SOXP-1

Overview
NameSOXP-1 (AFD29619.1)
Smed IDSMED30019097
Uniprot Best hitTranscription factor SOX-13 OS=Homo sapiens OX=9606 GN=SOX13 PE=1 SV=3 (E=5.49816e-13)
Length (bp)1596
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SOXP-1 (SMED30019097) t-SNE clustered cells

Violin plots show distribution of expression levels for SOXP-1 (SMED30019097) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SOXP-1 (SMED30019097) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SOXP-1 (SMED30019097) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top

Expression Details

SOXP-1 ( SOXP-1 ) is expressed during Stage 4, Stage 5, Stage 6, Stage 7 and Stage 8 in the blastomere, sigma neoblast and neoblast

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm
Anatomical Expression

PAGE et. al., 2020




SMED30019097

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 33

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neoblastSMED30019097SMESG000010063.1 SMED30019097smed_20140614PMID:29906446
Zeng et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pigment cellSMED30019097SMESG000010063.1 SmedASXL_013552SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
X1 cellSMED30019097SMESG000010063.1 SmedASXL_013552SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30019097SMESG000010063.1 SmedASXL_013552SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
protonephridiaSMED30019097SMESG000010063.1 dd_Smed_v4_7227_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30019097SMESG000010063.1 dd_Smed_v4_7227_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30019097SMESG000010063.1 dd_Smed_v4_7227_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30019097SMESG000010063.1 JQ425151.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 6 colorimetric in situ hybridization evidence
neoblastSMED30019097SMESG000010063.1 JQ425151.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 8 colorimetric in situ hybridization evidence
blastomereSMED30019097SMESG000010063.1 JQ425151.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 5 colorimetric in situ hybridization evidence
neoblastSMED30019097SMESG000010063.1 JQ425151.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 7 colorimetric in situ hybridization evidence
blastomereSMED30019097SMESG000010063.1 JQ425151.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 4 colorimetric in situ hybridization evidence
neoblastSMED30019097SMESG000010063.1 SMED30019097smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 7 colorimetric in situ hybridization evidence
neoblastSMED30019097SMESG000010063.1 SMED30019097smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 6 colorimetric in situ hybridization evidence
neoblastSMED30019097SMESG000010063.1 SMED30019097smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 8 colorimetric in situ hybridization evidence
blastomereSMED30019097SMESG000010063.1 SMED30019097smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 5 colorimetric in situ hybridization evidence
blastomereSMED30019097SMESG000010063.1 SMED30019097smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 4 colorimetric in situ hybridization evidence
neoblastSMED30019097SMESG000010063.1 AFD29619.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 8 colorimetric in situ hybridization evidence
neoblastSMED30019097SMESG000010063.1 AFD29619.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 7 colorimetric in situ hybridization evidence
neoblastSMED30019097SMESG000010063.1 AFD29619.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 6 colorimetric in situ hybridization evidence
blastomereSMED30019097SMESG000010063.1 AFD29619.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 5 colorimetric in situ hybridization evidence
blastomereSMED30019097SMESG000010063.1 AFD29619.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 4 colorimetric in situ hybridization evidence
sigma neoblastSMED30019097SMESG000010063.1 JQ425151smed_ncbi_20200123PMID:25017721
van Wolfswinkel et al., 2014
FACS sorted cell population asexual adult fluorescence in situ hybridization evidence
sigma neoblastSMED30019097SMESG000010063.1 JQ425151smed_ncbi_20200123PMID:25017721
van Wolfswinkel et al., 2014
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30019097SMESG000010063.1 dd_Smed_v4_7227_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30019097SMESG000010063.1 SMED_17522_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30019097SMESG000010063.1 SMED_17522_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30019097SMESG000010063.1 SMED_11833_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30019097SMESG000010063.1 SMED_11833_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30019097SMESG000010063.1 SMED_11833_V2_2GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30019097SMESG000010063.1 SMED_11833_V2_2GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30019097SMESG000010063.1 SmWIOct06_023556GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30019097SMESG000010063.1 SMED30019097smed_20140614PMID:22385657
Wagner et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SOXP-1 vs. Ensembl Human
Match: SOX13 (SRY-box transcription factor 13 [Source:HGNC Symbol;Acc:HGNC:11192])

HSP 1 Score: 75.0998 bits (183), Expect = 1.145e-13
Identity = 33/71 (46.48%), Postives = 48/71 (67.61%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            +N FM++++  RR IL  FPD  NS +SK LG  WK +TN+ K  Y EE  RL++ H  ++PDYKY+P+ +
Sbjct:  428 MNAFMVWAKDERRKILQAFPDMHNSSISKILGSRWKSMTNQEKQPYYEEQARLSRQHLEKYPDYKYKPRPK 498          
BLAST of SOXP-1 vs. Ensembl Human
Match: SOX13 (SRY-box transcription factor 13 [Source:HGNC Symbol;Acc:HGNC:11192])

HSP 1 Score: 75.0998 bits (183), Expect = 1.145e-13
Identity = 33/71 (46.48%), Postives = 48/71 (67.61%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            +N FM++++  RR IL  FPD  NS +SK LG  WK +TN+ K  Y EE  RL++ H  ++PDYKY+P+ +
Sbjct:  428 MNAFMVWAKDERRKILQAFPDMHNSSISKILGSRWKSMTNQEKQPYYEEQARLSRQHLEKYPDYKYKPRPK 498          
BLAST of SOXP-1 vs. Ensembl Human
Match: SOX5 (SRY-box transcription factor 5 [Source:HGNC Symbol;Acc:HGNC:11201])

HSP 1 Score: 73.559 bits (179), Expect = 2.168e-13
Identity = 33/71 (46.48%), Postives = 47/71 (66.20%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            +N FM++++  RR IL  FPD  NS +SK LG  WK +TN  K  Y EE  RL++ H  ++PDYKY+P+ +
Sbjct:  174 MNAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKAMTNLEKQPYYEEQARLSKQHLEKYPDYKYKPRPK 244          
BLAST of SOXP-1 vs. Ensembl Human
Match: SOX6 (SRY-box transcription factor 6 [Source:HGNC Symbol;Acc:HGNC:16421])

HSP 1 Score: 73.9442 bits (180), Expect = 3.726e-13
Identity = 31/71 (43.66%), Postives = 49/71 (69.01%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            +N FM++++  RR IL  FPD  NS +SK LG  WK ++N+ K  Y EE  RL+++H  ++P+YKY+P+ +
Sbjct:  601 MNAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKSMSNQEKQPYYEEQARLSKIHLEKYPNYKYKPRPK 671          
BLAST of SOXP-1 vs. Ensembl Human
Match: SOX6 (SRY-box transcription factor 6 [Source:HGNC Symbol;Acc:HGNC:16421])

HSP 1 Score: 73.9442 bits (180), Expect = 3.751e-13
Identity = 31/71 (43.66%), Postives = 49/71 (69.01%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            +N FM++++  RR IL  FPD  NS +SK LG  WK ++N+ K  Y EE  RL+++H  ++P+YKY+P+ +
Sbjct:  598 MNAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKSMSNQEKQPYYEEQARLSKIHLEKYPNYKYKPRPK 668          
BLAST of SOXP-1 vs. Ensembl Celegans
Match: egl-13 (Transcription factor egl-13 [Source:UniProtKB/Swiss-Prot;Acc:Q23045])

HSP 1 Score: 72.7886 bits (177), Expect = 7.519e-14
Identity = 32/71 (45.07%), Postives = 47/71 (66.20%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            +N FM+++R  RR IL  +PD  NS +SK LG  WK ++N  K  Y EE  RL++LH  + PDY+Y+P+ +
Sbjct:  176 MNAFMVWARDERRKILKAYPDMHNSNISKILGSRWKGMSNSEKQPYYEEQSRLSKLHMEQHPDYRYRPRPK 246          
BLAST of SOXP-1 vs. Ensembl Celegans
Match: egl-13 (Transcription factor egl-13 [Source:UniProtKB/Swiss-Prot;Acc:Q23045])

