Protein flightless-1

Overview
NameProtein flightless-1
Smed IDSMED30019094
Length (bp)4553
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein flightless-1 (SMED30019094) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein flightless-1 (SMED30019094) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein flightless-1 (SMED30019094) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein flightless-1 (SMED30019094) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019094

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30019094SMESG000020935.1 Contig3539GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30019094SMESG000020935.1 dd_Smed_v4_1781_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30019094SMESG000020935.1 dd_Smed_v4_1781_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30019094SMESG000020935.1 dd_Smed_v4_1781_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30019094SMESG000020935.1 dd_Smed_v4_1781_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30019094SMESG000020935.1 dd_Smed_v4_1781_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30019094SMESG000020935.1 dd_Smed_v4_1781_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein flightless-1 vs. Ensembl Human
Match: FLII (FLII actin remodeling protein [Source:HGNC Symbol;Acc:HGNC:3750])

HSP 1 Score: 816.224 bits (2107), Expect = 0.000e+0
Identity = 533/1325 (40.23%), Postives = 778/1325 (58.72%), Query Frame = 2
Query:  512 SKSVSQFLLGIDLSCVEIKDNDCSEAFSNMTRIQWLKLVSTGLEQIPKGVEKLTQLQRLTISKNNINKLSGDWCTELKALRVFNARKNKLTDDSLPEQLFNNPQLQVVDLSFNLLTEVPAGLVEAKSLLVLNLSDNQIKNVSKDLFANCVSLMILDLSNNQIVGFPTXXXXXXXXXXXXXXXXXXXXXXXRSINGXXXXXXXXXXXXXXXXENIPSDLDKLPCLQDLDISDNNLPKVPQTIYEITSLTKLNLSGNEIDELSGLVDCWPNLEVXXXXXXXXXXXPSFITRLSKLKKLYVDENRLTFNGIPPGIGKLSNLEVFSASENLLENIPEGLCRCGQLKHLNLRMNKLVTLPDAINVLIESLKTFNIENNPNLKMPPKLVEVDLKSKYAFYNIDFSLETQMQLARGAPAKASSKSVTQKHKFTQDTASRIRRLRRKKIDEKSEKGSDSKRVLEGMQKVAKDKDAIMEDREKEEKLLSAK--KWQDAIAKPNLDYSKLFDDDVGIEPGIELWDMDDFYPRRITDELPLGTFFDGDCYIILHTSLDEKSHTSLNHSIYYWIGSQASLDKVTASAVHAVYLRNYLSTNCRCERTEQGDESPEFVALFEGNIIVCEGARGQTGFLKTEDKEHRKKMYRLFGADKSISIYSLDPTP---ENLDSKFVYLFDESSTRLFLWIGNKSRLMLQTKGRLLADNINQTERKGQSEIITERENSESDEFKNSLQSSSGIDSLDWSNLSSKEVSIDWKPPTPILYDVKLGRGYLEMPQIE---------------LPNGRLVKSLLEAKHVYILDSNGDMFVWIGDMAPKFLKFAGXXXXXXXXXXXXXXXXXXXTVCCQTSEPQIFKMQFADWVDTCAVDFTRSVESVRK----RGVNLXXXXXXXXXXXXXRAFFMPRERPMPLEDAKAIMEDCNEDLVGNNMDSNDGKPFKIKQFVYLNRNWVLVEDKWIGHFFNQDCYIVHAEYWXXXXXXXXXXXXXXXXXXXSR-----------------IQTVIYFWQGREASDIPWLQFNFSLKKEMEIKFSGMDNMSTTKDSFKKVETKRMFQQQEISTFLAHFQHRFVIHLGKYQDRYSDQRKNRIELYYLRENGNALCTRTIEVKPMIAFVNSCFHYIMKIPAAASKTENDQ--IICWIGKNSDSHYDEVLQAVAADTFPESSDILTVKEGAEP-GIFWQALGGKKNYDHEAQFMSFSRLFRLSNEQGFFCASEKCSDFCQDDLADEDVMLLDTGSQIYLWFGNRTSDVEKKLSYKAAKLYQEHMARIQPDRIRQLKITQKKKEPHNFRRCFHGWGPFKEAM 4354
            +  V  F+ G+DLS  + K     E    MT ++WLKL  TGL  +P+ +  L +L+ L++S NN+  L G+  + L +LR   AR N L +  +P+ +F    L V+DLS N LTE P  L  AK++LVLNLS N I  +   LF N   L+ LDLS N++   P  +RR  +LQ+L L+ NPL  +QLR +  +  L TL L +T R   N+P+ L+ L  L D+D+S N+L +VP+ +Y + SL +LNLS N+I ELS  +D W ++E LNLSRN+L SLPS I +LSKLKKLY++ N+L F+G+P GIGKL+NLE F A+ N LE +PE LCRC +L+ L L  N LVTLP+AI+ L E ++  ++  NPNL MPPK  +        +YNIDFSL+ Q++LA    + A+  +        +D  +R  RLRR+K    S +   +K+VL+GM  VA++K+   E+   + +  S K  +W   + KP LDYS+ F +DVG  PG+ +W +++F P  + +E   G F++ DCYI+L T LD+    SLN  IYYWIG +A+LDK   SA+HAV LRNYL   CR  R E GDES EF+ +F+ +I   EG    +GF   ED  +  +MYR++G  K+I    L+P P    +LD +FV+L D     +++W G ++ L   TK RL A+ IN+ ERKG++EI    +  E  EF  +L            +   K V  D+ PP P LY V LG GYLE+PQI                +P  RL++SLL+ + VYILD   D+F+W+G  +P+ ++ A LKL  EL  +L R    + +   + +E Q+FK +F +W D   VD+TR+ E+V +     G    D  +KD+MK D+ A F+PR+ PM L +A+ +ME+ NEDL G            ++ FV   + +  + ++  GHF+ QDCY+    YW   E ++ + +ED  ++   +                  Q ++YFWQGREAS++ WL F FSL+K+ E  F G            K+E  RM QQQE   FL+HF+ +F+IH GK   R + Q   +  LY +R NG+ALCTR I++    + +NS F +I+K+P    ++E++Q  +  W+G+ SD    ++ + +    F  S     + EG EP   FW  +G +K YD +A++M  +RLFR SNE+G+F  +EKCSDFCQDDLAD+D+MLLD G ++Y+W G +TS VE KLS KA ++Y +HM   + +R R+L++ +K  E H F RCFH W  F +A+
Sbjct:    3 ATGVLPFVRGVDLSGNDFKGGYFPENVKAMTSLRWLKLNRTGLCYLPEELAALQKLEHLSVSHNNLTTLHGE-LSSLPSLRAIVARANSLKNSGVPDDIFKLDDLSVLDLSHNQLTECPRELENAKNMLVLNLSHNSIDTIPNQLFINLTDLLYLDLSENRLESLPPQMRRLVHLQTLVLNGNPLLHAQLRQLPAMTALQTLHLRSTQRTQSNLPTSLEGLSNLADVDLSCNDLTRVPECLYTLPSLRRLNLSSNQITELSLCIDQWVHVETLNLSRNQLTSLPSAICKLSKLKKLYLNSNKLDFDGLPSGIGKLTNLEEFMAANNNLELVPESLCRCPKLRKLVLNKNHLVTLPEAIHFLTE-IEVLDVRENPNLVMPPKPAD----RAAEWYNIDFSLQNQLRLA--GASPATVAAAAAAGSGPKDPMARKMRLRRRK---DSAQDDQAKQVLKGMSDVAQEKNKKQEE-SADARAPSGKVRRWDQGLEKPRLDYSEFFTEDVGQLPGLTIWQIENFVP-VLVEEAFHGKFYEADCYIVLKTFLDDSG--SLNWEIYYWIGGEATLDKKACSAIHAVNLRNYLGAECRTVREEMGDESEEFLQVFDNDISYIEGGTA-SGFYTVEDTHYVTRMYRVYG-KKNI---KLEPVPLKGTSLDPRFVFLLDR-GLDIYVWRGAQATLSSTTKARLFAEKINKNERKGKAEITLLVQGQELPEFWEALGGE--------PSEIKKHVPEDFWPPQPKLYKVGLGLGYLELPQINYKLSVEHKQRPKVELMPRMRLLQSLLDTRCVYILDCWSDVFIWLGRKSPRLVRAAALKLGQELCGMLHRPRHATVSRSLEGTEAQVFKAKFKNWDDVLTVDYTRNAEAVLQSPGLSGKVKRDAEKKDQMKADLTALFLPRQPPMSLAEAEQLMEEWNEDLDG------------MEGFVLEGKKFARLPEEEFGHFYTQDCYVFLCRYWVPVEYEEEEKKEDKEEKAEGKEGEEATAEAEEKQPEEDFQCIVYFWQGREASNMGWLTFTFSLQKKFESLFPG------------KLEVVRMTQQQENPKFLSHFKRKFIIHRGK---RKAVQGAQQPSLYQIRTNGSALCTRCIQINTDSSLLNSEFCFILKVPF---ESEDNQGIVYAWVGRASDPDEAKLAEDILNTMFDTSYSKQVINEGEEPENFFWVGIGAQKPYDDDAEYMKHTRLFRCSNEKGYFAVTEKCSDFCQDDLADDDIMLLDNGQEVYMWVGTQTSQVEIKLSLKACQVYIQHMRSKEHERPRRLRLVRKGNEQHAFTRCFHAWSAFCKAL 1268          
BLAST of Protein flightless-1 vs. Ensembl Human
Match: FLII (FLII actin remodeling protein [Source:HGNC Symbol;Acc:HGNC:3750])

HSP 1 Score: 816.224 bits (2107), Expect = 0.000e+0
Identity = 533/1325 (40.23%), Postives = 778/1325 (58.72%), Query Frame = 2
Query:  512 SKSVSQFLLGIDLSCVEIKDNDCSEAFSNMTRIQWLKLVSTGLEQIPKGVEKLTQLQRLTISKNNINKLSGDWCTELKALRVFNARKNKLTDDSLPEQLFNNPQLQVVDLSFNLLTEVPAGLVEAKSLLVLNLSDNQIKNVSKDLFANCVSLMILDLSNNQIVGFPTXXXXXXXXXXXXXXXXXXXXXXXRSINGXXXXXXXXXXXXXXXXENIPSDLDKLPCLQDLDISDNNLPKVPQTIYEITSLTKLNLSGNEIDELSGLVDCWPNLEVXXXXXXXXXXXPSFITRLSKLKKLYVDENRLTFNGIPPGIGKLSNLEVFSASENLLENIPEGLCRCGQLKHLNLRMNKLVTLPDAINVLIESLKTFNIENNPNLKMPPKLVEVDLKSKYAFYNIDFSLETQMQLARGAPAKASSKSVTQKHKFTQDTASRIRRLRRKKIDEKSEKGSDSKRVLEGMQKVAKDKDAIMEDREKEEKLLSAK--KWQDAIAKPNLDYSKLFDDDVGIEPGIELWDMDDFYPRRITDELPLGTFFDGDCYIILHTSLDEKSHTSLNHSIYYWIGSQASLDKVTASAVHAVYLRNYLSTNCRCERTEQGDESPEFVALFEGNIIVCEGARGQTGFLKTEDKEHRKKMYRLFGADKSISIYSLDPTP---ENLDSKFVYLFDESSTRLFLWIGNKSRLMLQTKGRLLADNINQTERKGQSEIITERENSESDEFKNSLQSSSGIDSLDWSNLSSKEVSIDWKPPTPILYDVKLGRGYLEMPQIE---------------LPNGRLVKSLLEAKHVYILDSNGDMFVWIGDMAPKFLKFAGXXXXXXXXXXXXXXXXXXXTVCCQTSEPQIFKMQFADWVDTCAVDFTRSVESVRK----RGVNLXXXXXXXXXXXXXRAFFMPRERPMPLEDAKAIMEDCNEDLVGNNMDSNDGKPFKIKQFVYLNRNWVLVEDKWIGHFFNQDCYIVHAEYWXXXXXXXXXXXXXXXXXXXSR-----------------IQTVIYFWQGREASDIPWLQFNFSLKKEMEIKFSGMDNMSTTKDSFKKVETKRMFQQQEISTFLAHFQHRFVIHLGKYQDRYSDQRKNRIELYYLRENGNALCTRTIEVKPMIAFVNSCFHYIMKIPAAASKTENDQ--IICWIGKNSDSHYDEVLQAVAADTFPESSDILTVKEGAEP-GIFWQALGGKKNYDHEAQFMSFSRLFRLSNEQGFFCASEKCSDFCQDDLADEDVMLLDTGSQIYLWFGNRTSDVEKKLSYKAAKLYQEHMARIQPDRIRQLKITQKKKEPHNFRRCFHGWGPFKEAM 4354
            +  V  F+ G+DLS  + K     E    MT ++WLKL  TGL  +P+ +  L +L+ L++S NN+  L G+  + L +LR   AR N L +  +P+ +F    L V+DLS N LTE P  L  AK++LVLNLS N I  +   LF N   L+ LDLS N++   P  +RR  +LQ+L L+ NPL  +QLR +  +  L TL L +T R   N+P+ L+ L  L D+D+S N+L +VP+ +Y + SL +LNLS N+I ELS  +D W ++E LNLSRN+L SLPS I +LSKLKKLY++ N+L F+G+P GIGKL+NLE F A+ N LE +PE LCRC +L+ L L  N LVTLP+AI+ L E ++  ++  NPNL MPPK  +        +YNIDFSL+ Q++LA    + A+  +        +D  +R  RLRR+K    S +   +K+VL+GM  VA++K+   E+   + +  S K  +W   + KP LDYS+ F +DVG  PG+ +W +++F P  + +E   G F++ DCYI+L T LD+    SLN  IYYWIG +A+LDK   SA+HAV LRNYL   CR  R E GDES EF+ +F+ +I   EG    +GF   ED  +  +MYR++G  K+I    L+P P    +LD +FV+L D     +++W G ++ L   TK RL A+ IN+ ERKG++EI    +  E  EF  +L            +   K V  D+ PP P LY V LG GYLE+PQI                +P  RL++SLL+ + VYILD   D+F+W+G  +P+ ++ A LKL  EL  +L R    + +   + +E Q+FK +F +W D   VD+TR+ E+V +     G    D  +KD+MK D+ A F+PR+ PM L +A+ +ME+ NEDL G            ++ FV   + +  + ++  GHF+ QDCY+    YW   E ++ + +ED  ++   +                  Q ++YFWQGREAS++ WL F FSL+K+ E  F G            K+E  RM QQQE   FL+HF+ +F+IH GK   R + Q   +  LY +R NG+ALCTR I++    + +NS F +I+K+P    ++E++Q  +  W+G+ SD    ++ + +    F  S     + EG EP   FW  +G +K YD +A++M  +RLFR SNE+G+F  +EKCSDFCQDDLAD+D+MLLD G ++Y+W G +TS VE KLS KA ++Y +HM   + +R R+L++ +K  E H F RCFH W  F +A+
Sbjct:    3 ATGVLPFVRGVDLSGNDFKGGYFPENVKAMTSLRWLKLNRTGLCYLPEELAALQKLEHLSVSHNNLTTLHGE-LSSLPSLRAIVARANSLKNSGVPDDIFKLDDLSVLDLSHNQLTECPRELENAKNMLVLNLSHNSIDTIPNQLFINLTDLLYLDLSENRLESLPPQMRRLVHLQTLVLNGNPLLHAQLRQLPAMTALQTLHLRSTQRTQSNLPTSLEGLSNLADVDLSCNDLTRVPECLYTLPSLRRLNLSSNQITELSLCIDQWVHVETLNLSRNQLTSLPSAICKLSKLKKLYLNSNKLDFDGLPSGIGKLTNLEEFMAANNNLELVPESLCRCPKLRKLVLNKNHLVTLPEAIHFLTE-IEVLDVRENPNLVMPPKPAD----RAAEWYNIDFSLQNQLRLA--GASPATVAAAAAAGSGPKDPMARKMRLRRRK---DSAQDDQAKQVLKGMSDVAQEKNKKQEE-SADARAPSGKVRRWDQGLEKPRLDYSEFFTEDVGQLPGLTIWQIENFVP-VLVEEAFHGKFYEADCYIVLKTFLDDSG--SLNWEIYYWIGGEATLDKKACSAIHAVNLRNYLGAECRTVREEMGDESEEFLQVFDNDISYIEGGTA-SGFYTVEDTHYVTRMYRVYG-KKNI---KLEPVPLKGTSLDPRFVFLLDR-GLDIYVWRGAQATLSSTTKARLFAEKINKNERKGKAEITLLVQGQELPEFWEALGGE--------PSEIKKHVPEDFWPPQPKLYKVGLGLGYLELPQINYKLSVEHKQRPKVELMPRMRLLQSLLDTRCVYILDCWSDVFIWLGRKSPRLVRAAALKLGQELCGMLHRPRHATVSRSLEGTEAQVFKAKFKNWDDVLTVDYTRNAEAVLQSPGLSGKVKRDAEKKDQMKADLTALFLPRQPPMSLAEAEQLMEEWNEDLDG------------MEGFVLEGKKFARLPEEEFGHFYTQDCYVFLCRYWVPVEYEEEEKKEDKEEKAEGKEGEEATAEAEEKQPEEDFQCIVYFWQGREASNMGWLTFTFSLQKKFESLFPG------------KLEVVRMTQQQENPKFLSHFKRKFIIHRGK---RKAVQGAQQPSLYQIRTNGSALCTRCIQINTDSSLLNSEFCFILKVPF---ESEDNQGIVYAWVGRASDPDEAKLAEDILNTMFDTSYSKQVINEGEEPENFFWVGIGAQKPYDDDAEYMKHTRLFRCSNEKGYFAVTEKCSDFCQDDLADDDIMLLDNGQEVYMWVGTQTSQVEIKLSLKACQVYIQHMRSKEHERPRRLRLVRKGNEQHAFTRCFHAWSAFCKAL 1268          
BLAST of Protein flightless-1 vs. Ensembl Human
Match: FLII (FLII actin remodeling protein [Source:HGNC Symbol;Acc:HGNC:3750])

