Uridine phosphorylase

Overview
NameUridine phosphorylase
Smed IDSMED30019099
Length (bp)996
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Uridine phosphorylase (SMED30019099) t-SNE clustered cells

Violin plots show distribution of expression levels for Uridine phosphorylase (SMED30019099) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Uridine phosphorylase (SMED30019099) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Uridine phosphorylase (SMED30019099) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019099

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30019099SMESG000074532.1 dd_Smed_v4_9107_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30019099SMESG000074532.1 dd_Smed_v4_9107_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Uridine phosphorylase vs. Ensembl Human
Match: UPP2 (uridine phosphorylase 2 [Source:HGNC Symbol;Acc:HGNC:23061])

HSP 1 Score: 186.422 bits (472), Expect = 4.013e-56
Identity = 108/299 (36.12%), Postives = 162/299 (54.18%), Query Frame = 3
Query:   18 FDMIRNKYLEAQINKDTIINLYHLDIYENPSYLQREFGDVKIVCMGGKASRMRELAKIWGKYCNIHNFENDLHDYSGAGDRFSMFKVYKIIFLSHGMGIPSISIALNEVTKLLHFAGVTDPLFIRIGTCGGLGLAPGTIVVSEYCYDSQLNDYQEIFVCGQSIKKKAILDKSCISEFINVSELFVGSESKVKIVKANTMCANDFYEEQARMDGPCNHITVDNKDAFFQKLINEYGIRNIEMESLGFAAFCHNLGIRGMVIALILVDRLVSDFVSISLDEIKHHQRVVNEILMNYFKTQL 914
            F  ++N YL+  +++D    LYHLD+      L   FGDVK VC+GG  +RM+  A    K       E D+ D     DR+ M+K   ++ +SHGMGIPSISI L+E+ KLLH A   D   IRIGT GG+G+APGT+V+++   DS      E  +    + +   LDK    E  N S+      + V     +TMC  DFYE Q R+DG     + + K  + ++   + G+RNIEMES  FAA C   G++  V+ + L+DRL  D +++  D +  +Q+    ++ N+ + +L
Sbjct:   24 FVHVKNPYLDL-MDEDI---LYHLDLGTKTHNLPAMFGDVKFVCVGGSPNRMKAFALFMHKELGFEEAEEDIKDICAGTDRYCMYKTGPVLAISHGMGIPSISIMLHELIKLLHHARCCDVTIIRIGTSGGIGIAPGTVVITDIAVDSFFKPRFEQVILDNIVTRSTELDKELSEELFNCSKEIPNFPTLV----GHTMCTYDFYEGQGRLDGALCSFSREKKLDYLKRAF-KAGVRNIEMESTVFAAMCGLCGLKAAVVCVTLLDRLDCDQINLPHDVLVEYQQRPQLLISNFIRRRL 313          
BLAST of Uridine phosphorylase vs. Ensembl Human
Match: UPP2 (uridine phosphorylase 2 [Source:HGNC Symbol;Acc:HGNC:23061])

HSP 1 Score: 186.808 bits (473), Expect = 1.354e-55
Identity = 108/299 (36.12%), Postives = 162/299 (54.18%), Query Frame = 3
Query:   18 FDMIRNKYLEAQINKDTIINLYHLDIYENPSYLQREFGDVKIVCMGGKASRMRELAKIWGKYCNIHNFENDLHDYSGAGDRFSMFKVYKIIFLSHGMGIPSISIALNEVTKLLHFAGVTDPLFIRIGTCGGLGLAPGTIVVSEYCYDSQLNDYQEIFVCGQSIKKKAILDKSCISEFINVSELFVGSESKVKIVKANTMCANDFYEEQARMDGPCNHITVDNKDAFFQKLINEYGIRNIEMESLGFAAFCHNLGIRGMVIALILVDRLVSDFVSISLDEIKHHQRVVNEILMNYFKTQL 914
            F  ++N YL+  +++D    LYHLD+      L   FGDVK VC+GG  +RM+  A    K       E D+ D     DR+ M+K   ++ +SHGMGIPSISI L+E+ KLLH A   D   IRIGT GG+G+APGT+V+++   DS      E  +    + +   LDK    E  N S+      + V     +TMC  DFYE Q R+DG     + + K  + ++   + G+RNIEMES  FAA C   G++  V+ + L+DRL  D +++  D +  +Q+    ++ N+ + +L
Sbjct:   81 FVHVKNPYLDL-MDEDI---LYHLDLGTKTHNLPAMFGDVKFVCVGGSPNRMKAFALFMHKELGFEEAEEDIKDICAGTDRYCMYKTGPVLAISHGMGIPSISIMLHELIKLLHHARCCDVTIIRIGTSGGIGIAPGTVVITDIAVDSFFKPRFEQVILDNIVTRSTELDKELSEELFNCSKEIPNFPTLV----GHTMCTYDFYEGQGRLDGALCSFSREKKLDYLKRAF-KAGVRNIEMESTVFAAMCGLCGLKAAVVCVTLLDRLDCDQINLPHDVLVEYQQRPQLLISNFIRRRL 370          
BLAST of Uridine phosphorylase vs. Ensembl Human
Match: UPP1 (uridine phosphorylase 1 [Source:HGNC Symbol;Acc:HGNC:12576])

HSP 1 Score: 182.185 bits (461), Expect = 1.600e-54
Identity = 101/279 (36.20%), Postives = 153/279 (54.84%), Query Frame = 3
Query:   78 LYHLDIYENPSYLQREFGDVKIVCMGGKASRMRELAKIWGKYCNIHNFENDLHDYSGAGDRFSMFKVYKIIFLSHGMGIPSISIALNEVTKLLHFAGVTDPLFIRIGTCGGLGLAPGTIVVSEYCYDSQLNDYQEIFVCGQSIKKKAILDKSCISEFINVSELFVGSESKVKIVKANTMCANDFYEEQARMDGPCNHITVDNKDAFFQKLINEYGIRNIEMESLGFAAFCHNLGIRGMVIALILVDRLVSDFVSISLDEIKHHQRVVNEILMNYFKTQL 914
            LYH ++  +       FGDVK VC+GG  SRM+   +  G    +     D  +     DR++M+KV  ++ +SHGMGIPSISI L+E+ KLL++A  ++   IRIGT GG+GL PGT+V++E   D+      E  V G+ + +K  L+K  + E +    L     S+   V  NTMC  DFYE Q R+DG     T  +K A+ +      G+RNIEMES  FAA C   G++  V+ + L++RL  D +S   + +  +Q+    ++  + K +L
Sbjct:   34 LYHFNLTTSRHNFPALFGDVKFVCVGGSPSRMKAFIRCVGAELGLDCPGRDYPNICAGTDRYAMYKVGPVLSVSHGMGIPSISIMLHELIKLLYYARCSNVTIIRIGTSGGIGLEPGTVVITEQAVDTCFKAEFEQIVLGKRVIRKTDLNKKLVQELL----LCSAELSEFTTVVGNTMCTLDFYEGQGRLDGALCSYTEKDKQAYLEAAYAA-GVRNIEMESSVFAAMCSACGLQAAVVCVTLLNRLEGDQISSPRNVLSEYQQRPQRLVSYFIKKKL 307          
BLAST of Uridine phosphorylase vs. Ensembl Human
Match: UPP1 (uridine phosphorylase 1 [Source:HGNC Symbol;Acc:HGNC:12576])

HSP 1 Score: 182.185 bits (461), Expect = 1.600e-54
Identity = 101/279 (36.20%), Postives = 153/279 (54.84%), Query Frame = 3
Query:   78 LYHLDIYENPSYLQREFGDVKIVCMGGKASRMRELAKIWGKYCNIHNFENDLHDYSGAGDRFSMFKVYKIIFLSHGMGIPSISIALNEVTKLLHFAGVTDPLFIRIGTCGGLGLAPGTIVVSEYCYDSQLNDYQEIFVCGQSIKKKAILDKSCISEFINVSELFVGSESKVKIVKANTMCANDFYEEQARMDGPCNHITVDNKDAFFQKLINEYGIRNIEMESLGFAAFCHNLGIRGMVIALILVDRLVSDFVSISLDEIKHHQRVVNEILMNYFKTQL 914
            LYH ++  +       FGDVK VC+GG  SRM+   +  G    +     D  +     DR++M+KV  ++ +SHGMGIPSISI L+E+ KLL++A  ++   IRIGT GG+GL PGT+V++E   D+      E  V G+ + +K  L+K  + E +    L     S+   V  NTMC  DFYE Q R+DG     T  +K A+ +      G+RNIEMES  FAA C   G++  V+ + L++RL  D +S   + +  +Q+    ++  + K +L
Sbjct:   34 LYHFNLTTSRHNFPALFGDVKFVCVGGSPSRMKAFIRCVGAELGLDCPGRDYPNICAGTDRYAMYKVGPVLSVSHGMGIPSISIMLHELIKLLYYARCSNVTIIRIGTSGGIGLEPGTVVITEQAVDTCFKAEFEQIVLGKRVIRKTDLNKKLVQELL----LCSAELSEFTTVVGNTMCTLDFYEGQGRLDGALCSYTEKDKQAYLEAAYAA-GVRNIEMESSVFAAMCSACGLQAAVVCVTLLNRLEGDQISSPRNVLSEYQQRPQRLVSYFIKKKL 307          
BLAST of Uridine phosphorylase vs. Ensembl Human
Match: UPP1 (uridine phosphorylase 1 [Source:HGNC Symbol;Acc:HGNC:12576])

HSP 1 Score: 93.2041 bits (230), Expect = 1.414e-22
Identity = 47/113 (41.59%), Postives = 68/113 (60.18%), Query Frame = 3
Query:   78 LYHLDIYENPSYLQREFGDVKIVCMGGKASRMRELAKIWGKYCNIHNFENDLHDYSGAGDRFSMFKVYKIIFLSHGMGIPSISIALNEVTKLLHFAGVTDPLFIRIGTCGGLG 416
            LYH ++  +       FGDVK VC+GG  SRM+   +  G    +     D  +     DR++M+KV  ++ +SHGMGIPSISI L+E+ KLL++A  ++   IRIGT GG+G
Sbjct:   34 LYHFNLTTSRHNFPALFGDVKFVCVGGSPSRMKAFIRCVGAELGLDCPGRDYPNICAGTDRYAMYKVGPVLSVSHGMGIPSISIMLHELIKLLYYARCSNVTIIRIGTSGGIG 146          
BLAST of Uridine phosphorylase vs. Ensembl Celegans
Match: upp-1 (Uridine and thymidine phosphorylase [Source:UniProtKB/Swiss-Prot;Acc:Q23588])

HSP 1 Score: 152.525 bits (384), Expect = 9.533e-44
Identity = 103/293 (35.15%), Postives = 156/293 (53.24%), Query Frame = 3
Query:   33 NKYLEAQINKDTIINLYHLDIYENPSYLQREFGDVKIVCMGGKASRMRELAKIWGKYCNIHNFENDLHDYSGAGDRFSMFKVYKIIFLSHGMGIPSISIALNEVTKLLHFAGVTDPLFIRIGTCGGLGLAPGTIVVSEYCYDSQLNDYQEIFVCGQSIKKKAILDKSCISEFINVSELFVGSESKVKIVKANTMCANDFYEEQARMDGPCNHITVDNKDAFFQKLINEYGIRNIEMESLGFAAFCHNLGIRGMVIALILVDRLVSDFVSISLDEIKHHQRVVNEILMNYFKTQ 911
            NKY + +  +D    LYH     +   +   FGD K VC GG   R +  A+ + K  NI   EN         DRF ++K   + +++HGMG PS+SI L E  KL+H AGV +P FIR+GT GG+G+ PGT+VVS    +++L D     + G+ I++   LD +            VG E  + +    TMCA+DFYE Q R+DG       ++K AF +KL N  G+RNIEMES  FA+F    G +  ++ + L++R+  D V I+ ++   ++     ++  Y + Q
Sbjct:   14 NKYFDIKDKRDF---LYHFGFGVDTLDIPAVFGDTKFVCTGGSPGRFKLYAEWFAKEANIPCSEN-----LSRSDRFVIYKTGPVCWINHGMGTPSLSIMLVESFKLMHHAGVKNPTFIRLGTSGGVGVPPGTVVVSTEAMNAELGDTYVQIIAGKRIERPTQLDAALREALCE-----VGKEKSIPVETGKTMCADDFYEGQMRLDGYFCDYEEEDKYAFLRKL-NALGVRNIEMESTCFASFTCRAGFQSAIVCVTLLNRMDGDQVQIAKEQYIEYEERPFRLVTAYIRKQ 292          
BLAST of Uridine phosphorylase vs. Ensembl Fly
Match: CG3788 (gene:FBgn0034800 transcript:FBtr0071995)

