SOXP-1

Overview
NameSOXP-1 (AFD29619.1)
Smed IDSMED30019097
Uniprot Best hitTranscription factor SOX-13 OS=Homo sapiens GN=SOX13 PE=1 SV=3 (E=5.41384e-13)
Length (bp)1596
Neoblast Clusters

Zeng et. al., 2018


▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SOXP-1 (SMED30019097) t-SNE clustered cells

Violin plots show distribution of expression levels for SOXP-1 (SMED30019097) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SOXP-1 (SMED30019097) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SOXP-1 (SMED30019097) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017


Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

Download CSV of Expression Data

 

back to top

Expression Details

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm
Homology
BLAST of SOXP-1 vs. Ensembl Human
Match: SOX13 (SRY-box 13 [Source:HGNC Symbol;Acc:HGNC:11192])

HSP 1 Score: 75.0998 bits (183), Expect = 1.054e-13
Identity = 33/71 (46.48%), Postives = 48/71 (67.61%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            +N FM++++  RR IL  FPD  NS +SK LG  WK +TN+ K  Y EE  RL++ H  ++PDYKY+P+ +
Sbjct:  428 MNAFMVWAKDERRKILQAFPDMHNSSISKILGSRWKSMTNQEKQPYYEEQARLSRQHLEKYPDYKYKPRPK 498          
BLAST of SOXP-1 vs. Ensembl Human
Match: SOX13 (SRY-box 13 [Source:HGNC Symbol;Acc:HGNC:11192])

HSP 1 Score: 75.0998 bits (183), Expect = 1.054e-13
Identity = 33/71 (46.48%), Postives = 48/71 (67.61%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            +N FM++++  RR IL  FPD  NS +SK LG  WK +TN+ K  Y EE  RL++ H  ++PDYKY+P+ +
Sbjct:  428 MNAFMVWAKDERRKILQAFPDMHNSSISKILGSRWKSMTNQEKQPYYEEQARLSRQHLEKYPDYKYKPRPK 498          
BLAST of SOXP-1 vs. Ensembl Human
Match: SOX5 (SRY-box 5 [Source:HGNC Symbol;Acc:HGNC:11201])

HSP 1 Score: 73.559 bits (179), Expect = 2.151e-13
Identity = 33/71 (46.48%), Postives = 47/71 (66.20%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            +N FM++++  RR IL  FPD  NS +SK LG  WK +TN  K  Y EE  RL++ H  ++PDYKY+P+ +
Sbjct:  174 MNAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKAMTNLEKQPYYEEQARLSKQHLEKYPDYKYKPRPK 244          
BLAST of SOXP-1 vs. Ensembl Human
Match: SOX6 (SRY-box 6 [Source:HGNC Symbol;Acc:HGNC:16421])

HSP 1 Score: 73.9442 bits (180), Expect = 3.423e-13
Identity = 31/71 (43.66%), Postives = 49/71 (69.01%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            +N FM++++  RR IL  FPD  NS +SK LG  WK ++N+ K  Y EE  RL+++H  ++P+YKY+P+ +
Sbjct:  601 MNAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKSMSNQEKQPYYEEQARLSKIHLEKYPNYKYKPRPK 671          
BLAST of SOXP-1 vs. Ensembl Human
Match: SOX6 (SRY-box 6 [Source:HGNC Symbol;Acc:HGNC:16421])

HSP 1 Score: 73.9442 bits (180), Expect = 3.446e-13
Identity = 31/71 (43.66%), Postives = 49/71 (69.01%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            +N FM++++  RR IL  FPD  NS +SK LG  WK ++N+ K  Y EE  RL+++H  ++P+YKY+P+ +
Sbjct:  598 MNAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKSMSNQEKQPYYEEQARLSKIHLEKYPNYKYKPRPK 668          
BLAST of SOXP-1 vs. Ensembl Celegans
Match: egl-13 (Transcription factor egl-13 [Source:UniProtKB/Swiss-Prot;Acc:Q23045])

HSP 1 Score: 72.7886 bits (177), Expect = 7.569e-14
Identity = 32/71 (45.07%), Postives = 47/71 (66.20%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            +N FM+++R  RR IL  +PD  NS +SK LG  WK ++N  K  Y EE  RL++LH  + PDY+Y+P+ +
Sbjct:  179 MNAFMVWARDERRKILKAYPDMHNSNISKILGSRWKGMSNSEKQPYYEEQSRLSKLHMEQHPDYRYRPRPK 249          
BLAST of SOXP-1 vs. Ensembl Celegans
Match: egl-13 (Transcription factor egl-13 [Source:UniProtKB/Swiss-Prot;Acc:Q23045])

HSP 1 Score: 72.7886 bits (177), Expect = 7.569e-14
Identity = 32/71 (45.07%), Postives = 47/71 (66.20%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            +N FM+++R  RR IL  +PD  NS +SK LG  WK ++N  K  Y EE  RL++LH  + PDY+Y+P+ +
Sbjct:  179 MNAFMVWARDERRKILKAYPDMHNSNISKILGSRWKGMSNSEKQPYYEEQSRLSKLHMEQHPDYRYRPRPK 249          
BLAST of SOXP-1 vs. Ensembl Celegans
Match: egl-13 (Transcription factor egl-13 [Source:UniProtKB/Swiss-Prot;Acc:Q23045])