HSP 1 Score: 72.7886 bits (177), Expect = 7.519e-14
Identity = 32/71 (45.07%), Postives = 47/71 (66.20%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            +N FM+++R  RR IL  +PD  NS +SK LG  WK ++N  K  Y EE  RL++LH  + PDY+Y+P+ +
Sbjct:  176 MNAFMVWARDERRKILKAYPDMHNSNISKILGSRWKGMSNSEKQPYYEEQSRLSKLHMEQHPDYRYRPRPK 246          
BLAST of SOXP-1 vs. Ensembl Celegans
Match: egl-13 (Transcription factor egl-13 [Source:UniProtKB/Swiss-Prot;Acc:Q23045])

HSP 1 Score: 72.7886 bits (177), Expect = 7.519e-14
Identity = 32/71 (45.07%), Postives = 47/71 (66.20%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            +N FM+++R  RR IL  +PD  NS +SK LG  WK ++N  K  Y EE  RL++LH  + PDY+Y+P+ +
Sbjct:  176 MNAFMVWARDERRKILKAYPDMHNSNISKILGSRWKGMSNSEKQPYYEEQSRLSKLHMEQHPDYRYRPRPK 246          
BLAST of SOXP-1 vs. Ensembl Celegans
Match: egl-13 (Transcription factor egl-13 [Source:UniProtKB/Swiss-Prot;Acc:Q23045])

HSP 1 Score: 72.7886 bits (177), Expect = 8.187e-14
Identity = 32/71 (45.07%), Postives = 47/71 (66.20%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            +N FM+++R  RR IL  +PD  NS +SK LG  WK ++N  K  Y EE  RL++LH  + PDY+Y+P+ +
Sbjct:  179 MNAFMVWARDERRKILKAYPDMHNSNISKILGSRWKGMSNSEKQPYYEEQSRLSKLHMEQHPDYRYRPRPK 249          
BLAST of SOXP-1 vs. Ensembl Celegans
Match: egl-13 (Transcription factor egl-13 [Source:UniProtKB/Swiss-Prot;Acc:Q23045])

HSP 1 Score: 72.7886 bits (177), Expect = 8.355e-14
Identity = 32/71 (45.07%), Postives = 47/71 (66.20%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            +N FM+++R  RR IL  +PD  NS +SK LG  WK ++N  K  Y EE  RL++LH  + PDY+Y+P+ +
Sbjct:  182 MNAFMVWARDERRKILKAYPDMHNSNISKILGSRWKGMSNSEKQPYYEEQSRLSKLHMEQHPDYRYRPRPK 252          
BLAST of SOXP-1 vs. Ensembl Fly
Match: Sox102F (gene:FBgn0039938 transcript:FBtr0089252)

HSP 1 Score: 72.0182 bits (175), Expect = 5.830e-13
Identity = 31/71 (43.66%), Postives = 46/71 (64.79%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            +N FM++++  RR IL   PD  NS +SK LG  WK ++N  K  Y EE  RL++LH  + PDY+Y+P+ +
Sbjct:  389 MNAFMVWAKDERRKILKACPDMHNSNISKILGARWKAMSNADKQPYYEEQSRLSKLHMEQHPDYRYRPRPK 459          
BLAST of SOXP-1 vs. Ensembl Fly
Match: Sox102F (gene:FBgn0039938 transcript:FBtr0334488)

HSP 1 Score: 72.0182 bits (175), Expect = 5.830e-13
Identity = 31/71 (43.66%), Postives = 46/71 (64.79%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            +N FM++++  RR IL   PD  NS +SK LG  WK ++N  K  Y EE  RL++LH  + PDY+Y+P+ +
Sbjct:  389 MNAFMVWAKDERRKILKACPDMHNSNISKILGARWKAMSNADKQPYYEEQSRLSKLHMEQHPDYRYRPRPK 459          
BLAST of SOXP-1 vs. Ensembl Fly
Match: Sox102F (gene:FBgn0039938 transcript:FBtr0334489)

HSP 1 Score: 72.0182 bits (175), Expect = 5.830e-13
Identity = 31/71 (43.66%), Postives = 46/71 (64.79%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            +N FM++++  RR IL   PD  NS +SK LG  WK ++N  K  Y EE  RL++LH  + PDY+Y+P+ +
Sbjct:  389 MNAFMVWAKDERRKILKACPDMHNSNISKILGARWKAMSNADKQPYYEEQSRLSKLHMEQHPDYRYRPRPK 459          
BLAST of SOXP-1 vs. Ensembl Fly
Match: Sox102F (gene:FBgn0039938 transcript:FBtr0100600)

HSP 1 Score: 72.0182 bits (175), Expect = 6.264e-13
Identity = 31/71 (43.66%), Postives = 46/71 (64.79%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            +N FM++++  RR IL   PD  NS +SK LG  WK ++N  K  Y EE  RL++LH  + PDY+Y+P+ +
Sbjct:  427 MNAFMVWAKDERRKILKACPDMHNSNISKILGARWKAMSNADKQPYYEEQSRLSKLHMEQHPDYRYRPRPK 497          
BLAST of SOXP-1 vs. Ensembl Fly
Match: Sox100B (gene:FBgn0024288 transcript:FBtr0085735)

HSP 1 Score: 70.8626 bits (172), Expect = 1.163e-12
Identity = 39/118 (33.05%), Postives = 64/118 (54.24%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKRVRRFGRAIYDRQPCTTERSNSTSATDEENGKDNNSVQDGRRSSDIEN 763
            +N FM++++  RR +   +P   NS+LSK LG LWK + +  K  + E A++L   H  E PDYKYQP+++  R   +    +  +     + SAT   +GK  +S  +G+R +   N
Sbjct:   81 MNAFMVWAQAARRVMSKQYPHLQNSELSKSLGKLWKNLKDSDKKPFMEFAEKLRMTHKQEHPDYKYQPRRKKARVLPSQQSGEGGSPGPEMTLSATMGSSGKPRSSNSNGQRRAGKGN 198          
BLAST of SOXP-1 vs. Ensembl Zebrafish
Match: sox6 (SRY-box transcription factor 6 [Source:ZFIN;Acc:ZDB-GENE-081120-6])

HSP 1 Score: 75.0998 bits (183), Expect = 9.749e-14
Identity = 32/71 (45.07%), Postives = 49/71 (69.01%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            +N FM++++  RR IL  FPD  NS +SK LG  WK +TN+ K  Y EE  RL+++H  ++P+YKY+P+ +
Sbjct:  563 MNAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKSMTNQEKQPYYEEQARLSKIHLEKYPNYKYKPRPK 633          
BLAST of SOXP-1 vs. Ensembl Zebrafish
Match: sox6 (SRY-box transcription factor 6 [Source:ZFIN;Acc:ZDB-GENE-081120-6])

HSP 1 Score: 75.0998 bits (183), Expect = 9.749e-14
Identity = 32/71 (45.07%), Postives = 49/71 (69.01%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            +N FM++++  RR IL  FPD  NS +SK LG  WK +TN+ K  Y EE  RL+++H  ++P+YKY+P+ +
Sbjct:  563 MNAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKSMTNQEKQPYYEEQARLSKIHLEKYPNYKYKPRPK 633          
BLAST of SOXP-1 vs. Ensembl Zebrafish
Match: sox6 (SRY-box transcription factor 6 [Source:ZFIN;Acc:ZDB-GENE-081120-6])

HSP 1 Score: 75.0998 bits (183), Expect = 9.749e-14
Identity = 32/71 (45.07%), Postives = 49/71 (69.01%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            +N FM++++  RR IL  FPD  NS +SK LG  WK +TN+ K  Y EE  RL+++H  ++P+YKY+P+ +
Sbjct:  563 MNAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKSMTNQEKQPYYEEQARLSKIHLEKYPNYKYKPRPK 633          
BLAST of SOXP-1 vs. Ensembl Zebrafish
Match: sox6 (SRY-box transcription factor 6 [Source:ZFIN;Acc:ZDB-GENE-081120-6])

HSP 1 Score: 75.0998 bits (183), Expect = 9.749e-14
Identity = 32/71 (45.07%), Postives = 49/71 (69.01%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            +N FM++++  RR IL  FPD  NS +SK LG  WK +TN+ K  Y EE  RL+++H  ++P+YKY+P+ +
Sbjct:  563 MNAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKSMTNQEKQPYYEEQARLSKIHLEKYPNYKYKPRPK 633          
BLAST of SOXP-1 vs. Ensembl Zebrafish
Match: sox6 (SRY-box transcription factor 6 [Source:ZFIN;Acc:ZDB-GENE-081120-6])