HSP 1 Score: 189.119 bits (479), Expect = 7.249e-57
Identity = 105/280 (37.50%), Postives = 158/280 (56.43%), Query Frame = 3
Query:   78 LYHLDIYENPSYLQREFGDVKIVCMGGKASRMRELAKIWGKYCNIH-NFENDLHDYSGAGDRFSMFKVYKIIFLSHGMGIPSISIALNEVTKLLHFAGVTDPLFIRIGTCGGLGLAPGTIVVSEYCYDSQLNDYQEIFVCGQSIKKKAILDKSCISEFINVSELFVGSESKVKIVKANTMCANDFYEEQARMDGPCNHITVDNKDAFFQKLINEYGIRNIEMESLGFAAFCHNLGIRGMVIALILVDRLVSDFVSISLDEIKHHQRVVNEILMNYFKTQL 914
            LYHL +    +   + FGDV+ VCMGG   RM   A    +   +  N    L + S AG RFS+FKV  ++  SHGMG PSISI L+E+ K+++ A   DP+FIRIGT GG+G+ PGT+++S    D +LN   EI V G S++  + LD+S   E   +       + K + V   T+CA+DFYE Q+R+DG     T + K ++ + L ++  ++NIEMESL FAA      IRG V+ + +++RL  D +    D +   ++   E++  Y +  L
Sbjct:   68 LYHLGLNTETTDFPKVFGDVRFVCMGGTPGRMENFAYYVMQEIGLKINAATKLRNISEAGQRFSLFKVGPVLCASHGMGCPSISILLHELIKMMYHAKCKDPVFIRIGTSGGIGVEPGTVIISSEAIDGRLNPVHEILVHGVSVQHASQLDESLADE---IKMCHDPCKDKYEAVIGRTLCAHDFYEGQSRLDGAFCEYTPEMKKSYLETLQSQQ-VKNIEMESLAFAALTSRANIRGAVVCVAILNRLNGDQIKTPHDVLSKWEKRPQELVARYIRKVL 343          
BLAST of Uridine phosphorylase vs. Ensembl Fly
Match: CG3788 (gene:FBgn0034800 transcript:FBtr0303465)

HSP 1 Score: 189.119 bits (479), Expect = 7.249e-57
Identity = 105/280 (37.50%), Postives = 158/280 (56.43%), Query Frame = 3
Query:   78 LYHLDIYENPSYLQREFGDVKIVCMGGKASRMRELAKIWGKYCNIH-NFENDLHDYSGAGDRFSMFKVYKIIFLSHGMGIPSISIALNEVTKLLHFAGVTDPLFIRIGTCGGLGLAPGTIVVSEYCYDSQLNDYQEIFVCGQSIKKKAILDKSCISEFINVSELFVGSESKVKIVKANTMCANDFYEEQARMDGPCNHITVDNKDAFFQKLINEYGIRNIEMESLGFAAFCHNLGIRGMVIALILVDRLVSDFVSISLDEIKHHQRVVNEILMNYFKTQL 914
            LYHL +    +   + FGDV+ VCMGG   RM   A    +   +  N    L + S AG RFS+FKV  ++  SHGMG PSISI L+E+ K+++ A   DP+FIRIGT GG+G+ PGT+++S    D +LN   EI V G S++  + LD+S   E   +       + K + V   T+CA+DFYE Q+R+DG     T + K ++ + L ++  ++NIEMESL FAA      IRG V+ + +++RL  D +    D +   ++   E++  Y +  L
Sbjct:   68 LYHLGLNTETTDFPKVFGDVRFVCMGGTPGRMENFAYYVMQEIGLKINAATKLRNISEAGQRFSLFKVGPVLCASHGMGCPSISILLHELIKMMYHAKCKDPVFIRIGTSGGIGVEPGTVIISSEAIDGRLNPVHEILVHGVSVQHASQLDESLADE---IKMCHDPCKDKYEAVIGRTLCAHDFYEGQSRLDGAFCEYTPEMKKSYLETLQSQQ-VKNIEMESLAFAALTSRANIRGAVVCVAILNRLNGDQIKTPHDVLSKWEKRPQELVARYIRKVL 343          
BLAST of Uridine phosphorylase vs. Ensembl Fly
Match: CG6330 (gene:FBgn0039464 transcript:FBtr0085084)

HSP 1 Score: 185.652 bits (470), Expect = 8.230e-56
Identity = 105/276 (38.04%), Postives = 157/276 (56.88%), Query Frame = 3
Query:   78 LYHLDIYENPSYLQREFGDVKIVCMGGKASRMRELAK-IWGKYCNIHNFENDLHDYSGAGDRFSMFKVYKIIFLSHGMGIPSISIALNEVTKLLHFAGVTDPLFIRIGTCGGLGLAPGTIVVSEYCYDSQLNDYQEIFVCGQSIKKKAILDKSCISEFINVSELFVGSESKVKIVKANTMCANDFYEEQARMDGPCNHITVDNKDAFFQKLINEYGIRNIEMESLGFAAFCHNLGIRGMVIALILVDRLVSDFVSISLDEIKHHQRVVNEILMNYF 902
            LYHL +      LQ  FGDVK VCMGG   RM   A  I  +          L D S    R+SM+KV  ++ +SHGMG PS+SI ++E+ KL++ A   DP+FIRIGTCGG+G+  GT++++E   D QL +  E  + G++I + A LDK    E  +++      +     +   T+C NDFYE Q R+DG     + + K A+ +KL  E G+ NIEMES  FAA  H+ GI+  V+ + L++RL  D V+ +  E+ +  +   +IL++ +
Sbjct:   40 LYHLALGSESHDLQEMFGDVKFVCMGGTPKRMENFAHFIMNEIGYKLPAGTQLQDISAYSYRYSMYKVGPVLCVSHGMGTPSVSILMHEMIKLMYHAKCKDPVFIRIGTCGGIGVDGGTVIITEDALDGQLRNSHEFTILGKTIHRPAKLDKKLARELKSLAS----PDDPYDTIIGKTLCTNDFYEGQGRLDGAFCDFSENEKMAYLEKL-RENGVVNIEMESTIFAALTHHAGIKAAVVCVALLNRLNGDQVN-APKEVMNEWQARPQILVSRY 309          
BLAST of Uridine phosphorylase vs. Ensembl Fly
Match: CG17224 (gene:FBgn0031489 transcript:FBtr0077671)

HSP 1 Score: 183.726 bits (465), Expect = 1.082e-55
Identity = 102/284 (35.92%), Postives = 164/284 (57.75%), Query Frame = 3
Query:   78 LYHLDI----YENPSYLQREFGDVKIVCMGGKASRMRELAKIWGKYCNIHNFENDLHDYSGAGDRFSMFKVYKIIFLSHGMGIPSISIALNEVTKLLHFAGVTDPLFIRIGTCGGLGLAPGTIVVSEYCYDSQLNDYQEIFVCGQSIKKKAILDKSCISEFINVSELFVGSESKVKIVKANTMCANDFYEEQARMDGPCNHITVDNKDAFFQKLINEYGIRNIEMESLGFAAFCHNLGIRGMVIALILVDRLVSDFVSISLDEIKHHQRVVNEILMNYFKTQLE 917
            LYHLDI      + S LQ  FGDV+++CMGG  SRMR+LA ++ +   + +   D  D    G+R++M+KV  ++ +SHG+G  S S+ L+E+ KLL +A   DP+ +RIGTCGGLG+ PGT+V S+  ++  L +  EI + GQ + + A   +  I + +      V +    + + ANTM  + FYE Q R DG     +  +K  F QK  ++ GIRNIEME+  FA+    +G++   + + L+DRL  D ++I++D+    ++    ++  Y K  L+
Sbjct:   21 LYHLDINVANTRDTSELQNRFGDVRVICMGGTGSRMRQLA-LYLRDILVVSESGDPVDLCERGNRYAMYKVGPVLCVSHGVGSSSFSVVLHELIKLLKYARCQDPVLLRIGTCGGLGVPPGTVVASKNAFNGLLRNEHEIAILGQRVVRPAQFSEDVIRDLLAFG---VDANDGFQTISANTMGTDCFYEGQGRTDGAICEYSEKDKMEFLQK-CHDLGIRNIEMEASMFASVTQKVGVKAGDVCVTLIDRLKGDQITITIDQKHEFEQRPFFVVGRYIKRLLQ 299          
BLAST of Uridine phosphorylase vs. Ensembl Fly
Match: CG17224 (gene:FBgn0031489 transcript:FBtr0300815)

HSP 1 Score: 183.726 bits (465), Expect = 1.082e-55
Identity = 102/284 (35.92%), Postives = 164/284 (57.75%), Query Frame = 3
Query:   78 LYHLDI----YENPSYLQREFGDVKIVCMGGKASRMRELAKIWGKYCNIHNFENDLHDYSGAGDRFSMFKVYKIIFLSHGMGIPSISIALNEVTKLLHFAGVTDPLFIRIGTCGGLGLAPGTIVVSEYCYDSQLNDYQEIFVCGQSIKKKAILDKSCISEFINVSELFVGSESKVKIVKANTMCANDFYEEQARMDGPCNHITVDNKDAFFQKLINEYGIRNIEMESLGFAAFCHNLGIRGMVIALILVDRLVSDFVSISLDEIKHHQRVVNEILMNYFKTQLE 917
            LYHLDI      + S LQ  FGDV+++CMGG  SRMR+LA ++ +   + +   D  D    G+R++M+KV  ++ +SHG+G  S S+ L+E+ KLL +A   DP+ +RIGTCGGLG+ PGT+V S+  ++  L +  EI + GQ + + A   +  I + +      V +    + + ANTM  + FYE Q R DG     +  +K  F QK  ++ GIRNIEME+  FA+    +G++   + + L+DRL  D ++I++D+    ++    ++  Y K  L+
Sbjct:   21 LYHLDINVANTRDTSELQNRFGDVRVICMGGTGSRMRQLA-LYLRDILVVSESGDPVDLCERGNRYAMYKVGPVLCVSHGVGSSSFSVVLHELIKLLKYARCQDPVLLRIGTCGGLGVPPGTVVASKNAFNGLLRNEHEIAILGQRVVRPAQFSEDVIRDLLAFG---VDANDGFQTISANTMGTDCFYEGQGRTDGAICEYSEKDKMEFLQK-CHDLGIRNIEMEASMFASVTQKVGVKAGDVCVTLIDRLKGDQITITIDQKHEFEQRPFFVVGRYIKRLLQ 299          
BLAST of Uridine phosphorylase vs. Ensembl Zebrafish
Match: upp2 (uridine phosphorylase 2 [Source:ZFIN;Acc:ZDB-GENE-040426-830])

