLEIASGILAYTKRDKVISSVEKALNQSISLDYGQSNKEKATKAVDRAQSIFKCCGATQGPKDWANTAW--AKSNTNQTVPESCCKKKAAGCNGAPADSDTYYQKGCSQGLQDFIKSHMKTLGGIGLGIAIIQILGMIFSLCLFRS 238          
BLAST of Tetraspanin vs. Ensembl Nematostella
Match: EDO34309 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPQ7])

HSP 1 Score: 89.3521 bits (220), Expect = 5.550e-21
Identity = 49/170 (28.82%), Postives = 83/170 (48.82%), Query Frame = 3
Query:  363 GCCGAVRESKLLLGMYIVFLMLIIFIQVALGIFAIFYKQKIEKSVSKTLKTAITELYGYDKDNDKITDNIQQILSCCGIEGPQDWEKSKWYIEKMNKSQMFPKSCCRDNAEC---YDKISGATAFSEGCVSRLREYLQRIFPIFIGVILGIAFFEIFVVICAFCLCRNTG 863
            G CG  RESK  L ++ + L+++  +++  G+    YK + +  V   L  AI      ++   K  D +Q+ L CCG  GP DW  S ++ EK       PKSCC  +++    YDK       ++GC + L +   +     IG+ +G A  ++  ++ A C+  +TG
Sbjct:   66 GICGTCRESKCCLSIFFILLLVVFSLEITAGVLGAIYKNQAKDEVKNGLTDAIDHYSKEEQGFQKAVDKLQENLDCCGSTGPNDWVNSTFWKEK----HHLPKSCCTHDSDVCFPYDKFHN----TKGCYTTLLDKFNKNLSYIIGIGIGFAVLQLIGMLSACCVMCSTG 227          
BLAST of Tetraspanin vs. Ensembl Nematostella
Match: EDO46887 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNN8])

HSP 1 Score: 88.1965 bits (217), Expect = 1.363e-20
Identity = 51/169 (30.18%), Postives = 88/169 (52.07%), Query Frame = 3
Query:  363 GCCGAVRESKLLLGMYIVFLMLIIFIQVALGIFAIFYKQKIEKSVSKTLKTAITE--LYGYDKDNDKITDNIQQILSCCGIEGPQDWEKSKWYIEKMNKSQMFPKSCCRD--NAECYDKISGATA--FSEGCVSRLREYLQRIFPIFIGVILGIAFFEIFVVICAFCLC 851
             CCGA++ES+ +LG Y   +  I  ++V   + A  Y+++IEK++   +++ + E  L G+D     I D I +   CCG    +DW ++KW         M P+SCC+D  +++C + IS      +  GC   +++YL     +  G  + IA  ++  +I A CLC
Sbjct:   64 ACCGALKESQCMLGTYFGLVTAIFCLEVTAIVLAYVYRERIEKNLHGDIRSTMNEYHLSGHDAVTRAI-DEIHRDFKCCGNAQYRDWFETKW---AKTHPDMVPRSCCKDPSDSKCNENISKDPTKIYRRGCYMFVKKYLSNNLHVISGFGIWIAVIQLMGIIFATCLC 228          
BLAST of Tetraspanin vs. Ensembl Medaka
Match: tspan7 (tetraspanin 6 [Source:NCBI gene;Acc:101163337])

HSP 1 Score: 91.6633 bits (226), Expect = 2.803e-21
Identity = 59/232 (25.43%), Postives = 110/232 (47.41%), Query Frame = 3
Query:  177 KCLLIIFNVVFWLSGLILIVIPSIYLSNEKTKIVEKLDKFNSRXXXXXXXXXXXXXXXXXXCGCCGAVRESKLLLGMYIVFLMLIIFIQVALGIFAIFYKQKIEKSVSKTLKTAITELYGYDKDNDKITDNIQQILSCCGIEGPQDWEKSKWYIEKMNKSQMFPKSCCRDNAECYDKI------SGATAFSEGCVSRLREYLQRIFPIFIGVILGIAFFEIFVVICAFCLCR 854
            K  LI ++++FW +G++L+ +          +    L           ++  G II +    GC    R S  +L +Y +FL L+   ++  GI    ++ +I+  +    + A+    G +  +  + D IQ+ L CCG++   DW+++ ++I     S+  P SCC+DN  C  +I      +G   F+ GC + +   ++    +  G+  GIAFF++F +  A CL R