HSP 1 Score: 75.0998 bits (183), Expect = 1.116e-13
Identity = 32/71 (45.07%), Postives = 49/71 (69.01%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            +N FM++++  RR IL  FPD  NS +SK LG  WK +TN+ K  Y EE  RL+++H  ++P+YKY+P+ +
Sbjct:  580 MNAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKSMTNQEKQPYYEEQARLSKIHLEKYPNYKYKPRPK 650          
BLAST of SOXP-1 vs. Ensembl Xenopus
Match: spidr (scaffold protein involved in DNA repair [Source:Xenbase;Acc:XB-GENE-5813435])

HSP 1 Score: 73.9442 bits (180), Expect = 3.403e-13
Identity = 31/71 (43.66%), Postives = 49/71 (69.01%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            +N FM++++  RR IL  FPD  NS +SK LG  WK ++N+ K  Y EE  RL+++H  ++P+YKY+P+ +
Sbjct:  511 MNAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKAMSNQEKQPYYEEQARLSKIHLEKYPNYKYKPRPK 581          
BLAST of SOXP-1 vs. Ensembl Xenopus
Match: spidr (scaffold protein involved in DNA repair [Source:Xenbase;Acc:XB-GENE-5813435])

HSP 1 Score: 73.559 bits (179), Expect = 3.728e-13
Identity = 31/71 (43.66%), Postives = 49/71 (69.01%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            +N FM++++  RR IL  FPD  NS +SK LG  WK ++N+ K  Y EE  RL+++H  ++P+YKY+P+ +
Sbjct:  506 MNAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKAMSNQEKQPYYEEQARLSKIHLEKYPNYKYKPRPK 576          
BLAST of SOXP-1 vs. Ensembl Xenopus
Match: spidr (scaffold protein involved in DNA repair [Source:Xenbase;Acc:XB-GENE-5813435])

HSP 1 Score: 73.559 bits (179), Expect = 3.740e-13
Identity = 31/71 (43.66%), Postives = 49/71 (69.01%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            +N FM++++  RR IL  FPD  NS +SK LG  WK ++N+ K  Y EE  RL+++H  ++P+YKY+P+ +
Sbjct:  573 MNAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKAMSNQEKQPYYEEQARLSKIHLEKYPNYKYKPRPK 643          
BLAST of SOXP-1 vs. Ensembl Xenopus
Match: spidr (scaffold protein involved in DNA repair [Source:Xenbase;Acc:XB-GENE-5813435])

HSP 1 Score: 73.559 bits (179), Expect = 3.800e-13
Identity = 31/71 (43.66%), Postives = 49/71 (69.01%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            +N FM++++  RR IL  FPD  NS +SK LG  WK ++N+ K  Y EE  RL+++H  ++P+YKY+P+ +
Sbjct:  571 MNAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKAMSNQEKQPYYEEQARLSKIHLEKYPNYKYKPRPK 641          
BLAST of SOXP-1 vs. Ensembl Xenopus
Match: spidr (scaffold protein involved in DNA repair [Source:Xenbase;Acc:XB-GENE-5813435])

HSP 1 Score: 73.559 bits (179), Expect = 3.842e-13
Identity = 31/71 (43.66%), Postives = 49/71 (69.01%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            +N FM++++  RR IL  FPD  NS +SK LG  WK ++N+ K  Y EE  RL+++H  ++P+YKY+P+ +
Sbjct:  586 MNAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKAMSNQEKQPYYEEQARLSKIHLEKYPNYKYKPRPK 656          
BLAST of SOXP-1 vs. Ensembl Mouse
Match: Sox13 (SRY (sex determining region Y)-box 13 [Source:MGI Symbol;Acc:MGI:98361])

HSP 1 Score: 75.0998 bits (183), Expect = 8.108e-14
Identity = 33/71 (46.48%), Postives = 48/71 (67.61%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            +N FM++++  RR IL  FPD  NS +SK LG  WK +TN+ K  Y EE  RL++ H  ++PDYKY+P+ +
Sbjct:  420 MNAFMVWAKDERRKILQAFPDMHNSSISKILGSRWKSMTNQEKQPYYEEQARLSRQHLEKYPDYKYKPRPK 490          
BLAST of SOXP-1 vs. Ensembl Mouse
Match: Sox13 (SRY (sex determining region Y)-box 13 [Source:MGI Symbol;Acc:MGI:98361])

HSP 1 Score: 75.0998 bits (183), Expect = 8.108e-14
Identity = 33/71 (46.48%), Postives = 48/71 (67.61%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            +N FM++++  RR IL  FPD  NS +SK LG  WK +TN+ K  Y EE  RL++ H  ++PDYKY+P+ +
Sbjct:  420 MNAFMVWAKDERRKILQAFPDMHNSSISKILGSRWKSMTNQEKQPYYEEQARLSRQHLEKYPDYKYKPRPK 490          
BLAST of SOXP-1 vs. Ensembl Mouse
Match: Sox13 (SRY (sex determining region Y)-box 13 [Source:MGI Symbol;Acc:MGI:98361])

HSP 1 Score: 74.7146 bits (182), Expect = 8.844e-14
Identity = 33/71 (46.48%), Postives = 48/71 (67.61%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            +N FM++++  RR IL  FPD  NS +SK LG  WK +TN+ K  Y EE  RL++ H  ++PDYKY+P+ +
Sbjct:  401 MNAFMVWAKDERRKILQAFPDMHNSSISKILGSRWKSMTNQEKQPYYEEQARLSRQHLEKYPDYKYKPRPK 471          
BLAST of SOXP-1 vs. Ensembl Mouse
Match: Sox5 (SRY (sex determining region Y)-box 5 [Source:MGI Symbol;Acc:MGI:98367])

HSP 1 Score: 73.559 bits (179), Expect = 1.517e-13
Identity = 33/71 (46.48%), Postives = 47/71 (66.20%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            +N FM++++  RR IL  FPD  NS +SK LG  WK +TN  K  Y EE  RL++ H  ++PDYKY+P+ +
Sbjct:  189 MNAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKAMTNLEKQPYYEEQARLSKQHLEKYPDYKYKPRPK 259          
BLAST of SOXP-1 vs. Ensembl Mouse
Match: Sox6 (SRY (sex determining region Y)-box 6 [Source:MGI Symbol;Acc:MGI:98368])

HSP 1 Score: 73.9442 bits (180), Expect = 2.459e-13
Identity = 31/71 (43.66%), Postives = 49/71 (69.01%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            +N FM++++  RR IL  FPD  NS +SK LG  WK ++N+ K  Y EE  RL+++H  ++P+YKY+P+ +
Sbjct:  582 MNAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKSMSNQEKQPYYEEQARLSKIHLEKYPNYKYKPRPK 652          
BLAST of SOXP-1 vs. UniProt
Match: sp|Q9UN79|SOX13_HUMAN (Transcription factor SOX-13 OS=Homo sapiens OX=9606 GN=SOX13 PE=1 SV=3)

HSP 1 Score: 75.0998 bits (183), Expect = 5.498e-13
Identity = 33/71 (46.48%), Postives = 48/71 (67.61%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            +N FM++++  RR IL  FPD  NS +SK LG  WK +TN+ K  Y EE  RL++ H  ++PDYKY+P+ +
Sbjct:  428 MNAFMVWAKDERRKILQAFPDMHNSSISKILGSRWKSMTNQEKQPYYEEQARLSRQHLEKYPDYKYKPRPK 498          
BLAST of SOXP-1 vs. UniProt
Match: sp|Q04891|SOX13_MOUSE (Transcription factor SOX-13 OS=Mus musculus OX=10090 GN=Sox13 PE=1 SV=4)