HSP 1 Score: 185.267 bits (469), Expect = 5.165e-56
Identity = 104/279 (37.28%), Postives = 154/279 (55.20%), Query Frame = 3
Query:   78 LYHLDIYENPSYLQREFGDVKIVCMGGKASRMRELAKIWGKYCNIHNFENDLHDYSGAGDRFSMFKVYKIIFLSHGMGIPSISIALNEVTKLLHFAGVTDPLFIRIGTCGGLGLAPGTIVVSEYCYDSQLNDYQEIFVCGQSIKKKAILDKSCISEFINVSELFVGSESKVKIVKANTMCANDFYEEQARMDGPCNHITVDNKDAFFQKLINEYGIRNIEMESLGFAAFCHNLGIRGMVIALILVDRLVSDFVSISLDEIKHHQRVVNEILMNYFKTQL 914
            LYH  +      L + FGDVK VC+GG  +RMR  A+   +   + +   D+ D     DR+SM+KV  ++ +SHGMG+PSISI L+E+ KLL+ A   D +  RIGT GG+GLA GTIV+++   DS      E  V G+ I +   LD     E +  S       + +  V ANTMC +DFYE Q R+DG     + + K  + +K  +E G+RNIEMES  FAA CH   ++  V+ + L++R   D +S   D +  +Q+    ++ +  K +L
Sbjct:   36 LYHFSLSTKTHDLPQMFGDVKFVCVGGSPNRMRTFAEYIHEQLEMPSNTADIKDICEGTDRYSMYKVGPVLSISHGMGVPSISIMLHELIKLLYHARCRDVIIFRIGTSGGIGLAAGTIVITDKAVDSFFRPQFEQVVLGKVITRSTELDVDIAQELLQYSSEL----TDMPTVIANTMCTHDFYEGQGRLDGALCSFSTEEKFEYLRK-ASEAGVRNIEMESSVFAAMCHVCNLKAAVVCVTLLNRFEGDQISTPHDILMEYQQRPQRLVAHLIKKRL 309          
BLAST of Uridine phosphorylase vs. Ensembl Zebrafish
Match: upp1 (uridine phosphorylase 1 [Source:ZFIN;Acc:ZDB-GENE-050306-2])

HSP 1 Score: 134.806 bits (338), Expect = 2.022e-37
Identity = 72/198 (36.36%), Postives = 108/198 (54.55%), Query Frame = 3
Query:   78 LYHLDIYENPSYLQREFGDVKIVCMGGKASRMRELAKIWGKYCNIHNFENDLHDYSGAGDRFSMFKVYKIIFLSHGMGIPSISIALNEVTKLLHFAGVTDPLFIRIGTCGGLGLAPGTIVVSEYCYDSQLNDYQEIFVCGQSIKKKAILDKSCISEFINVSELFVGSESKVKIVKANTMCANDFYEEQARMDGPCNHI 671
            LYH ++  +   L + FGDVK VC+GG   RM+   +   K   + +   +  +     DR++M+KV  ++ +SHGMGIPSISI L+E+ KLL+ A  TD   +RIGT GG+GL PGT+VV++   DS    + E  + G+ + +   LDK    E +   +       + +I+  NTMC  DFYE     +  C  I
Sbjct:   30 LYHFNLGTSTHDLPKMFGDVKFVCVGGSPWRMKSFTEYIAKELGLVDPNAEYPNICAGTDRYAMYKVGPVLSVSHGMGIPSISIMLHELIKLLYHARCTDVTVVRIGTSGGIGLKPGTVVVTKQSVDSLFQPHLEQTILGKPVVRSTELDKELAEELLQCGKEL----GEFEIIIGNTMCTLDFYEGSNVFEDKCTRI 223          
BLAST of Uridine phosphorylase vs. Ensembl Xenopus
Match: upp2 (uridine phosphorylase 2 [Source:NCBI gene;Acc:493536])

HSP 1 Score: 184.882 bits (468), Expect = 1.336e-55
Identity = 106/299 (35.45%), Postives = 162/299 (54.18%), Query Frame = 3
Query:   18 FDMIRNKYLEAQINKDTIINLYHLDIYENPSYLQREFGDVKIVCMGGKASRMRELAKIWGKYCNIHNFENDLHDYSGAGDRFSMFKVYKIIFLSHGMGIPSISIALNEVTKLLHFAGVTDPLFIRIGTCGGLGLAPGTIVVSEYCYDSQLNDYQEIFVCGQSIKKKAILDKSCISEFINVSELFVGSESKVKIVKANTMCANDFYEEQARMDGPCNHITVDNKDAFFQKLINEYGIRNIEMESLGFAAFCHNLGIRGMVIALILVDRLVSDFVSISLDEIKHHQRVVNEILMNYFKTQL 914
            F  I+N +L++ + +D    LYH D+      L   FGDVK VC+GG A+RMR  A    +   +     ++ D     DR+SM+KV  ++ +SHGMGIPSISI L+E+ KLLH A   D   IRIGT GG+G+ PGT+V+++   DS      E  V  + + +   L +    + +  S+      +    +  +TMC  DFYE Q R+DG     + + K  + Q+     G+RNIEMES  FAA C   G++  V+ + L++RL  D ++ S D +  +Q+   +++  Y K QL
Sbjct:   24 FVHIKNPHLDS-LPEDI---LYHFDLGTKTHDLPSMFGDVKFVCVGGSANRMRAFALFIHQELGLEGEGTEVADICAGTDRYSMYKVGPVLSISHGMGIPSISIMLHELIKLLHHAKCRDVTIIRIGTSGGIGIEPGTVVITDVAVDSFFRPQFEQVVLDKVVVRNTDLHRELAEDLLQCSKEI----ASFPTIIGHTMCTYDFYEGQGRLDGALCSFSKEEKFEYLQRAFTA-GVRNIEMESTVFAAMCQLCGLKAAVVCVTLLNRLEGDQIAESHDTLIEYQKRPQQLIAEYIKKQL 313          
BLAST of Uridine phosphorylase vs. Ensembl Xenopus
Match: upp1 (uridine phosphorylase 1 [Source:NCBI gene;Acc:496532])

HSP 1 Score: 179.489 bits (454), Expect = 1.639e-53
Identity = 102/279 (36.56%), Postives = 155/279 (55.56%), Query Frame = 3
Query:   78 LYHLDIYENPSYLQREFGDVKIVCMGGKASRMRELAKIWGKYCNIHNFENDLHDYSGAGDRFSMFKVYKIIFLSHGMGIPSISIALNEVTKLLHFAGVTDPLFIRIGTCGGLGLAPGTIVVSEYCYDSQLNDYQEIFVCGQSIKKKAILDKSCISEFINVSELFVGSESKVKIVKANTMCANDFYEEQARMDGPCNHITVDNKDAFFQKLINEYGIRNIEMESLGFAAFCHNLGIRGMVIALILVDRLVSDFVSISLDEIKHHQRVVNEILMNYFKTQL 914
            LYH DI          FGDVK VC+GG  SRM+  A+       + +  +D+ +     DR++M+KV  ++ +SHGMGIPSISI L+E+ KLL+ +  T+   IRIGT GG+GL PG++V++    D+      E  + G+++ +   LD     EF   S+      +K   V  NTMC  DFYE QAR+DG     T + K  +  K   + G+RNIEMES  FAA C+  G++  V+ + L++RL  D +S S + +  +Q+   +++  + K  L
Sbjct:   35 LYHFDIGTGTHDFPAMFGDVKFVCVGGSPSRMKAFAQYINGELALGDPNSDVANICAGTDRYAMYKVGPVLSISHGMGIPSISIMLHELIKLLYHSKCTNVTIIRIGTSGGIGLEPGSVVITSQSVDASFRPQFEQIILGKTVVRNTELDSELAREFFQCSKEI----NKFNTVIGNTMCTLDFYEGQARLDGAFCSYTEEEKMQYL-KAAYDAGVRNIEMESSVFAAMCNISGLKAAVVCVTLLNRLEGDQISSSHEVLVDYQQRPQKLVGFFIKKHL 308          
BLAST of Uridine phosphorylase vs. Ensembl Mouse
Match: Upp2 (uridine phosphorylase 2 [Source:MGI Symbol;Acc:MGI:1923904])

HSP 1 Score: 195.282 bits (495), Expect = 1.243e-59
Identity = 111/296 (37.50%), Postives = 163/296 (55.07%), Query Frame = 3
Query:   27 IRNKYLEAQINKDTIINLYHLDIYENPSYLQREFGDVKIVCMGGKASRMRELAKIWGKYCNIHNFENDLHDYSGAGDRFSMFKVYKIIFLSHGMGIPSISIALNEVTKLLHFAGVTDPLFIRIGTCGGLGLAPGTIVVSEYCYDSQLNDYQEIFVCGQSIKKKAILDKSCISEFINVSELFVGSESKVKIVKANTMCANDFYEEQARMDGPCNHITVDNKDAFFQKLINEYGIRNIEMESLGFAAFCHNLGIRGMVIALILVDRLVSDFVSISLDEIKHHQRVVNEILMNYFKTQL 914
            ++N YLE  +++D    LYHLD+      L   FGDVK VC+GG  +RM+  A+   K   +     D+ D     DR+ MFK   ++ +SHGMGIPSISI L+E+ KLLH A   D   IRIGT GG+G+APG++V+++   DS      E  +    + +   LDK   ++  N S         V  +  +TMC  DFYE Q R+DG     + + K  + ++     G+RNIEMES  FAA C   G+R  V+ + L+DRL SD +++S D +  +Q+    ++ N+ K QL
Sbjct:   27 VKNPYLEG-MDEDI---LYHLDLGTKTHNLPAMFGDVKFVCVGGSPNRMKAFAQFMHKELRLEGDGEDIEDICAGTDRYCMFKTGPVLSVSHGMGIPSISIMLHELIKLLHHAHCCDVTIIRIGTSGGIGIAPGSVVITDTAVDSFFKPRFEQVILDNVVTRSTELDKELANDLFNCSREI----PNVPTLIGHTMCTYDFYEGQGRLDGALCSFSREKKLDYLKRAYRA-GVRNIEMESTVFAAMCGLCGLRAAVVCVTLLDRLESDQINLSHDVLVEYQQRPQLLISNFIKKQL 313          
BLAST of Uridine phosphorylase vs. Ensembl Mouse
Match: Upp2 (uridine phosphorylase 2 [Source:MGI Symbol;Acc:MGI:1923904])

HSP 1 Score: 194.897 bits (494), Expect = 2.176e-59
Identity = 111/296 (37.50%), Postives = 163/296 (55.07%), Query Frame = 3
Query:   27 IRNKYLEAQINKDTIINLYHLDIYENPSYLQREFGDVKIVCMGGKASRMRELAKIWGKYCNIHNFENDLHDYSGAGDRFSMFKVYKIIFLSHGMGIPSISIALNEVTKLLHFAGVTDPLFIRIGTCGGLGLAPGTIVVSEYCYDSQLNDYQEIFVCGQSIKKKAILDKSCISEFINVSELFVGSESKVKIVKANTMCANDFYEEQARMDGPCNHITVDNKDAFFQKLINEYGIRNIEMESLGFAAFCHNLGIRGMVIALILVDRLVSDFVSISLDEIKHHQRVVNEILMNYFKTQL 914
            ++N YLE  +++D    LYHLD+      L   FGDVK VC+GG  +RM+  A+   K   +     D+ D     DR+ MFK   ++ +SHGMGIPSISI L+E+ KLLH A   D   IRIGT GG+G+APG++V+++   DS      E  +    + +   LDK   ++  N S         V  +  +TMC  DFYE Q R+DG     + + K  + ++     G+RNIEMES  FAA C   G+R  V+ + L+DRL SD +++S D +  +Q+    ++ N+ K QL
Sbjct:   45 VKNPYLEG-MDEDI---LYHLDLGTKTHNLPAMFGDVKFVCVGGSPNRMKAFAQFMHKELRLEGDGEDIEDICAGTDRYCMFKTGPVLSVSHGMGIPSISIMLHELIKLLHHAHCCDVTIIRIGTSGGIGIAPGSVVITDTAVDSFFKPRFEQVILDNVVTRSTELDKELANDLFNCSREI----PNVPTLIGHTMCTYDFYEGQGRLDGALCSFSREKKLDYLKRAYRA-GVRNIEMESTVFAAMCGLCGLRAAVVCVTLLDRLESDQINLSHDVLVEYQQRPQLLISNFIKKQL 331          
BLAST of Uridine phosphorylase vs. Ensembl Mouse
Match: Upp2 (uridine phosphorylase 2 [Source:MGI Symbol;Acc:MGI:1923904])