Sbjct:   18 KTFLICYSLIFWFTGVVLLAVG--VWGKVSLEAYLSLASEGGTNAPYVLIGTGAIIVIFGLFGCFATCRGSPWMLKLYAMFLTLVFLSELVAGISGFIFRHEIKAVMGTAYENAVRSYNGTNSLSVAL-DTIQRTLRCCGVKNYTDWKEAPYFI-----SKGIPLSCCKDNGNCTVEIMKDLDKAGKEVFTTGCFALVTTVMESNLGVIAGISFGIAFFQVFGIFLACCLSR 241          
BLAST of Tetraspanin vs. Ensembl Medaka
Match: ENSORLT00000000775.2 (CD82 antigen [Source:NCBI gene;Acc:101156312])

HSP 1 Score: 90.8929 bits (224), Expect = 6.131e-21
Identity = 52/183 (28.42%), Postives = 90/183 (49.18%), Query Frame = 3
Query:  363 GCCGAVRESKLLLGMYIVFLMLIIFIQVALGIFAIFYKQKIEKSVSKTLKTAITELYGYDKDNDKITDNIQQILSCCGIEGPQDWEKSKWYIEKMNKSQ-MFPKSCCR---------DNAECYDKISGATAFSEGCVSRLREYLQRIFPIFIGVILGIAFFEIFVVICAFCLCRNTGSHVQEV 881
            GC GA+ + K LLG+Y   L++I+  Q+A G+     K+K+ + +SK +   +    G     ++  D IQ+ + CCG  G +DW  +      +N SQ +FP SC           D+  C  +      ++ GC + +  +L     + +G+ L +A  E+  +I + CLCRN G+   +V
Sbjct:   72 GCLGAIFQIKCLLGLYFTCLLVILVAQIAAGVLVYLQKEKVNEQMSKIVDKVLGSYAGNSSRTEQAWDLIQKKMQCCGWMGQEDWNNNA---VILNSSQLLFPCSCQNLTLTVQNRSDSGFCEAQTPDWPVYNVGCSASVENWLITNIGVVLGICLTVALIELLGMILSICLCRNVGTDYSKV 251          
BLAST of Tetraspanin vs. Ensembl Medaka
Match: tspan11 (tetraspanin 11 [Source:NCBI gene;Acc:101168088])

HSP 1 Score: 90.5077 bits (223), Expect = 6.991e-21
Identity = 62/233 (26.61%), Postives = 109/233 (46.78%), Query Frame = 3
Query:  177 KCLLIIFNVVFWLSGLILIVIPSIYLSNEKTKIVEKLDKFNSRXXXXXXXXXXXXXXXXXXCGCCGAVRESKLLLGMYIVFLMLIIFIQVALGIFAIFYKQKIEKSVSKTLKTAITELYGYDKDNDKIT---DNIQQILSCCGIEGPQDWEKSKWYIEKMNKSQMFPKSCCRDNAEC---YDKISGATAFSEGCVSRLREYLQRIFPIFIGVILGIAFFEIFVVICAFCLCRN 857
            K LL IFN +FW+ G  ++ +  ++   EK+  +  L           +++ G ++ V  F GCC  +RE +  L +Y  FL++I  I++  G+ A  Y Q++ + + + L   ++E Y      + IT   D +QQ   CCG    QDW  S +      + ++ P SCC+         D  S       GC+++L ++L     +   V +G+A  +I  ++   CL R 
Sbjct:   18 KYLLFIFNFLFWMGGAAVLGV-GVWTLVEKSDYLSLLASSTFAVSAYILILAGSLVVVTGFLGCCAVIRERRRCLSVYFFFLLVIFLIELVAGVLAYVYYQRLSEELKQHLNQTMSENYA-QPGKEAITAAVDRLQQDFKCCGSNNSQDWAHSVYISSIAAEQRVVPDSCCKTITHACGKRDHPSNIYKVEGGCITKLEQFLADHLLVIGAVGIGVACLQICGMVFTCCLYRR 248          
BLAST of Tetraspanin vs. Ensembl Medaka
Match: ENSORLT00000001610.2 (CD151 molecule (Raph blood group) [Source:NCBI gene;Acc:101161865])

HSP 1 Score: 88.5817 bits (218), Expect = 4.367e-20
Identity = 67/238 (28.15%), Postives = 111/238 (46.64%), Query Frame = 3
Query:  159 CGPKLAKCLLIIFNVVFWLSGLILIVIPSIYLSNEKTKIVEKLDKFNSRXXXXXXXXXXXXXXXXXXCGCCGAVRESKLLLGMYIVFLMLIIFIQVALGIFAIFYKQKIEKSVSKTLKTAITELY--GYDKDNDKITDNIQQILSCCGIEGPQDWEKSKWYIEKMNKSQMFPKSCCRDNAE---CYDKISGATAFSEGCVSRLREYLQRIFPIFIGVILGIAFFEIFVVICAFCLCRN 857