HSP 1 Score: 75.0998 bits (183), Expect = 5.671e-13
Identity = 33/71 (46.48%), Postives = 48/71 (67.61%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            +N FM++++  RR IL  FPD  NS +SK LG  WK +TN+ K  Y EE  RL++ H  ++PDYKY+P+ +
Sbjct:  420 MNAFMVWAKDERRKILQAFPDMHNSSISKILGSRWKSMTNQEKQPYYEEQARLSRQHLEKYPDYKYKPRPK 490          
BLAST of SOXP-1 vs. UniProt
Match: sp|P36394|SRY_RAT (Sex-determining region Y protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Sry PE=1 SV=2)

HSP 1 Score: 68.1662 bits (165), Expect = 1.255e-12
Identity = 31/73 (42.47%), Postives = 47/73 (64.38%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKRVR 628
            +N FM++SR  R  +    P   NS++SK+LG  WK +T   K  + +EA+RL  LH  ++P+YKYQP +RV+
Sbjct:    9 MNAFMVWSRGERHKLAQQNPSMQNSEISKQLGYQWKSLTEAEKRPFFQEAQRLKTLHREKYPNYKYQPHRRVK 81          
BLAST of SOXP-1 vs. UniProt
Match: sp|Q23045|EGL13_CAEEL (Transcription factor egl-13 OS=Caenorhabditis elegans OX=6239 GN=egl-13 PE=1 SV=2)

HSP 1 Score: 73.559 bits (179), Expect = 1.346e-12
Identity = 32/71 (45.07%), Postives = 47/71 (66.20%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            +N FM+++R  RR IL  +PD  NS +SK LG  WK ++N  K  Y EE  RL++LH  + PDY+Y+P+ +
Sbjct:  333 MNAFMVWARDERRKILKAYPDMHNSNISKILGSRWKGMSNSEKQPYYEEQSRLSKLHMEQHPDYRYRPRPK 403          
BLAST of SOXP-1 vs. UniProt
Match: sp|P47792|SX19A_DANRE (Transcription factor Sox-19a OS=Danio rerio OX=7955 GN=sox19a PE=1 SV=2)

HSP 1 Score: 72.0182 bits (175), Expect = 1.455e-12
Identity = 32/73 (43.84%), Postives = 48/73 (65.75%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKRVR 628
            +N FM++SR  RR +    P   NS++SK LG  WK +T+  K  + +EAKRL  LH  E+PDYKY+P+++ +
Sbjct:   57 MNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLTDAEKRPFIDEAKRLRALHMKEYPDYKYKPRRKTK 129          
BLAST of SOXP-1 vs. TrEMBL
Match: gnl|BL_ORD_ID|17042143 (tr|H9CXU8|H9CXU8_SCHMD SOXP-1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 614.379 bits (1583), Expect = 0.000e+0
Identity = 318/334 (95.21%), Postives = 318/334 (95.21%), Query Frame = 2
Query:  215 MLCSNCSNNQDTLKLWMVHLASCHPLPPEWLSEKAKVLNDDENQRPYTIVTDSXXXXXXXXXXXXLNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKRVRRFGRAIYDRQPCTTERSNSTSATDEENGKDNNSVQDGRRSSDIENQYIRYSVLGKNIVKRECQSFNSPLKSDNVKLETQEQDFIQAMPKPLNVRITNYNENSIFLRQQRLPSSSTMYLLPSENLIISNGIMGSQDLGEDYCRELYIINDFFPENVNIDDEIDITGNIFSNDLDLEWSEIDENYKQDLPNLNSLFQH 1216
            MLCSNCSNNQDTLKLWMVHLASCHPLPPEWLSEKAKVLNDDENQRPYTIVTDSRKRRRRPTTPRPLNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKRVRRFGRAIYDRQPCTTERSNSTSATDEENGKDNNSVQDGRRSSDIENQYIRYSVLGKNIVKRECQSFNSPLKSDNVKLETQEQDFIQAMPKPLNVRITNYNENSIFLRQQRLPSSSTMYLLPSENLIISNGIMGSQDL                ENVNIDDEIDITGNIFSNDLDLEWSEIDENYKQDLPNLNSLFQH
Sbjct:    1 MLCSNCSNNQDTLKLWMVHLASCHPLPPEWLSEKAKVLNDDENQRPYTIVTDSRKRRRRPTTPRPLNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKRVRRFGRAIYDRQPCTTERSNSTSATDEENGKDNNSVQDGRRSSDIENQYIRYSVLGKNIVKRECQSFNSPLKSDNVKLETQEQDFIQAMPKPLNVRITNYNENSIFLRQQRLPSSSTMYLLPSENLIISNGIMGSQDL----------------ENVNIDDEIDITGNIFSNDLDLEWSEIDENYKQDLPNLNSLFQH 318          
BLAST of SOXP-1 vs. TrEMBL
Match: gnl|BL_ORD_ID|24441027 (tr|A0A3P7P8C9|A0A3P7P8C9_DIBLA HMG box domain-containing protein (Fragment) OS=Dibothriocephalus latus OX=60516 GN=DILT_LOCUS10137 PE=4 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 5.011e-33
Identity = 66/135 (48.89%), Postives = 97/135 (71.85%), Query Frame = 2
Query:  221 CSNCSNNQDT-LKLWMVHLASCHPLPPEWLSEKAKVLNDDENQRPYTIVTDSXXXXXXXXXXXXLNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            C  C + +D+ ++ W+ HLA  H +P EW SE+A  L     + PYT++T+S+K+R R + PRPLN+FMIF++HIRRN+L VF  ASNS +S++LG +W+ +   +K  Y+ EA RL ++H +EFPDYKYQPKK+
Sbjct:    6 CLACPSARDSGVEAWICHLAEAHVMPTEWTSERAARLVGPAARTPYTLITESKKKRCRGSVPRPLNSFMIFAQHIRRNVLRVFGKASNSVISRQLGEIWRTLPRPVKERYDAEAARLVKIHQIEFPDYKYQPKKK 140          
BLAST of SOXP-1 vs. TrEMBL
Match: gnl|BL_ORD_ID|21299753 (tr|A0A087W088|A0A087W088_ECHMU Transcription factor SOX 14 OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000191100 PE=4 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 1.269e-32
Identity = 70/134 (52.24%), Postives = 97/134 (72.39%), Query Frame = 2
Query:  221 CSNCSNNQDTLKLWMVHLASCHPLPPEWLSEKAKVLNDDENQRPYTIVTDSXXXXXXXXXXXXLNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            C+ C + Q  L  W+ HL   H LP EW S++A  L      +PYT +T+S+KRRR+ + PRPLN+FM+F++HIRRN+L V  +ASNS LS++LGI+W+ V   IK+ Y+EEA +L ++H LEFP+YKYQPKKR
Sbjct:    4 CAECPSAQSGLHAWIRHLTDFHALPTEWPSDRALRLTGAAAAKPYTTITESKKRRRKDSVPRPLNSFMLFAQHIRRNVLRVHNEASNSVLSQQLGIVWRSVPRAIKNCYDEEAAKLVKIHQLEFPNYKYQPKKR 137          
BLAST of SOXP-1 vs. TrEMBL
Match: gnl|BL_ORD_ID|16179662 (tr|A0A0R3WGL7|A0A0R3WGL7_TAEAS HMG box domain-containing protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS10011 PE=4 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 2.596e-32
Identity = 70/134 (52.24%), Postives = 97/134 (72.39%), Query Frame = 2
Query:  221 CSNCSNNQDTLKLWMVHLASCHPLPPEWLSEKAKVLNDDENQRPYTIVTDSXXXXXXXXXXXXLNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            C++C   Q  L  W+ HL   H LP EW S++A  L      +PYT +T+S+KRRR+ + PRPLN+FM+F++HIRRN+L V  +ASNS LS++LGI+W+ V   IK+ Y+EEA +L ++H LEFP+YKYQPKKR
Sbjct:   39 CADCPPAQSGLHTWIRHLTDFHALPTEWPSDRALRLTGTAAAKPYTTITESKKRRRKDSVPRPLNSFMLFAQHIRRNVLRVHNEASNSVLSQQLGIVWRSVPRAIKNCYDEEAAKLVKIHQLEFPNYKYQPKKR 172          
BLAST of SOXP-1 vs. TrEMBL
Match: gnl|BL_ORD_ID|19113828 (tr|A0A068WSN2|A0A068WSN2_ECHGR Transcription factor SOX 14 OS=Echinococcus granulosus OX=6210 GN=EgrG_000191100 PE=4 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 2.780e-32
Identity = 70/134 (52.24%), Postives = 96/134 (71.64%), Query Frame = 2
Query:  221 CSNCSNNQDTLKLWMVHLASCHPLPPEWLSEKAKVLNDDENQRPYTIVTDSXXXXXXXXXXXXLNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            C+ C   Q  L  W+ HL   H LP EW S++A  L      +PYT +T+S+KRRR+ + PRPLN+FM+F++HIRRN+L V  +ASNS LS++LGI+W+ V   IK+ Y+EEA +L ++H LEFP+YKYQPKKR
Sbjct:    4 CAECPPAQGGLHAWIRHLTDFHALPTEWPSDRALRLTGAAAAKPYTTITESKKRRRKDSVPRPLNSFMLFAQHIRRNVLRVHNEASNSVLSQQLGIVWRSVPRAIKNCYDEEAAKLVKIHQLEFPNYKYQPKKR 137          
BLAST of SOXP-1 vs. Ensembl Cavefish
Match: sox19b (transcription factor Sox-19b [Source:NCBI gene;Acc:103045346])