HSP 1 Score: 191.045 bits (484), Expect = 1.660e-58
Identity = 106/279 (37.99%), Postives = 153/279 (54.84%), Query Frame = 3
Query:   78 LYHLDIYENPSYLQREFGDVKIVCMGGKASRMRELAKIWGKYCNIHNFENDLHDYSGAGDRFSMFKVYKIIFLSHGMGIPSISIALNEVTKLLHFAGVTDPLFIRIGTCGGLGLAPGTIVVSEYCYDSQLNDYQEIFVCGQSIKKKAILDKSCISEFINVSELFVGSESKVKIVKANTMCANDFYEEQARMDGPCNHITVDNKDAFFQKLINEYGIRNIEMESLGFAAFCHNLGIRGMVIALILVDRLVSDFVSISLDEIKHHQRVVNEILMNYFKTQL 914
            LYHLD+      L   FGDVK VC+GG  +RM+  A+   K   +     D+ D     DR+ MFK   ++ +SHGMGIPSISI L+E+ KLLH A   D   IRIGT GG+G+APG++V+++   DS      E  +    + +   LDK   ++  N S         V  +  +TMC  DFYE Q R+DG     + + K  + ++     G+RNIEMES  FAA C   G+R  V+ + L+DRL SD +++S D +  +Q+    ++ N+ K QL
Sbjct:    6 LYHLDLGTKTHNLPAMFGDVKFVCVGGSPNRMKAFAQFMHKELRLEGDGEDIEDICAGTDRYCMFKTGPVLSVSHGMGIPSISIMLHELIKLLHHAHCCDVTIIRIGTSGGIGIAPGSVVITDTAVDSFFKPRFEQVILDNVVTRSTELDKELANDLFNCSREI----PNVPTLIGHTMCTYDFYEGQGRLDGALCSFSREKKLDYLKRAYRA-GVRNIEMESTVFAAMCGLCGLRAAVVCVTLLDRLESDQINLSHDVLVEYQQRPQLLISNFIKKQL 279          
BLAST of Uridine phosphorylase vs. Ensembl Mouse
Match: Upp2 (uridine phosphorylase 2 [Source:MGI Symbol;Acc:MGI:1923904])

HSP 1 Score: 171.4 bits (433), Expect = 1.104e-50
Identity = 98/254 (38.58%), Postives = 138/254 (54.33%), Query Frame = 3
Query:   27 IRNKYLEAQINKDTIINLYHLDIYENPSYLQREFGDVKIVCMGGKASRMRELAKIWGKYCNIHNFENDLHDYSGAGDRFSMFKVYKIIFLSHGMGIPSISIALNEVTKLLHFAGVTDPLFIRIGTCGGLGLAPGTIVVSEYCYDSQLNDYQEIFVCGQSIKKKAILDKSCISEFINVSELFVGSESKVKIVKANTMCANDFYEEQARMDGPCNHITVDNKDAFFQKLINEYGIRNIEMESLGFAAFCHNLGIRG 788
            ++N YLE  +++D    LYHLD+      L   FGDVK VC+GG  +RM+  A+   K   +     D+ D     DR+ MFK   ++ +SHGMGIPSISI L+E+ KLLH A   D   IRIGT GG+G+APG++V+++   DS      E  +    + +   LDK   ++  N S         V  +  +TMC  DFYE Q R+DG     + + K  + ++     G+RNIEMES  FAA C   G+RG
Sbjct:   27 VKNPYLEG-MDEDI---LYHLDLGTKTHNLPAMFGDVKFVCVGGSPNRMKAFAQFMHKELRLEGDGEDIEDICAGTDRYCMFKTGPVLSVSHGMGIPSISIMLHELIKLLHHAHCCDVTIIRIGTSGGIGIAPGSVVITDTAVDSFFKPRFEQVILDNVVTRSTELDKELANDLFNCSREI----PNVPTLIGHTMCTYDFYEGQGRLDGALCSFSREKKLDYLKRAYRA-GVRNIEMESTVFAAMCGLCGLRG 271          
BLAST of Uridine phosphorylase vs. Ensembl Mouse
Match: Upp2 (uridine phosphorylase 2 [Source:MGI Symbol;Acc:MGI:1923904])

HSP 1 Score: 169.088 bits (427), Expect = 1.417e-49
Identity = 97/253 (38.34%), Postives = 137/253 (54.15%), Query Frame = 3
Query:   27 IRNKYLEAQINKDTIINLYHLDIYENPSYLQREFGDVKIVCMGGKASRMRELAKIWGKYCNIHNFENDLHDYSGAGDRFSMFKVYKIIFLSHGMGIPSISIALNEVTKLLHFAGVTDPLFIRIGTCGGLGLAPGTIVVSEYCYDSQLNDYQEIFVCGQSIKKKAILDKSCISEFINVSELFVGSESKVKIVKANTMCANDFYEEQARMDGPCNHITVDNKDAFFQKLINEYGIRNIEMESLGFAAFCHNLGIR 785
            ++N YLE  +++D    LYHLD+      L   FGDVK VC+GG  +RM+  A+   K   +     D+ D     DR+ MFK   ++ +SHGMGIPSISI L+E+ KLLH A   D   IRIGT GG+G+APG++V+++   DS      E  +    + +   LDK   ++  N S         V  +  +TMC  DFYE Q R+DG     + + K  + ++     G+RNIEMES  FAA C   G+R
Sbjct:   65 VKNPYLEG-MDEDI---LYHLDLGTKTHNLPAMFGDVKFVCVGGSPNRMKAFAQFMHKELRLEGDGEDIEDICAGTDRYCMFKTGPVLSVSHGMGIPSISIMLHELIKLLHHAHCCDVTIIRIGTSGGIGIAPGSVVITDTAVDSFFKPRFEQVILDNVVTRSTELDKELANDLFNCSREI----PNVPTLIGHTMCTYDFYEGQGRLDGALCSFSREKKLDYLKRAYRA-GVRNIEMESTVFAAMCGLCGLR 308          
BLAST of Uridine phosphorylase vs. UniProt/SwissProt
Match: sp|Q8CGR7|UPP2_MOUSE (Uridine phosphorylase 2 OS=Mus musculus OX=10090 GN=Upp2 PE=2 SV=1)

HSP 1 Score: 195.282 bits (495), Expect = 8.696e-59
Identity = 111/296 (37.50%), Postives = 163/296 (55.07%), Query Frame = 3
Query:   27 IRNKYLEAQINKDTIINLYHLDIYENPSYLQREFGDVKIVCMGGKASRMRELAKIWGKYCNIHNFENDLHDYSGAGDRFSMFKVYKIIFLSHGMGIPSISIALNEVTKLLHFAGVTDPLFIRIGTCGGLGLAPGTIVVSEYCYDSQLNDYQEIFVCGQSIKKKAILDKSCISEFINVSELFVGSESKVKIVKANTMCANDFYEEQARMDGPCNHITVDNKDAFFQKLINEYGIRNIEMESLGFAAFCHNLGIRGMVIALILVDRLVSDFVSISLDEIKHHQRVVNEILMNYFKTQL 914
            ++N YLE  +++D    LYHLD+      L   FGDVK VC+GG  +RM+  A+   K   +     D+ D     DR+ MFK   ++ +SHGMGIPSISI L+E+ KLLH A   D   IRIGT GG+G+APG++V+++   DS      E  +    + +   LDK   ++  N S         V  +  +TMC  DFYE Q R+DG     + + K  + ++     G+RNIEMES  FAA C   G+R  V+ + L+DRL SD +++S D +  +Q+    ++ N+ K QL
Sbjct:   27 VKNPYLEG-MDEDI---LYHLDLGTKTHNLPAMFGDVKFVCVGGSPNRMKAFAQFMHKELRLEGDGEDIEDICAGTDRYCMFKTGPVLSVSHGMGIPSISIMLHELIKLLHHAHCCDVTIIRIGTSGGIGIAPGSVVITDTAVDSFFKPRFEQVILDNVVTRSTELDKELANDLFNCSREI----PNVPTLIGHTMCTYDFYEGQGRLDGALCSFSREKKLDYLKRAYRA-GVRNIEMESTVFAAMCGLCGLRAAVVCVTLLDRLESDQINLSHDVLVEYQQRPQLLISNFIKKQL 313          
BLAST of Uridine phosphorylase vs. UniProt/SwissProt
Match: sp|O95045|UPP2_HUMAN (Uridine phosphorylase 2 OS=Homo sapiens OX=9606 GN=UPP2 PE=1 SV=1)

HSP 1 Score: 186.422 bits (472), Expect = 1.927e-55
Identity = 108/299 (36.12%), Postives = 162/299 (54.18%), Query Frame = 3
Query:   18 FDMIRNKYLEAQINKDTIINLYHLDIYENPSYLQREFGDVKIVCMGGKASRMRELAKIWGKYCNIHNFENDLHDYSGAGDRFSMFKVYKIIFLSHGMGIPSISIALNEVTKLLHFAGVTDPLFIRIGTCGGLGLAPGTIVVSEYCYDSQLNDYQEIFVCGQSIKKKAILDKSCISEFINVSELFVGSESKVKIVKANTMCANDFYEEQARMDGPCNHITVDNKDAFFQKLINEYGIRNIEMESLGFAAFCHNLGIRGMVIALILVDRLVSDFVSISLDEIKHHQRVVNEILMNYFKTQL 914
            F  ++N YL+  +++D    LYHLD+      L   FGDVK VC+GG  +RM+  A    K       E D+ D     DR+ M+K   ++ +SHGMGIPSISI L+E+ KLLH A   D   IRIGT GG+G+APGT+V+++   DS      E  +    + +   LDK    E  N S+      + V     +TMC  DFYE Q R+DG     + + K  + ++   + G+RNIEMES  FAA C   G++  V+ + L+DRL  D +++  D +  +Q+    ++ N+ + +L
Sbjct:   24 FVHVKNPYLDL-MDEDI---LYHLDLGTKTHNLPAMFGDVKFVCVGGSPNRMKAFALFMHKELGFEEAEEDIKDICAGTDRYCMYKTGPVLAISHGMGIPSISIMLHELIKLLHHARCCDVTIIRIGTSGGIGIAPGTVVITDIAVDSFFKPRFEQVILDNIVTRSTELDKELSEELFNCSKEIPNFPTLV----GHTMCTYDFYEGQGRLDGALCSFSREKKLDYLKRAF-KAGVRNIEMESTVFAAMCGLCGLKAAVVCVTLLDRLDCDQINLPHDVLVEYQQRPQLLISNFIRRRL 313          
BLAST of Uridine phosphorylase vs. UniProt/SwissProt
Match: sp|Q16831|UPP1_HUMAN (Uridine phosphorylase 1 OS=Homo sapiens OX=9606 GN=UPP1 PE=1 SV=1)