            CG    K LL  FN  FWL+G++++ +    L  EK+  +  L           +++ G I+ V    GCC   +E + LL +Y V L+ I  ++V  G+ A  Y Q++ + +   LK  +   Y  G  +   +  D +QQ   CCG     DW+++ W    M+  +  P SCC+   E     D  S       GC+++L +++Q    I   V +GIA  +I  ++   CL R+
Sbjct:   11 CGTICLKYLLFTFNFFFWLAGVVVMGVGVWTLL-EKSDYISLLPSKTYAASAYILVLAGAIVMVTGVLGCCATFKEQRRLLRVYFVLLLCIFLLEVLAGVLAYIYYQQLNEELKLNLKETLIRKYEVGSYEHITRAVDKLQQEFKCCGSNSSSDWKENSWV---MDTGRKVPDSCCKTLTEKCGVRDHPSNIYKVEGGCITKLEKFIQDHLKIIGAVGIGIACVQIVGMVFTCCLYRS 244          
BLAST of Tetraspanin vs. Ensembl Medaka
Match: tspan11 (tetraspanin 11 [Source:NCBI gene;Acc:101168088])

HSP 1 Score: 88.5817 bits (218), Expect = 4.495e-20
Identity = 60/232 (25.86%), Postives = 107/232 (46.12%), Query Frame = 3
Query:  177 KCLLIIFNVVFWLSGLILIVIPSIYLSNEKTKIVEKLDKFNSRXXXXXXXXXXXXXXXXXXCGCCGAVRESKLLLGMYIVFLMLIIFIQVALGIFAIFYKQKIEKSVSKTLKTAITELYGYDKDNDKIT---DNIQQILSCCGIEGPQDWEKSKWYIEKMNKSQMFPKSCCRDNAEC---YDKISGATAFSEGCVSRLREYLQRIFPIFIGVILGIAFFEIFVVICAFCLCR 854
            K LL IFN +FW+ G  ++ +  ++   EK+  +  L           +++ G ++ V  F GCC  +RE +  L +Y  FL++I  I++  G+ A  Y Q++ + + + L   ++E Y      + IT   D +QQ   CCG    QDW  S +      + ++ P SCC+         D  S       GC+++L ++L     +   V +G+A  ++        +CR
Sbjct:   18 KYLLFIFNFLFWMGGAAVLGV-GVWTLVEKSDYLSLLASSTFAVSAYILILAGSLVVVTGFLGCCAVIRERRRCLSVYFFFLLVIFLIELVAGVLAYVYYQRLSEELKQHLNQTMSENYA-QPGKEAITAAVDRLQQDFKCCGSNNSQDWAHSVYISSIAAEQRVVPDSCCKTITHACGKRDHPSNIYKVEGGCITKLEQFLADHLLVIGAVGIGVACLQVSRTKSVVGVCR 247          
BLAST of Tetraspanin vs. Planmine SMEST
Match: SMESG000021627.1 (SMESG000021627.1)

HSP 1 Score: 451.055 bits (1159), Expect = 9.910e-162
Identity = 244/245 (99.59%), Postives = 245/245 (100.00%), Query Frame = 3
Query:  147 MAIGCGPKLAKCLLIIFNVVFWLSGLILIVIPSIYLSNEKTKIVEKLDKFNSRXXXXXXXXXXXXXXXXXXCGCCGAVRESKLLLGMYIVFLMLIIFIQVALGIFAIFYKQKIEKSVSKTLKTAITELYGYDKDNDKITDNIQQILSCCGIEGPQDWEKSKWYIEKMNKSQMFPKSCCRDNAECYDKISGATAFSEGCVSRLREYLQRIFPIFIGVILGIAFFEIFVVICAFCLCRNTGSHVQEV 881
            MAIGCGPKLAKCLLIIFNVVFWLSGLILIVIPSIYLSNEKTKIVEKLDKFNSRGLFIGVLVLGIIIFVIAFCGCCGAVRESKLLLGMYIVFLMLIIFIQVALGIFAIFYKQKIEKSVSKTLKTAITELYGYDKDNDKITDNIQQILSCCGIEGPQDWEKSKWYIEKMNKSQMFPKSCCRDNAECY+KISGATAFSEGCVSRLREYLQRIFPIFIGVILGIAFFEIFVVICAFCLCRNTGSHVQEV
Sbjct:    1 MAIGCGPKLAKCLLIIFNVVFWLSGLILIVIPSIYLSNEKTKIVEKLDKFNSRGLFIGVLVLGIIIFVIAFCGCCGAVRESKLLLGMYIVFLMLIIFIQVALGIFAIFYKQKIEKSVSKTLKTAITELYGYDKDNDKITDNIQQILSCCGIEGPQDWEKSKWYIEKMNKSQMFPKSCCRDNAECYNKISGATAFSEGCVSRLREYLQRIFPIFIGVILGIAFFEIFVVICAFCLCRNTGSHVQEV 245          