HSP 1 Score: 72.0182 bits (175), Expect = 1.590e-13
Identity = 36/96 (37.50%), Postives = 57/96 (59.38%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKRVRRFGR--AIYDRQPCTTERSNSTS 691
            +N FM++SR  RR +    P   NS++SK LG  WK +T+  K  + +EAKRL  +H  E+PDYKY+P+++ +   +  A   + P TT +  + S
Sbjct:   58 MNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLTDAEKRPFIDEAKRLRAVHMKEYPDYKYKPRRKTKPLLKKDAPPGKYPLTTAQGQALS 153          
BLAST of SOXP-1 vs. Ensembl Cavefish
Match: sox13 (SRY-box transcription factor 13 [Source:NCBI gene;Acc:103022571])

HSP 1 Score: 73.559 bits (179), Expect = 2.175e-13
Identity = 32/71 (45.07%), Postives = 47/71 (66.20%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            +N FM++++  RR IL  FPD  NS +SK LG  WK ++N+ K  Y EE  RL++ H   +PDYKY+P+ +
Sbjct:  433 MNAFMVWAKDERRRILQAFPDMHNSSISKILGSRWKSMSNQEKQPYYEEQARLSRQHLERYPDYKYKPRPK 503          
BLAST of SOXP-1 vs. Ensembl Cavefish
Match: sox13 (SRY-box transcription factor 13 [Source:NCBI gene;Acc:103022571])

HSP 1 Score: 73.559 bits (179), Expect = 2.257e-13
Identity = 32/71 (45.07%), Postives = 47/71 (66.20%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            +N FM++++  RR IL  FPD  NS +SK LG  WK ++N+ K  Y EE  RL++ H   +PDYKY+P+ +
Sbjct:  441 MNAFMVWAKDERRRILQAFPDMHNSSISKILGSRWKSMSNQEKQPYYEEQARLSRQHLERYPDYKYKPRPK 511          
BLAST of SOXP-1 vs. Ensembl Cavefish
Match: sox6 (SRY-box transcription factor 6 [Source:ZFIN;Acc:ZDB-GENE-081120-6])

HSP 1 Score: 73.559 bits (179), Expect = 2.404e-13
Identity = 31/71 (43.66%), Postives = 49/71 (69.01%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            +N FM++++  RR IL  FPD  NS +SK LG  WK ++N+ K  Y EE  RL+++H  ++P+YKY+P+ +
Sbjct:  582 MNAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKSMSNQEKQPYYEEQARLSKIHLEKYPNYKYKPRPK 652          
BLAST of SOXP-1 vs. Ensembl Cavefish
Match: sox13 (SRY-box transcription factor 13 [Source:NCBI gene;Acc:103022571])

HSP 1 Score: 73.559 bits (179), Expect = 2.561e-13
Identity = 32/71 (45.07%), Postives = 47/71 (66.20%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            +N FM++++  RR IL  FPD  NS +SK LG  WK ++N+ K  Y EE  RL++ H   +PDYKY+P+ +
Sbjct:  465 MNAFMVWAKDERRRILQAFPDMHNSSISKILGSRWKSMSNQEKQPYYEEQARLSRQHLERYPDYKYKPRPK 535          
BLAST of SOXP-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008165.1 (pep scaffold:Pmarinus_7.0:GL479973:18969:29522:-1 gene:ENSPMAG00000007384.1 transcript:ENSPMAT00000008165.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 71.633 bits (174), Expect = 8.488e-15
Identity = 31/69 (44.93%), Postives = 46/69 (66.67%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPK 616
            +N FM++++  RR IL  FPD  NS +SK LG  WK ++++ K  Y EE  RL++LH   +P YKY+P+
Sbjct:   65 MNAFMVWAKDERRKILQAFPDMHNSSISKILGSRWKAMSSQEKQPYYEEQARLSKLHLERYPGYKYRPR 133          
BLAST of SOXP-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006684.1 (pep scaffold:Pmarinus_7.0:GL477399:28105:35473:-1 gene:ENSPMAG00000006026.1 transcript:ENSPMAT00000006684.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 67.3958 bits (163), Expect = 8.760e-13
Identity = 30/72 (41.67%), Postives = 49/72 (68.06%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNS-QLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            +N FM++++  RR IL  FPD  ++ Q+S+  G  WK ++N+ K  Y EE  RL++LH  ++PDYKY+P+ +
Sbjct:   65 MNAFMVWAKDERRKILQAFPDMKHTLQISECPGSRWKSMSNQEKQPYYEEQARLSKLHLEKYPDYKYKPRPK 136          
BLAST of SOXP-1 vs. Ensembl Sea Lamprey
Match: sox1b (SRY-box transcription factor 1b [Source:NCBI gene;Acc:562710])

HSP 1 Score: 67.781 bits (164), Expect = 1.942e-12
Identity = 32/70 (45.71%), Postives = 44/70 (62.86%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKK 619
            +N FM++SR  RR +    P   NS++SK LG  WK +T   K  + +EAKRL  LH  E PDYKY+P++
Sbjct:   63 MNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLTEAEKRPFIDEAKRLRALHMKEHPDYKYRPRR 132          
BLAST of SOXP-1 vs. Ensembl Sea Lamprey
Match: sox10 (SRY-box transcription factor 10 [Source:ZFIN;Acc:ZDB-GENE-011207-1])

HSP 1 Score: 66.6254 bits (161), Expect = 2.277e-12
Identity = 29/71 (40.85%), Postives = 45/71 (63.38%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            +N FM++++  RR +   +P   N++LSK LG LW+ +    K  + EEA+RL   H  + PDYKYQP++R
Sbjct:  116 MNAFMVWAQAARRKLSDQYPQLHNAELSKTLGKLWRLLNEGEKRPFVEEAERLRMQHKKDHPDYKYQPRRR 186          
BLAST of SOXP-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010223.1 (pep scaffold:Pmarinus_7.0:GL478813:2555:9375:-1 gene:ENSPMAG00000009255.1 transcript:ENSPMAT00000010223.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 61.6178 bits (148), Expect = 3.113e-12
Identity = 30/71 (42.25%), Postives = 46/71 (64.79%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            +N FM++++  RR +    PD  N++LSK LG  W+ +T E +    EEA+RL  LH  E PDYKY+P+++
Sbjct:   10 MNAFMVWAKDERRRLAKQNPDLHNAELSKMLGKSWRALTPESRRPCVEEAERLRLLHLSEHPDYKYRPRRK 80          
BLAST of SOXP-1 vs. Ensembl Nematostella
Match: EDO36072 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJN1])

HSP 1 Score: 71.633 bits (174), Expect = 1.013e-15
Identity = 35/73 (47.95%), Postives = 49/73 (67.12%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKRVR 628
            +N FMI+S   RR + +  P   NSQ+SK LG  W+K+T E K  +  EAK L +LH +E PDYKY+P++RV+
Sbjct:   11 MNAFMIWSSKKRRQLAAENPKLHNSQISKMLGTEWRKLTVEEKQKFFAEAKLLNELHMIEHPDYKYRPRRRVK 83          
BLAST of SOXP-1 vs. Ensembl Nematostella
Match: EDO38755 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC09])