HSP 1 Score: 72.7886 bits (177), Expect = 7.760e-14
Identity = 32/71 (45.07%), Postives = 47/71 (66.20%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            +N FM+++R  RR IL  +PD  NS +SK LG  WK ++N  K  Y EE  RL++LH  + PDY+Y+P+ +
Sbjct:  182 MNAFMVWARDERRKILKAYPDMHNSNISKILGSRWKGMSNSEKQPYYEEQSRLSKLHMEQHPDYRYRPRPK 252          
BLAST of SOXP-1 vs. Ensembl Celegans
Match: egl-13 (Transcription factor egl-13 [Source:UniProtKB/Swiss-Prot;Acc:Q23045])

HSP 1 Score: 73.559 bits (179), Expect = 8.731e-14
Identity = 32/71 (45.07%), Postives = 47/71 (66.20%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            +N FM+++R  RR IL  +PD  NS +SK LG  WK ++N  K  Y EE  RL++LH  + PDY+Y+P+ +
Sbjct:  285 MNAFMVWARDERRKILKAYPDMHNSNISKILGSRWKGMSNSEKQPYYEEQSRLSKLHMEQHPDYRYRPRPK 355          
BLAST of SOXP-1 vs. Ensembl Celegans
Match: egl-13 (Transcription factor egl-13 [Source:UniProtKB/Swiss-Prot;Acc:Q23045])

HSP 1 Score: 73.559 bits (179), Expect = 8.731e-14
Identity = 32/71 (45.07%), Postives = 47/71 (66.20%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            +N FM+++R  RR IL  +PD  NS +SK LG  WK ++N  K  Y EE  RL++LH  + PDY+Y+P+ +
Sbjct:  285 MNAFMVWARDERRKILKAYPDMHNSNISKILGSRWKGMSNSEKQPYYEEQSRLSKLHMEQHPDYRYRPRPK 355          
BLAST of SOXP-1 vs. Ensembl Fly
Match: Sox102F (Sox102F [Source:FlyBase gene name;Acc:FBgn0039938])

HSP 1 Score: 72.0182 bits (175), Expect = 5.805e-13
Identity = 31/71 (43.66%), Postives = 46/71 (64.79%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            +N FM++++  RR IL   PD  NS +SK LG  WK ++N  K  Y EE  RL++LH  + PDY+Y+P+ +
Sbjct:  389 MNAFMVWAKDERRKILKACPDMHNSNISKILGARWKAMSNADKQPYYEEQSRLSKLHMEQHPDYRYRPRPK 459          
BLAST of SOXP-1 vs. Ensembl Fly
Match: Sox102F (Sox102F [Source:FlyBase gene name;Acc:FBgn0039938])

HSP 1 Score: 72.0182 bits (175), Expect = 5.805e-13
Identity = 31/71 (43.66%), Postives = 46/71 (64.79%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            +N FM++++  RR IL   PD  NS +SK LG  WK ++N  K  Y EE  RL++LH  + PDY+Y+P+ +
Sbjct:  389 MNAFMVWAKDERRKILKACPDMHNSNISKILGARWKAMSNADKQPYYEEQSRLSKLHMEQHPDYRYRPRPK 459          
BLAST of SOXP-1 vs. Ensembl Fly
Match: Sox102F (Sox102F [Source:FlyBase gene name;Acc:FBgn0039938])

HSP 1 Score: 72.0182 bits (175), Expect = 5.805e-13
Identity = 31/71 (43.66%), Postives = 46/71 (64.79%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            +N FM++++  RR IL   PD  NS +SK LG  WK ++N  K  Y EE  RL++LH  + PDY+Y+P+ +
Sbjct:  389 MNAFMVWAKDERRKILKACPDMHNSNISKILGARWKAMSNADKQPYYEEQSRLSKLHMEQHPDYRYRPRPK 459          
BLAST of SOXP-1 vs. Ensembl Fly
Match: Sox102F (Sox102F [Source:FlyBase gene name;Acc:FBgn0039938])

HSP 1 Score: 72.0182 bits (175), Expect = 6.235e-13
Identity = 31/71 (43.66%), Postives = 46/71 (64.79%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            +N FM++++  RR IL   PD  NS +SK LG  WK ++N  K  Y EE  RL++LH  + PDY+Y+P+ +
Sbjct:  427 MNAFMVWAKDERRKILKACPDMHNSNISKILGARWKAMSNADKQPYYEEQSRLSKLHMEQHPDYRYRPRPK 497          
BLAST of SOXP-1 vs. Ensembl Fly
Match: Sox100B (Sox100B [Source:FlyBase gene name;Acc:FBgn0024288])

HSP 1 Score: 70.8626 bits (172), Expect = 1.159e-12
Identity = 39/118 (33.05%), Postives = 64/118 (54.24%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKRVRRFGRAIYDRQPCTTERSNSTSATDEENGKDNNSVQDGRRSSDIEN 763
            +N FM++++  RR +   +P   NS+LSK LG LWK + +  K  + E A++L   H  E PDYKYQP+++  R   +    +  +     + SAT   +GK  +S  +G+R +   N
Sbjct:   81 MNAFMVWAQAARRVMSKQYPHLQNSELSKSLGKLWKNLKDSDKKPFMEFAEKLRMTHKQEHPDYKYQPRRKKARVLPSQQSGEGGSPGPEMTLSATMGSSGKPRSSNSNGQRRAGKGN 198          
BLAST of SOXP-1 vs. Ensembl Zebrafish
Match: sox6 (SRY (sex determining region Y)-box 6 [Source:ZFIN;Acc:ZDB-GENE-081120-6])