BLAST of Tetraspanin vs. Planmine SMEST
Match: SMESG000021642.1 (SMESG000021642.1)

HSP 1 Score: 219.935 bits (559), Expect = 1.408e-70
Identity = 117/246 (47.56%), Postives = 164/246 (66.67%), Query Frame = 3
Query:  147 MAIGCGPKLAKCLLIIFNVVFWLSGLILIVIPSIYLSNEKTKIVEKL-DKFNSRXXXXXXXXXXXXXXXXXXCGCCGAVRESKLLLGMYIVFLMLIIFIQVALGIFAIFYKQKIEKSVSKTLKTAITELYGYDKDNDKITDNIQQILSCCGIEGPQDWEKSKWYIEKMNKSQMFPKSCCRDNAECYDKISGATAFSEGCVSRLREYLQRIFPIFIGVILGIAFFEIFVVICAFCLCRNTGSHVQEV 881
            MAIGCGPK+AK LLIIFN+ FW +G+ILIV+ SIYL+N   K V+ + +   +R + IG+LV+GI+IF+I F GCCGAV+ES++LL +YI+ +  II  +V  GIFAI  +Q +E ++           YG D       DN+QQI+ CCG     DW +S WY+ K++K Q  PKSCC+   +     +  T F +GC+ ++ +Y ++ FP+ IGV LGIA FEIFVVICAFC+CR + +H Q+V
Sbjct:    1 MAIGCGPKIAKILLIIFNIAFWATGVILIVVASIYLANGTMKYVDDIINASTNRNILIGLLVIGIVIFIIGFSGCCGAVKESRMLLAIYIILVCAIIIAEVGFGIFAIVKRQPLEDAIKNDFTNTFQNRYGNDTTITVAIDNLQQIIPCCGATKQLDWTQSNWYLNKLDKVQTAPKSCCKLPTDYCWLTNNGTMFPDGCIPKMEDYAKKFFPVIIGVALGIACFEIFVVICAFCVCRGSTTHRQQV 246          
BLAST of Tetraspanin vs. Planmine SMEST
Match: SMESG000021637.1 (SMESG000021637.1)

HSP 1 Score: 160.229 bits (404), Expect = 1.486e-47
Identity = 103/246 (41.87%), Postives = 155/246 (63.01%), Query Frame = 3
Query:  147 MAIGCGPKLAKCLLIIFNVVFWLSGLILIVIPSIYLSNEKTKIVEKLDKFNSRXXXXXXXXXXXXXXXXXXCGCCGAVRESKLLLGMYIVFLMLIIFIQVALGIFA-IFYKQKIEKSVSKTLKTAITELYGYDKDNDKITDNIQQILSCCGIEGPQDWEKSKWYIEKMNKSQMFPKSCCRDNAECYDKISGATAFSEGCVSRLREYLQRIFPIFIGVILGIAFFEIFVVICAFCLCRNTGSHVQEV 881
            M I CG  LAK  L +FN+VF  SGLILI++ SI L ++   +V       ++ + + +LVLGIIIF+IAFCGCCGAV+ES+ LL +Y+V L++II  ++A+G F  I +    EK  ++ +K  + + YG   D  +I + IQQ   CCG+    DW++S WY + +NK+Q+ P SCC  N +C+   +       GC+ +L +YL +IF I I V+ GI  FEIFVV+CAFC+ R+  + ++ +
Sbjct:    1 MGIDCGSSLAKIFLFLFNIVFCFSGLILIIMSSILLKDKSIALV-------NQYIVVFILVLGIIIFLIAFCGCCGAVKESRFLLRIYVVSLVVIILSELAIGTFLFIKWNPAAEKLKAEFIKMVMVD-YGVKMDKTEIVNEIQQGFGCCGVYNDTDWKESYWY-KSINKAQVVPNSCCPSNNKCWLD-NKEKVMKIGCLKKLMQYLNKIFLIVIFVVFGIILFEIFVVMCAFCVYRHKNNIMRRL 236          
BLAST of Tetraspanin vs. Planmine SMEST
Match: SMESG000073695.1 (SMESG000073695.1)

HSP 1 Score: 131.724 bits (330), Expect = 6.668e-37
Identity = 71/191 (37.17%), Postives = 117/191 (61.26%), Query Frame = 3
Query:  147 MAIGCGPKLAKCLLIIFNVVFWLSGLILIVIPSIYLSNEKTKIVEKLDKFNSRXXXXXXXXXXXX---XXXXXXCGCCGAVRESKLLLGMYIVFLMLIIFIQVALGIFAIFYKQKIEKSVSKTLKTAITELY-----GYDKDNDKITDNIQQILSCCGIEGPQDWEKSKWYIEKMNKSQMFPKSCCRDNAE 695