HSP 1 Score: 70.0922 bits (170), Expect = 3.677e-15
Identity = 35/71 (49.30%), Postives = 49/71 (69.01%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            +N FM++SR  R  IL   P  +N++LSK LG+ WKK++ E K  Y E+AK L ++H  + PDYKYQPK+R
Sbjct:   12 MNCFMVWSREKRCQILQENPGINNARLSKLLGMAWKKLSVEEKEPYIEKAKHLTEMHKEKHPDYKYQPKRR 82          
BLAST of SOXP-1 vs. Ensembl Nematostella
Match: EDO47688 (Predicted protein; Sox family protein 2 [Source:UniProtKB/TrEMBL;Acc:Q3S383])

HSP 1 Score: 71.633 bits (174), Expect = 3.287e-14
Identity = 34/73 (46.58%), Postives = 48/73 (65.75%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKRVR 628
            +N +M++SR  RR I    P   NS++SK LG+ W  +T + K  Y EEAKRL +LH  + PDYKYQPK++ +
Sbjct:   12 MNAYMVWSRKERRRIAEECPRMLNSEISKRLGLEWNSLTLDEKQPYVEEAKRLRELHKKDHPDYKYQPKRKPK 84          
BLAST of SOXP-1 vs. Ensembl Nematostella
Match: EDO33516 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRZ8])

HSP 1 Score: 67.3958 bits (163), Expect = 3.772e-14
Identity = 32/71 (45.07%), Postives = 48/71 (67.61%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            LN F+++S+  RR I +  P   N  +S++LG+ W+K+T E K+ Y EEAK+L + H   +P YKYQP+KR
Sbjct:   10 LNAFILWSKKRRRVIANENPQMHNFDISRKLGLEWQKLTEEEKAYYFEEAKKLKEEHKERYPHYKYQPRKR 80          
BLAST of SOXP-1 vs. Ensembl Nematostella
Match: EDO39449 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9V3])

HSP 1 Score: 63.929 bits (154), Expect = 6.444e-13
Identity = 28/71 (39.44%), Postives = 46/71 (64.79%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            +N FM++SR  RR +   +P+  N ++SK LG  W +++ E K  +  EAKRL  +H  ++PDY Y+P++R
Sbjct:   13 MNAFMVWSRTERRKLALKYPNMLNCEISKLLGAEWSRLSEEEKRPFVTEAKRLRTIHNQKYPDYSYKPRRR 83          
BLAST of SOXP-1 vs. Ensembl Medaka
Match: sox6b (SRY-box containing gene 6b [Source:NCBI gene;Acc:100304449])

HSP 1 Score: 74.3294 bits (181), Expect = 1.274e-13
Identity = 32/71 (45.07%), Postives = 49/71 (69.01%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            +N FM++++  RR IL  FPD  NS +SK LG  WK ++N+ K  Y EE  RL++LH  ++P+YKY+P+ +
Sbjct:  489 MNAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKSMSNQDKQPYYEEQARLSKLHLEKYPNYKYKPRPK 559          
BLAST of SOXP-1 vs. Ensembl Medaka
Match: sox6b (SRY-box containing gene 6b [Source:NCBI gene;Acc:100304449])

HSP 1 Score: 74.3294 bits (181), Expect = 1.310e-13
Identity = 32/71 (45.07%), Postives = 49/71 (69.01%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            +N FM++++  RR IL  FPD  NS +SK LG  WK ++N+ K  Y EE  RL++LH  ++P+YKY+P+ +
Sbjct:  560 MNAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKSMSNQDKQPYYEEQARLSKLHLEKYPNYKYKPRPK 630          
BLAST of SOXP-1 vs. Ensembl Medaka
Match: sox6b (SRY-box containing gene 6b [Source:NCBI gene;Acc:100304449])

HSP 1 Score: 74.3294 bits (181), Expect = 1.351e-13
Identity = 32/71 (45.07%), Postives = 49/71 (69.01%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            +N FM++++  RR IL  FPD  NS +SK LG  WK ++N+ K  Y EE  RL++LH  ++P+YKY+P+ +
Sbjct:  533 MNAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKSMSNQDKQPYYEEQARLSKLHLEKYPNYKYKPRPK 603          
BLAST of SOXP-1 vs. Ensembl Medaka
Match: sox6b (SRY-box containing gene 6b [Source:NCBI gene;Acc:100304449])

HSP 1 Score: 74.3294 bits (181), Expect = 1.523e-13
Identity = 32/71 (45.07%), Postives = 49/71 (69.01%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            +N FM++++  RR IL  FPD  NS +SK LG  WK ++N+ K  Y EE  RL++LH  ++P+YKY+P+ +
Sbjct:  574 MNAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKSMSNQDKQPYYEEQARLSKLHLEKYPNYKYKPRPK 644          
BLAST of SOXP-1 vs. Ensembl Medaka
Match: sox6b (SRY-box containing gene 6b [Source:NCBI gene;Acc:100304449])

HSP 1 Score: 74.3294 bits (181), Expect = 1.523e-13
Identity = 32/71 (45.07%), Postives = 49/71 (69.01%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKR 622
            +N FM++++  RR IL  FPD  NS +SK LG  WK ++N+ K  Y EE  RL++LH  ++P+YKY+P+ +
Sbjct:  574 MNAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKSMSNQDKQPYYEEQARLSKLHLEKYPNYKYKPRPK 644          
BLAST of SOXP-1 vs. Planmine SMEST
Match: SMESG000010063.1 (SMESG000010063.1)

HSP 1 Score: 614.379 bits (1583), Expect = 0.000e+0
Identity = 318/334 (95.21%), Postives = 318/334 (95.21%), Query Frame = 2
Query:  215 MLCSNCSNNQDTLKLWMVHLASCHPLPPEWLSEKAKVLNDDENQRPYTIVTDSXXXXXXXXXXXXLNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKRVRRFGRAIYDRQPCTTERSNSTSATDEENGKDNNSVQDGRRSSDIENQYIRYSVLGKNIVKRECQSFNSPLKSDNVKLETQEQDFIQAMPKPLNVRITNYNENSIFLRQQRLPSSSTMYLLPSENLIISNGIMGSQDLGEDYCRELYIINDFFPENVNIDDEIDITGNIFSNDLDLEWSEIDENYKQDLPNLNSLFQH 1216
            MLCSNCSNNQDTLKLWMVHLASCHPLPPEWLSEKAKVLNDDENQRPYTIVTDSRKRRRRPTTPRPLNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKRVRRFGRAIYDRQPCTTERSNSTSATDEENGKDNNSVQDGRRSSDIENQYIRYSVLGKNIVKRECQSFNSPLKSDNVKLETQEQDFIQAMPKPLNVRITNYNENSIFLRQQRLPSSSTMYLLPSENLIISNGIMGSQDL                ENVNIDDEIDITGNIFSNDLDLEWSEIDENYKQDLPNLNSLFQH
Sbjct:    1 MLCSNCSNNQDTLKLWMVHLASCHPLPPEWLSEKAKVLNDDENQRPYTIVTDSRKRRRRPTTPRPLNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKRVRRFGRAIYDRQPCTTERSNSTSATDEENGKDNNSVQDGRRSSDIENQYIRYSVLGKNIVKRECQSFNSPLKSDNVKLETQEQDFIQAMPKPLNVRITNYNENSIFLRQQRLPSSSTMYLLPSENLIISNGIMGSQDL----------------ENVNIDDEIDITGNIFSNDLDLEWSEIDENYKQDLPNLNSLFQH 318          
BLAST of SOXP-1 vs. Planmine SMEST
Match: SMESG000010063.1 (SMESG000010063.1)