HSP 1 Score: 807.749 bits (2085), Expect = 0.000e+0
Identity = 526/1301 (40.43%), Postives = 767/1301 (58.95%), Query Frame = 2
Query:  584 EAFSNMTRIQWLKLVSTGLEQIPKGVEKLTQLQRLTISKNNINKLSGDWCTELKALRVFNARKNKLTDDSLPEQLFNNPQLQVVDLSFNLLTEVPAGLVEAKSLLVLNLSDNQIKNVSKDLFANCVSLMILDLSNNQIVGFPTXXXXXXXXXXXXXXXXXXXXXXXRSINGXXXXXXXXXXXXXXXXENIPSDLDKLPCLQDLDISDNNLPKVPQTIYEITSLTKLNLSGNEIDELSGLVDCWPNLEVXXXXXXXXXXXPSFITRLSKLKKLYVDENRLTFNGIPPGIGKLSNLEVFSASENLLENIPEGLCRCGQLKHLNLRMNKLVTLPDAINVLIESLKTFNIENNPNLKMPPKLVEVDLKSKYAFYNIDFSLETQMQLARGAPAKASSKSVTQKHKFTQDTASRIRRLRRKKIDEKSEKGSDSKRVLEGMQKVAKDKDAIMEDREKEEKLLSAK--KWQDAIAKPNLDYSKLFDDDVGIEPGIELWDMDDFYPRRITDELPLGTFFDGDCYIILHTSLDEKSHTSLNHSIYYWIGSQASLDKVTASAVHAVYLRNYLSTNCRCERTEQGDESPEFVALFEGNIIVCEGARGQTGFLKTEDKEHRKKMYRLFGADKSISIYSLDPTP---ENLDSKFVYLFDESSTRLFLWIGNKSRLMLQTKGRLLADNINQTERKGQSEIITERENSESDEFKNSLQSSSGIDSLDWSNLSSKEVSIDWKPPTPILYDVKLGRGYLEMPQIE---------------LPNGRLVKSLLEAKHVYILDSNGDMFVWIGDMAPKFLKFAGXXXXXXXXXXXXXXXXXXXTVCCQTSEPQIFKMQFADWVDTCAVDFTRSVESVRK----RGVNLXXXXXXXXXXXXXRAFFMPRERPMPLEDAKAIMEDCNEDLVGNNMDSNDGKPFKIKQFVYLNRNWVLVEDKWIGHFFNQDCYIVHAEYWXXXXXXXXXXXXXXXXXXXSR-----------------IQTVIYFWQGREASDIPWLQFNFSLKKEMEIKFSGMDNMSTTKDSFKKVETKRMFQQQEISTFLAHFQHRFVIHLGKYQDRYSDQRKNRIELYYLRENGNALCTRTIEVKPMIAFVNSCFHYIMKIPAAASKTENDQ--IICWIGKNSDSHYDEVLQAVAADTFPESSDILTVKEGAEP-GIFWQALGGKKNYDHEAQFMSFSRLFRLSNEQGFFCASEKCSDFCQDDLADEDVMLLDTGSQIYLWFGNRTSDVEKKLSYKAAKLYQEHMARIQPDRIRQLKITQKKKEPHNFRRCFHGWGPFKEAM 4354
            E    MT ++WLKL  TGL  +P+ +  L +L+ L++S NN+  L G+  + L +LR   AR N L +  +P+ +F    L V+DLS N LTE P  L  AK++LVLNLS N I  +   LF N   L+ LDLS N++   P  +RR  +LQ+L L+ NPL  +QLR +  +  L TL L +T R   N+P+ L+ L  L D+D+S N+L +VP+ +Y + SL +LNLS N+I ELS  +D W ++E LNLSRN+L SLPS I +LSKLKKLY++ N+L F+G+P GIGKL+NLE F A+ N LE +PE LCRC +L+ L L  N LVTLP+AI+ L E ++  ++  NPNL MPPK  +        +YNIDFSL+ Q++LA    + A+  +        +D  +R  RLRR+K    S +   +K+VL+GM  VA++K+   E+   + +  S K  +W   + KP LDYS+ F +DVG  PG+ +W +++F P  + +E   G F++ DCYI+L T LD+    SLN  IYYWIG +A+LDK   SA+HAV LRNYL   CR  R E GDES EF+ +F+ +I   EG    +GF   ED  +  +MYR++G  K+I    L+P P    +LD +FV+L D     +++W G ++ L   TK RL A+ IN+ ERKG++EI    +  E  EF  +L            +   K V  D+ PP P LY V LG GYLE+PQI                +P  RL++SLL+ + VYILD   D+F+W+G  +P+ ++ A LKL  EL  +L R    + +   + +E Q+FK +F +W D   VD+TR+ E+V +     G    D  +KD+MK D+ A F+PR+ PM L +A+ +ME+ NEDL G            ++ FV   + +  + ++  GHF+ QDCY+    YW   E ++ + +ED  ++   +                  Q ++YFWQGREAS++ WL F FSL+K+ E  F G            K+E  RM QQQE   FL+HF+ +F+IH GK   R + Q   +  LY +R NG+ALCTR I++    + +NS F +I+K+P    ++E++Q  +  W+G+ SD    ++ + +    F  S     + EG EP   FW  +G +K YD +A++M  +RLFR SNE+G+F  +EKCSDFCQDDLAD+D+MLLD G ++Y+W G +TS VE KLS KA ++Y +HM   + +R R+L++ +K  E H F RCFH W  F +A+
Sbjct:   16 ENVKAMTSLRWLKLNRTGLCYLPEELAALQKLEHLSVSHNNLTTLHGE-LSSLPSLRAIVARANSLKNSGVPDDIFKLDDLSVLDLSHNQLTECPRELENAKNMLVLNLSHNSIDTIPNQLFINLTDLLYLDLSENRLESLPPQMRRLVHLQTLVLNGNPLLHAQLRQLPAMTALQTLHLRSTQRTQSNLPTSLEGLSNLADVDLSCNDLTRVPECLYTLPSLRRLNLSSNQITELSLCIDQWVHVETLNLSRNQLTSLPSAICKLSKLKKLYLNSNKLDFDGLPSGIGKLTNLEEFMAANNNLELVPESLCRCPKLRKLVLNKNHLVTLPEAIHFLTE-IEVLDVRENPNLVMPPKPAD----RAAEWYNIDFSLQNQLRLA--GASPATVAAAAAAGSGPKDPMARKMRLRRRK---DSAQDDQAKQVLKGMSDVAQEKNKKQEE-SADARAPSGKVRRWDQGLEKPRLDYSEFFTEDVGQLPGLTIWQIENFVP-VLVEEAFHGKFYEADCYIVLKTFLDDSG--SLNWEIYYWIGGEATLDKKACSAIHAVNLRNYLGAECRTVREEMGDESEEFLQVFDNDISYIEGGTA-SGFYTVEDTHYVTRMYRVYG-KKNI---KLEPVPLKGTSLDPRFVFLLDR-GLDIYVWRGAQATLSSTTKARLFAEKINKNERKGKAEITLLVQGQELPEFWEALGGE--------PSEIKKHVPEDFWPPQPKLYKVGLGLGYLELPQINYKLSVEHKQRPKVELMPRMRLLQSLLDTRCVYILDCWSDVFIWLGRKSPRLVRAAALKLGQELCGMLHRPRHATVSRSLEGTEAQVFKAKFKNWDDVLTVDYTRNAEAVLQSPGLSGKVKRDAEKKDQMKADLTALFLPRQPPMSLAEAEQLMEEWNEDLDG------------MEGFVLEGKKFARLPEEEFGHFYTQDCYVFLCRYWVPVEYEEEEKKEDKEEKAEGKEGEEATAEAEEKQPEEDFQCIVYFWQGREASNMGWLTFTFSLQKKFESLFPG------------KLEVVRMTQQQENPKFLSHFKRKFIIHRGK---RKAVQGAQQPSLYQIRTNGSALCTRCIQINTDSSLLNSEFCFILKVPF---ESEDNQGIVYAWVGRASDPDEAKLAEDILNTMFDTSYSKQVINEGEEPENFFWVGIGAQKPYDDDAEYMKHTRLFRCSNEKGYFAVTEKCSDFCQDDLADDDIMLLDNGQEVYMWVGTQTSQVEIKLSLKACQVYIQHMRSKEHERPRRLRLVRKGNEQHAFTRCFHAWSAFCKAL 1257          
BLAST of Protein flightless-1 vs. Ensembl Human
Match: FLII (FLII actin remodeling protein [Source:HGNC Symbol;Acc:HGNC:3750])