HSP 1 Score: 182.185 bits (461), Expect = 7.685e-54
Identity = 101/279 (36.20%), Postives = 153/279 (54.84%), Query Frame = 3
Query:   78 LYHLDIYENPSYLQREFGDVKIVCMGGKASRMRELAKIWGKYCNIHNFENDLHDYSGAGDRFSMFKVYKIIFLSHGMGIPSISIALNEVTKLLHFAGVTDPLFIRIGTCGGLGLAPGTIVVSEYCYDSQLNDYQEIFVCGQSIKKKAILDKSCISEFINVSELFVGSESKVKIVKANTMCANDFYEEQARMDGPCNHITVDNKDAFFQKLINEYGIRNIEMESLGFAAFCHNLGIRGMVIALILVDRLVSDFVSISLDEIKHHQRVVNEILMNYFKTQL 914
            LYH ++  +       FGDVK VC+GG  SRM+   +  G    +     D  +     DR++M+KV  ++ +SHGMGIPSISI L+E+ KLL++A  ++   IRIGT GG+GL PGT+V++E   D+      E  V G+ + +K  L+K  + E +    L     S+   V  NTMC  DFYE Q R+DG     T  +K A+ +      G+RNIEMES  FAA C   G++  V+ + L++RL  D +S   + +  +Q+    ++  + K +L
Sbjct:   34 LYHFNLTTSRHNFPALFGDVKFVCVGGSPSRMKAFIRCVGAELGLDCPGRDYPNICAGTDRYAMYKVGPVLSVSHGMGIPSISIMLHELIKLLYYARCSNVTIIRIGTSGGIGLEPGTVVITEQAVDTCFKAEFEQIVLGKRVIRKTDLNKKLVQELL----LCSAELSEFTTVVGNTMCTLDFYEGQGRLDGALCSYTEKDKQAYLEAAYAA-GVRNIEMESSVFAAMCSACGLQAAVVCVTLLNRLEGDQISSPRNVLSEYQQRPQRLVSYFIKKKL 307          
BLAST of Uridine phosphorylase vs. UniProt/SwissProt
Match: sp|P52624|UPP1_MOUSE (Uridine phosphorylase 1 OS=Mus musculus OX=10090 GN=Upp1 PE=1 SV=2)

HSP 1 Score: 167.162 bits (422), Expect = 3.879e-48
Identity = 91/279 (32.62%), Postives = 148/279 (53.05%), Query Frame = 3
Query:   78 LYHLDIYENPSYLQREFGDVKIVCMGGKASRMRELAKIWGKYCNIHNFENDLHDYSGAGDRFSMFKVYKIIFLSHGMGIPSISIALNEVTKLLHFAGVTDPLFIRIGTCGGLGLAPGTIVVSEYCYDSQLNDYQEIFVCGQSIKKKAILDKSCISEFINVSELFVGSESKVKIVKANTMCANDFYEEQARMDGPCNHITVDNKDAFFQKLINEYGIRNIEMESLGFAAFCHNLGIRGMVIALILVDRLVSDFVSISLDEIKHHQRVVNEILMNYFKTQL 914
            LYH ++  +       FGDVK VC+GG +SRM    K       + +   +  +     DR++M+K   ++ +SHGMGIPSI I L+E+ K+L+ A  ++   IRIGT GG+GL PG++V+++   +       E  V G+ + +   LD   + E +  S       ++  +V  NTMC  DFYE Q R+DG     T  +K ++  +  +  G+RNIEMES  FA  C   G++  V+ + L+DRL  D ++   D +  +Q+    ++ ++ K  L
Sbjct:   35 LYHFNLSTSTHDFPAMFGDVKFVCVGGSSSRMNTFIKYVAAELGLDHPGKEYPNICAGTDRYAMYKAGPVLSVSHGMGIPSIGIMLHELIKMLYHARCSNITIIRIGTSGGIGLEPGSVVITQQAVNECFKPEFEQIVLGKRVIRNTNLDAQLVQELVQCSSDL----NEFPMVVGNTMCTLDFYEGQGRLDGALCSYTEKDKQSYL-RAAHAAGVRNIEMESSVFATMCSACGLKAAVVCVTLLDRLQGDQINTPHDVLVEYQQRPQRLVGHFIKKSL 308          
BLAST of Uridine phosphorylase vs. UniProt/SwissProt
Match: sp|Q23588|UTPP_CAEEL (Uridine and thymidine phosphorylase OS=Caenorhabditis elegans OX=6239 GN=upp-1 PE=1 SV=2)

HSP 1 Score: 152.525 bits (384), Expect = 1.213e-42
Identity = 103/293 (35.15%), Postives = 156/293 (53.24%), Query Frame = 3
Query:   33 NKYLEAQINKDTIINLYHLDIYENPSYLQREFGDVKIVCMGGKASRMRELAKIWGKYCNIHNFENDLHDYSGAGDRFSMFKVYKIIFLSHGMGIPSISIALNEVTKLLHFAGVTDPLFIRIGTCGGLGLAPGTIVVSEYCYDSQLNDYQEIFVCGQSIKKKAILDKSCISEFINVSELFVGSESKVKIVKANTMCANDFYEEQARMDGPCNHITVDNKDAFFQKLINEYGIRNIEMESLGFAAFCHNLGIRGMVIALILVDRLVSDFVSISLDEIKHHQRVVNEILMNYFKTQ 911
            NKY + +  +D    LYH     +   +   FGD K VC GG   R +  A+ + K  NI   EN         DRF ++K   + +++HGMG PS+SI L E  KL+H AGV +P FIR+GT GG+G+ PGT+VVS    +++L D     + G+ I++   LD +            VG E  + +    TMCA+DFYE Q R+DG       ++K AF +KL N  G+RNIEMES  FA+F    G +  ++ + L++R+  D V I+ ++   ++     ++  Y + Q
Sbjct:   14 NKYFDIKDKRDF---LYHFGFGVDTLDIPAVFGDTKFVCTGGSPGRFKLYAEWFAKEANIPCSEN-----LSRSDRFVIYKTGPVCWINHGMGTPSLSIMLVESFKLMHHAGVKNPTFIRLGTSGGVGVPPGTVVVSTEAMNAELGDTYVQIIAGKRIERPTQLDAALREALCE-----VGKEKSIPVETGKTMCADDFYEGQMRLDGYFCDYEEEDKYAFLRKL-NALGVRNIEMESTCFASFTCRAGFQSAIVCVTLLNRMDGDQVQIAKEQYIEYEERPFRLVTAYIRKQ 292          
BLAST of Uridine phosphorylase vs. TrEMBL
Match: A0A0R3W9Z3 (PNP_UDP_1 domain-containing protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS7315 PE=4 SV=1)

HSP 1 Score: 239.965 bits (611), Expect = 4.555e-74
Identity = 124/280 (44.29%), Postives = 180/280 (64.29%), Query Frame = 3
Query:   78 LYHLDIYENPSYLQREFGDVKIVCMGGKASRMRELAKIWGKYCNIH-NFENDLHDYSGAGDRFSMFKVYKIIFLSHGMGIPSISIALNEVTKLLHFAGVTDPLFIRIGTCGGLGLAPGTIVVSEYCYDSQLNDYQEIFVCGQSIKKKAILDKSCISEFINVSELFVGSESKVKIVKANTMCANDFYEEQARMDGPCNHITVDNKDAFFQKLINEYGIRNIEMESLGFAAFCHNLGIRGMVIALILVDRLVSDFVSISLDEIKHHQRVVNEILMNYFKTQL 914
            LYH+ +  + + L+++FGDVK V MGG   RM+++A+I  K  +I       L + +   DR+ M+KV  I+ +SHGMGIPSISI L+E+ KLL+ AG  D  FIR+GTCGG+GL PG++V++  C D   NDY ++ + G+++++ A LD+  + E I  +E     +    +V   TMCA+DFYEEQ R+DG     T + K AF +K  +  G+RN+EMESLGFAAFC +L I+  VI + LV+RLVSD +S  +D +   Q    EIL+NY K Q+
Sbjct:   27 LYHVGLATDTTDLKKQFGDVKFVIMGGSPKRMKKIAEILLKALDIQLPCGTGLANIACTTDRYEMYKVGPILSVSHGMGIPSISILLHEMAKLLYHAGCQDVRFIRLGTCGGIGLEPGSVVITTSCLDCAFNDYFQLKILGKTVRRPAHLDELLVKELIETAE---SMKLDFTVVPGKTMCADDFYEEQGRLDGAICEYTAEEKMAFLKKAYDT-GVRNLEMESLGFAAFCQHLQIKAAVICVTLVNRLVSDQISTPVDVLHAWQERPLEILINYIKKQM 302          
BLAST of Uridine phosphorylase vs. TrEMBL
Match: A0A068Y5H2 (Uridine phosphorylase 1 OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000734400 PE=4 SV=1)

HSP 1 Score: 233.417 bits (594), Expect = 7.110e-71
Identity = 121/280 (43.21%), Postives = 178/280 (63.57%), Query Frame = 3
Query:   78 LYHLDIYENPSYLQREFGDVKIVCMGGKASRMRELAKIWGKYCNIH-NFENDLHDYSGAGDRFSMFKVYKIIFLSHGMGIPSISIALNEVTKLLHFAGVTDPLFIRIGTCGGLGLAPGTIVVSEYCYDSQLNDYQEIFVCGQSIKKKAILDKSCISEFINVSELFVGSESKVKIVKANTMCANDFYEEQARMDGPCNHITVDNKDAFFQKLINEYGIRNIEMESLGFAAFCHNLGIRGMVIALILVDRLVSDFVSISLDEIKHHQRVVNEILMNYFKTQL 914
            LYH+ +  + + L+++FGDVK V MGG   RM+++A+   K  ++       L + + A DR+ M+KV  I+ +SHGMG+PSISI L+E+ KLL+ AG  D  FIR+GTCGG+GL PG++V++  C D   NDY ++ + G+++++ A LD+  + E I  +E     +    +V   TMCA+DFYEEQ R+DG     T + K  F +K  +  G+RN EMESLGFAAFC +L I+  VI + LV+RLVSD +S  L+ +   Q    EIL+NY K Q+
Sbjct:   71 LYHVGLDTDTTDLKKQFGDVKFVIMGGSPKRMKKIAERLLKALDVQLPCGTGLANIACASDRYEMYKVGPILTVSHGMGVPSISILLHEMAKLLYHAGCQDVSFIRLGTCGGIGLEPGSVVITTSCLDCAFNDYFQLKILGKTVRRPAHLDEHLVKELIETAE---SMKPDFNVVAGKTMCADDFYEEQGRLDGAICEYTEEEKMVFLKKAYD-CGVRNFEMESLGFAAFCQHLKIKAAVICVTLVNRLVSDQISTPLEIMHAWQERPLEILINYIKNQI 346          
BLAST of Uridine phosphorylase vs. TrEMBL
Match: A0A068X2M1 (Uridine phosphorylase 1 OS=Echinococcus granulosus OX=6210 GN=EgrG_000734400 PE=4 SV=1)

HSP 1 Score: 232.646 bits (592), Expect = 1.220e-70
Identity = 121/280 (43.21%), Postives = 178/280 (63.57%), Query Frame = 3
Query:   78 LYHLDIYENPSYLQREFGDVKIVCMGGKASRMRELAKIWGKYCNIH-NFENDLHDYSGAGDRFSMFKVYKIIFLSHGMGIPSISIALNEVTKLLHFAGVTDPLFIRIGTCGGLGLAPGTIVVSEYCYDSQLNDYQEIFVCGQSIKKKAILDKSCISEFINVSELFVGSESKVKIVKANTMCANDFYEEQARMDGPCNHITVDNKDAFFQKLINEYGIRNIEMESLGFAAFCHNLGIRGMVIALILVDRLVSDFVSISLDEIKHHQRVVNEILMNYFKTQL 914
            LYH+ +  + + L+++FGDVK V MGG   RM+++A+   K  ++       L + + A DR+ M+KV  I+ +SHGMG+PSISI L+E+ KLL+ AG  D  FIR+GTCGG+GL PG++V++  C D   NDY ++ + G+++++ A LD+  + E I  +E     +    +V   TMCA+DFYEEQ R+DG     T + K  F +K  +  G+RN EMESLGFAAFC +L I+  VI + LV+RLVSD +S  L+ +   Q    EIL+NY K Q+
Sbjct:   71 LYHVGLDTDTTDLRKQFGDVKFVIMGGSPKRMKKIAERLLKALDVQLPCGTGLANIACASDRYEMYKVGPILSVSHGMGVPSISILLHEMAKLLYHAGCQDVSFIRLGTCGGIGLEPGSVVITTSCLDCAFNDYFQLKILGKTVRRPAHLDEHLVKELIETAE---SMKPDFNVVAGKTMCADDFYEEQGRLDGAICEYTEEEKMVFLKKAYD-CGVRNFEMESLGFAAFCQHLKIKAAVICVTLVNRLVSDQISTPLEIMHAWQERPLEILINYIKNQI 346          
BLAST of Uridine phosphorylase vs. TrEMBL
Match: A0A0X3PQD0 (Uridine phosphorylase 1 OS=Schistocephalus solidus OX=70667 GN=UPP1 PE=4 SV=1)