HSP 1 Score: 75.0998 bits (183), Expect = 9.472e-14
Identity = 32/71 (45.07%), Postives = 49/71 (69.01%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            +N FM++++  RR IL  FPD  NS +SK LG  WK +TN+ K  Y EE  RL+++H  ++P+YKY+P+ +
Sbjct:  580 MNAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKSMTNQEKQPYYEEQARLSKIHLEKYPNYKYKPRPK 650          
BLAST of SOXP-1 vs. Ensembl Zebrafish
Match: sox6 (SRY (sex determining region Y)-box 6 [Source:ZFIN;Acc:ZDB-GENE-081120-6])

HSP 1 Score: 75.0998 bits (183), Expect = 9.472e-14
Identity = 32/71 (45.07%), Postives = 49/71 (69.01%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            +N FM++++  RR IL  FPD  NS +SK LG  WK +TN+ K  Y EE  RL+++H  ++P+YKY+P+ +
Sbjct:  580 MNAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKSMTNQEKQPYYEEQARLSKIHLEKYPNYKYKPRPK 650          
BLAST of SOXP-1 vs. Ensembl Zebrafish
Match: sox19a (SRY (sex determining region Y)-box 19a [Source:ZFIN;Acc:ZDB-GENE-980526-102])

HSP 1 Score: 72.0182 bits (175), Expect = 1.618e-13
Identity = 32/73 (43.84%), Postives = 48/73 (65.75%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKRVR 628
            +N FM++SR  RR +    P   NS++SK LG  WK +T+  K  + +EAKRL  LH  E+PDYKY+P+++ +
Sbjct:   57 MNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLTDAEKRPFIDEAKRLRALHMKEYPDYKYKPRRKTK 129          
BLAST of SOXP-1 vs. Ensembl Zebrafish
Match: sox13 (SRY (sex determining region Y)-box 13 [Source:ZFIN;Acc:ZDB-GENE-100519-1])

HSP 1 Score: 73.559 bits (179), Expect = 2.232e-13
Identity = 32/71 (45.07%), Postives = 47/71 (66.20%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            +N FM++++  RR IL  FPD  NS +SK LG  WK ++N+ K  Y EE  RL++ H   +PDYKY+P+ +
Sbjct:  412 MNAFMVWAKDERRRILQAFPDMHNSSISKILGSRWKSMSNQEKQPYYEEQARLSRQHLERYPDYKYKPRPK 482          
BLAST of SOXP-1 vs. Ensembl Zebrafish
Match: sox19a (SRY (sex determining region Y)-box 19a [Source:ZFIN;Acc:ZDB-GENE-980526-102])

HSP 1 Score: 72.0182 bits (175), Expect = 2.282e-13
Identity = 32/73 (43.84%), Postives = 48/73 (65.75%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKRVR 628
            +N FM++SR  RR +    P   NS++SK LG  WK +T+  K  + +EAKRL  LH  E+PDYKY+P+++ +
Sbjct:   56 MNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLTDAEKRPFIDEAKRLRALHMKEYPDYKYKPRRKTK 128          
BLAST of SOXP-1 vs. Ensembl Xenopus
Match: sox5 (SRY (sex determining region Y)-box 5 [Source:Xenbase;Acc:XB-GENE-487032])

HSP 1 Score: 73.559 bits (179), Expect = 1.012e-13
Identity = 33/71 (46.48%), Postives = 47/71 (66.20%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            +N FM++++  RR IL  FPD  NS +SK LG  WK +TN  K  Y EE  RL++ H  ++PDYKY+P+ +
Sbjct:  295 MNAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKAMTNLEKQPYYEEQARLSKQHLEKYPDYKYKPRPK 365          
BLAST of SOXP-1 vs. Ensembl Xenopus
Match: sox6 (SRY (sex determining region Y)-box 6 [Source:Xenbase;Acc:XB-GENE-483934])

HSP 1 Score: 73.559 bits (179), Expect = 1.033e-13
Identity = 31/71 (43.66%), Postives = 49/71 (69.01%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            +N FM++++  RR IL  FPD  NS +SK LG  WK ++N+ K  Y EE  RL+++H  ++P+YKY+P+ +
Sbjct:  386 MNAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKAMSNQEKQPYYEEQARLSKIHLEKYPNYKYKPRPK 456          
BLAST of SOXP-1 vs. Ensembl Xenopus
Match: sox6 (SRY (sex determining region Y)-box 6 [Source:Xenbase;Acc:XB-GENE-483934])

HSP 1 Score: 73.559 bits (179), Expect = 1.084e-13
Identity = 31/71 (43.66%), Postives = 49/71 (69.01%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            +N FM++++  RR IL  FPD  NS +SK LG  WK ++N+ K  Y EE  RL+++H  ++P+YKY+P+ +
Sbjct:  395 MNAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKAMSNQEKQPYYEEQARLSKIHLEKYPNYKYKPRPK 465          
BLAST of SOXP-1 vs. Ensembl Xenopus
Match: sox13 (SRY (sex determining region Y)-box 13 [Source:Xenbase;Acc:XB-GENE-481889])