HSP 1 Score: 807.749 bits (2085), Expect = 0.000e+0
Identity = 526/1301 (40.43%), Postives = 767/1301 (58.95%), Query Frame = 2
Query:  584 EAFSNMTRIQWLKLVSTGLEQIPKGVEKLTQLQRLTISKNNINKLSGDWCTELKALRVFNARKNKLTDDSLPEQLFNNPQLQVVDLSFNLLTEVPAGLVEAKSLLVLNLSDNQIKNVSKDLFANCVSLMILDLSNNQIVGFPTXXXXXXXXXXXXXXXXXXXXXXXRSINGXXXXXXXXXXXXXXXXENIPSDLDKLPCLQDLDISDNNLPKVPQTIYEITSLTKLNLSGNEIDELSGLVDCWPNLEVXXXXXXXXXXXPSFITRLSKLKKLYVDENRLTFNGIPPGIGKLSNLEVFSASENLLENIPEGLCRCGQLKHLNLRMNKLVTLPDAINVLIESLKTFNIENNPNLKMPPKLVEVDLKSKYAFYNIDFSLETQMQLARGAPAKASSKSVTQKHKFTQDTASRIRRLRRKKIDEKSEKGSDSKRVLEGMQKVAKDKDAIMEDREKEEKLLSAK--KWQDAIAKPNLDYSKLFDDDVGIEPGIELWDMDDFYPRRITDELPLGTFFDGDCYIILHTSLDEKSHTSLNHSIYYWIGSQASLDKVTASAVHAVYLRNYLSTNCRCERTEQGDESPEFVALFEGNIIVCEGARGQTGFLKTEDKEHRKKMYRLFGADKSISIYSLDPTP---ENLDSKFVYLFDESSTRLFLWIGNKSRLMLQTKGRLLADNINQTERKGQSEIITERENSESDEFKNSLQSSSGIDSLDWSNLSSKEVSIDWKPPTPILYDVKLGRGYLEMPQIE---------------LPNGRLVKSLLEAKHVYILDSNGDMFVWIGDMAPKFLKFAGXXXXXXXXXXXXXXXXXXXTVCCQTSEPQIFKMQFADWVDTCAVDFTRSVESVRK----RGVNLXXXXXXXXXXXXXRAFFMPRERPMPLEDAKAIMEDCNEDLVGNNMDSNDGKPFKIKQFVYLNRNWVLVEDKWIGHFFNQDCYIVHAEYWXXXXXXXXXXXXXXXXXXXSR-----------------IQTVIYFWQGREASDIPWLQFNFSLKKEMEIKFSGMDNMSTTKDSFKKVETKRMFQQQEISTFLAHFQHRFVIHLGKYQDRYSDQRKNRIELYYLRENGNALCTRTIEVKPMIAFVNSCFHYIMKIPAAASKTENDQ--IICWIGKNSDSHYDEVLQAVAADTFPESSDILTVKEGAEP-GIFWQALGGKKNYDHEAQFMSFSRLFRLSNEQGFFCASEKCSDFCQDDLADEDVMLLDTGSQIYLWFGNRTSDVEKKLSYKAAKLYQEHMARIQPDRIRQLKITQKKKEPHNFRRCFHGWGPFKEAM 4354
            E    MT ++WLKL  TGL  +P+ +  L +L+ L++S NN+  L G+  + L +LR   AR N L +  +P+ +F    L V+DLS N LTE P  L  AK++LVLNLS N I  +   LF N   L+ LDLS N++   P  +RR  +LQ+L L+ NPL  +QLR +  +  L TL L +T R   N+P+ L+ L  L D+D+S N+L +VP+ +Y + SL +LNLS N+I ELS  +D W ++E LNLSRN+L SLPS I +LSKLKKLY++ N+L F+G+P GIGKL+NLE F A+ N LE +PE LCRC +L+ L L  N LVTLP+AI+ L E ++  ++  NPNL MPPK  +        +YNIDFSL+ Q++LA    + A+  +        +D  +R  RLRR+K    S +   +K+VL+GM  VA++K+   E+   + +  S K  +W   + KP LDYS+ F +DVG  PG+ +W +++F P  + +E   G F++ DCYI+L T LD+    SLN  IYYWIG +A+LDK   SA+HAV LRNYL   CR  R E GDES EF+ +F+ +I   EG    +GF   ED  +  +MYR++G  K+I    L+P P    +LD +FV+L D     +++W G ++ L   TK RL A+ IN+ ERKG++EI    +  E  EF  +L            +   K V  D+ PP P LY V LG GYLE+PQI                +P  RL++SLL+ + VYILD   D+F+W+G  +P+ ++ A LKL  EL  +L R    + +   + +E Q+FK +F +W D   VD+TR+ E+V +     G    D  +KD+MK D+ A F+PR+ PM L +A+ +ME+ NEDL G            ++ FV   + +  + ++  GHF+ QDCY+    YW   E ++ + +ED  ++   +                  Q ++YFWQGREAS++ WL F FSL+K+ E  F G            K+E  RM QQQE   FL+HF+ +F+IH GK   R + Q   +  LY +R NG+ALCTR I++    + +NS F +I+K+P    ++E++Q  +  W+G+ SD    ++ + +    F  S     + EG EP   FW  +G +K YD +A++M  +RLFR SNE+G+F  +EKCSDFCQDDLAD+D+MLLD G ++Y+W G +TS VE KLS KA ++Y +HM   + +R R+L++ +K  E H F RCFH W  F +A+
Sbjct:   16 ENVKAMTSLRWLKLNRTGLCYLPEELAALQKLEHLSVSHNNLTTLHGE-LSSLPSLRAIVARANSLKNSGVPDDIFKLDDLSVLDLSHNQLTECPRELENAKNMLVLNLSHNSIDTIPNQLFINLTDLLYLDLSENRLESLPPQMRRLVHLQTLVLNGNPLLHAQLRQLPAMTALQTLHLRSTQRTQSNLPTSLEGLSNLADVDLSCNDLTRVPECLYTLPSLRRLNLSSNQITELSLCIDQWVHVETLNLSRNQLTSLPSAICKLSKLKKLYLNSNKLDFDGLPSGIGKLTNLEEFMAANNNLELVPESLCRCPKLRKLVLNKNHLVTLPEAIHFLTE-IEVLDVRENPNLVMPPKPAD----RAAEWYNIDFSLQNQLRLA--GASPATVAAAAAAGSGPKDPMARKMRLRRRK---DSAQDDQAKQVLKGMSDVAQEKNKKQEE-SADARAPSGKVRRWDQGLEKPRLDYSEFFTEDVGQLPGLTIWQIENFVP-VLVEEAFHGKFYEADCYIVLKTFLDDSG--SLNWEIYYWIGGEATLDKKACSAIHAVNLRNYLGAECRTVREEMGDESEEFLQVFDNDISYIEGGTA-SGFYTVEDTHYVTRMYRVYG-KKNI---KLEPVPLKGTSLDPRFVFLLDR-GLDIYVWRGAQATLSSTTKARLFAEKINKNERKGKAEITLLVQGQELPEFWEALGGE--------PSEIKKHVPEDFWPPQPKLYKVGLGLGYLELPQINYKLSVEHKQRPKVELMPRMRLLQSLLDTRCVYILDCWSDVFIWLGRKSPRLVRAAALKLGQELCGMLHRPRHATVSRSLEGTEAQVFKAKFKNWDDVLTVDYTRNAEAVLQSPGLSGKVKRDAEKKDQMKADLTALFLPRQPPMSLAEAEQLMEEWNEDLDG------------MEGFVLEGKKFARLPEEEFGHFYTQDCYVFLCRYWVPVEYEEEEKKEDKEEKAEGKEGEEATAEAEEKQPEEDFQCIVYFWQGREASNMGWLTFTFSLQKKFESLFPG------------KLEVVRMTQQQENPKFLSHFKRKFIIHRGK---RKAVQGAQQPSLYQIRTNGSALCTRCIQINTDSSLLNSEFCFILKVPF---ESEDNQGIVYAWVGRASDPDEAKLAEDILNTMFDTSYSKQVINEGEEPENFFWVGIGAQKPYDDDAEYMKHTRLFRCSNEKGYFAVTEKCSDFCQDDLADDDIMLLDNGQEVYMWVGTQTSQVEIKLSLKACQVYIQHMRSKEHERPRRLRLVRKGNEQHAFTRCFHAWSAFCKAL 1257          
BLAST of Protein flightless-1 vs. Ensembl Human
Match: FLII (FLII actin remodeling protein [Source:HGNC Symbol;Acc:HGNC:3750])

HSP 1 Score: 774.622 bits (1999), Expect = 0.000e+0
Identity = 511/1325 (38.57%), Postives = 750/1325 (56.60%), Query Frame = 2
Query:  512 SKSVSQFLLGIDLSCVEIKDNDCSEAFSNMTRIQWLKLVSTGLEQIPKGVEKLTQLQRLTISKNNINKLSGDWCTELKALRVFNARKNKLTDDSLPEQLFNNPQLQVVDLSFNLLTEVPAGLVEAKSLLVLNLSDNQIKNVSKDLFANCVSLMILDLSNNQIVGFPTXXXXXXXXXXXXXXXXXXXXXXXRSINGXXXXXXXXXXXXXXXXENIPSDLDKLPCLQDLDISDNNLPKVPQTIYEITSLTKLNLSGNEIDELSGLVDCWPNLEVXXXXXXXXXXXPSFITRLSKLKKLYVDENRLTFNGIPPGIGKLSNLEVFSASENLLENIPEGLCRCGQLKHLNLRMNKLVTLPDAINVLIESLKTFNIENNPNLKMPPKLVEVDLKSKYAFYNIDFSLETQMQLARGAPAKASSKSVTQKHKFTQDTASRIRRLRRKKIDEKSEKGSDSKRVLEGMQKVAKDKDAIMEDREKEEKLLSAK--KWQDAIAKPNLDYSKLFDDDVGIEPGIELWDMDDFYPRRITDELPLGTFFDGDCYIILHTSLDEKSHTSLNHSIYYWIGSQASLDKVTASAVHAVYLRNYLSTNCRCERTEQGDESPEFVALFEGNIIVCEGARGQTGFLKTEDKEHRKKMYRLFGADKSISIYSLDPTP---ENLDSKFVYLFDESSTRLFLWIGNKSRLMLQTKGRLLADNINQTERKGQSEIITERENSESDEFKNSLQSSSGIDSLDWSNLSSKEVSIDWKPPTPILYDVKLGRGYLEMPQIE---------------LPNGRLVKSLLEAKHVYILDSNGDMFVWIGDMAPKFLKFAGXXXXXXXXXXXXXXXXXXXTVCCQTSEPQIFKMQFADWVDTCAVDFTRSVESVRK----RGVNLXXXXXXXXXXXXXRAFFMPRERPMPLEDAKAIMEDCNEDLVGNNMDSNDGKPFKIKQFVYLNRNWVLVEDKWIGHFFNQDCYIVHAEYWXXXXXXXXXXXXXXXXXXXSR-----------------IQTVIYFWQGREASDIPWLQFNFSLKKEMEIKFSGMDNMSTTKDSFKKVETKRMFQQQEISTFLAHFQHRFVIHLGKYQDRYSDQRKNRIELYYLRENGNALCTRTIEVKPMIAFVNSCFHYIMKIPAAASKTENDQ--IICWIGKNSDSHYDEVLQAVAADTFPESSDILTVKEGAEP-GIFWQALGGKKNYDHEAQFMSFSRLFRLSNEQGFFCASEKCSDFCQDDLADEDVMLLDTGSQIYLWFGNRTSDVEKKLSYKAAKLYQEHMARIQPDRIRQLKITQKKKEPHNFRRCFHGWGPFKEAM 4354
            +  V  F+ G+DLS  + K     E    MT ++WLKL  TGL  +P+ +  L +L+ L++S NN+  L G+  + L +LR   AR N L +  +P+ +F    L V+DLS N LTE P  L  AK++L                        +L+LS+N                              R +  +  L TL L +T R   N+P+ L+ L  L D+D+S N+L +VP+ +Y + SL +LNLS N+I ELS  +D W ++E LNLSRN+L SLPS I +LSKLKKLY++ N+L F+G+P GIGKL+NLE F A+ N LE +PE LCRC +L+ L L  N LVTLP+AI+ L E ++  ++  NPNL MPPK  +        +YNIDFSL+ Q++LA  +PA  ++ +     K   D  +R  RLRR+K    S +   +K+VL+GM  VA++K+   E+   + +  S K  +W   + KP LDYS+ F +DVG  PG+ +W +++F P  + +E   G F++ DCYI+L T LD+    SLN  IYYWIG +A+LDK   SA+HAV LRNYL   CR  R E GDES EF+ +F+ +I   EG    +GF   ED  +  +MYR++G  K+I    L+P P    +LD +FV+L D     +++W G ++ L   TK RL A+ IN+ ERKG++EI    +  E  EF  +L            +   K V  D+ PP P LY V LG GYLE+PQI                +P  RL++SLL+ + VYILD   D+F+W+G  +P+ ++ A LKL  EL  +L R    + +   + +E Q+FK +F +W D   VD+TR+ E+V +     G    D  +KD+MK D+ A F+PR+ PM L +A+ +ME+ NEDL G            ++ FV   + +  + ++  GHF+ QDCY+    YW   E ++ + +ED  ++   +                  Q ++YFWQGREAS++ WL F FSL+K+ E  F G            K+E  RM QQQE   FL+HF+ +F+IH GK   R + Q   +  LY +R NG+ALCTR I++    + +NS F +I+K+P    ++E++Q  +  W+G+ SD    ++ + +    F  S     + EG EP   FW  +G +K YD +A++M  +RLFR SNE+G+F  +EKCSDFCQDDLAD+D+MLLD G ++Y+W G +TS VE KLS KA ++Y +HM   + +R R+L++ +K  E H F RCFH W  F +A+
Sbjct:    3 ATGVLPFVRGVDLSGNDFKGGYFPENVKAMTSLRWLKLNRTGLCYLPEELAALQKLEHLSVSHNNLTTLHGE-LSSLPSLRAIVARANSLKNSGVPDDIFKLDDLSVLDLSHNQLTECPRELENAKNML------------------------VLNLSHN------------------------------RQLPAMTALQTLHLRSTQRTQSNLPTSLEGLSNLADVDLSCNDLTRVPECLYTLPSLRRLNLSSNQITELSLCIDQWVHVETLNLSRNQLTSLPSAICKLSKLKKLYLNSNKLDFDGLPSGIGKLTNLEEFMAANNNLELVPESLCRCPKLRKLVLNKNHLVTLPEAIHFLTE-IEVLDVRENPNLVMPPKPAD----RAAEWYNIDFSLQNQLRLAGASPATVAAAAAGSGPK---DPMARKMRLRRRK---DSAQDDQAKQVLKGMSDVAQEKNKKQEE-SADARAPSGKVRRWDQGLEKPRLDYSEFFTEDVGQLPGLTIWQIENFVP-VLVEEAFHGKFYEADCYIVLKTFLDDSG--SLNWEIYYWIGGEATLDKKACSAIHAVNLRNYLGAECRTVREEMGDESEEFLQVFDNDISYIEGGTA-SGFYTVEDTHYVTRMYRVYG-KKNI---KLEPVPLKGTSLDPRFVFLLDR-GLDIYVWRGAQATLSSTTKARLFAEKINKNERKGKAEITLLVQGQELPEFWEALGGE--------PSEIKKHVPEDFWPPQPKLYKVGLGLGYLELPQINYKLSVEHKQRPKVELMPRMRLLQSLLDTRCVYILDCWSDVFIWLGRKSPRLVRAAALKLGQELCGMLHRPRHATVSRSLEGTEAQVFKAKFKNWDDVLTVDYTRNAEAVLQSPGLSGKVKRDAEKKDQMKADLTALFLPRQPPMSLAEAEQLMEEWNEDLDG------------MEGFVLEGKKFARLPEEEFGHFYTQDCYVFLCRYWVPVEYEEEEKKEDKEEKAEGKEGEEATAEAEEKQPEEDFQCIVYFWQGREASNMGWLTFTFSLQKKFESLFPG------------KLEVVRMTQQQENPKFLSHFKRKFIIHRGK---RKAVQGAQQPSLYQIRTNGSALCTRCIQINTDSSLLNSEFCFILKVPF---ESEDNQGIVYAWVGRASDPDEAKLAEDILNTMFDTSYSKQVINEGEEPENFFWVGIGAQKPYDDDAEYMKHTRLFRCSNEKGYFAVTEKCSDFCQDDLADDDIMLLDNGQEVYMWVGTQTSQVEIKLSLKACQVYIQHMRSKEHERPRRLRLVRKGNEQHAFTRCFHAWSAFCKAL 1213          
BLAST of Protein flightless-1 vs. Ensembl Celegans
Match: fli-1 (pep chromosome:WBcel235:III:8675297:8683732:-1 gene:WBGene00001443.1 transcript:B0523.5.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:fli-1)