            MAIGCG K +K  + +FN++FW++GLI IV+ SIYL+    K  E++   N R     +  +  +   +FV+ FCGCCGA+RES+LLLG YIV L+LI+ ++++ GI+A   ++++ + + K+L+ +I + Y       +++     D IQ+   CCG++  ++WE S WYI + +     P SCC  + E
Sbjct:    1 MAIGCGAKFSKYTVFLFNILFWITGLIFIVLGSIYLTTGGFKSFEEVITPNDRYFTRLMYCIIGLGCIVFVVGFCGCCGAIRESRLLLGTYIVLLLLIMIVEISCGIYATVKEKEVVRKIEKSLEKSIIKNYPPFNSTSNQNLKNAIDYIQKTFRCCGVKTYKNWENSTWYISRNDSFMETPSSCCESDIE 191          
BLAST of Tetraspanin vs. Planmine SMEST
Match: SMESG000043678.1 (SMESG000043678.1)

HSP 1 Score: 95.9005 bits (237), Expect = 4.286e-23
Identity = 53/164 (32.32%), Postives = 80/164 (48.78%), Query Frame = 3
Query:  360 CGCCGAVRESKLLLGMYIVFLMLIIFIQVALGIFAIFYKQKIEKSVSKTLKTAITELYGYDKDNDKITDNIQQILSCCGIEGPQDWEKSKWYIEKMNKSQMFPKSCCRDNAECYDKISGATAFSEGCVSRLREYLQRIFPIFIGVILGIAFFEIFVVICAFCLC 851
            CGCCGA  ES  LLG Y +FL+LI   ++A G+  + YK K++  V    +    EL     D +   + +Q+ + CCG +G  D+ K              P SCC   ++C D       ++ GC S   E +Q  + IF  ++LGI   E+  +I + CLC
Sbjct:   70 CGCCGAYHESPCLLGTYFIFLLLIFAAEIAAGVLVVLYKDKVKSYVGVKFQKGTEELKSKPDDTEHWMNGVQRNMKCCGYKGSSDYTK-------------VPGSCC-STSKCEDP------YTRGCESAWTELIQNNWVIFASILLGIPLIELLGLIFSMCLC 213          
The following BLAST results are available for this feature:
BLAST of Tetraspanin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TSPAN75.040e-2226.38tetraspanin 7 [Source:HGNC Symbol;Acc:HGNC:11854][more]
TSPAN61.162e-2024.37tetraspanin 6 [Source:HGNC Symbol;Acc:HGNC:11858][more]
TSPAN171.170e-2029.84tetraspanin 17 [Source:HGNC Symbol;Acc:HGNC:13594][more]
TSPAN171.972e-2030.65tetraspanin 17 [Source:HGNC Symbol;Acc:HGNC:13594][more]
TSPAN173.708e-2030.00tetraspanin 17 [Source:HGNC Symbol;Acc:HGNC:13594][more]
back to top
BLAST of Tetraspanin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tsp-177.650e-1726.91Tetraspanin-17 [Source:UniProtKB/Swiss-Prot;Acc:Q... [more]
tsp-173.552e-1525.29Tetraspanin-17 [Source:UniProtKB/Swiss-Prot;Acc:Q... [more]
tsp-111.316e-1326.79Tetraspanin [Source:UniProtKB/TrEMBL;Acc:Q17526][more]
tsp-111.316e-1326.79Tetraspanin [Source:UniProtKB/TrEMBL;Acc:Q17526][more]
tsp-76.804e-1225.21Tetraspanin [Source:UniProtKB/TrEMBL;Acc:Q9XVI4][more]
back to top
BLAST of Tetraspanin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tsp96F2.437e-2328.11gene:FBgn0027865 transcript:FBtr0330164[more]
Tsp96F2.437e-2328.11gene:FBgn0027865 transcript:FBtr0084912[more]
Tsp96F3.631e-2328.11gene:FBgn0027865 transcript:FBtr0330163[more]
Tsp47F9.493e-2132.91gene:FBgn0033629 transcript:FBtr0088151[more]
Tsp66E1.008e-1528.52gene:FBgn0035936 transcript:FBtr0076507[more]