HSP 1 Score: 72.4034 bits (176), Expect = 2.629e-13
Identity = 32/71 (45.07%), Postives = 46/71 (64.79%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            +N FM++++  RR IL  FPD  NS +SK LG  WK ++N  K  Y EE  RL++ H   +PDYKY+P+ +
Sbjct:  382 MNAFMVWAKDERRKILQAFPDMHNSSISKILGSRWKSMSNAEKQPYYEEQARLSRQHLERYPDYKYKPRPK 452          
BLAST of SOXP-1 vs. Ensembl Xenopus
Match: sox13 (SRY (sex determining region Y)-box 13 [Source:Xenbase;Acc:XB-GENE-481889])

HSP 1 Score: 72.4034 bits (176), Expect = 2.727e-13
Identity = 32/71 (45.07%), Postives = 46/71 (64.79%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            +N FM++++  RR IL  FPD  NS +SK LG  WK ++N  K  Y EE  RL++ H   +PDYKY+P+ +
Sbjct:  383 MNAFMVWAKDERRKILQAFPDMHNSSISKILGSRWKSMSNAEKQPYYEEQARLSRQHLERYPDYKYKPRPK 453          
BLAST of SOXP-1 vs. Ensembl Mouse
Match: Sox13 (SRY (sex determining region Y)-box 13 [Source:MGI Symbol;Acc:MGI:98361])

HSP 1 Score: 75.0998 bits (183), Expect = 7.170e-14
Identity = 33/71 (46.48%), Postives = 48/71 (67.61%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            +N FM++++  RR IL  FPD  NS +SK LG  WK +TN+ K  Y EE  RL++ H  ++PDYKY+P+ +
Sbjct:  420 MNAFMVWAKDERRKILQAFPDMHNSSISKILGSRWKSMTNQEKQPYYEEQARLSRQHLEKYPDYKYKPRPK 490          
BLAST of SOXP-1 vs. Ensembl Mouse
Match: Sox13 (SRY (sex determining region Y)-box 13 [Source:MGI Symbol;Acc:MGI:98361])

HSP 1 Score: 75.0998 bits (183), Expect = 7.170e-14
Identity = 33/71 (46.48%), Postives = 48/71 (67.61%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            +N FM++++  RR IL  FPD  NS +SK LG  WK +TN+ K  Y EE  RL++ H  ++PDYKY+P+ +
Sbjct:  420 MNAFMVWAKDERRKILQAFPDMHNSSISKILGSRWKSMTNQEKQPYYEEQARLSRQHLEKYPDYKYKPRPK 490          
BLAST of SOXP-1 vs. Ensembl Mouse
Match: Sox13 (SRY (sex determining region Y)-box 13 [Source:MGI Symbol;Acc:MGI:98361])

HSP 1 Score: 74.7146 bits (182), Expect = 7.911e-14
Identity = 33/71 (46.48%), Postives = 48/71 (67.61%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            +N FM++++  RR IL  FPD  NS +SK LG  WK +TN+ K  Y EE  RL++ H  ++PDYKY+P+ +
Sbjct:  401 MNAFMVWAKDERRKILQAFPDMHNSSISKILGSRWKSMTNQEKQPYYEEQARLSRQHLEKYPDYKYKPRPK 471          
BLAST of SOXP-1 vs. Ensembl Mouse
Match: Sox5 (SRY (sex determining region Y)-box 5 [Source:MGI Symbol;Acc:MGI:98367])

HSP 1 Score: 73.559 bits (179), Expect = 1.445e-13
Identity = 33/71 (46.48%), Postives = 47/71 (66.20%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            +N FM++++  RR IL  FPD  NS +SK LG  WK +TN  K  Y EE  RL++ H  ++PDYKY+P+ +
Sbjct:  189 MNAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKAMTNLEKQPYYEEQARLSKQHLEKYPDYKYKPRPK 259          
BLAST of SOXP-1 vs. Ensembl Mouse
Match: Sox6 (SRY (sex determining region Y)-box 6 [Source:MGI Symbol;Acc:MGI:98368])

HSP 1 Score: 73.9442 bits (180), Expect = 2.171e-13
Identity = 31/71 (43.66%), Postives = 49/71 (69.01%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            +N FM++++  RR IL  FPD  NS +SK LG  WK ++N+ K  Y EE  RL+++H  ++P+YKY+P+ +
Sbjct:  582 MNAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKSMSNQEKQPYYEEQARLSKIHLEKYPNYKYKPRPK 652          
BLAST of SOXP-1 vs. UniProt
Match: sp|Q9UN79|SOX13_HUMAN (Transcription factor SOX-13 OS=Homo sapiens GN=SOX13 PE=1 SV=3)

HSP 1 Score: 75.0998 bits (183), Expect = 5.414e-13
Identity = 33/71 (46.48%), Postives = 48/71 (67.61%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            +N FM++++  RR IL  FPD  NS +SK LG  WK +TN+ K  Y EE  RL++ H  ++PDYKY+P+ +
Sbjct:  428 MNAFMVWAKDERRKILQAFPDMHNSSISKILGSRWKSMTNQEKQPYYEEQARLSRQHLEKYPDYKYKPRPK 498          
BLAST of SOXP-1 vs. UniProt
Match: sp|Q04891|SOX13_MOUSE (Transcription factor SOX-13 OS=Mus musculus GN=Sox13 PE=2 SV=4)