HSP 1 Score: 718.768 bits (1854), Expect = 0.000e+0
Identity = 494/1298 (38.06%), Postives = 748/1298 (57.63%), Query Frame = 2
Query:  509 MSKSVSQFLLGIDLSCVEIKDNDCSEAFSNMTRIQWLKLVSTGLEQIPKGVEKLTQLQRLTISKNNINKLSGDWCTELKALRVFNARKNKLTDDSLPEQLFNNPQLQVVDLSFNLLTEVPAGLVEAKSLLVLNLSDNQIKNVSKDLFANCVSLMILDLSNNQIVGFPTXXXXXXXXXXXXXXXXXXXXXXXRSINGXXXXXXXXXXXXXXXXENIPSDLDKLPCLQDLDISDNNLPKVPQTIYEITSLTKLNLSGNEIDELSGLVDCWPNLEVXXXXXXXXXXXPSFITRLSKLKKLYVDENRLTFNGIPPGIGKLSNLEVFSASENLLENIPEGLCRCGQLKHLNLRMNKLVTLPDAINVLIESLKTFNIENNPNLKMPPKLVEVDLKSKYAFYNIDFSLETQMQLARGAPAKASSKSVTQKHKFTQDTASRIRRLRRKKIDEKSEKGSDSKRVLEGMQKVAKDKDAIMEDREKEEKLL----SAKKWQDAIAK--PNLDYSKLFDDDVGIEPGIELWDMDDFYPRRITDELPLGTFFDGDCYIILHTSLDEKSHTSLNHSIYYWIGSQASLDKVTASAVHAVYLRNYLSTNCRCERTEQGDESPEFVALFEGNIIVCEGARGQTGFLKTEDKEHRKKMYRLFGADKSISIYSLDPTP---ENLDSKFVYLFDESSTRLFLWIGNKSRLMLQTKGRLLADNINQTERKGQSEIITERENSESDEFKNSLQSSSGIDSLDWSNLSSKEVSIDWKPPTPILYDVKLGRGYLEMPQIELPNGRLVKSLLEAKHVYILDSNGDMFVWIGDMAPKFLKFAGXXXXXXXXXXXXXXXXXXXTVCCQTSEPQIFKMQFADWVDTCAVDFTRSVESVRKRGVNLXXXXXXXXXXXXXRAFFMPRERPMPLEDAKAIMEDCNEDLVGNNMDSNDGKPFKIKQFVYLNRNWVLVEDKWIGHFFNQDCYIVHAEYWXXXXXXXXXXXXXXXXXXXSR-IQTVIYFWQGREASDIPWLQFNFSLKKEMEIKFSGMDNMSTTKDSFKKVETKRMFQQQEISTFLAHFQHRFVIHLGKYQDRYSDQRKNRIELYYLRENGNALCTRTIEVKPMIAFVNSCFHYIMKIPAAASKTENDQ--IICWIGKNSDSHYDEVLQAVAADTFPESSD----ILTVKEGAEPGIFWQALGGKKNYDHEAQFMSFSRLFRLSNEQGFFCASEKCSDFCQDDLADEDVMLLDTGSQIYLWFGNRTSDVEKKLSYKAAKLYQEHMARIQPDRIRQLKITQKKKEPHNFRRCFHGWGPFKEAM 4354
            MS  V QF+ GID S  +   +        MT++ WLKL  + LEQ+P  + +   L+ L ++ N +  + G+  ++L  LR    R N L    +P  +F    L ++DLS N L EVP  L  AK  +VLNLS N I+ +   + AN + L+ LDLSNN++   P  +RR   LQSL LSNNPL+  QL+ +  +  L+ L +SNT+R L+NIP  LD +  L+D+D S+NNLP VP+ ++++ +L KLNLSGN+I++L+     W NLE LN+S N+L  LP  + +L++L KLY   N+LTF GIP GIGKL  L V   S N LE +PEG+ RC +L+ L L  N+L+TLP+ I+ L+  LK  ++  N NL MPPK    D + K AFYNIDFSLE Q ++A    + +SS S        QD  +R +   R++  +  ++ +D  +V++GM K+A    A+ E +++EE+      SA  W+  I K   ++DYS +FD+DVG + G+ +W++++FYP  I DE   G F+D D Y++L T+   ++   L H+I+YW+G  ASLDK   SAVHAV LRN+L+  CR +R E  DE+ EF+ LF   I+  EG R  +GF  TE   H  ++YR   A  + +   ++P P   E+LD +F +L D   T +++W G KSR+ +  K RL A+ +N+ +RKG+SEI T R+     EF  +L  +             + V   +      LY V +G G+LE+PQ+ELP G   + +L +K V++LDSN D+F+WIG  A + LK AG KL  EL +++ R          +  E  +F+ +FA W +   VD+TR+ +SV++       + + + M+ D+ A F+ R+  M  E+++ +MEDCN DL              ++ FV   + +V +  K  G F+  DCY+    Y  +PEED+   +E   D++     + V+YFWQGR+AS++ WL F F L+   E  F         KD   K+E  RM+QQQE   FL+HF+ +F+I  G+ +    +      EL+ +R NG+++C RTI+V      + S F ++++IP    + +  +  +  W+GK+SD    E  + VA+D      D    I+ V+EG E   FW+ LGGKK Y+ ++ F+  +RLFR +NE+G+F  SEK  DFCQDDL D+D+M+LD G  ++LW G R+SD+E KLSY+AA++Y   M     ++ R+  +  + +E   FR+CFH W   KE M
Sbjct:    1 MSTGVLQFVKGIDFSGNDFSGDRFPHDVEQMTQMTWLKLNDSKLEQVPDELSRCANLEHLQMAHNQLISVHGE-LSDLPRLRSVIVRDNNLKTAGIPTDIFRMKDLTIIDLSRNQLREVPTNLEYAKGSIVLNLSYNNIETIPNSVCANLIDLLFLDLSNNKLDMLPPQIRRLSMLQSLKLSNNPLNHFQLKQLPSMTSLSVLHMSNTNRTLDNIPPTLDDMHNLRDVDFSENNLPIVPEALFKLRNLRKLNLSGNKIEKLNMTEGEWENLETLNMSHNQLTVLPDCVVKLTRLTKLYAANNQLTFEGIPSGIGKLIQLTVLHLSYNKLELVPEGISRCVKLQKLKLDHNRLITLPEGIH-LLPDLKVLDLHENENLVMPPK--PNDARKKLAFYNIDFSLEHQRKIAGQMTSPSSSISSVHSGGARQDALARRKEFIRRRKQQADQQSAD--KVIQGMSKIAGVGAALTEKQQEEEERQLEAKSAVNWKKNIEKNRRHIDYSDIFDEDVGSDEGMWVWEIENFYPS-IMDEAFHGQFYDADAYLVLKTT--REASGQLRHAIFYWLGEHASLDKGMCSAVHAVGLRNHLNATCRTQREEMNDETEEFLTLFGEEIVYIEGGRTISGFYTTEKPAHLTRLYR---AGVNGTAVEMEPVPLSVESLDPRFCFLLDAGET-IWIWSGYKSRITVSNKARLFAERLNKRDRKGKSEIETCRQARCPPEFWQALTGNPDKPQ----GAIVEHVPEGFVAERKKLYKVNIGMGFLELPQVELPKGIAKQDMLGSKGVFVLDSNSDIFLWIGKKANRLLKMAGQKLVVELHQMIDRPDYAQVYRETEGEESMMFRSKFAGWDEIVPVDYTRTSDSVQRVPDLKVIVKKDNMMRADLAALFLERQPSMSYEESEELMEDCNYDLE------------LMESFVLEGKKFVKLPQKEFGIFYTMDCYVFLCRYAVMPEEDEEGEDEHDEDDKPEMDFKCVVYFWQGRDASNMGWLNFTFQLQPNFEEIF---------KD---KLEVVRMYQQQENHKFLSHFKRKFLIKRGR-RGLTKNLGGKWPELFQMRANGSSVCNRTIQVDCQANQLCSAFCHMLRIPFKEIEEDGHRGVVYVWMGKDSDPREHEFARQVASDLVVRDDDNDFRIVEVQEGEENEEFWKVLGGKKKYETDSSFVKHTRLFRCTNEKGYFAISEKTVDFCQDDLDDDDIMILDNGDAVFLWIGARSSDIEAKLSYQAAQVYHASMRMKANEKPRKFMLAVRGRESCRFRKCFHAWSKMKEPM 1256          
BLAST of Protein flightless-1 vs. Ensembl Celegans
Match: let-413 (pep chromosome:WBcel235:V:7972924:7977774:-1 gene:WBGene00002632.1 transcript:F26D11.11a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:let-413)

HSP 1 Score: 76.2554 bits (186), Expect = 1.364e-13
Identity = 103/368 (27.99%), Postives = 174/368 (47.28%), Query Frame = 2
Query:  632 TGLEQIPKGVEKLTQLQRLTISKNNINKLSGDWCTELKALRVFNARKNKLTDDSLPEQLFNNPQLQVVDLSFNLLTEVPAGLVEAKSLLVLNLSDNQIKNVSKDLFANCVSLMILDLSNNQIVGFPTXXXXXXXXXXXXXXXXXXXXXXXRSINGXXXXXXXXXXXXXXXXENIPSDLDKLPCLQD-----------------------LDISDNNLPKVPQTIYEITSLTKLNLSGNEIDELSGLVDCWPNLEVXXXXXXXXXXXPSFITRLSKLKKLYVDENRLTFNGIPPGIGKLSNLEVFSASENLLENIPEGLCRCGQLKHLNLRMNKLVTLPDAINVLIESLKTFNIENN--PNLKMPPKLV 1660
            + L+ IP  + +  +L+ L ++ NNI +L     + L+ LR+ +   N+L    LP ++ N  QL  ++L+ N + ++P  +   K L  LNLS N    + + +   C S+ IL L+   +   P+N+    NL+ L   +N L    L  +          L      LE +P+++ KL  L++                       LD+S+N + ++P+ +  + +LT LN+S NEI EL         L++L   RN L++L S I +   L +LY+ +N LT   +P  IG L  L   +   N L +IP+ +  C  L  L+LR N L  LP  I    E+L   ++ +N  P+L    K++
Sbjct:   23 SNLQAIPSDIFRFRKLEDLNLTMNNIKELDHRLFS-LRHLRILDVSDNELA--VLPAEIGNLTQLIELNLNRNSIAKLPDTMQNCKLLTTLNLSSNPFTRLPETI-CECSSITILSLNETSLTLLPSNIGSLTNLRVLEARDNLLRTIPLSIVE---LRKLEELDLGQNELEALPAEIGKLTSLREFYVDINSLTSLPDSISGCRMLDQLDVSENQIIRLPENLGRMPNLTDLNISINEIIELPSSFGELKRLQMLKADRNSLHNLTSEIGKCQSLTELYLGQNFLT--DLPDTIGDLRQLTTLNVDCNNLSDIPDTIGNCKSLTVLSLRQNILTELPMTIGK-CENLTVLDVASNKLPHLPFTVKVL 380          

HSP 2 Score: 72.7886 bits (177), Expect = 1.587e-12
Identity = 95/333 (28.53%), Postives = 156/333 (46.85%), Query Frame = 2
Query:  596 NMTRIQWLKLVSTGLEQIPKGVEKLTQLQRLTISKNNINKLSGDWCTELKALRVFNARKNKLTDDSLPEQLFNNPQLQVVDLSFNLLTEVPAGLVEAKSLLVLNLSDNQIKNVSKDLFANCVSLMILDLSNNQIVGFPTXXXXXXXXXXXXXXXXXXXXXXXRSINGXXXXXXXXXXXXXXXXENIPSDLDKLPCLQDLDISDNNLPKVPQTIYEITSLTKLNLSGNEIDELSGLVDCWPNLEVXXXXXXXXXXXPSFITRLSKLKKLYVDENRLTFNGIPPGIGKLSNLEVFSASENLLENIPEGLCRCGQLKHLNLRMNKLVTLPDAINVL 1594
            ++  ++ L +    L  +P  +  LTQL  L +++N+I KL  D     K L   N   N  T   LPE +     + ++ L+   LT +P+ +    +L VL   DN ++ +   +      L  LDL  N++   P  + +  +L+   +  N L+     SI+G + L  L +S        +P +L ++P L DL+IS N + ++P +  E+  L  L    N +  L+  +    +L  L L +N L  LP  I  L +L  L VD N L+   IP  IG   +L V S  +N+L  +P  + +C  L  L++  NKL  LP  + VL
Sbjct:   57 SLRHLRILDVSDNELAVLPAEIGNLTQLIELNLNRNSIAKLP-DTMQNCKLLTTLNLSSNPFT--RLPETICECSSITILSLNETSLTLLPSNIGSLTNLRVLEARDNLLRTIPLSI-VELRKLEELDLGQNELEALPAEIGKLTSLREFYVDINSLTSLPD-SISGCRMLDQLDVSENQII--RLPENLGRMPNLTDLNISINEIIELPSSFGELKRLQMLKADRNSLHNLTSEIGKCQSLTELYLGQNFLTDLPDTIGDLRQLTTLNVDCNNLS--DIPDTIGNCKSLTVLSLRQNILTELPMTIGKCENLTVLDVASNKLPHLPFTVKVL 380          