HSP 1 Score: 370.933 bits (951), Expect = 2.317e-127
Identity = 191/195 (97.95%), Postives = 192/195 (98.46%), Query Frame = 2
Query:  215 MLCSNCSNNQDTLKLWMVHLASCHPLPPEWLSEKAKVLNDDENQRPYTIVTDSXXXXXXXXXXXXLNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKRVRRFGRAIYDRQPCTTERSNSTSATDEENGKDNNSVQDGRRSSDIENQYIRYSVLGKNI 799
            MLCSNCSNNQDTLKLWMVHLASCHPLPPEWLSEKAKVLNDDENQRPYTIVTDSRKRRRRPTTPRPLNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKRVRRFGRAIYDRQPCTTERSNSTSATDEENGKDNNSVQDGRRSSDIENQYIRYSVL   +
Sbjct:    1 MLCSNCSNNQDTLKLWMVHLASCHPLPPEWLSEKAKVLNDDENQRPYTIVTDSRKRRRRPTTPRPLNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKRVRRFGRAIYDRQPCTTERSNSTSATDEENGKDNNSVQDGRRSSDIENQYIRYSVLATTL 195          
BLAST of SOXP-1 vs. Planmine SMEST
Match: SMESG000074761.1 (SMESG000074761.1)

HSP 1 Score: 135.191 bits (339), Expect = 8.471e-34
Identity = 73/129 (56.59%), Postives = 97/129 (75.19%), Query Frame = 2
Query:  218 LCSNCSNNQDTLKLWMVHLASCHPLPPEWLSEKAKVLNDDENQRPYTIVTDSXXXXXXXXXXXXLNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYK 604
            LC  CS  Q++L+ WM HL   HPLP +W+S+ A  L DD+  +PY+ VT+SRK+R++  TPRPLN+FMIFSRH+RRN+L  F DASNS++SK LG LW  +   IKS+Y+ EAK+LA LH+ EFP+YK
Sbjct:   26 LCQKCSAYQNSLRDWMKHLVDRHPLPIQWMSDLANNLTDDKLSKPYSTVTESRKKRKKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILHSKEFPEYK 154          
BLAST of SOXP-1 vs. Planmine SMEST
Match: SMESG000011244.1 (SMESG000011244.1)

HSP 1 Score: 69.3218 bits (168), Expect = 3.111e-12
Identity = 30/77 (38.96%), Postives = 49/77 (63.64%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKRVRRFGR 640
            +N FM++SR  RR +    P   NS++SK LG +WK ++ E K  + +EAKRL   H  ++PDYKY+P+++ +   +
Sbjct:  260 MNAFMVWSRGQRRRMAQDNPKMHNSEISKRLGGMWKNLSEEDKKPFIDEAKRLRANHMTQYPDYKYRPRRKHKAMDK 336          
BLAST of SOXP-1 vs. Planmine SMEST
Match: SMESG000011244.1 (SMESG000011244.1)