HSP 1 Score: 75.0998 bits (183), Expect = 5.584e-13
Identity = 33/71 (46.48%), Postives = 48/71 (67.61%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            +N FM++++  RR IL  FPD  NS +SK LG  WK +TN+ K  Y EE  RL++ H  ++PDYKY+P+ +
Sbjct:  420 MNAFMVWAKDERRKILQAFPDMHNSSISKILGSRWKSMTNQEKQPYYEEQARLSRQHLEKYPDYKYKPRPK 490          
BLAST of SOXP-1 vs. UniProt
Match: sp|Q23045|EGL13_CAEEL (Transcription factor egl-13 OS=Caenorhabditis elegans GN=egl-13 PE=1 SV=2)

HSP 1 Score: 73.559 bits (179), Expect = 1.355e-12
Identity = 32/71 (45.07%), Postives = 47/71 (66.20%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            +N FM+++R  RR IL  +PD  NS +SK LG  WK ++N  K  Y EE  RL++LH  + PDY+Y+P+ +
Sbjct:  333 MNAFMVWARDERRKILKAYPDMHNSNISKILGSRWKGMSNSEKQPYYEEQSRLSKLHMEQHPDYRYRPRPK 403          
BLAST of SOXP-1 vs. UniProt
Match: sp|P47792|SX19A_DANRE (Transcription factor Sox-19a OS=Danio rerio GN=sox19a PE=1 SV=2)

HSP 1 Score: 72.0182 bits (175), Expect = 1.415e-12
Identity = 32/73 (43.84%), Postives = 48/73 (65.75%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKRVR 628
            +N FM++SR  RR +    P   NS++SK LG  WK +T+  K  + +EAKRL  LH  E+PDYKY+P+++ +
Sbjct:   57 MNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLTDAEKRPFIDEAKRLRALHMKEYPDYKYKPRRKTK 129          
BLAST of SOXP-1 vs. UniProt
Match: sp|Q5RCU4|SOX6_PONAB (Transcription factor SOX-6 OS=Pongo abelii GN=SOX6 PE=2 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 1.650e-12
Identity = 31/71 (43.66%), Postives = 49/71 (69.01%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            +N FM++++  RR IL  FPD  NS +SK LG  WK ++N+ K  Y EE  RL+++H  ++P+YKY+P+ +
Sbjct:  584 MNAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKSMSNQEKQPYYEEQARLSKIHLEKYPNYKYKPRPK 654          
BLAST of SOXP-1 vs. TrEMBL
Match: tr|H9CXU8|H9CXU8_SCHMD (SOXP-1 OS=Schmidtea mediterranea PE=2 SV=1)