HSP 3 Score: 53.5286 bits (127), Expect = 1.084e-6
Identity = 74/296 (25.00%), Postives = 120/296 (40.54%), Query Frame = 2
Query:  530 FLLGIDLSCVEIKDNDCSEAFSNMTRIQWLKLVSTGLEQIPKGVEKLTQLQRLTISKNNINKLSGDWCTELKALRVFNARKNKLTDDSLPEQLFNNPQLQVVDLSFNLLTEVPAGLVEAKSLLVLNLSDNQIKNVSKDLFANCVSLMILDLSNNQIVGFPTXXXXXXXXXXXXXXXXXXXXXXXRSINGXXXXXXXXXXXXXXXXENIPSDLDKLPCLQDLDISDNNLPKVPQTIYEITSLTKLNLSGNEIDELSGLVDCWPNLEVXXXXXXXXXXXPSFITRLSKLKKLYVDENR 1417
             L  I LS VE++            +++ L L    LE +P  + KLT L+   +  N++  L  D  +  + L   +  +N++    LPE L   P L  +++S N + E+P+   E K L +L    N + N++ ++   C SL  L L  N +   P                                                   +  L  L  L++  NNL  +P TI    SLT L+L  N + EL   +    NL VL+++ N+L  LP  +  L KL+ L++ EN+
Sbjct:  162 LLRTIPLSIVELR------------KLEELDLGQNELEALPAEIGKLTSLREFYVDINSLTSLP-DSISGCRMLDQLDVSENQII--RLPENLGRMPNLTDLNISINEIIELPSSFGELKRLQMLKADRNSLHNLTSEI-GKCQSLTELYLGQNFLTDLP-------------------------------------------------DTIGDLRQLTTLNVDCNNLSDIPDTIGNCKSLTVLSLRQNILTELPMTIGKCENLTVLDVASNKLPHLPFTVKVLYKLQALWLSENQ 392          
BLAST of Protein flightless-1 vs. Ensembl Celegans
Match: let-413 (pep chromosome:WBcel235:V:7972934:7977774:-1 gene:WBGene00002632.1 transcript:F26D11.11b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:let-413)

HSP 1 Score: 75.8702 bits (185), Expect = 1.807e-13
Identity = 103/368 (27.99%), Postives = 175/368 (47.55%), Query Frame = 2
Query:  632 TGLEQIPKGVEKLTQLQRLTISKNNINKLSGDWCTELKALRVFNARKNKLTDDSLPEQLFNNPQLQVVDLSFNLLTEVPAGLVEAKSLLVLNLSDNQIKNVSKDLFANCVSLMILDLSNNQIVGFPTXXXXXXXXXXXXXXXXXXXXXXXRSINGXXXXXXXXXXXXXXXXENIPSDLDKLPCLQD-----------------------LDISDNNLPKVPQTIYEITSLTKLNLSGNEIDELSGLVDCWPNLEVXXXXXXXXXXXPSFITRLSKLKKLYVDENRLTFNGIPPGIGKLSNLEVFSASENLLENIPEGLCRCGQLKHLNLRMNKLVTLPDAINVLIESLKTFNIENN--PNLKMPPKLV 1660
            + L+ IP  + +  +L+ L ++ NNI +L     + L+ LR+ +   N+L    LP ++ N  QL  ++L+ N + ++P  +   K L  LNLS N    + + +   C S+ IL L+   +   P+N+    NL+ L   +N L    L  +   +      L      LE +P+++ KL  L++                       LD+S+N + ++P+ +  + +LT LN+S NEI EL         L++L   RN L++L S I +   L +LY+ +N LT   +P  IG L  L   +   N L +IP+ +  C  L  L+LR N L  LP  I    E+L   ++ +N  P+L    K++
Sbjct:   23 SNLQAIPSDIFRFRKLEDLNLTMNNIKELDHRLFS-LRHLRILDVSDNELA--VLPAEIGNLTQLIELNLNRNSIAKLPDTMQNCKLLTTLNLSSNPFTRLPETI-CECSSITILSLNETSLTLLPSNIGSLTNLRVLEARDNLLRTIPLSIV---ELRKLEELDLGQNELEALPAEIGKLTSLREFYVDINSLTSLPDSISGCRMLDQLDVSENQIIRLPENLGRMPNLTDLNISINEIIELPSSFGELKRLQMLKADRNSLHNLTSEIGKCQSLTELYLGQNFLT--DLPDTIGDLRQLTTLNVDCNNLSDIPDTIGNCKSLTVLSLRQNILTELPMTIGK-CENLTVLDVASNKLPHLPFTVKVL 380          

HSP 2 Score: 72.0182 bits (175), Expect = 2.304e-12
Identity = 95/333 (28.53%), Postives = 156/333 (46.85%), Query Frame = 2
Query:  596 NMTRIQWLKLVSTGLEQIPKGVEKLTQLQRLTISKNNINKLSGDWCTELKALRVFNARKNKLTDDSLPEQLFNNPQLQVVDLSFNLLTEVPAGLVEAKSLLVLNLSDNQIKNVSKDLFANCVSLMILDLSNNQIVGFPTXXXXXXXXXXXXXXXXXXXXXXXRSINGXXXXXXXXXXXXXXXXENIPSDLDKLPCLQDLDISDNNLPKVPQTIYEITSLTKLNLSGNEIDELSGLVDCWPNLEVXXXXXXXXXXXPSFITRLSKLKKLYVDENRLTFNGIPPGIGKLSNLEVFSASENLLENIPEGLCRCGQLKHLNLRMNKLVTLPDAINVL 1594
            ++  ++ L +    L  +P  +  LTQL  L +++N+I KL  D     K L   N   N  T   LPE +     + ++ L+   LT +P+ +    +L VL   DN ++ +   +      L  LDL  N++   P  + +  +L+   +  N L+     SI+G + L  L +S        +P +L ++P L DL+IS N + ++P +  E+  L  L    N +  L+  +    +L  L L +N L  LP  I  L +L  L VD N L+   IP  IG   +L V S  +N+L  +P  + +C  L  L++  NKL  LP  + VL
Sbjct:   57 SLRHLRILDVSDNELAVLPAEIGNLTQLIELNLNRNSIAKLP-DTMQNCKLLTTLNLSSNPFT--RLPETICECSSITILSLNETSLTLLPSNIGSLTNLRVLEARDNLLRTIPLSI-VELRKLEELDLGQNELEALPAEIGKLTSLREFYVDINSLTSLPD-SISGCRMLDQLDVSENQII--RLPENLGRMPNLTDLNISINEIIELPSSFGELKRLQMLKADRNSLHNLTSEIGKCQSLTELYLGQNFLTDLPDTIGDLRQLTTLNVDCNNLS--DIPDTIGNCKSLTVLSLRQNILTELPMTIGKCENLTVLDVASNKLPHLPFTVKVL 380          

HSP 3 Score: 53.5286 bits (127), Expect = 1.175e-6
Identity = 74/296 (25.00%), Postives = 120/296 (40.54%), Query Frame = 2
Query:  530 FLLGIDLSCVEIKDNDCSEAFSNMTRIQWLKLVSTGLEQIPKGVEKLTQLQRLTISKNNINKLSGDWCTELKALRVFNARKNKLTDDSLPEQLFNNPQLQVVDLSFNLLTEVPAGLVEAKSLLVLNLSDNQIKNVSKDLFANCVSLMILDLSNNQIVGFPTXXXXXXXXXXXXXXXXXXXXXXXRSINGXXXXXXXXXXXXXXXXENIPSDLDKLPCLQDLDISDNNLPKVPQTIYEITSLTKLNLSGNEIDELSGLVDCWPNLEVXXXXXXXXXXXPSFITRLSKLKKLYVDENR 1417
             L  I LS VE++            +++ L L    LE +P  + KLT L+   +  N++  L  D  +  + L   +  +N++    LPE L   P L  +++S N + E+P+   E K L +L    N + N++ ++   C SL  L L  N +   P                                                   +  L  L  L++  NNL  +P TI    SLT L+L  N + EL   +    NL VL+++ N+L  LP  +  L KL+ L++ EN+
Sbjct:  162 LLRTIPLSIVELR------------KLEELDLGQNELEALPAEIGKLTSLREFYVDINSLTSLP-DSISGCRMLDQLDVSENQII--RLPENLGRMPNLTDLNISINEIIELPSSFGELKRLQMLKADRNSLHNLTSEI-GKCQSLTELYLGQNFLTDLP-------------------------------------------------DTIGDLRQLTTLNVDCNNLSDIPDTIGNCKSLTVLSLRQNILTELPMTIGKCENLTVLDVASNKLPHLPFTVKVLYKLQALWLSENQ 392          
BLAST of Protein flightless-1 vs. Ensembl Celegans
Match: gsnl-1 (Gelsolin-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q21253])

HSP 1 Score: 71.2478 bits (173), Expect = 3.256e-12
Identity = 81/351 (23.08%), Postives = 148/351 (42.17%), Query Frame = 2
Query: 2015 DVGIEPGIELWDMDDFYPRRITDELPLGTFFDGDCYIILHTSLDEKSHTSLNHSIYYWIGSQASLDKVTASAVHAVYLRNYLSTNCRCERTEQGDESPEFVALFEGNIIVCEGARGQTGFLKTED--KEHRKKMYRLFGADKSISIYSLDPTPENLDSKFVYLFDESSTRLFLWIGNKSRLMLQTKGRLLADNINQTERKGQSEIITERENSESDEFKNSLQSSSGIDSLDWSNLSSKEVSIDWKPPTP--ILYDVKLGRGYLEMPQIELPNGRLVKSLLEAKHVYILDS-NGDMFVWIGDMAPKFLKFAGXXXXXXXXXXXXXXXXXXXTVCCQTSEPQIFKMQFADWVD 3052
            ++G + G+ +W ++ F    +  E+  G F+ GD YI L+   D          +++W+G  AS D++  +A+  V + + L       R  Q  ESP F++ F   I    G   ++G+   +D  K  +  ++   G  +++    ++    +L+   V++ D     L++W+  +S  + + KG   A NI   ER G  ++    ++ E D          G+ S+   +    +    WK  T    L+ V    G  ++  +      + K  L+ K  +ILD+ NG +FVWIG       +   L      L+          T   +++E   F   F DWVD
Sbjct:   12 EIGKKNGLLVWRINKFVLEPVP-EVDHGVFYIGDAYIALYQKYDG------CWDVHFWLGKNASTDEIGVAAIKTVEIDDSLGGIPTQHREIQNYESPLFLSYFPDGIRYVSGGY-ESGYRHVDDQFKNWKPHLFHCKGK-RNVRCTEVECEVNSLNLGDVFILDLGKD-LYVWMPPESGRLERIKGMARAKNIADHERMGIPKVHI-LDDVEWDNDSTFWSYFGGVSSVRKVSKGKDDDDNYWKRLTEQITLWKVSDASGAAKVSMVS-QGENIRKEQLDPKDAFILDAINGGIFVWIGHECTLEERSKALIWGQNYLKQHHLPRWTQVTRVLESAESTQFTQWFRDWVD 350          

HSP 2 Score: 59.3066 bits (142), Expect = 1.477e-8
Identity = 44/142 (30.99%), Postives = 73/142 (51.41%), Query Frame = 2
Query: 3926 FPESSDILTVKEGAEPGIFWQALGGKKNYDHEAQFMSFSRL-FRLSNEQGFFCASEKCSDFCQDDLADEDVMLLDTGSQIYLWFGNRTSDVEKKLSYKAAKLYQEHMARIQPDRIRQLKITQ-----KKKEPHNFRRCFHGW 4333
             P  + +  V E AE   F Q     +++  E +  +F+ L F++S+E G     E+ ++F Q+DL  +DVM+LD  + IY+W G   +  EKK +   AKLY      ++ D++ + K T      + KEP  F++ F  W
Sbjct:  323 LPRWTQVTRVLESAESTQFTQWF---RDWVDEKKKNTFTPLLFQVSDESGLLHV-EEIANFTQEDLDGDDVMILDALNSIYVWVGANANANEKKEALNTAKLY------LEKDKLPRHKKTAIDTIFQGKEPPTFKKFFPSW 454          

HSP 3 Score: 50.8322 bits (120), Expect = 6.762e-6
Identity = 53/213 (24.88%), Postives = 88/213 (41.31%), Query Frame = 2
Query: 2468 ENLDSKFVYLFDESSTRLFLWIGNKSRLMLQTKGRLLADN-INQTERKGQSEIITERENSESDEFKNSLQSSSGIDSLDWSNLSSKEVSIDWKPPTPILYDVKLGRGYLEMPQIELPNGRLVKSLLEAKHVYILDSNGDMFVWIGDMAPKFLKFAGXXXXXXXXXXXXXXXXXXXTV--CCQTSEPQIFKMQFADWVDTCAVDFTRSVESVRK 3097
            E LD K  ++ D  +  +F+WIG++  L  ++K  +   N + Q      +++    E++ES +F    +        DW +   K         TP+L+ V    G L + +I        +  L+   V ILD+   ++VW+G  A    K   L  A   LE           +    Q  EP  FK  F  W D    +  RSV+++R+
Sbjct:  277 EQLDPKDAFILDAINGGIFVWIGHECTLEERSKALIWGQNYLKQHHLPRWTQVTRVLESAESTQFTQWFR--------DWVDEKKKNTF------TPLLFQVSDESGLLHVEEI----ANFTQEDLDGDDVMILDALNSIYVWVGANANANEKKEALNTAKLYLEKDKLPRHKKTAIDTIFQGKEPPTFKKFFPSWDDNLFKNEVRSVQNMRR 471          
BLAST of Protein flightless-1 vs. Ensembl Celegans
Match: soc-2 (Leucine-rich repeat protein soc-2 [Source:UniProtKB/Swiss-Prot;Acc:Q22875])

HSP 1 Score: 68.9366 bits (167), Expect = 2.409e-11
Identity = 91/338 (26.92%), Postives = 155/338 (45.86%), Query Frame = 2
Query:  572 NDCSEAFSNMTRIQWLKLVSTGLEQIPKGVEKLTQLQRLTISKNNINKLSGDWCTELKALRVFNARKNKLTDDSLPEQLFNNPQLQVVDLSFNLLTEVPAGLVEAKSLLVLNLSDNQIKNVSKDLFANCVSLMILDLSNNQIVGFPTXXXXXXXXXXXXXXXXXXXXXXXRSINGXXXXXXXXXXXXXXXXENIPSDLDKLPCLQDLDISDNNLPKVPQTIYEITSLTKLNLSGNEIDEL-SGLVDCWPNLEVXXXXXXXXXXXPSFITRLSKLKKLYVDENRLTFNGIPP-GIGKLSNLEVFSASENLLENIPEGL-CRCGQLKHLNLRMNKLVTLP 1576
            + C EA     + Q L L S  +  IP  +++LTQL  L + KN +  L  +   +L  L+     +N LT  SLP+ L +   L+ +DL  N LTEVP+ + +  SL  L L  N+I  V + +  N   L +LD+  N+I   P+ + +  +L    +S N L+                           +P ++     L  LD+  N+L ++P +I ++ +L ++ +  N+I  + S L  C    E +  S +     P+ +T L K+  + +  N LT    P  G  +  +    +   N +  IP G+  +  +L  LNL+ N+LV+LP
Sbjct:  140 HKCKEA-----QDQRLDLSSIEITSIPSPIKELTQLTELFLYKNKLTCLPTE-IGQLVNLKKLGLSENALT--SLPDSLASLESLETLDLRHNKLTEVPSVIYKIGSLETLWLRYNRIVAVDEQI-GNLSKLKMLDVRENKIRELPSAIGKLTSLVVCLVSYNHLT--------------------------RVPEEIGDCHSLTQLDLQHNDLSELPYSIGKLVNLVRIGIRYNKIRCIPSELESCQQLEEFIVESNHLQLLPPNLLTMLPKIHTVNLSRNELT--AFPAGGPQQFVSTVTINMEHNQISKIPIGIFSKATRLTKLNLKENELVSLP 440          