back to top
BLAST of Tetraspanin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tspan361.006e-2426.79tetraspanin 36 [Source:NCBI gene;Acc:437021][more]
tspan361.006e-2426.79tetraspanin 36 [Source:NCBI gene;Acc:437021][more]
cd151l5.515e-2225.51CD151 antigen, like [Source:ZFIN;Acc:ZDB-GENE-0404... [more]
cd1519.993e-2129.29CD151 molecule [Source:ZFIN;Acc:ZDB-GENE-041010-13... [more]
cd82a1.341e-2027.96CD82 molecule a [Source:ZFIN;Acc:ZDB-GENE-030131-2... [more]
back to top
BLAST of Tetraspanin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cd1514.574e-2428.40CD151 molecule (Raph blood group) [Source:NCBI gen... [more]
cd1511.533e-2128.00CD151 molecule (Raph blood group) [Source:NCBI gen... [more]
sertad41.796e-2024.14SERTA domain containing 4 [Source:Xenbase;Acc:XB-G... [more]
tspan72.123e-2027.23tetraspanin 7 [Source:NCBI gene;Acc:394976][more]
cd821.693e-1931.11CD82 molecule [Source:NCBI gene;Acc:394799][more]
back to top
BLAST of Tetraspanin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tspan172.700e-2230.86tetraspanin 17 [Source:MGI Symbol;Acc:MGI:1921507][more]
Tspan173.910e-2230.86tetraspanin 17 [Source:MGI Symbol;Acc:MGI:1921507][more]
Tspan176.929e-2230.50tetraspanin 17 [Source:MGI Symbol;Acc:MGI:1921507][more]
Tspan78.990e-2227.23tetraspanin 7 [Source:MGI Symbol;Acc:MGI:1298407][more]
Tspan62.416e-2125.21tetraspanin 6 [Source:MGI Symbol;Acc:MGI:1926264][more]
back to top
BLAST of Tetraspanin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6NWG0|TSN36_DANRE7.593e-2426.79Tetraspanin-36 OS=Danio rerio OX=7955 GN=tspan36 P... [more]
sp|Q7YQK9|TSN7_PONPY1.431e-2127.23Tetraspanin-7 OS=Pongo pygmaeus OX=9600 GN=TSPAN7 ... [more]
sp|Q9D7W4|TSN17_MOUSE2.154e-2130.86Tetraspanin-17 OS=Mus musculus OX=10090 GN=Tspan17... [more]
sp|Q7YQL0|TSN7_PANTR2.218e-2126.38Tetraspanin-7 OS=Pan troglodytes OX=9598 GN=TSPAN7... [more]
sp|P41732|TSN7_HUMAN2.421e-2126.38Tetraspanin-7 OS=Homo sapiens OX=9606 GN=TSPAN7 PE... [more]
back to top
BLAST of Tetraspanin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3ICM98.331e-2932.45Tetraspanin OS=Lingula unguis OX=7574 GN=LOC106163... [more]
A0A1S3IDT41.060e-2832.58Tetraspanin OS=Lingula unguis OX=7574 GN=LOC106163... [more]
A0A3S1CDQ53.258e-2832.66Tetraspanin OS=Elysia chlorotica OX=188477 GN=EGW0... [more]
A0A1S3ICX61.548e-2732.71Tetraspanin OS=Lingula unguis OX=7574 GN=LOC106163... [more]
A0A2C9JYJ24.982e-2732.67Tetraspanin OS=Biomphalaria glabrata OX=6526 GN=10... [more]
back to top