HSP 1 Score: 69.3218 bits (168), Expect = 3.117e-12
Identity = 30/77 (38.96%), Postives = 49/77 (63.64%), Query Frame = 2
Query:  410 LNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKRVRRFGR 640
            +N FM++SR  RR +    P   NS++SK LG +WK ++ E K  + +EAKRL   H  ++PDYKY+P+++ +   +
Sbjct:  261 MNAFMVWSRGQRRRMAQDNPKMHNSEISKRLGGMWKNLSEEDKKPFIDEAKRLRANHMTQYPDYKYRPRRKHKAMDK 337          
The following BLAST results are available for this feature:
BLAST of SOXP-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SOX131.145e-1346.48SRY-box transcription factor 13 [Source:HGNC Symbo... [more]
SOX131.145e-1346.48SRY-box transcription factor 13 [Source:HGNC Symbo... [more]
SOX52.168e-1346.48SRY-box transcription factor 5 [Source:HGNC Symbol... [more]
SOX63.726e-1343.66SRY-box transcription factor 6 [Source:HGNC Symbol... [more]
SOX63.751e-1343.66SRY-box transcription factor 6 [Source:HGNC Symbol... [more]
back to top
BLAST of SOXP-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
egl-137.519e-1445.07Transcription factor egl-13 [Source:UniProtKB/Swi... [more]
egl-137.519e-1445.07Transcription factor egl-13 [Source:UniProtKB/Swi... [more]
egl-137.519e-1445.07Transcription factor egl-13 [Source:UniProtKB/Swi... [more]
egl-138.187e-1445.07Transcription factor egl-13 [Source:UniProtKB/Swi... [more]
egl-138.355e-1445.07Transcription factor egl-13 [Source:UniProtKB/Swi... [more]
back to top
BLAST of SOXP-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sox102F5.830e-1343.66gene:FBgn0039938 transcript:FBtr0089252[more]
Sox102F5.830e-1343.66gene:FBgn0039938 transcript:FBtr0334488[more]
Sox102F5.830e-1343.66gene:FBgn0039938 transcript:FBtr0334489[more]
Sox102F6.264e-1343.66gene:FBgn0039938 transcript:FBtr0100600[more]
Sox100B1.163e-1233.05gene:FBgn0024288 transcript:FBtr0085735[more]
back to top
BLAST of SOXP-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sox69.749e-1445.07SRY-box transcription factor 6 [Source:ZFIN;Acc:ZD... [more]
sox69.749e-1445.07SRY-box transcription factor 6 [Source:ZFIN;Acc:ZD... [more]
sox69.749e-1445.07SRY-box transcription factor 6 [Source:ZFIN;Acc:ZD... [more]
sox69.749e-1445.07SRY-box transcription factor 6 [Source:ZFIN;Acc:ZD... [more]
sox61.116e-1345.07SRY-box transcription factor 6 [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of SOXP-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
spidr3.403e-1343.66scaffold protein involved in DNA repair [Source:Xe... [more]
spidr3.728e-1343.66scaffold protein involved in DNA repair [Source:Xe... [more]
spidr3.740e-1343.66scaffold protein involved in DNA repair [Source:Xe... [more]
spidr3.800e-1343.66scaffold protein involved in DNA repair [Source:Xe... [more]
spidr3.842e-1343.66scaffold protein involved in DNA repair [Source:Xe... [more]
back to top
BLAST of SOXP-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sox138.108e-1446.48SRY (sex determining region Y)-box 13 [Source:MGI ... [more]
Sox138.108e-1446.48SRY (sex determining region Y)-box 13 [Source:MGI ... [more]
Sox138.844e-1446.48SRY (sex determining region Y)-box 13 [Source:MGI ... [more]
Sox51.517e-1346.48SRY (sex determining region Y)-box 5 [Source:MGI S... [more]
Sox62.459e-1343.66SRY (sex determining region Y)-box 6 [Source:MGI S... [more]
back to top
BLAST of SOXP-1 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9UN79|SOX13_HUMAN5.498e-1346.48Transcription factor SOX-13 OS=Homo sapiens OX=960... [more]
sp|Q04891|SOX13_MOUSE5.671e-1346.48Transcription factor SOX-13 OS=Mus musculus OX=100... [more]
sp|P36394|SRY_RAT1.255e-1242.47Sex-determining region Y protein (Fragment) OS=Rat... [more]
sp|Q23045|EGL13_CAEEL1.346e-1245.07Transcription factor egl-13 OS=Caenorhabditis eleg... [more]
sp|P47792|SX19A_DANRE1.455e-1243.84Transcription factor Sox-19a OS=Danio rerio OX=795... [more]
back to top
BLAST of SOXP-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|170421430.000e+095.21tr|H9CXU8|H9CXU8_SCHMD SOXP-1 OS=Schmidtea mediter... [more]
gnl|BL_ORD_ID|244410275.011e-3348.89tr|A0A3P7P8C9|A0A3P7P8C9_DIBLA HMG box domain-cont... [more]
gnl|BL_ORD_ID|212997531.269e-3252.24tr|A0A087W088|A0A087W088_ECHMU Transcription facto... [more]
gnl|BL_ORD_ID|161796622.596e-3252.24tr|A0A0R3WGL7|A0A0R3WGL7_TAEAS HMG box domain-cont... [more]
gnl|BL_ORD_ID|191138282.780e-3252.24tr|A0A068WSN2|A0A068WSN2_ECHGR Transcription facto... [more]
back to top
BLAST of SOXP-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sox19b1.590e-1337.50transcription factor Sox-19b [Source:NCBI gene;Acc... [more]
sox132.175e-1345.07SRY-box transcription factor 13 [Source:NCBI gene;... [more]
sox132.257e-1345.07SRY-box transcription factor 13 [Source:NCBI gene;... [more]
sox62.404e-1343.66SRY-box transcription factor 6 [Source:ZFIN;Acc:ZD... [more]
sox132.561e-1345.07SRY-box transcription factor 13 [Source:NCBI gene;... [more]
back to top
BLAST of SOXP-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008165.18.488e-1544.93pep scaffold:Pmarinus_7.0:GL479973:18969:29522:-1 ... [more]
ENSPMAT00000006684.18.760e-1341.67pep scaffold:Pmarinus_7.0:GL477399:28105:35473:-1 ... [more]
sox1b1.942e-1245.71SRY-box transcription factor 1b [Source:NCBI gene;... [more]
sox102.277e-1240.85SRY-box transcription factor 10 [Source:ZFIN;Acc:Z... [more]
ENSPMAT00000010223.13.113e-1242.25pep scaffold:Pmarinus_7.0:GL478813:2555:9375:-1 ge... [more]
back to top
BLAST of SOXP-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SOXP-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO360721.013e-1547.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO387553.677e-1549.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO476883.287e-1446.58Predicted protein; Sox family protein 2 [Source:U... [more]
EDO335163.772e-1445.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO394496.444e-1339.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SOXP-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sox6b1.274e-1345.07SRY-box containing gene 6b [Source:NCBI gene;Acc:1... [more]
sox6b1.310e-1345.07SRY-box containing gene 6b [Source:NCBI gene;Acc:1... [more]
sox6b1.351e-1345.07SRY-box containing gene 6b [Source:NCBI gene;Acc:1... [more]
sox6b1.523e-1345.07SRY-box containing gene 6b [Source:NCBI gene;Acc:1... [more]
sox6b1.523e-1345.07SRY-box containing gene 6b [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of SOXP-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000010063.10.000e+095.21SMESG000010063.1[more]
SMESG000010063.12.317e-12797.95SMESG000010063.1[more]
SMESG000074761.18.471e-3456.59SMESG000074761.1[more]
SMESG000011244.13.111e-1238.96SMESG000011244.1[more]
SMESG000011244.13.117e-1238.96SMESG000011244.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30019097
GenBankAFD29619.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019097 ID=SMED30019097|Name=SOXP-1|organism=Schmidtea mediterranea sexual|type=transcript|length=1596bp
GGAATAACAGCCAATTAGGGATCAGCTGCAATTTGGCCTATGATTGGACA
TTGATTTTTATAGTCTCAGGCGTTCTCAGCTTACGTGTGCACCTTTTTAG
TGGACACGTTAAATTTGATAGGTGCTTAGTGGTGTTGATTCCTGTTTGGA
AACTGTATATAACCAAGGTTATTTGTTGCTTTGAGACAAATGCAACACAA
TCAAATAATTAATTATGCTATGTTCAAATTGTTCAAACAATCAGGATACT
TTGAAATTATGGATGGTCCATTTAGCTTCTTGTCACCCATTACCTCCTGA
ATGGCTTAGTGAAAAGGCCAAAGTATTAAATGATGACGAAAATCAGCGCC
CCTATACAATTGTCACTGATTCCCGAAAAAGAAGGCGACGTCCAACCACA
CCAAGACCACTAAATACGTTCATGATTTTTTCGAGGCATATCAGACGAAA
TATTCTCTCAGTGTTTCCGGATGCATCAAATTCCCAATTAAGCAAAGAGC
TTGGAATTTTATGGAAGAAAGTCACAAATGAAATTAAATCCCTTTATGAA
GAAGAGGCAAAGCGATTGGCTCAATTACATGCTCTTGAATTTCCCGATTA
TAAATATCAACCAAAGAAACGAGTCCGAAGATTTGGAAGAGCGATTTATG
ATCGACAGCCCTGTACAACAGAAAGATCTAACTCAACTAGTGCAACAGAC
GAAGAAAATGGTAAAGACAATAATAGTGTTCAAGACGGTAGAAGATCAAG
CGATATTGAGAATCAGTATATAAGATATTCAGTTTTGGGTAAAAATATTG
TAAAACGAGAATGTCAGTCCTTTAATAGTCCTTTAAAAAGCGACAACGTT
AAATTGGAAACGCAAGAACAAGATTTTATCCAAGCGATGCCCAAACCTCT
AAACGTCCGAATAACGAATTACAACGAAAACAGTATATTTTTACGACAAC
AAAGATTACCATCAAGTAGCACAATGTATTTACTTCCTTCAGAAAACCTA
ATAATTAGTAATGGGATTATGGGATCACAGGACTTGGGTGAGGATTATTG
TAGAGAGTTGTATATAATTAATGATTTTTTCCCAGAAAATGTAAACATAG
ACGATGAAATTGATATAACAGGAAACATTTTTAGCAATGATTTAGATTTA
GAGTGGTCTGAAATTGATGAAAATTACAAACAAGATTTACCAAATCTTAA
TTCATTATTTCAACACTAATATATTTGATTTATAAAATATTTAAATATTT
TTTATTAAACAGTCTTTTACATGTACATATAGTATTGGAACTCTTCTCTG
ACTTATAAGATAACAGAGATATTGTAATAAGATTAAATTGGTTATGTGTT
TCGGTTTTTGTAAGATTGGTAATTTTCAGAAGAATTTAGACTTTTTTCAT
GGAAATTGGAATTGAGAAACAAACTGAATAAAGAAACAAATTTTTGAAAA
AAACGAAACAGATACTTATTATCAAAAGAAAATTATCTGAAGCATCGAGT
CGGTATGAAAAATAAACTAATTAGTCAGAAAATTTTTGATGAAATAACGT
CTAATGAAATTAAGATCTCCAAGGAATACTTTTTCTAACATTTGAT
back to top

protein sequence of SMED30019097-orf-1

>SMED30019097-orf-1 ID=SMED30019097-orf-1|Name=SMED30019097-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=335bp
MLCSNCSNNQDTLKLWMVHLASCHPLPPEWLSEKAKVLNDDENQRPYTIV
TDSRKRRRRPTTPRPLNTFMIFSRHIRRNILSVFPDASNSQLSKELGILW
KKVTNEIKSLYEEEAKRLAQLHALEFPDYKYQPKKRVRRFGRAIYDRQPC
TTERSNSTSATDEENGKDNNSVQDGRRSSDIENQYIRYSVLGKNIVKREC
QSFNSPLKSDNVKLETQEQDFIQAMPKPLNVRITNYNENSIFLRQQRLPS
SSTMYLLPSENLIISNGIMGSQDLGEDYCRELYIINDFFPENVNIDDEID
ITGNIFSNDLDLEWSEIDENYKQDLPNLNSLFQH*
back to top
Aliases
The feature 'SOXP-1' has the following synonyms
Synonym
SOXP-1
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000020protonephridia
PLANA:0000099neuron
PLANA:0002075pigment cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0004517blastomere
PLANA:0000429neoblast
PLANA:0000009sigma neoblast
Vocabulary: INTERPRO
TermDefinition
IPR036910HMG_box_dom_sf
IPR009071HMG_box_dom
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000006Stage 6
PLANA:0000007Stage 7
PLANA:0000005Stage 5
PLANA:0000008Stage 8
PLANA:0000004Stage 4
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR009071High mobility group box domainSMARTSM00398hmgende2coord: 61..131
e-value: 1.1E-19
score: 81.4
IPR009071High mobility group box domainPFAMPF00505HMG_boxcoord: 63..130
e-value: 4.0E-16
score: 59.2
IPR009071High mobility group box domainPROSITEPS50118HMG_BOX_2coord: 62..130
score: 16.295
IPR036910High mobility group box domain superfamilyGENE3DG3DSA:1.10.30.10coord: 60..139
e-value: 1.9E-21
score: 78.3
IPR036910High mobility group box domain superfamilySUPERFAMILYSSF47095HMG-boxcoord: 52..133
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 148..178
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 149..166
NoneNo IPR availablePANTHERPTHR45789:SF2FI18025P1coord: 46..167
NoneNo IPR availablePANTHERPTHR45789FAMILY NOT NAMEDcoord: 46..167