HSP 2 Score: 68.5514 bits (166), Expect = 2.884e-11
Identity = 101/375 (26.93%), Postives = 165/375 (44.00%), Query Frame = 2
Query:  578 CSEAFSNMTRI----------QWLKLVSTGLEQIPKGVEKLTQLQRLTISKNNINKLSGDW--CTELKALRVFNARKNKLTDDSLPEQLFNN-PQLQVVDLSFNLLTEVPAGLVEA-KSLLVLNLSDNQIKNVSKDLFANCVSLMILDLSNNQIVGFPTXXXXXXXXXXXXXXXXXXXXXXXRSINGXXXXXXXXXXXXXXXXENIPSDLDKLPCLQDLDISDNNLPKVPQTIYEITSLTKLNLSGNEIDELSGLVDCWPNLEVXXXXXXXXXXXPSFITRLSKLKKLYVDENRLTFNGIPPGIGKLSNLEVFSASENLLENIPEGLCRCGQLKHLNLRMN-KLVTLPDAINVLIESLKTFNIENNPNLKMPPKL 1657
            C  +++++TR+            L L    L ++P  + KL  L R+ I  N I  +  +   C +L+    F    N L    LP  L    P++  V+LS N LT  PAG  +   S + +N+  NQI  +   +F+    L  L+L  N++V  P                          ++     +   L+ ++ +L+ +P D++KL  L+ L +S+N L K+P                N+I  L+        L  L+L  N L ++P+ I  L  L KL+V  N++    +P  IG L +L+     EN L  IPE +     LK L L  N  L  LP  +  L +SL+  +IEN+P  ++PP++
Sbjct:  288 CLVSYNHLTRVPEEIGDCHSLTQLDLQHNDLSELPYSIGKLVNLVRIGIRYNKIRCIPSELESCQQLEE---FIVESNHL--QLLPPNLLTMLPKIHTVNLSRNELTAFPAGGPQQFVSTVTINMEHNQISKIPIGIFSKATRLTKLNLKENELVSLP--------------------------LDMGSWTSITELNLSTNQLKVLPEDIEKLVNLEILVLSNNQLKKLP----------------NQIGNLN-------KLRELDLEENELETVPTEIGFLQHLTKLWVQSNKIL--TLPRSIGNLCSLQDLRLGENNLTAIPEEIGHLDSLKSLYLNDNSSLHNLPFEL-ALCQSLEIMSIENSPLSQIPPEI 605          

HSP 3 Score: 66.6254 bits (161), Expect = 1.068e-10
Identity = 65/233 (27.90%), Postives = 113/233 (48.50%), Query Frame = 2
Query: 1151 IPSDLDKLPCLQDLDISDNNLPKVPQTIYEITSLTKLNLSGNEIDELSGLVDCWPNLEVXXXXXXXXXXXPSFITRLSKLKKLYVDENRLTFNGIPPGIGKLSNLEVFSASENLLENIPEGLCRCGQLKHLNLRMNKLVTLPDAINVLI----------------------ESLKTFNIENNPNLKMPPKLVEVDLKSKYAFYNIDFSLETQMQLARGAPAK-ASSKSVTQKH 1780
            +P+++ +L  L+ L +S+N L  +P ++  + SL  L+L  N++ E+  ++    +LE L L  NR+ ++   I  LSKLK L V EN++    +P  IGKL++L V   S N L  +PE +  C  L  L+L+ N L  LP +I  L+                      + L+ F +E+N    +PP L+ +  K     + ++ S         G P +  S+ ++  +H
Sbjct:  183 LPTEIGQLVNLKKLGLSENALTSLPDSLASLESLETLDLRHNKLTEVPSVIYKIGSLETLWLRYNRIVAVDEQIGNLSKLKMLDVRENKI--RELPSAIGKLTSLVVCLVSYNHLTRVPEEIGDCHSLTQLDLQHNDLSELPYSIGKLVNLVRIGIRYNKIRCIPSELESCQQLEEFIVESNHLQLLPPNLLTMLPK----IHTVNLSRNELTAFPAGGPQQFVSTVTINMEH 409          

HSP 4 Score: 57.3806 bits (137), Expect = 8.231e-8
Identity = 86/374 (22.99%), Postives = 162/374 (43.32%), Query Frame = 2
Query:  542 IDLSCVEIKDNDCSEAFSNMTRIQWLKLVSTGLEQIPKGVEKLTQLQRLTISKNNINKLSGDWCTELKALRVFNARKNKLTDD---------------------SLPEQLFNNPQLQVVDLSFNLLTEVPAGLVEAKSLLVLNLSDNQIKNVSKDLFANCVSLMILDLSNNQIVGFPTXXXXXXXXXXXXXXXXXXXXXXXRSINGXXXXXXXXXXXXXXXXENIPSDLDKLPCLQDLDISDNNLPKVPQTIYEITSLTKL---NLSGNEIDEL--SGLVDCWPNLEVXXXXXXXXXXXPSFITRLSKLKKLYVDENRLTFNGIPPGIGKLSNLEVFSASENLLENIPEGLCRCGQLKHLNLRMNKLVTLPDAI 1585
            +DLS +EI           +T++  L L    L  +P  + +L  L++L +S+N +  L  D    L++L   + R NKLT+                      ++ EQ+ N  +L+++D+  N + E+P+ + +  SL+V  +S N +  V +++  +C SL  LDL +N +   P                     S  + +N       + +     ++  IPS+L+    L++  +  N+L  +P  +  +T L K+   NLS NE+      G       + +               ++ ++L KL + EN L    +P  +G  +++   + S N L+ +PE + +   L+ L L  N+L  LP+ I
Sbjct:  150 LDLSSIEI--TSIPSPIKELTQLTELFLYKNKLTCLPTEIGQLVNLKKLGLSENALTSLP-DSLASLESLETLDLRHNKLTEVPSVIYKIGSLETLWLRYNRIVAVDEQIGNLSKLKMLDVRENKIRELPSAIGKLTSLVVCLVSYNHLTRVPEEI-GDCHSLTQLDLQHNDLSELP--------------------YSIGKLVN------LVRIGIRYNKIRCIPSELESCQQLEEFIVESNHLQLLPPNL--LTMLPKIHTVNLSRNELTAFPAGGPQQFVSTVTINMEHNQISKIPIGIFSKATRLTKLNLKENELV--SLPLDMGSWTSITELNLSTNQLKVLPEDIEKLVNLEILVLSNNQLKKLPNQI 489          

HSP 5 Score: 50.8322 bits (120), Expect = 7.824e-6
Identity = 34/85 (40.00%), Postives = 51/85 (60.00%), Query Frame = 2
Query: 1361 PSFITRLSKLKKLYVDENRLTFNGIPPGIGKLSNLEVFSASENLLENIPEGLCRCGQLKHLNLRMNKLVTLPDAINVLIESLKTF 1615
            PS I  L++L +L++ +N+LT   +P  IG+L NL+    SEN L ++P+ L     L+ L+LR NKL  +P  I   I SL+T 
Sbjct:  161 PSPIKELTQLTELFLYKNKLTC--LPTEIGQLVNLKKLGLSENALTSLPDSLASLESLETLDLRHNKLTEVPSVI-YKIGSLETL 242          

HSP 6 Score: 50.447 bits (119), Expect = 9.437e-6
Identity = 45/155 (29.03%), Postives = 70/155 (45.16%), Query Frame = 2
Query: 1184 QDLDISDNNLPKVPQTIYEITSLTKLNLSGNEIDELSGLVDCWPNLEVXXXXXXXXXXXPSFITRLSKLKKLYVDENRLTFNGIPPGIGKLSNLEVFSASENLLENIPEGLCRCGQLKHLNLRMNKLVTLPDAINVLIESLKTFNIENNPNLKMP 1648
            Q LD+S   +  +P  I E+T LT+L L  N++  L                       P+ I +L  LKKL + EN LT   +P  +  L +LE      N L  +P  + + G L+ L LR N++V + + I  L   LK  ++  N   ++P
Sbjct:  148 QRLDLSSIEITSIPSPIKELTQLTELFLYKNKLTCL-----------------------PTEIGQLVNLKKLGLSENALT--SLPDSLASLESLETLDLRHNKLTEVPSVIYKIGSLETLWLRYNRIVAVDEQIGNL-SKLKMLDVRENKIRELP 276          
BLAST of Protein flightless-1 vs. Ensembl Fly
Match: fliI (gene:FBgn0000709 transcript:FBtr0077192)

HSP 1 Score: 904.049 bits (2335), Expect = 0.000e+0
Identity = 534/1302 (41.01%), Postives = 798/1302 (61.29%), Query Frame = 2
Query:  518 SVSQFLLGIDLSCVEIKDNDCSEAFSN----MTRIQWLKLVSTGLEQIPKGVEKLTQLQRLTISKNNINKLSGDWCTELKALRVFNARKNKLTDDSLPEQLFNNPQLQVVDLSFNLLTEVPAGLVEAKSLLVLNLSDNQIKNVSKDLFANCVSLMILDLSNNQIVGFPTXXXXXXXXXXXXXXXXXXXXXXXRSINGXXXXXXXXXXXXXXXXENIPSDLDKLPCLQDLDISDNNLPKVPQTIYEITSLTKLNLSGNEIDELSGLVDCWPNLEVXXXXXXXXXXXPSFITRLSKLKKLYVDENRLTFNGIPPGIGKLSNLEVFSASENLLENIPEGLCRCGQLKHLNLRMNKLVTLPDAINVLIESLKTFNIENNPNLKMPPKLVEVDLKSKYAFYNIDFSLETQMQLARGAPAKASSKSVTQKHKFTQDTASRIRRLRRKKIDEKSEKGSDSKRVLEGMQKVAKDKD----AIMEDREKEEKLLSAKKWQDAIAKPNLDYSKLFDDDVGIEPGIELWDMDDFYPRRITDELPLGTFFDGDCYIILHTSLDEKSHTSLNHSIYYWIGSQASLDKVTASAVHAVYLRNYLSTNCRCERTEQGDESPEFVALFEGNIIVCEGARGQTGFLKTEDKEHRKKMYRLFGADKSISIYSLDPTPENLDSKFVYLFDESSTRLFLWIGNKSRLMLQTKGRLLADNINQTERKGQSEIITERENSESDEFKNSLQSSSGIDSLDWSNLSSKEVSIDWKPPTPILYDVKLGRGYLEMPQIELPNGRLVKSLLEAKHVYILDSNGDMFVWIGDMAPKFLKFAGXXXXXXXXXXXXXXXXXXXTVCCQTSEPQIFKMQFADWVDTCAVDFTRSVESVRKRGVNLXXXXXXXXXXXXXRAFFMPRERPMPLEDAKAIMEDCNEDLVGNNMDSNDGKPFKIKQFVYLNRNWVLVEDKWIGHFFNQDCYIVHAEYWX-----------XXXXXXXXXXXXXXXXXXSRIQTVIYFWQGREASDIPWLQFNFSLKKEMEIKFSGMDNMSTTKDSFKKVETKRMFQQQEISTFLAHFQHRFVIHLGKYQDR-YSDQRKNRIELYYLRENGNALCTRTIEVKPMIAFVNSCFHYIMKIPAAASKTENDQ----IICWIGKNSDSHYDEVLQAVAADTFPES-SDILTVKEGAEP-GIFWQALGGKKNYDHEAQFMSFSRLFRLSNEQGFFCASEKCSDFCQDDLADEDVMLLDTGSQIYLWFGNRTSDVEKKLSYKAAKLYQEHMARIQPDRIRQLKITQKKKEPHNFRRCFHGWGPFK 4345
            SV  F+ G+D +      ND S  F +    M+R+QWL L  T L +IP+ +  L +L+ L+++ N + K+ G+  TEL  LR  + R N+L +  +P +LF+  +L  +DLS N L EVP GL  AK+L+VLNLS+NQI+++   LF +   L+ LDLS+N++   P   RR  NL++L+LS+NPL + QLR +  L+ L  L +S T R L N P+ +D L  L +LD+S N+LPK+P  +Y + +L +LNLS NE+ EL+  V+ W  LE LNLSRN+L +LP+ + +L KL++L V++N+L F GIP GIGKL  LEVFSA+ NLLE +PEGLCRCG LK LNL  N+L+TLPDAI+ L+E L   ++ NNP L MPPK  E    +   FYNIDFSL+TQ++LA  A   +   S T K     D+ +R  RLRR     +SE   D+ +VL+GM+ VAKDKD    A+ ED + E   L  K+W +++ KP LDYSK F+ D G  PG+ +W++++F P +I +E+  G F++GDCYI+L T  D+     L+  I++WIG++A+LDK   +A+HAV LRN+L   CR  R EQGDES +F++LFE  +I  EG R  TGF   E+  H  ++Y +     +I +  + P   +LD +  ++ D   T +++W+G +S+  L +K RL+A+ I++TERK + EI  ER+  ES EF   L  +S  +  D +    + V  D++P  P LY V+LG GYLE+PQ+ELP  +L  +LL +KHVYILD   D+FVW G  + + ++ A +KL+ EL  ++ R          + +E QIF+ +FA W +  AVDFTR+ +SV K G NL     + + + D+ A FMPR+  MPL +A+ + E+ N DL              ++ FV  N+ +V + ++ +G F+  +CY+    Y                     ++    ++    IQ V+YFWQGR A ++ WL F F+L+K+ +  F             +++E  R+FQQQE   F++HF+ +F+IH GK +D+ ++ + K+ +E ++LR NG AL TR I++ P    +NS F YI+ +P    +TE+D     +  WIG  + +   +++Q +A   F      +  + EG EP   FW ALGG+K YD +A++M+++RLFR SNE+G++  +EKC+DFCQDDLAD+D+M+LD G  ++LW G R S+VE KL+YK+A++Y +HM   QP+R R+L +T K KE   F +CFHGW  FK
Sbjct:    2 SVLPFVRGVDFT-----KNDFSATFPSSMRQMSRVQWLTLDRTQLAEIPEELGHLQKLEHLSLNHNRLEKIFGE-LTELSCLRSLDLRHNQLKNSGIPPELFHLEELTTLDLSHNKLKEVPEGLERAKNLIVLNLSNNQIESIPTPLFIHLTDLLFLDLSHNRLETLPPQTRRLINLKTLDLSHNPLELFQLRQLPSLQSLEVLKMSGTQRTLLNFPTSIDSLANLCELDLSHNSLPKLPDCVYNVVTLVRLNLSDNELTELTAGVELWQRLESLNLSRNQLVALPAALCKLPKLRRLLVNDNKLNFEGIPSGIGKLGALEVFSAANNLLEMVPEGLCRCGALKQLNLSCNRLITLPDAIH-LLEGLDQLDLRNNPELVMPPKPSEASKATSLEFYNIDFSLQTQLRLAGAAVPPSMPSSATPK-----DSTARKIRLRR---GPRSEGDQDAAKVLKGMKDVAKDKDNEAGAVPEDGKPES--LKPKRWDESLEKPQLDYSKFFEKDDGQLPGLTIWEIENFLPNKI-EEVVHGKFYEGDCYIVLKTKFDDLG--LLDWEIFFWIGNEATLDKRACAAIHAVNLRNFLGARCRTVREEQGDESEQFLSLFETEVIYIEGGRTATGFYTIEEMIHITRLYLVHAYGATIHLEPVAPAITSLDPRHAFVLD-LGTHIYIWMGERSKNTLNSKARLMAEKISKTERKNKCEIQLERQGEESAEFWQGLGMTS--EEADAAEPPKEHVPEDYQPVQPRLYQVQLGMGYLELPQVELPEQKLCHTLLNSKHVYILDCYTDLFVWFGKKSTRLVRAAAVKLSRELFNMMDRPDYALVMRVPEGNEMQIFRTKFAGWDEVMAVDFTRTAKSVAKTGANLTQWARQQETRTDLAALFMPRQSAMPLAEAEQLEEEWNYDLE------------MMEAFVLENKKFVRLPEEELGRFYTGECYVFLCRYCIPIEEPENGSEDGANPAADVSKSSANNQPEDEIQCVVYFWQGRNAGNMGWLTFTFTLQKKFKAMFG------------EELEVVRIFQQQENLKFMSHFKRKFIIHTGKRKDKAHTAKGKSPVEFFHLRSNGGALTTRLIQINPDAVHLNSTFCYILHVPF---ETEDDSQSGIVYVWIGSKACNEEAKLVQDIAEQMFNSPWVSLQILNEGDEPENFFWVALGGRKPYDTDAEYMNYTRLFRCSNERGYYTVAEKCADFCQDDLADDDIMILDNGEHVFLWMGPRCSEVEVKLAYKSAQVYIQHMRIKQPERPRKLFLTMKNKESRRFTKCFHGWSAFK 1253          
BLAST of Protein flightless-1 vs. Ensembl Fly
Match: Gel (gene:FBgn0010225 transcript:FBtr0309257)