BLAST of Tetraspanin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cd1511.035e-2128.15CD151 antigen-like [Source:NCBI gene;Acc:103041246... [more]
tspan113.200e-2128.21tetraspanin-11-like [Source:NCBI gene;Acc:10302424... [more]
tspan112.726e-2027.39tetraspanin-11-like [Source:NCBI gene;Acc:10302424... [more]
cd82b2.956e-2026.29CD82 antigen-like [Source:NCBI gene;Acc:107197274][more]
tspan366.963e-2025.81tetraspanin 36 [Source:NCBI gene;Acc:437021][more]
back to top
BLAST of Tetraspanin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000005284.16.070e-2732.02pep scaffold:Pmarinus_7.0:GL480552:16638:25636:-1 ... [more]
CD1513.103e-2327.62CD151 molecule (Raph blood group) [Source:HGNC Sym... [more]
tspan3a3.155e-1829.41tetraspanin 3a [Source:ZFIN;Acc:ZDB-GENE-030131-77... [more]
ENSPMAT00000009492.13.355e-1829.26pep scaffold:Pmarinus_7.0:GL476618:258874:270129:-... [more]
tspan171.625e-1627.98tetraspanin 17 [Source:ZFIN;Acc:ZDB-GENE-030131-36... [more]
back to top
BLAST of Tetraspanin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tetraspanin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO359387.446e-2929.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO382881.539e-2233.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO359171.139e-2131.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO343095.550e-2128.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO468871.363e-2030.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tetraspanin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tspan72.803e-2125.43tetraspanin 6 [Source:NCBI gene;Acc:101163337][more]
ENSORLT00000000775.26.131e-2128.42CD82 antigen [Source:NCBI gene;Acc:101156312][more]
tspan116.991e-2126.61tetraspanin 11 [Source:NCBI gene;Acc:101168088][more]
ENSORLT00000001610.24.367e-2028.15CD151 molecule (Raph blood group) [Source:NCBI gen... [more]
tspan114.495e-2025.86tetraspanin 11 [Source:NCBI gene;Acc:101168088][more]
back to top
BLAST of Tetraspanin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000021627.19.910e-16299.59SMESG000021627.1[more]
SMESG000021642.11.408e-7047.56SMESG000021642.1[more]
SMESG000021637.11.486e-4741.87SMESG000021637.1[more]
SMESG000073695.16.668e-3737.17SMESG000073695.1[more]
SMESG000043678.14.286e-2332.32SMESG000043678.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019103 ID=SMED30019103|Name=Tetraspanin|organism=Schmidtea mediterranea sexual|type=transcript|length=972bp
ATCAAGTTAAAGTTCTAAAATAAACAATGTTTGTTTAAAAGAATCAAATC
GTAGCCTTGAGAAATTCGACCAATTGAAAGTAAAAATAACAATTCACTGA