HSP 1 Score: 221.861 bits (564), Expect = 4.282e-67
Identity = 120/280 (42.86%), Postives = 172/280 (61.43%), Query Frame = 3
Query:   78 LYHLDIYENPSYLQREFGDVKIVCMGGKASRMRELA-KIWGKYCNIHNFENDLHDYSGAGDRFSMFKVYKIIFLSHGMGIPSISIALNEVTKLLHFAGVTDPLFIRIGTCGGLGLAPGTIVVSEYCYDSQLNDYQEIFVCGQSIKKKAILDKSCISEFINVSELFVGSESKVKIVKANTMCANDFYEEQARMDGPCNHITVDNKDAFFQKLINEYGIRNIEMESLGFAAFCHNLGIRGMVIALILVDRLVSDFVSISLDEIKHHQRVVNEILMNYFKTQL 914
            LYH  +  + + L++ FGDVK V MGG   RM+++A ++  ++         L + +GA DR+ ++KV  I+ +SHGMGIPSISI L+E+ KLL  AG  D +FIR+GTCGGLGL PG++VV+  C D    ++ ++ + G+S+++ A LD   + E I +S+      +   ++   TMCANDFYEEQ R+DG     + + K  F +K  +  G+RNIEMESLGFAAFC +LGIR  V+ + LVDRL SD +      I   Q    EIL+ Y K  L
Sbjct:   16 LYHFGLASDTNDLKKMFGDVKFVLMGGSPKRMKKIAERLLAEFKVELPCGTGLTNIAGATDRYELYKVGPILSVSHGMGIPSISILLHEMAKLLWHAGCEDVIFIRLGTCGGLGLEPGSVVVTTDCVDCCFENFLQLKILGKSVQRPARLDCQLVQELIEISKSIAHDYT---VIAGQTMCANDFYEEQGRLDGAICEYSKEEKLEFLKKAYS-LGVRNIEMESLGFAAFCQHLGIRAAVLCVTLVDRLKSDQIDAPHHVIHAWQERPLEILIAYLKKHL 291          
BLAST of Uridine phosphorylase vs. TrEMBL
Match: A0A0R3X5C7 (PNP_UDP_1 domain-containing protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS8648 PE=4 SV=1)

HSP 1 Score: 223.016 bits (567), Expect = 4.457e-67
Identity = 123/306 (40.20%), Postives = 179/306 (58.50%), Query Frame = 3
Query:   78 LYHLDIYENPSYLQREFGDVKIVCMGGKASRMRELAKIWGKYCNIH-NFENDLHDYSGAGDRFSMFKVYKIIFLSHGMGIPSISIALNEVTKLLHFAGVTDPLFIRIGTCGGLGLAPGTIVVSEYCYDSQLNDYQEIF--------------------------VCGQSIKKKAILDKSCISEFINVSELFVGSESKVKIVKANTMCANDFYEEQARMDGPCNHITVDNKDAFFQKLINEYGIRNIEMESLGFAAFCHNLGIRGMVIALILVDRLVSDFVSISLDEIKHHQRVVNEILMNYFKTQL 914
            LYH+ +  + + L+++FGDVK V MGG   RM+++A+I  K  +I       L + +   DR+ M+KV  I+ +SHGMGIPSISI L+E+ KLL+ AG  D  FIR+GTCGG+GL PG++V++  C D   NDY ++                           + G+++++ A LD+  + E I  +      +    +V   TMCA+DFYEEQ R+DG     T + K AF +K  +  G+RN+EMESLGFAAFC +L I+  VI + LV+RLVSD +S  +D +   Q    EIL+NY K Q+
Sbjct:   20 LYHVGLATDTTDLKKQFGDVKFVIMGGSPKRMKKIAEILLKELDIQLPCGTGLANIACTTDRYEMYKVGPILSVSHGMGIPSISILLHEMAKLLYHAGCQDVRFIRLGTCGGIGLEPGSVVITTSCLDCAFNDYFQLVRFASFVFFVGSHLLHFLTVMSILLQKILGKTVRRPAHLDEHFVKELIETAR---SMKLDFNVVSGKTMCADDFYEEQGRLDGAICEYTEEEKMAFLKKAYDS-GVRNLEMESLGFAAFCQHLKIKAAVICVTLVNRLVSDQISTPVDVLHAWQERPLEILINYIKKQM 321          
BLAST of Uridine phosphorylase vs. Ensembl Cavefish
Match: upp2 (uridine phosphorylase 2 [Source:NCBI gene;Acc:103025624])

HSP 1 Score: 186.037 bits (471), Expect = 2.301e-56
Identity = 107/296 (36.15%), Postives = 164/296 (55.41%), Query Frame = 3
Query:   27 IRNKYLEAQINKDTIINLYHLDIYENPSYLQREFGDVKIVCMGGKASRMRELAKIWGKYCNIHNFENDLHDYSGAGDRFSMFKVYKIIFLSHGMGIPSISIALNEVTKLLHFAGVTDPLFIRIGTCGGLGLAPGTIVVSEYCYDSQLNDYQEIFVCGQSIKKKAILDKSCISEFINVSELFVGSESKVKIVKANTMCANDFYEEQARMDGPCNHITVDNKDAFFQKLINEYGIRNIEMESLGFAAFCHNLGIRGMVIALILVDRLVSDFVSISLDEIKHHQRVVNEILMNYFKTQL 914
            ++N +L++ + +D    LYH ++      L   FGD+K VC+GG A+RMR  A+   +   +    +D+ D     DR+SM+KV  ++ +SHGMG+PSISI L+E+ KLL+ A   D +  RIGT GG+GLAPGT+V+++   DS      E  V G+ I +   LD+    E +  S    G  +    V  NTMC +DFYE Q R+DG     + + K  + +K  +E G+RNIEMES  FAA C    ++  VI + L++R   D +S   D +  +Q     ++ ++ K  L
Sbjct:   23 VKNPHLDS-MEEDI---LYHFNLGTKTHNLPAMFGDIKFVCVGGSANRMRTFAQFIHQELELPGNVDDIRDICEETDRYSMYKVGPVLSISHGMGVPSISIMLHELIKLLYHARCRDVVLFRIGTSGGIGLAPGTVVITDKAVDSFFRPQFEQVVLGKVIIRSTELDEEVARELLQCSAELSGFPT----VIGNTMCTHDFYEGQGRLDGALCSFSTEEKLEYLRK-AHEAGVRNIEMESTVFAAMCRVCNLKAAVICVTLLNRFEGDQISTPHDVLVEYQSRPQCLVAHFIKKHL 309          
BLAST of Uridine phosphorylase vs. Ensembl Cavefish
Match: upp1 (uridine phosphorylase 1-like [Source:NCBI gene;Acc:103041301])

HSP 1 Score: 168.703 bits (426), Expect = 1.273e-49
Identity = 108/297 (36.36%), Postives = 163/297 (54.88%), Query Frame = 3
Query:   27 IRNKYLEAQINKDTIINLYHLDIYENPSYLQREFGDVKIVCMGGKASRMRELAKIWGKYCNIHNFENDLHDYSGAGDRFSMFKVYKIIFLSHGMGIPSISIALNEVTKLLHFAGVTDPLFIRIGTCGGLGLAPGTIVVSEYCYDSQLNDYQEIFVCGQSIKKKAILDKSCISEFINVSELFVGSE-SKVKIVKANTMCANDFYEEQARMDGPCNHITVDNKDAFFQKLINEYGIRNIEMESLGFAAFCHNLGIRGMVIALILVDRLVSDFVSISLDEIKHHQRVVNEILMNYFKTQL 914
            + N +LE+   K+ I  LYH ++      LQ +FGDVK VC+GG   RM+   +       + + + +  +     DR++M+KV  ++ +SHGMGIPSISI L+E+ KLL+ A  TD   +RIGT GG+GL PGT+VV++   DS      E  V G     K ++  + + E +    L  G E  + + V  NTMC  DFYE QAR+DG     T ++K  +  +     G+RNIEMES  FAA C    +R  V+ + L+DR   D ++ S D +  +Q+    ++ +Y K +L
Sbjct:   18 VNNPHLESM--KEDI--LYHFNLGTTSHDLQAQFGDVKFVCVGGSPWRMKSFIEYIAGELGLADPKAEYPNICEGTDRYAMYKVGPVLSVSHGMGIPSISIMLHELIKLLYHARCTDVTVVRIGTSGGIGLQPGTVVVTKQSVDSAFLPRFEQVVLG-----KPVVRSTELDEELAEELLQCGKELPEFQTVIGNTMCTLDFYEGQARLDGAFCSYTEEDKQNYLAEAYAA-GVRNIEMESSVFAAMCKLSNLRAAVVCVTLLDRQKGDQMTSSHDVMHSYQQRPQLLVGHYIKKKL 304          
BLAST of Uridine phosphorylase vs. Ensembl Cavefish
Match: upp1 (uridine phosphorylase 1-like [Source:NCBI gene;Acc:103041301])