HSP 1 Score: 92.0485 bits (227), Expect = 2.413e-18
Identity = 86/368 (23.37%), Postives = 176/368 (47.83%), Query Frame = 2
Query: 2015 DVGIEPGIELWDMDDFYPRRITDELPLGTFFDGDCYIILHTSLDEKSHTSLNHSIYYWIGSQASLDKVTASAVHAVYLRNYLSTNCRCERTEQGDESPEFVALFEGNIIVCEGARGQTGFLKTE-DKEHRKKMYRLFGADKSISIYSLDPTPENLDSKFVYLFDESSTRLFLWIGNKSRLMLQTKGRLLADNINQTERKGQSEI-ITERENSESDE--FKNSLQSSSGIDSLDWSNLSSKEVSIDWKPPTPILYDVKLGRGYLEMPQI-ELPNGRLVKSLLEAKHVYILDSNGDMFVWIGDMAPKFLKFAGXXXXXXXXXXXXXXXXXXXTVCCQTSEPQIFKMQFADWVDTCAVDFTRSVESVRKRG 3103
            + G  PG+E+W +++F P  I  +   G F+ GD +I+L+T ++ K    L+  +++W+G + S D+  A+A+  V L + L+      R  Q  ES  F++ F+  I   +G  G TGF   E + +   +++++ G  +++ +  ++ +  ++++   ++ D  S  +++++G++++ + + K    A+ I   +  G++ + I +  ++++D+  F + L S S     D S                 LY V    G L++  I + P   L +++L+ +  +ILD+   +FVW+G  A +  K   +  A E L      +        + SE   FK  F  W D   +  +R + S    G
Sbjct:   53 NAGRTPGLEIWRIENFEPV-IYPKTNYGKFYTGDSFIVLNT-IENKKDKKLSWDVHFWLGLETSTDEAGAAAILTVQLDDLLNGGPVQHREVQDHESQLFLSYFKNGIRYEQGGVG-TGFKHVETNAQGETRLFQVKGK-RNVRVRQVNLSVSSMNTGDCFILDAGSD-IYVYVGSQAKRVEKLKAISAANQIRDQDHNGRARVQIVDDFSTDADKQHFFDVLGSGSADQVPDESTADEDSAFERTDAAAVSLYKVSDASGKLKVDIIGQKP---LTQAMLDTRECFILDTGSGIFVWVGKGATQKEKTDAMAKAQEFLRTKKYPAWTQIHRIVEGSESAPFKQYFDTWRD-AGMSHSRLIRSALGIG 411          

HSP 2 Score: 79.7221 bits (195), Expect = 1.325e-14
Identity = 51/133 (38.35%), Postives = 69/133 (51.88%), Query Frame = 2
Query: 3953 VKEGAEPGIFWQALGGKKNYDH----EAQFMSFSRLFRLSNEQGFFCASEKCSDFCQDDLADEDVMLLDTGSQIYLWFGNRTSDVEKKLSYKAAKLY--QEHMARIQPDRIRQLKITQKKKEPHNFRRCFHGW 4333
            V+EGAEP  FW+ L G+  YD     +   +  SRLF      G F   E+ + + Q+DL  +D+MLLD G +IYLW G   S+ E       AKLY   E  AR   D +  +++ Q  KEP  F+R F  W
Sbjct:  631 VEEGAEPDEFWEELNGEGQYDRSLGDDGAPLLESRLFHCHLSSGGFLKVEEVAQYEQEDLDSDDIMLLDAGDEIYLWVGYGVSEEENGKLLDTAKLYFNLEPTAR-SFDTVSIIRVPQ-GKEPRVFKRMFPNW 761          
BLAST of Protein flightless-1 vs. Ensembl Fly
Match: Gel (gene:FBgn0010225 transcript:FBtr0336707)

HSP 1 Score: 92.0485 bits (227), Expect = 2.527e-18
Identity = 86/368 (23.37%), Postives = 176/368 (47.83%), Query Frame = 2
Query: 2015 DVGIEPGIELWDMDDFYPRRITDELPLGTFFDGDCYIILHTSLDEKSHTSLNHSIYYWIGSQASLDKVTASAVHAVYLRNYLSTNCRCERTEQGDESPEFVALFEGNIIVCEGARGQTGFLKTE-DKEHRKKMYRLFGADKSISIYSLDPTPENLDSKFVYLFDESSTRLFLWIGNKSRLMLQTKGRLLADNINQTERKGQSEI-ITERENSESDE--FKNSLQSSSGIDSLDWSNLSSKEVSIDWKPPTPILYDVKLGRGYLEMPQI-ELPNGRLVKSLLEAKHVYILDSNGDMFVWIGDMAPKFLKFAGXXXXXXXXXXXXXXXXXXXTVCCQTSEPQIFKMQFADWVDTCAVDFTRSVESVRKRG 3103
            + G  PG+E+W +++F P  I  +   G F+ GD +I+L+T ++ K    L+  +++W+G + S D+  A+A+  V L + L+      R  Q  ES  F++ F+  I   +G  G TGF   E + +   +++++ G  +++ +  ++ +  ++++   ++ D  S  +++++G++++ + + K    A+ I   +  G++ + I +  ++++D+  F + L S S     D S                 LY V    G L++  I + P   L +++L+ +  +ILD+   +FVW+G  A +  K   +  A E L      +        + SE   FK  F  W D   +  +R + S    G
Sbjct:    7 NAGRTPGLEIWRIENFEPV-IYPKTNYGKFYTGDSFIVLNT-IENKKDKKLSWDVHFWLGLETSTDEAGAAAILTVQLDDLLNGGPVQHREVQDHESQLFLSYFKNGIRYEQGGVG-TGFKHVETNAQGETRLFQVKGK-RNVRVRQVNLSVSSMNTGDCFILDAGSD-IYVYVGSQAKRVEKLKAISAANQIRDQDHNGRARVQIVDDFSTDADKQHFFDVLGSGSADQVPDESTADEDSAFERTDAAAVSLYKVSDASGKLKVDIIGQKP---LTQAMLDTRECFILDTGSGIFVWVGKGATQKEKTDAMAKAQEFLRTKKYPAWTQIHRIVEGSESAPFKQYFDTWRD-AGMSHSRLIRSALGIG 365          

HSP 2 Score: 79.7221 bits (195), Expect = 1.423e-14
Identity = 51/133 (38.35%), Postives = 69/133 (51.88%), Query Frame = 2
Query: 3953 VKEGAEPGIFWQALGGKKNYDH----EAQFMSFSRLFRLSNEQGFFCASEKCSDFCQDDLADEDVMLLDTGSQIYLWFGNRTSDVEKKLSYKAAKLY--QEHMARIQPDRIRQLKITQKKKEPHNFRRCFHGW 4333
            V+EGAEP  FW+ L G+  YD     +   +  SRLF      G F   E+ + + Q+DL  +D+MLLD G +IYLW G   S+ E       AKLY   E  AR   D +  +++ Q  KEP  F+R F  W
Sbjct:  585 VEEGAEPDEFWEELNGEGQYDRSLGDDGAPLLESRLFHCHLSSGGFLKVEEVAQYEQEDLDSDDIMLLDAGDEIYLWVGYGVSEEENGKLLDTAKLYFNLEPTAR-SFDTVSIIRVPQ-GKEPRVFKRMFPNW 715          
BLAST of Protein flightless-1 vs. Ensembl Fly
Match: Gel (gene:FBgn0010225 transcript:FBtr0078971)

HSP 1 Score: 92.0485 bits (227), Expect = 2.527e-18
Identity = 86/368 (23.37%), Postives = 176/368 (47.83%), Query Frame = 2
Query: 2015 DVGIEPGIELWDMDDFYPRRITDELPLGTFFDGDCYIILHTSLDEKSHTSLNHSIYYWIGSQASLDKVTASAVHAVYLRNYLSTNCRCERTEQGDESPEFVALFEGNIIVCEGARGQTGFLKTE-DKEHRKKMYRLFGADKSISIYSLDPTPENLDSKFVYLFDESSTRLFLWIGNKSRLMLQTKGRLLADNINQTERKGQSEI-ITERENSESDE--FKNSLQSSSGIDSLDWSNLSSKEVSIDWKPPTPILYDVKLGRGYLEMPQI-ELPNGRLVKSLLEAKHVYILDSNGDMFVWIGDMAPKFLKFAGXXXXXXXXXXXXXXXXXXXTVCCQTSEPQIFKMQFADWVDTCAVDFTRSVESVRKRG 3103
            + G  PG+E+W +++F P  I  +   G F+ GD +I+L+T ++ K    L+  +++W+G + S D+  A+A+  V L + L+      R  Q  ES  F++ F+  I   +G  G TGF   E + +   +++++ G  +++ +  ++ +  ++++   ++ D  S  +++++G++++ + + K    A+ I   +  G++ + I +  ++++D+  F + L S S     D S                 LY V    G L++  I + P   L +++L+ +  +ILD+   +FVW+G  A +  K   +  A E L      +        + SE   FK  F  W D   +  +R + S    G
Sbjct:    7 NAGRTPGLEIWRIENFEPV-IYPKTNYGKFYTGDSFIVLNT-IENKKDKKLSWDVHFWLGLETSTDEAGAAAILTVQLDDLLNGGPVQHREVQDHESQLFLSYFKNGIRYEQGGVG-TGFKHVETNAQGETRLFQVKGK-RNVRVRQVNLSVSSMNTGDCFILDAGSD-IYVYVGSQAKRVEKLKAISAANQIRDQDHNGRARVQIVDDFSTDADKQHFFDVLGSGSADQVPDESTADEDSAFERTDAAAVSLYKVSDASGKLKVDIIGQKP---LTQAMLDTRECFILDTGSGIFVWVGKGATQKEKTDAMAKAQEFLRTKKYPAWTQIHRIVEGSESAPFKQYFDTWRD-AGMSHSRLIRSALGIG 365          

HSP 2 Score: 79.7221 bits (195), Expect = 1.423e-14
Identity = 51/133 (38.35%), Postives = 69/133 (51.88%), Query Frame = 2
Query: 3953 VKEGAEPGIFWQALGGKKNYDH----EAQFMSFSRLFRLSNEQGFFCASEKCSDFCQDDLADEDVMLLDTGSQIYLWFGNRTSDVEKKLSYKAAKLY--QEHMARIQPDRIRQLKITQKKKEPHNFRRCFHGW 4333
            V+EGAEP  FW+ L G+  YD     +   +  SRLF      G F   E+ + + Q+DL  +D+MLLD G +IYLW G   S+ E       AKLY   E  AR   D +  +++ Q  KEP  F+R F  W
Sbjct:  585 VEEGAEPDEFWEELNGEGQYDRSLGDDGAPLLESRLFHCHLSSGGFLKVEEVAQYEQEDLDSDDIMLLDAGDEIYLWVGYGVSEEENGKLLDTAKLYFNLEPTAR-SFDTVSIIRVPQ-GKEPRVFKRMFPNW 715          
BLAST of Protein flightless-1 vs. Ensembl Fly
Match: Gel (gene:FBgn0010225 transcript:FBtr0078973)