CAAAAAGTTTAGTCCGATTCATTTTTAACTATAAATTTTGATATCAATGG
CGATTGGATGCGGCCCGAAACTGGCGAAATGCTTGCTAATTATATTCAAT
GTTGTTTTCTGGCTGTCAGGTCTGATCCTTATCGTGATCCCTTCGATCTA
CTTGTCCAATGAGAAAACGAAAATAGTAGAAAAATTAGACAAGTTCAACA
GTCGAGGCTTGTTCATTGGAGTTCTCGTTCTGGGAATTATAATCTTTGTA
ATTGCGTTCTGTGGCTGTTGCGGTGCGGTCAGAGAGAGCAAGCTGTTGCT
GGGCATGTACATAGTTTTCCTGATGCTGATTATCTTCATACAAGTGGCGC
TAGGAATATTTGCAATCTTTTACAAGCAAAAGATAGAAAAATCTGTAAGC
AAAACGCTAAAAACAGCTATCACAGAATTATACGGGTATGATAAAGATAA
TGATAAGATAACTGATAACATTCAACAAATACTTTCGTGTTGTGGTATAG
AGGGACCGCAGGATTGGGAAAAATCAAAATGGTACATAGAGAAGATGAAT
AAAAGTCAAATGTTTCCTAAGTCATGCTGCCGTGATAATGCCGAATGTTA
CGATAAAATATCTGGAGCAACAGCATTTTCTGAAGGCTGCGTCTCTCGAT
TGAGAGAATATTTACAACGAATTTTCCCGATATTTATTGGAGTGATTTTG
GGGATCGCTTTCTTTGAGATATTTGTGGTAATCTGCGCGTTCTGTCTGTG
TCGTAACACCGGATCCCACGTGCAAGAGGTGTAAGCATTGCCAAGCTGTT
CAAATGGACTTTTTGCAATATTATTTTTATTCATGATTTTTATGATTATG
ATTATTATTATTATTATTATTA
back to top

protein sequence of SMED30019103-orf-1

>SMED30019103-orf-1 ID=SMED30019103-orf-1|Name=SMED30019103-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=246bp
MAIGCGPKLAKCLLIIFNVVFWLSGLILIVIPSIYLSNEKTKIVEKLDKF
NSRGLFIGVLVLGIIIFVIAFCGCCGAVRESKLLLGMYIVFLMLIIFIQV
ALGIFAIFYKQKIEKSVSKTLKTAITELYGYDKDNDKITDNIQQILSCCG
IEGPQDWEKSKWYIEKMNKSQMFPKSCCRDNAECYDKISGATAFSEGCVS
RLREYLQRIFPIFIGVILGIAFFEIFVVICAFCLCRNTGSHVQEV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0003104enteric muscle cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR000301Tetraspanin
IPR018499Tetraspanin/Peripherin
IPR008952Tetraspanin_EC2_sf
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000301TetraspaninPRINTSPR00259TMFOURcoord: 79..107
score: 32.36
coord: 52..78
score: 29.39
coord: 212..238
score: 29.24
coord: 12..35
score: 28.63
IPR000301TetraspaninPIRSFPIRSF002419Tetraspanincoord: 1..244
e-value: 3.2E-50
score: 168.2
IPR018499Tetraspanin/PeripherinPFAMPF00335Tetraspanincoord: 11..236
e-value: 3.5E-47
score: 161.0
IPR008952Tetraspanin, EC2 domain superfamilyGENE3DG3DSA:1.10.1450.10coord: 108..208
e-value: 9.9E-15
score: 56.1
IPR008952Tetraspanin, EC2 domain superfamilySUPERFAMILYSSF48652Tetraspanincoord: 109..207
NoneNo IPR availablePANTHERPTHR19282TETRASPANINcoord: 4..235
NoneNo IPR availablePANTHERPTHR19282:SF273TETRASPANINcoord: 4..235
NoneNo IPR availableCDDcd03127tetraspanin_LELcoord: 107..209
e-value: 1.26672E-15
score: 67.9147
NoneNo IPR availableTMHMMTMhelixcoord: 55..77
NoneNo IPR availableTMHMMTMhelixcoord: 212..234
NoneNo IPR availableTMHMMTMhelixcoord: 13..35
NoneNo IPR availableTMHMMTMhelixcoord: 84..106