HSP 1 Score: 168.703 bits (426), Expect = 1.273e-49
Identity = 108/297 (36.36%), Postives = 163/297 (54.88%), Query Frame = 3
Query:   27 IRNKYLEAQINKDTIINLYHLDIYENPSYLQREFGDVKIVCMGGKASRMRELAKIWGKYCNIHNFENDLHDYSGAGDRFSMFKVYKIIFLSHGMGIPSISIALNEVTKLLHFAGVTDPLFIRIGTCGGLGLAPGTIVVSEYCYDSQLNDYQEIFVCGQSIKKKAILDKSCISEFINVSELFVGSE-SKVKIVKANTMCANDFYEEQARMDGPCNHITVDNKDAFFQKLINEYGIRNIEMESLGFAAFCHNLGIRGMVIALILVDRLVSDFVSISLDEIKHHQRVVNEILMNYFKTQL 914
            + N +LE+   K+ I  LYH ++      LQ +FGDVK VC+GG   RM+   +       + + + +  +     DR++M+KV  ++ +SHGMGIPSISI L+E+ KLL+ A  TD   +RIGT GG+GL PGT+VV++   DS      E  V G     K ++  + + E +    L  G E  + + V  NTMC  DFYE QAR+DG     T ++K  +  +     G+RNIEMES  FAA C    +R  V+ + L+DR   D ++ S D +  +Q+    ++ +Y K +L
Sbjct:   18 VNNPHLESM--KEDI--LYHFNLGTTSHDLQAQFGDVKFVCVGGSPWRMKSFIEYIAGELGLADPKAEYPNICEGTDRYAMYKVGPVLSVSHGMGIPSISIMLHELIKLLYHARCTDVTVVRIGTSGGIGLQPGTVVVTKQSVDSAFLPRFEQVVLG-----KPVVRSTELDEELAEELLQCGKELPEFQTVIGNTMCTLDFYEGQARLDGAFCSYTEEDKQNYLAEAYAA-GVRNIEMESSVFAAMCKLSNLRAAVVCVTLLDRQKGDQMTSSHDVMHSYQQRPQLLVGHYIKKKL 304          
BLAST of Uridine phosphorylase vs. Ensembl Cavefish
Match: ENSAMXT00000048355.1 (pep primary_assembly:Astyanax_mexicanus-2.0:19:25864867:25870015:1 gene:ENSAMXG00000036087.1 transcript:ENSAMXT00000048355.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 115.161 bits (287), Expect = 4.693e-30
Identity = 76/221 (34.39%), Postives = 115/221 (52.04%), Query Frame = 3
Query:  255 DRFSMFKVYKIIFLSHGMGIPSISIALNEVTK-LLHFAGVTDPLFIRIGTCGGLGLAPGTIVVSEYCYDSQLNDYQEIFVCGQSIKKKAILDKSCISEFINVSELFVGSESKVKIVKANTMCANDFYEEQARMDGPCNHITVDNKDAFFQKLINEYGIRNIEMESLGFAAFCHNLGIRGMVIALILVDRLVSDFVSISLDEIKHHQRVVNEILMNYFKTQL 914
            D    +KV  ++ +SHGMG   +SI L+E+ K LL   G  D +  RIGT GG+GLAPGT+V+++   DS      E     Q + ++A    +C +E            S    V  NTMC +DFYE Q R+DG     + + K  + +K  +E G+RNIEMES  FAA C    ++  VI + L++R   D +S   D +  +Q     ++ ++ K +L
Sbjct:   33 DPLLHYKVRPVLSISHGMGC-LLSIMLHELIKWLLPTPGCRDVVLFRIGTSGGIGLAPGTVVITDKAVDSFFRPQFE-----QVVLERA---PACSAEL-----------SGFPTVIGNTMCTHDFYEGQGRLDGALCSFSTEEKLEYLRK-AHEAGVRNIEMESTVFAAMCRVCNLKAAVICVTLLNRFEGDQISTPHDVLVEYQSRPQCLVAHFIKKRL 232          
BLAST of Uridine phosphorylase vs. Ensembl Cavefish
Match: ENSAMXT00000043816.1 (pep primary_assembly:Astyanax_mexicanus-2.0:19:25865556:25870015:1 gene:ENSAMXG00000036087.1 transcript:ENSAMXT00000043816.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 113.62 bits (283), Expect = 8.920e-30
Identity = 78/231 (33.77%), Postives = 116/231 (50.22%), Query Frame = 3
Query:  225 NDLHDYSGAGDRFSMFKVYKIIFLSHGMGIPSISIALNEVTK-LLHFAGVTDPLFIRIGTCGGLGLAPGTIVVSEYCYDSQLNDYQEIFVCGQSIKKKAILDKSCISEFINVSELFVGSESKVKIVKANTMCANDFYEEQARMDGPCNHITVDNKDAFFQKLINEYGIRNIEMESLGFAAFCHNLGIRGMVIALILVDRLVSDFVSISLDEIKHHQRVVNEILMNYFKTQL 914
            +D+ D     D    +KV  ++ +SHGMG   +SI L+E+ K LL   G  D +  RIGT GG+GLAPGT+V+++   DS      E            +LD+          EL     S    V  NTMC +DFYE Q R+DG     + + K  + +K  +E G+RNIEMES  FAA C    ++  VI + L++R   D +S   D +  +Q     ++ ++ K +L
Sbjct:    1 DDIRDICEETDPLLHYKVRPVLSISHGMGC-LLSIMLHELIKWLLPTPGCRDVVLFRIGTSGGIGLAPGTVVITDKAVDSFFRPQFE-----------QVLDE----------EL-----SGFPTVIGNTMCTHDFYEGQGRLDGALCSFSTEEKLEYLRK-AHEAGVRNIEMESTVFAAMCRVCNLKAAVICVTLLNRFEGDQISTPHDVLVEYQSRPQCLVAHFIKKRL 203          
BLAST of Uridine phosphorylase vs. Ensembl Sea Lamprey
Match: upp1 (uridine phosphorylase 1 [Source:ZFIN;Acc:ZDB-GENE-050306-2])

HSP 1 Score: 173.711 bits (439), Expect = 3.788e-52
Identity = 101/279 (36.20%), Postives = 145/279 (51.97%), Query Frame = 3
Query:   78 LYHLDIYENPSYLQREFGDVKIVCMGGKASRMRELAKIWGKYCNIHNFENDLHDYSGAGDRFSMFKVYKIIFLSHGMGIPSISIALNEVTKLLHFAGVTDPLFIRIGTCGGLGLAPGTIVVSEYCYDSQLNDYQEIFVCGQSIKKKAILDKSCISEFINVSELFVGSESKVKIVKANTMCANDFYEEQARMDGPCNHITVDNKDAFFQKLINEYGIRNIEMESLGFAAFCHNLGIRGMVIALILVDRLVSDFVSISLDEIKHHQRVVNEILMNYFKTQL 914
            LYHL +      L   FGDVK VC+GG A RM   A+   K   + +  +   +   A DR+ M+KV  ++ +SHGMG+PSI I L+E+ KLL  A   +    RIGT GG+GL PG++VVS    D Q        V G+ + + + LD     E +  +E F     +   +  +TMC NDFYE Q R+DG     T   K  + ++  +  G+RNIEMES  FAA C   GIR  V+ + L++RL  D +S     +  +Q     ++  Y + QL
Sbjct:   38 LYHLGLATKSHDLPAMFGDVKFVCVGGSAWRMLAFARYIAKELELPDQGDGPTNLCEATDRYCMYKVGPVLSVSHGMGVPSIGIMLHELIKLLFHAKSRNVRIFRIGTSGGIGLEPGSVVVSRTAVDEQFRPEFRQVVLGEVVTRDSELDTELAHELLQCAEDFA---DEFPTIVGDTMCTNDFYEGQGRLDGALCCYTSAQKLEYLKRAYSA-GVRNIEMESSIFAAMCKLCGIRAAVVCVTLLNRLEGDQISSPHAVLSDYQERPQRLVSRYIRKQL 312          
BLAST of Uridine phosphorylase vs. Ensembl Nematostella
Match: EDO43586 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RY71])

HSP 1 Score: 172.555 bits (436), Expect = 1.361e-51
Identity = 107/298 (35.91%), Postives = 157/298 (52.68%), Query Frame = 3
Query:   27 IRNKYLEAQINKDTIINLYHLDIYENPSYLQREFGDVKIVCMGGKASRMRELAKIWGKYCNIHNFENDLHDYS--GAGDRFSMFKVYKIIFLSHGMGIPSISIALNEVTKLLHFAGVTDPLFIRIGTCGGLGLAPGTIVVSEYCYDSQLNDYQEIFVCGQSIKKKAILDKSCISEFINVSELFVGSESKVKIVKANTMCANDFYEEQARMDGPCNHITVDNKDAFFQKLINEYGIRNIEMESLGFAAFCHNLGIRGMVIALILVDRLVSDFVSISLDEIKHHQRVVNEILMNYFKTQL 914
            ++N +L A +  D    L+H+ I    S L + FGDVK VCMGG  +RMR+ AK   +    +   +D  D       DR+ ++KV  ++ ++HG+GIPS+ + L+E  KLLH AG     F R GT GGLGL  GT+V++    ++ L  Y E  + G+  K  A LD     + +  S+    +E K       TMC NDFYE Q R+DG     T+++K  F  K  +  G+RNIEMES+ FAA C    +   ++ + L+DRL  D V ++  E +  Q     I+  Y K  L
Sbjct:    6 VKNPHL-ASLEDDM---LFHIGI-SGSSELSKTFGDVKFVCMGGSTNRMRQFAKYLKQQLKPYLEISDDEDPKNLSTSDRYVLYKVGPVLAINHGIGIPSLMVILHETLKLLHHAGAEGVSFFRTGTSGGLGLKAGTVVLTTTAMNALLEPYHEQVILGKVTKFPASLDDKLKEDLMQCSDGIPTAEGK-------TMCTNDFYEGQGRLDGAFCEYTLNDKLDFLNKAYS-LGVRNIEMESVCFAAMCKRACVPAAILCVTLLDRLNGDQVHLTPAEHEEFQARPQRIVTAYIKKYL 290          
BLAST of Uridine phosphorylase vs. Ensembl Medaka
Match: upp2 (uridine phosphorylase 2 [Source:NCBI gene;Acc:101174143])

HSP 1 Score: 182.956 bits (463), Expect = 4.590e-55
Identity = 108/293 (36.86%), Postives = 162/293 (55.29%), Query Frame = 3
Query:   27 IRNKYLEAQINKDTIINLYHLDIYENPSYLQREFGDVKIVCMGGKASRMRELAKIWGKYCNIHNFENDLHDYSGAGDRFSMFKVYKIIFLSHGMGIPSISIALNEVTKLLHFAGVTDPLFIRIGTCGGLGLAPGTIVVSEYCYDSQLNDYQEIFVCGQSIKKKAILDKSCISEFIN-VSELFVGSESKVKIVKANTMCANDFYEEQARMDGPCNHITVDNKDAFFQKLINEYGIRNIEMESLGFAAFCHNLGIRGMVIALILVDRLVSDFVSISLDEIKHHQRVVNEILMNYF 902
            ++N YL+  + +D    LYH  +      L   FGD+K VC+GG A+RM+  A    +  +I    +D+ D     DR+SM+KV  ++ +SHGMG+PSISI L+E+ KLLH A   D +  R+GT GG+GL PGT+V+++   D       E  V G+ I +   LD+   SE +   SEL          V   TMC +DFYE Q R+DG     + + K  + +K   E G+RNIEMES  FAA C   G++  V+ + L++R   D ++ S + +  +Q+   +IL+ YF
Sbjct:   23 VKNPYLDT-MEEDI---LYHFSLSTKTHNLPEMFGDIKFVCVGGSANRMKAFAHFIHQDLHIPGNPDDIRDICEGTDRYSMYKVGPVLSISHGMGVPSISIMLHELIKLLHHARCQDVVLFRLGTSGGVGLNPGTVVITDKAVDYSFCPQFEQVVLGKVITRSTELDEEVASELLQYASEL-----QSFPTVIGKTMCTHDFYEGQGRLDGALCSFSHEEKLEYLRKAY-EAGVRNIEMESTVFAAMCRVCGLKAAVVCVTLLNRFEGDQITSSHEVLVEYQQ-RPQILVAYF 304          
BLAST of Uridine phosphorylase vs. Ensembl Medaka
Match: upp1 (uridine phosphorylase 1 [Source:NCBI gene;Acc:101163602])

HSP 1 Score: 173.326 bits (438), Expect = 2.115e-51
Identity = 104/297 (35.02%), Postives = 162/297 (54.55%), Query Frame = 3
Query:   27 IRNKYLEAQINKDTIINLYHLDIYENPSYLQREFGDVKIVCMGGKASRMRELAKIWGKYCNIHNFENDLHDYSGAGDRFSMFKVYKIIFLSHGMGIPSISIALNEVTKLLHFAGVTDPLFIRIGTCGGLGLAPGTIVVSEYCYDSQLNDYQEIFVCGQSIKKKAILDKSCISEFINVSELFVGSESKVKIVKANTMCANDFYEEQARMDGP-CNHITVDNKDAFFQKLINEYGIRNIEMESLGFAAFCHNLGIRGMVIALILVDRLVSDFVSISLDEIKHHQRVVNEILMNYFKTQL 914
            + N +L++   KD I  LYH  +      L   FGDVK VC+GG   RM+   +       + + +++  +     DR++M+KV  ++ +SHGMGIPSI+I L+E+ KLL+ A   D   IRIGT GG+GL PGT+VV++   D+      E  + G+++ +   LD++   E +  S+       + + V  NTMC  DFYE QAR+DG  C++   D +D   +    E G+ NIEMES  F+A C   G+R  V+ + L+DRL  D +  S + +   Q+    ++  + K QL
Sbjct:   18 VHNPHLDSL--KDDI--LYHFSLGTETHDLPAMFGDVKFVCVGGSPWRMKAFIEYIAAELEMEDPKSEYPNICAGTDRYAMYKVGPVLSVSHGMGIPSIAIMLHELIKLLYHAQCKDVTIIRIGTSGGIGLEPGTVVVTKQSVDATFQPKFEQVILGKTVVRNTDLDQNLAEELLQCSKEL----DQFETVIGNTMCTLDFYEGQARLDGAFCSYSEKDKQDYLIKA--REAGVCNIEMESSVFSAMCKLSGLRAAVVCVTLLDRLKGDQLMSSHEVLNSFQKRPQILVGCFIKKQL 304          
BLAST of Uridine phosphorylase vs. Planmine SMEST
Match: SMESG000074532.1 (SMESG000074532.1)