HSP 1 Score: 614.379 bits (1583), Expect = 0.000e+0
Identity = 318/334 (95.21%), Postives = 318/334 (95.21%), Query Frame = 2
Query:  215 MLCSNCSNNQDTLKLWMVHLASCHPLPPEWLSEKAKVLNDDENQRPYTIVTDSXXXXXXXXXXXXLNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKRVRRFGRAIYDRQPCTTERSNSTSATDEENGKDNNSVQDGRRSSDIENQYIRYSVLGKNIVKRECQSFNSPLKSDNVKLETQEQDFIQAMPKPLNVRITNYNENSIFLRQQRLPSSSTMYLLPSENLIISNGIMGSQDLGEDYCRELYIINDFFPENVNIDDEIDITGNIFSNDLDLEWSEIDENYKQDLPNLNSLFQH 1216
            MLCSNCSNNQDTLKLWMVHLASCHPLPPEWLSEKAKVLNDDENQRPYTIVTDSRKRRRRPTTPRPLNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKRVRRFGRAIYDRQPCTTERSNSTSATDEENGKDNNSVQDGRRSSDIENQYIRYSVLGKNIVKRECQSFNSPLKSDNVKLETQEQDFIQAMPKPLNVRITNYNENSIFLRQQRLPSSSTMYLLPSENLIISNGIMGSQDL                ENVNIDDEIDITGNIFSNDLDLEWSEIDENYKQDLPNLNSLFQH
Sbjct:    1 MLCSNCSNNQDTLKLWMVHLASCHPLPPEWLSEKAKVLNDDENQRPYTIVTDSRKRRRRPTTPRPLNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKRVRRFGRAIYDRQPCTTERSNSTSATDEENGKDNNSVQDGRRSSDIENQYIRYSVLGKNIVKRECQSFNSPLKSDNVKLETQEQDFIQAMPKPLNVRITNYNENSIFLRQQRLPSSSTMYLLPSENLIISNGIMGSQDL----------------ENVNIDDEIDITGNIFSNDLDLEWSEIDENYKQDLPNLNSLFQH 318          
BLAST of SOXP-1 vs. TrEMBL
Match: tr|A0A087W088|A0A087W088_ECHMU (Transcription factor SOX 14 OS=Echinococcus multilocularis GN=EmuJ_000191100 PE=4 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 9.097e-33
Identity = 70/134 (52.24%), Postives = 97/134 (72.39%), Query Frame = 2
Query:  221 CSNCSNNQDTLKLWMVHLASCHPLPPEWLSEKAKVLNDDENQRPYTIVTDSXXXXXXXXXXXXLNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            C+ C + Q  L  W+ HL   H LP EW S++A  L      +PYT +T+S+KRRR+ + PRPLN+FM+F++HIRRN+L V  +ASNS LS++LGI+W+ V   IK+ Y+EEA +L ++H LEFP+YKYQPKKR
Sbjct:    4 CAECPSAQSGLHAWIRHLTDFHALPTEWPSDRALRLTGAAAAKPYTTITESKKRRRKDSVPRPLNSFMLFAQHIRRNVLRVHNEASNSVLSQQLGIVWRSVPRAIKNCYDEEAAKLVKIHQLEFPNYKYQPKKR 137          
BLAST of SOXP-1 vs. TrEMBL
Match: tr|A0A1B9X8K2|A0A1B9X8K2_TAESA (Transcription factor SOX 14 OS=Taenia saginata GN=TSA_TSAs00103g08645 PE=4 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 1.535e-32
Identity = 70/134 (52.24%), Postives = 97/134 (72.39%), Query Frame = 2
Query:  221 CSNCSNNQDTLKLWMVHLASCHPLPPEWLSEKAKVLNDDENQRPYTIVTDSXXXXXXXXXXXXLNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            C++C   Q  L  W+ HL   H LP EW S++A  L      +PYT +T+S+KRRR+ + PRPLN+FM+F++HIRRN+L V  +ASNS LS++LGI+W+ V   IK+ Y+EEA +L ++H LEFP+YKYQPKKR
Sbjct:   17 CADCPPAQSGLHTWIRHLTDFHALPTEWPSDRALRLTGAAAAKPYTTITESKKRRRKDSVPRPLNSFMLFAQHIRRNVLRVHNEASNSVLSQQLGIVWRSVPRAIKNCYDEEAAKLVKIHQLEFPNYKYQPKKR 150          
BLAST of SOXP-1 vs. TrEMBL
Match: tr|A0A0R3WGL7|A0A0R3WGL7_TAEAS (Uncharacterized protein OS=Taenia asiatica PE=4 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 1.561e-32
Identity = 70/134 (52.24%), Postives = 97/134 (72.39%), Query Frame = 2
Query:  221 CSNCSNNQDTLKLWMVHLASCHPLPPEWLSEKAKVLNDDENQRPYTIVTDSXXXXXXXXXXXXLNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            C++C   Q  L  W+ HL   H LP EW S++A  L      +PYT +T+S+KRRR+ + PRPLN+FM+F++HIRRN+L V  +ASNS LS++LGI+W+ V   IK+ Y+EEA +L ++H LEFP+YKYQPKKR
Sbjct:   39 CADCPPAQSGLHTWIRHLTDFHALPTEWPSDRALRLTGTAAAKPYTTITESKKRRRKDSVPRPLNSFMLFAQHIRRNVLRVHNEASNSVLSQQLGIVWRSVPRAIKNCYDEEAAKLVKIHQLEFPNYKYQPKKR 172          
BLAST of SOXP-1 vs. TrEMBL
Match: tr|A0A0R3WNP4|A0A0R3WNP4_HYDTA (Uncharacterized protein OS=Hydatigena taeniaeformis PE=4 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 1.828e-32
Identity = 71/134 (52.99%), Postives = 97/134 (72.39%), Query Frame = 2
Query:  221 CSNCSNNQDTLKLWMVHLASCHPLPPEWLSEKAKVLNDDENQRPYTIVTDSXXXXXXXXXXXXLNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            C+ CS  Q  L  W+ HL   H LP EW S++A  L      +PYT +T+S+KRRR+ + PRPLN+FM+F++HIRRN+L V  +ASNS LS++LGI+W+ V   IK+ Y+EEA +L ++H LEFP+YKYQPKKR
Sbjct:   55 CAECSPAQGGLHAWIRHLTDFHALPTEWPSDRALRLTGPAAAKPYTTITESKKRRRKDSVPRPLNSFMLFAQHIRRNVLRVHNEASNSVLSQQLGIVWRSVPRAIKNCYDEEAAKLVKIHQLEFPNYKYQPKKR 188          
The following BLAST results are available for this feature:
BLAST of SOXP-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Human)
Total hits: 5
Match NameE-valueIdentityDescription
SOX131.054e-1346.48SRY-box 13 [Source:HGNC Symbol;Acc:HGNC:11192][more]
SOX131.054e-1346.48SRY-box 13 [Source:HGNC Symbol;Acc:HGNC:11192][more]
SOX52.151e-1346.48SRY-box 5 [Source:HGNC Symbol;Acc:HGNC:11201][more]
SOX63.423e-1343.66SRY-box 6 [Source:HGNC Symbol;Acc:HGNC:16421][more]
SOX63.446e-1343.66SRY-box 6 [Source:HGNC Symbol;Acc:HGNC:16421][more]
back to top
BLAST of SOXP-1 vs. Ensembl Celegans
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Celegan)
Total hits: 5
Match NameE-valueIdentityDescription