HSP 1 Score: 615.15 bits (1585), Expect = 0.000e+0
Identity = 298/298 (100.00%), Postives = 298/298 (100.00%), Query Frame = 3
Query:   24 MIRNKYLEAQINKDTIINLYHLDIYENPSYLQREFGDVKIVCMGGKASRMRELAKIWGKYCNIHNFENDLHDYSGAGDRFSMFKVYKIIFLSHGMGIPSISIALNEVTKLLHFAGVTDPLFIRIGTCGGLGLAPGTIVVSEYCYDSQLNDYQEIFVCGQSIKKKAILDKSCISEFINVSELFVGSESKVKIVKANTMCANDFYEEQARMDGPCNHITVDNKDAFFQKLINEYGIRNIEMESLGFAAFCHNLGIRGMVIALILVDRLVSDFVSISLDEIKHHQRVVNEILMNYFKTQLE 917
            MIRNKYLEAQINKDTIINLYHLDIYENPSYLQREFGDVKIVCMGGKASRMRELAKIWGKYCNIHNFENDLHDYSGAGDRFSMFKVYKIIFLSHGMGIPSISIALNEVTKLLHFAGVTDPLFIRIGTCGGLGLAPGTIVVSEYCYDSQLNDYQEIFVCGQSIKKKAILDKSCISEFINVSELFVGSESKVKIVKANTMCANDFYEEQARMDGPCNHITVDNKDAFFQKLINEYGIRNIEMESLGFAAFCHNLGIRGMVIALILVDRLVSDFVSISLDEIKHHQRVVNEILMNYFKTQLE
Sbjct:    1 MIRNKYLEAQINKDTIINLYHLDIYENPSYLQREFGDVKIVCMGGKASRMRELAKIWGKYCNIHNFENDLHDYSGAGDRFSMFKVYKIIFLSHGMGIPSISIALNEVTKLLHFAGVTDPLFIRIGTCGGLGLAPGTIVVSEYCYDSQLNDYQEIFVCGQSIKKKAILDKSCISEFINVSELFVGSESKVKIVKANTMCANDFYEEQARMDGPCNHITVDNKDAFFQKLINEYGIRNIEMESLGFAAFCHNLGIRGMVIALILVDRLVSDFVSISLDEIKHHQRVVNEILMNYFKTQLE 298          
The following BLAST results are available for this feature:
BLAST of Uridine phosphorylase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
UPP24.013e-5636.12uridine phosphorylase 2 [Source:HGNC Symbol;Acc:HG... [more]
UPP21.354e-5536.12uridine phosphorylase 2 [Source:HGNC Symbol;Acc:HG... [more]
UPP11.600e-5436.20uridine phosphorylase 1 [Source:HGNC Symbol;Acc:HG... [more]
UPP11.600e-5436.20uridine phosphorylase 1 [Source:HGNC Symbol;Acc:HG... [more]
UPP11.414e-2241.59uridine phosphorylase 1 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Uridine phosphorylase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
upp-19.533e-4435.15Uridine and thymidine phosphorylase [Source:UniPr... [more]
back to top
BLAST of Uridine phosphorylase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG37887.249e-5737.50gene:FBgn0034800 transcript:FBtr0071995[more]
CG37887.249e-5737.50gene:FBgn0034800 transcript:FBtr0303465[more]
CG63308.230e-5638.04gene:FBgn0039464 transcript:FBtr0085084[more]
CG172241.082e-5535.92gene:FBgn0031489 transcript:FBtr0077671[more]
CG172241.082e-5535.92gene:FBgn0031489 transcript:FBtr0300815[more]
back to top
BLAST of Uridine phosphorylase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
upp25.165e-5637.28uridine phosphorylase 2 [Source:ZFIN;Acc:ZDB-GENE-... [more]
upp12.022e-3736.36uridine phosphorylase 1 [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of Uridine phosphorylase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
upp21.336e-5535.45uridine phosphorylase 2 [Source:NCBI gene;Acc:4935... [more]
upp11.639e-5336.56uridine phosphorylase 1 [Source:NCBI gene;Acc:4965... [more]
back to top
BLAST of Uridine phosphorylase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Upp21.243e-5937.50uridine phosphorylase 2 [Source:MGI Symbol;Acc:MGI... [more]
Upp22.176e-5937.50uridine phosphorylase 2 [Source:MGI Symbol;Acc:MGI... [more]
Upp21.660e-5837.99uridine phosphorylase 2 [Source:MGI Symbol;Acc:MGI... [more]
Upp21.104e-5038.58uridine phosphorylase 2 [Source:MGI Symbol;Acc:MGI... [more]
Upp21.417e-4938.34uridine phosphorylase 2 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of Uridine phosphorylase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8CGR7|UPP2_MOUSE8.696e-5937.50Uridine phosphorylase 2 OS=Mus musculus OX=10090 G... [more]
sp|O95045|UPP2_HUMAN1.927e-5536.12Uridine phosphorylase 2 OS=Homo sapiens OX=9606 GN... [more]
sp|Q16831|UPP1_HUMAN7.685e-5436.20Uridine phosphorylase 1 OS=Homo sapiens OX=9606 GN... [more]
sp|P52624|UPP1_MOUSE3.879e-4832.62Uridine phosphorylase 1 OS=Mus musculus OX=10090 G... [more]
sp|Q23588|UTPP_CAEEL1.213e-4235.15Uridine and thymidine phosphorylase OS=Caenorhabdi... [more]
back to top
BLAST of Uridine phosphorylase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3W9Z34.555e-7444.29PNP_UDP_1 domain-containing protein OS=Taenia asia... [more]
A0A068Y5H27.110e-7143.21Uridine phosphorylase 1 OS=Echinococcus multilocul... [more]
A0A068X2M11.220e-7043.21Uridine phosphorylase 1 OS=Echinococcus granulosus... [more]
A0A0X3PQD04.282e-6742.86Uridine phosphorylase 1 OS=Schistocephalus solidus... [more]
A0A0R3X5C74.457e-6740.20PNP_UDP_1 domain-containing protein OS=Hydatigena ... [more]
back to top
BLAST of Uridine phosphorylase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
upp22.301e-5636.15uridine phosphorylase 2 [Source:NCBI gene;Acc:1030... [more]
upp11.273e-4936.36uridine phosphorylase 1-like [Source:NCBI gene;Acc... [more]
upp11.273e-4936.36uridine phosphorylase 1-like [Source:NCBI gene;Acc... [more]
ENSAMXT00000048355.14.693e-3034.39pep primary_assembly:Astyanax_mexicanus-2.0:19:258... [more]
ENSAMXT00000043816.18.920e-3033.77pep primary_assembly:Astyanax_mexicanus-2.0:19:258... [more]
back to top
BLAST of Uridine phosphorylase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
upp13.788e-5236.20uridine phosphorylase 1 [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of Uridine phosphorylase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Uridine phosphorylase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO435861.361e-5135.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Uridine phosphorylase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
upp24.590e-5536.86uridine phosphorylase 2 [Source:NCBI gene;Acc:1011... [more]
upp12.115e-5135.02uridine phosphorylase 1 [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of Uridine phosphorylase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000074532.10.000e+0100.00SMESG000074532.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019099 ID=SMED30019099|Name=Uridine phosphorylase|organism=Schmidtea mediterranea sexual|type=transcript|length=996bp
TTTAGACATCTTTTATATTTGACATGATTAGAAATAAGTATTTAGAAGCG
CAAATTAACAAAGATACTATCATTAACTTATATCATTTAGATATTTATGA
AAACCCATCTTACTTACAAAGGGAATTTGGAGATGTTAAAATAGTTTGTA
TGGGAGGGAAGGCCAGTAGAATGAGAGAATTAGCAAAAATATGGGGAAAA
TATTGCAATATTCACAACTTTGAAAATGATTTGCATGATTATTCAGGAGC
TGGCGATCGTTTTTCTATGTTCAAAGTCTACAAAATCATATTTTTGAGTC
ATGGAATGGGAATTCCTTCTATATCAATTGCGTTGAATGAAGTGACGAAA
TTATTACATTTTGCTGGAGTGACAGATCCATTATTTATTCGGATTGGTAC
ATGCGGTGGATTAGGTCTTGCCCCAGGAACAATTGTAGTGTCTGAATATT
GCTACGATTCACAACTGAATGATTACCAGGAAATATTTGTATGTGGACAG
TCGATTAAAAAGAAAGCAATTTTGGATAAATCTTGTATATCTGAATTTAT
AAACGTATCGGAACTATTTGTTGGATCTGAGAGCAAAGTAAAAATCGTGA
AAGCTAATACAATGTGTGCCAATGATTTTTATGAGGAACAAGCGAGAATG
GACGGGCCTTGTAATCATATTACGGTTGATAATAAAGACGCCTTTTTTCA
AAAGTTAATAAATGAATATGGAATACGAAATATAGAAATGGAATCTTTAG
GCTTTGCGGCATTTTGCCACAATTTAGGTATTAGAGGCATGGTAATCGCT
CTGATTTTGGTTGACCGATTGGTTTCCGATTTTGTGTCGATTTCACTTGA
TGAGATTAAACACCATCAAAGAGTTGTAAATGAAATTTTGATGAATTATT
TTAAAACACAACTTGAATAGATATTTTGCATAAACATTTTGATTTAATTT
TGATTAATTTTTGCTAATAAATTGTTTACTCGTTATGAAAAAGATC
back to top

protein sequence of SMED30019099-orf-1

>SMED30019099-orf-1 ID=SMED30019099-orf-1|Name=SMED30019099-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=299bp
MIRNKYLEAQINKDTIINLYHLDIYENPSYLQREFGDVKIVCMGGKASRM
RELAKIWGKYCNIHNFENDLHDYSGAGDRFSMFKVYKIIFLSHGMGIPSI
SIALNEVTKLLHFAGVTDPLFIRIGTCGGLGLAPGTIVVSEYCYDSQLND
YQEIFVCGQSIKKKAILDKSCISEFINVSELFVGSESKVKIVKANTMCAN
DFYEEQARMDGPCNHITVDNKDAFFQKLINEYGIRNIEMESLGFAAFCHN
LGIRGMVIALILVDRLVSDFVSISLDEIKHHQRVVNEILMNYFKTQLE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
Vocabulary: INTERPRO
TermDefinition
IPR035994Nucleoside_phosphorylase_sf
IPR010059Uridine_phosphorylase_euk
IPR000845Nucleoside_phosphorylase_d
Vocabulary: molecular function
TermDefinition
GO:0003824catalytic activity
GO:0004850uridine phosphorylase activity
Vocabulary: biological process
TermDefinition
GO:0009116nucleoside metabolic process
GO:0009166nucleotide catabolic process
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000845Nucleoside phosphorylase domainPFAMPF01048PNP_UDP_1coord: 39..263
e-value: 9.8E-22
score: 77.3
IPR035994Nucleoside phosphorylase superfamilyGENE3DG3DSA:3.40.50.1580coord: 2..298
e-value: 1.4E-79
score: 269.2
IPR035994Nucleoside phosphorylase superfamilySUPERFAMILYSSF53167Purine and uridine phosphorylasescoord: 30..273
IPR010059Uridine phosphorylase, eukaryoticTIGRFAMTIGR01719TIGR01719coord: 18..297
e-value: 3.7E-83
score: 277.0
NoneNo IPR availablePANTHERPTHR43691:SF3FI09636P-RELATEDcoord: 4..297
NoneNo IPR availablePANTHERPTHR43691FAMILY NOT NAMEDcoord: 4..297
NoneNo IPR availableCDDcd17763UP_hUPP-likecoord: 19..285
e-value: 4.54488E-107
score: 310.619