egl-137.569e-1445.07Transcription factor egl-13 [Source:UniProtKB/Swi... [more]
egl-137.569e-1445.07Transcription factor egl-13 [Source:UniProtKB/Swi... [more]
egl-137.760e-1445.07Transcription factor egl-13 [Source:UniProtKB/Swi... [more]
egl-138.731e-1445.07Transcription factor egl-13 [Source:UniProtKB/Swi... [more]
egl-138.731e-1445.07Transcription factor egl-13 [Source:UniProtKB/Swi... [more]
back to top
BLAST of SOXP-1 vs. Ensembl Fly
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Drosophila)
Total hits: 5
Match NameE-valueIdentityDescription
Sox102F5.805e-1343.66Sox102F [Source:FlyBase gene name;Acc:FBgn0039938][more]
Sox102F5.805e-1343.66Sox102F [Source:FlyBase gene name;Acc:FBgn0039938][more]
Sox102F5.805e-1343.66Sox102F [Source:FlyBase gene name;Acc:FBgn0039938][more]
Sox102F6.235e-1343.66Sox102F [Source:FlyBase gene name;Acc:FBgn0039938][more]
Sox100B1.159e-1233.05Sox100B [Source:FlyBase gene name;Acc:FBgn0024288][more]
back to top
BLAST of SOXP-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Zebrafish)
Total hits: 5
Match NameE-valueIdentityDescription
sox69.472e-1445.07SRY (sex determining region Y)-box 6 [Source:ZFIN;... [more]
sox69.472e-1445.07SRY (sex determining region Y)-box 6 [Source:ZFIN;... [more]
sox19a1.618e-1343.84SRY (sex determining region Y)-box 19a [Source:ZFI... [more]
sox132.232e-1345.07SRY (sex determining region Y)-box 13 [Source:ZFIN... [more]
sox19a2.282e-1343.84SRY (sex determining region Y)-box 19a [Source:ZFI... [more]
back to top
BLAST of SOXP-1 vs. Ensembl Xenopus
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Xenopus)
Total hits: 5
Match NameE-valueIdentityDescription
sox51.012e-1346.48SRY (sex determining region Y)-box 5 [Source:Xenba... [more]
sox61.033e-1343.66SRY (sex determining region Y)-box 6 [Source:Xenba... [more]
sox61.084e-1343.66SRY (sex determining region Y)-box 6 [Source:Xenba... [more]
sox132.629e-1345.07SRY (sex determining region Y)-box 13 [Source:Xenb... [more]
sox132.727e-1345.07SRY (sex determining region Y)-box 13 [Source:Xenb... [more]
back to top
BLAST of SOXP-1 vs. Ensembl Mouse
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Mouse)
Total hits: 5
Match NameE-valueIdentityDescription
Sox137.170e-1446.48SRY (sex determining region Y)-box 13 [Source:MGI ... [more]
Sox137.170e-1446.48SRY (sex determining region Y)-box 13 [Source:MGI ... [more]
Sox137.911e-1446.48SRY (sex determining region Y)-box 13 [Source:MGI ... [more]
Sox51.445e-1346.48SRY (sex determining region Y)-box 5 [Source:MGI S... [more]
Sox62.171e-1343.66SRY (sex determining region Y)-box 6 [Source:MGI S... [more]
back to top
BLAST of SOXP-1 vs. UniProt
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9UN79|SOX13_HUMAN5.414e-1346.48Transcription factor SOX-13 OS=Homo sapiens GN=SOX... [more]
sp|Q04891|SOX13_MOUSE5.584e-1346.48Transcription factor SOX-13 OS=Mus musculus GN=Sox... [more]
sp|Q23045|EGL13_CAEEL1.355e-1245.07Transcription factor egl-13 OS=Caenorhabditis eleg... [more]
sp|P47792|SX19A_DANRE1.415e-1243.84Transcription factor Sox-19a OS=Danio rerio GN=sox... [more]
sp|Q5RCU4|SOX6_PONAB1.650e-1243.66Transcription factor SOX-6 OS=Pongo abelii GN=SOX6... [more]
back to top
BLAST of SOXP-1 vs. TrEMBL
Analysis Date: 2017-05-17 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
tr|H9CXU8|H9CXU8_SCHMD0.000e+095.21SOXP-1 OS=Schmidtea mediterranea PE=2 SV=1[more]
tr|A0A087W088|A0A087W088_ECHMU9.097e-3352.24Transcription factor SOX 14 OS=Echinococcus multil... [more]
tr|A0A1B9X8K2|A0A1B9X8K2_TAESA1.535e-3252.24Transcription factor SOX 14 OS=Taenia saginata GN=... [more]
tr|A0A0R3WGL7|A0A0R3WGL7_TAEAS1.561e-3252.24Uncharacterized protein OS=Taenia asiatica PE=4 SV... [more]
tr|A0A0R3WNP4|A0A0R3WNP4_HYDTA1.828e-3252.99Uncharacterized protein OS=Hydatigena taeniaeformi... [more]
back to top
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2016-09-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableTMHMMTMhelixcoord: 15..32
NoneNo IPR availableTMHMMTMhelixcoord: 15..37
NoneNo IPR availableTMHMMTMhelixcoord: 4..26
NoneNo IPR availableTMHMMTMhelixcoord: 5..23
NoneNo IPR availableTMHMMTMhelixcoord: 7..29
NoneNo IPR availableTMHMMTMhelixcoord: 12..34
IPR009071High mobility group box domainSMARTSM00398hmgende2coord: 63..133
e-value: 1.1E-19
score: 81.4
IPR009071High mobility group box domainGENE3DG3DSA:1.10.30.10coord: 64..138
e-value: 6.1E-22
score: 77.5
IPR009071High mobility group box domainPFAMPF00505HMG_boxcoord: 65..132
e-value: 3.6E-16
score: 59.2
IPR009071High mobility group box domainPROSITEPS50118HMG_BOX_2coord: 64..132
score: 16.295
IPR009071High mobility group box domainSUPERFAMILYSSF47095HMG-boxcoord: 54..135

Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR009071HMG_box_dom
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast compartment
PLANA:0000009sigma neoblast
PLANA:0004517blastomere
PLANA:0000212blastomere compartment
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000007Stage 7
PLANA:0000006Stage 6
PLANA:0000005Stage 5
PLANA:0000004Stage 4
PLANA:0000008Stage 8
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019097 ID=SMED30019097|Name=SOXP-1|organism=Schmidtea mediterranea sexual|type=transcript|length=1596bp
GGAATAACAGCCAATTAGGGATCAGCTGCAATTTGGCCTATGATTGGACA
TTGATTTTTATAGTCTCAGGCGTTCTCAGCTTACGTGTGCACCTTTTTAG
TGGACACGTTAAATTTGATAGGTGCTTAGTGGTGTTGATTCCTGTTTGGA
AACTGTATATAACCAAGGTTATTTGTTGCTTTGAGACAAATGCAACACAA
TCAAATAATTAATTATGCTATGTTCAAATTGTTCAAACAATCAGGATACT
TTGAAATTATGGATGGTCCATTTAGCTTCTTGTCACCCATTACCTCCTGA
ATGGCTTAGTGAAAAGGCCAAAGTATTAAATGATGACGAAAATCAGCGCC
CCTATACAATTGTCACTGATTCCCGAAAAAGAAGGCGACGTCCAACCACA
CCAAGACCACTAAATACGTTCATGATTTTTTCGAGGCATATCAGACGAAA
TATTCTCTCAGTGTTTCCGGATGCATCAAATTCCCAATTAAGCAAAGAGC
TTGGAATTTTATGGAAGAAAGTCACAAATGAAATTAAATCCCTTTATGAA
GAAGAGGCAAAGCGATTGGCTCAATTACATGCTCTTGAATTTCCCGATTA
TAAATATCAACCAAAGAAACGAGTCCGAAGATTTGGAAGAGCGATTTATG
ATCGACAGCCCTGTACAACAGAAAGATCTAACTCAACTAGTGCAACAGAC
GAAGAAAATGGTAAAGACAATAATAGTGTTCAAGACGGTAGAAGATCAAG
CGATATTGAGAATCAGTATATAAGATATTCAGTTTTGGGTAAAAATATTG
TAAAACGAGAATGTCAGTCCTTTAATAGTCCTTTAAAAAGCGACAACGTT
AAATTGGAAACGCAAGAACAAGATTTTATCCAAGCGATGCCCAAACCTCT
AAACGTCCGAATAACGAATTACAACGAAAACAGTATATTTTTACGACAAC
AAAGATTACCATCAAGTAGCACAATGTATTTACTTCCTTCAGAAAACCTA
ATAATTAGTAATGGGATTATGGGATCACAGGACTTGGGTGAGGATTATTG
TAGAGAGTTGTATATAATTAATGATTTTTTCCCAGAAAATGTAAACATAG
ACGATGAAATTGATATAACAGGAAACATTTTTAGCAATGATTTAGATTTA
GAGTGGTCTGAAATTGATGAAAATTACAAACAAGATTTACCAAATCTTAA
TTCATTATTTCAACACTAATATATTTGATTTATAAAATATTTAAATATTT
TTTATTAAACAGTCTTTTACATGTACATATAGTATTGGAACTCTTCTCTG
ACTTATAAGATAACAGAGATATTGTAATAAGATTAAATTGGTTATGTGTT
TCGGTTTTTGTAAGATTGGTAATTTTCAGAAGAATTTAGACTTTTTTCAT
GGAAATTGGAATTGAGAAACAAACTGAATAAAGAAACAAATTTTTGAAAA
AAACGAAACAGATACTTATTATCAAAAGAAAATTATCTGAAGCATCGAGT
CGGTATGAAAAATAAACTAATTAGTCAGAAAATTTTTGATGAAATAACGT
CTAATGAAATTAAGATCTCCAAGGAATACTTTTTCTAACATTTGAT
back to top

protein sequence of SMED30019097-orf-1

>SMED30019097-orf-1 ID=SMED30019097-orf-1|Name=SMED30019097-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=335bp
MLCSNCSNNQDTLKLWMVHLASCHPLPPEWLSEKAKVLNDDENQRPYTIV
TDSRKRRRRPTTPRPLNTFMIFSRHIRRNILSVFPDASNSQLSKELGILW
KKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKRVRRFGRAIYDRQPC
TTERSNSTSATDEENGKDNNSVQDGRRSSDIENQYIRYSVLGKNIVKREC
QSFNSPLKSDNVKLETQEQDFIQAMPKPLNVRITNYNENSIFLRQQRLPS
SSTMYLLPSENLIISNGIMGSQDLGEDYCRELYIINDFFPENVNIDDEID
ITGNIFSNDLDLEWSEIDENYKQDLPNLNSLFQH*
back to top
Aliases
The feature 'SOXP-1' has the following synonyms
Synonym
SOXP-1
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30019097
GenBankAFD29619.1