HSP 1 Score: 92.0485 bits (227), Expect = 2.715e-18
Identity = 86/368 (23.37%), Postives = 176/368 (47.83%), Query Frame = 2
Query: 2015 DVGIEPGIELWDMDDFYPRRITDELPLGTFFDGDCYIILHTSLDEKSHTSLNHSIYYWIGSQASLDKVTASAVHAVYLRNYLSTNCRCERTEQGDESPEFVALFEGNIIVCEGARGQTGFLKTE-DKEHRKKMYRLFGADKSISIYSLDPTPENLDSKFVYLFDESSTRLFLWIGNKSRLMLQTKGRLLADNINQTERKGQSEI-ITERENSESDE--FKNSLQSSSGIDSLDWSNLSSKEVSIDWKPPTPILYDVKLGRGYLEMPQI-ELPNGRLVKSLLEAKHVYILDSNGDMFVWIGDMAPKFLKFAGXXXXXXXXXXXXXXXXXXXTVCCQTSEPQIFKMQFADWVDTCAVDFTRSVESVRKRG 3103
            + G  PG+E+W +++F P  I  +   G F+ GD +I+L+T ++ K    L+  +++W+G + S D+  A+A+  V L + L+      R  Q  ES  F++ F+  I   +G  G TGF   E + +   +++++ G  +++ +  ++ +  ++++   ++ D  S  +++++G++++ + + K    A+ I   +  G++ + I +  ++++D+  F + L S S     D S                 LY V    G L++  I + P   L +++L+ +  +ILD+   +FVW+G  A +  K   +  A E L      +        + SE   FK  F  W D   +  +R + S    G
Sbjct:   65 NAGRTPGLEIWRIENFEPV-IYPKTNYGKFYTGDSFIVLNT-IENKKDKKLSWDVHFWLGLETSTDEAGAAAILTVQLDDLLNGGPVQHREVQDHESQLFLSYFKNGIRYEQGGVG-TGFKHVETNAQGETRLFQVKGK-RNVRVRQVNLSVSSMNTGDCFILDAGSD-IYVYVGSQAKRVEKLKAISAANQIRDQDHNGRARVQIVDDFSTDADKQHFFDVLGSGSADQVPDESTADEDSAFERTDAAAVSLYKVSDASGKLKVDIIGQKP---LTQAMLDTRECFILDTGSGIFVWVGKGATQKEKTDAMAKAQEFLRTKKYPAWTQIHRIVEGSESAPFKQYFDTWRD-AGMSHSRLIRSALGIG 423          

HSP 2 Score: 80.1073 bits (196), Expect = 1.295e-14
Identity = 51/133 (38.35%), Postives = 69/133 (51.88%), Query Frame = 2
Query: 3953 VKEGAEPGIFWQALGGKKNYDH----EAQFMSFSRLFRLSNEQGFFCASEKCSDFCQDDLADEDVMLLDTGSQIYLWFGNRTSDVEKKLSYKAAKLY--QEHMARIQPDRIRQLKITQKKKEPHNFRRCFHGW 4333
            V+EGAEP  FW+ L G+  YD     +   +  SRLF      G F   E+ + + Q+DL  +D+MLLD G +IYLW G   S+ E       AKLY   E  AR   D +  +++ Q  KEP  F+R F  W
Sbjct:  643 VEEGAEPDEFWEELNGEGQYDRSLGDDGAPLLESRLFHCHLSSGGFLKVEEVAQYEQEDLDSDDIMLLDAGDEIYLWVGYGVSEEENGKLLDTAKLYFNLEPTAR-SFDTVSIIRVPQ-GKEPRVFKRMFPNW 773          
BLAST of Protein flightless-1 vs. Ensembl Zebrafish
Match: flii (FLII actin remodeling protein [Source:ZFIN;Acc:ZDB-GENE-071212-3])

HSP 1 Score: 858.981 bits (2218), Expect = 0.000e+0
Identity = 541/1310 (41.30%), Postives = 777/1310 (59.31%), Query Frame = 2
Query:  512 SKSVSQFLLGIDLSCVEIKDNDCSEAFSNMTRIQWLKLVSTGLEQIPKGVEKLTQLQRLTISKNNINKLSGDWCTELKALRVFNARKNKLTDDSLPEQLFNNPQLQVVDLSFNLLTEVPAGLVEAKSLLVLNLSDNQIKNVSKDLFANCVSLMILDLSNNQIVGFPTXXXXXXXXXXXXXXXXXXXXXXXRSINGXXXXXXXXXXXXXXXXENIPSDLDKLPCLQDLDISDNNLPKVPQTIYEITSLTKLNLSGNEIDELSGLVDCWPNLEVXXXXXXXXXXXPSFITRLSKLKKLYVDENRLTFNGIPPGIGKLSNLEVFSASENLLENIPEGLCRCGQLKHLNLRMNKLVTLPDAINVLIESLKTFNIENNPNLKMPPKLVEVDLKSKYAFYNIDFSLETQMQLARGAPAKASSKSVTQKHKFTQDTASRIRRLRRKKIDEKSEKGSDSKRVLEGMQKVAKDKD-AIMEDREKEEKLLSAKKWQDAIAKPNLDYSKLFDDDVGIEPGIELWDMDDFYPRRITDELPLGTFFDGDCYIILHTSLDEKSHTSLNHSIYYWIGSQASLDKVTASAVHAVYLRNYLSTNCRCERTEQGDESPEFVALFEGNIIVCEGARGQTGFLKTEDKEHRKKMYRLFGADKSISIYSLDPTPENLDSKFVYLFDESSTRLFLWIGNKSRLMLQTKGRLLADNINQTERKGQSEIITERENSESDEFKNSLQSSSGIDSLDWSNLSSKEVSIDWKPPTPILYDVKLGRGYLEMPQIE---------------LPNGRLVKSLLEAKHVYILDSNGDMFVWIGDMAPKFLKFAGXXXXXXXXXXXXXXXXXXXTVCCQTSEPQIFKMQFADWVDTCAVDFTRSVESVRKR----GVNLXXXXXXXXXXXXXRAFFMPRERPMPLEDAKAIMEDCNEDLVGNNMDSNDGKPFKIKQFVYLNRNWVLVEDKWIGHFFNQDCYIVHAEYWXXXXXXXXXXXXXXXXXXXSR--------IQTVIYFWQGREASDIPWLQFNFSLKKEMEIKFSGMDNMSTTKDSFKKVETKRMFQQQEISTFLAHFQHRFVIHLGKYQDRYSDQRKNRIELYYLRENGNALCTRTIEVKPMIAFVNSCFHYIMKIPAAASKTENDQII-CWIGKNSDSHYDEVLQAVAADTFPESSDILTVKEGAEP-GIFWQALGGKKNYDHEAQFMSFSRLFRLSNEQGFFCASEKCSDFCQDDLADEDVMLLDTGSQIYLWFGNRTSDVEKKLSYKAAKLYQEHMARIQPDRIRQLKITQKKKEPHNFRRCFHGWGPFKEA 4351
            +  V  F+ G+DLS  + K  +  E   +MT ++WLKL  TGL  +P+ +  L +L+ L++S N++  L G+  + L  LR   AR N L +  +P+ +F    L V+DLS N LTE+P  L  ++++LVLNLS N I N+   LF N   L+ LDLS+N +   P  +RR  +LQ+L L+NNPL  +QLR +  +  L TL L NT R   N+P+ L+ L  L D+D+S N+L +VP+ +Y + +L +LNLS N+I ELS  +D W  LE LNLSRN+L SLPS I +LSKLKKLYV+ N++ F+G+P G+GKLSNL  F A+ N LE +PEGLCRCG+LK L L  N+LVTLP+AI+ L E L+  ++  NPNL MPPK V+        +YNIDFSL+ Q++LA  +PA  ++       +   D  +R  RLRR K    S     +K+VL+GM  VA++K+ +I E+ + +   L  K+W   + KP LDYS+ F +DVG  PG+ +W +++F P ++ DE   G F++ DCYIIL T LDE    +LN  I+YWIG  A+LDK   +A+HAV LRNYL   CR  R E GDES EF A+F+  I   EG    +GF   ED ++  ++YR++G  K+I + S+     +LD +FV+L D +   +++W G  + L   TK RL A+ IN+ ERK ++EI T  +N E  EF   L                K V  D+ P  P LY V LG GYLE+PQI                +P  RLV+ LL+ K VYILD   D+F+WIG  +P+ ++ A LKL  E+  +L R          + +E Q+FK +F +W D   VD+TR+ ESV++     G    D+ +KD+MK D+ A F+PR+  MPL +A+ +ME+ NEDL G            ++ FV   + +  + ++  GHF  QDCY+    YW   E +D   +     EE            Q V+YFWQGREAS++ WL F FSL+K+ E  F G            K+E  RM QQQE   FL+HF+ +F+IH GK + +    + +   LY++R NG+ALCTRTI++    + +NS F +I+K+P  +  T+N  I+  W+G+ +D    ++ + +    F ++     + EG EP   FW  +G +K YD +A++M ++RLFR SNE+G+F  SEKCSDFCQDDLAD+D+MLLD G ++Y+W G +TS VE KLS KA ++Y +HM     +  R+L++ +K  EPH F RCFH W  FK A
Sbjct:    3 ATGVLPFIRGVDLSGNDFKGGNFPEHVKSMTSLRWLKLNRTGLCYLPEELASLQKLEHLSVSHNSLTTLHGE-LSSLPNLRAVVARANNLKNSGVPDDIFQLDDLSVLDLSHNQLTEIPRDLENSRNMLVLNLSHNSIDNIPNQLFINLTDLLYLDLSDNNLDSLPPQMRRLVHLQTLILNNNPLMHAQLRQLPVMVSLQTLHLRNTQRTQNNMPTSLEGLSNLTDVDLSCNDLTRVPECLYSLVNLKRLNLSSNQISELSLCIDQWTKLETLNLSRNQLTSLPSAICKLSKLKKLYVNSNKIDFDGLPSGVGKLSNLVEFMAANNNLELVPEGLCRCGKLKKLVLNKNRLVTLPEAIHFLTE-LEVLDVRENPNLVMPPKPVD----RTAEWYNIDFSLQNQLRLAGASPATVAAAGGGNSPR---DHMARKMRLRRCK---DSAHDDQAKQVLKGMSDVAQEKNKSIEENGDLKYSDLKTKRWDKNLEKPQLDYSEFFLEDVGQIPGVSVWQIENFIPIQV-DEAFHGKFYEADCYIILKTFLDENG--ALNWQIFYWIGQDATLDKKAGAAIHAVNLRNYLGAECRTIREEMGDESEEFTAVFDHEISYIEGGTA-SGFYTVEDTQYPTRLYRVYGK-KNIRLESVPLKASSLDPRFVFLLD-TGLEIYVWRGGNATLGGTTKARLFAEKINKNERKSKAEITTLMQNQEPPEFWEVLGGQP--------EEIKKHVPDDFTPIRPKLYKVGLGLGYLELPQINYKLSVEHKDKLKLDVVPELRLVQGLLDTKGVYILDCWSDVFIWIGRKSPRLVRAAALKLGQEVCGMLHRPKHAVVIRNLEGTECQVFKSKFKNWDDVLKVDYTRNAESVKQEAGLSGKVKKDVEQKDQMKADLTALFLPRQPAMPLTEAEQMMEEWNEDLDG------------MEGFVLEGKKFARLPEEEFGHFHTQDCYVFLCRYWVPVEYEDDKEKGKEKGEEGDDEEKQPEEDFQCVVYFWQGREASNMGWLTFTFSLQKKFESLFPG------------KLEVVRMTQQQENLKFLSHFKRKFIIHKGKRKLKVDSVQPS---LYHIRTNGSALCTRTIQIATDSSNLNSEFCFILKVPFES--TDNQGIVYTWVGRAADPDEAKLAEEIMNTMFDDTYSKQVINEGEEPENFFWVGIGSQKTYDEDAEYMKYARLFRCSNEKGYFAVSEKCSDFCQDDLADDDIMLLDNGKEVYMWVGTQTSQVEIKLSLKACQVYIQHMRSKDTENPRKLRLVRKGNEPHCFTRCFHAWSAFKTA 1257          
BLAST of Protein flightless-1 vs. Ensembl Zebrafish
Match: vil1 (villin 1 [Source:ZFIN;Acc:ZDB-GENE-040426-799])

HSP 1 Score: 190.66 bits (483), Expect = 3.842e-49
Identity = 193/795 (24.28%), Postives = 335/795 (42.14%), Query Frame = 2
Query: 2030 PGIELWDMDDFY----PRRITDELPLGTFFDGDCYIILHTSLDEKSHTSLNHSIYYWIGSQASLDKVTASAVHAVYLRNYLSTNCRCERTEQGDESPEFVALFEGNIIVCEGARGQTGFLKTEDKEHRKKMYRLFGADKSISIYSLDPTPENLDSKFVYLFDESSTRLFLWIGNKSRLMLQTKGRLLADNINQTERKGQSEIITERENSE--SDEFKNSLQSSSGIDSLDWSNLSSKEVSIDWKPPTPI-LYDVKLGRGYLEMPQIELPNGRLVKSLLEAKHVYILDSNG-DMFVWIGDMAPKFLKFAGXXXXXXXXXXXXXXXXXXXTVCCQTSEPQIFKMQFADWVD---TCAVDFTRS------VESVRKRGVNLXXXXXXXXXXXXXRAFFMPRERPMPLEDAKAIMEDCNEDLVGNNMDSNDGKPFKIKQFVYLNRNWVLVEDKWIGHFFNQDCYIVHAEYWXXXXXXXXXXXXXXXXXXXSRIQTVIYFWQGREASDIPWLQFNFSLKKEMEIKFSGMDNMSTTKDSFKKVETKRMFQQQEISTFLAHFQHRFVIHLGKYQDRYSDQRKNRIELYYLRENGNALCTRTIEVKPMIAFVNSCFHYIMKIPAAASKTENDQIICWIGKNSDSHYDEVLQAVAADTFPESSDILTVKEGAEPGIFWQALGGKKNYDHEAQFMS-----FSRLFRLSNEQGFFCASEKCSDFCQDDLADEDVMLLDTGSQIYLWFGNRTSDVEKKLSYKAAKLY-QEHMARIQPDRIRQLKITQKKKEPHNFRRCFHGWGPFK 4345
            PG+++W +++      P +       G FF+GD Y+IL+T    K+  + ++ I+YW+G   S D++ A+A++   + ++L       R  QG ES  F   F+  II  +G    +G  + E   +  +       +K +    ++ +  + +   V+L D  S  +  W G KS  M + +G  LA +I   ER G++++     + E  S+E    ++ S G    +       E+ +D K  T I LY +   +G L + ++ +    L + LL+ +  Y+LD  G  +F+W G  A K  +   LK+A   ++              + +E  +FK  F  W D   T  +  T +      VE V+    ++                     RP      K + +   E  V   ++ N+  P               V+ KW+GHF+  DCY++  +Y                 E +S+   ++Y WQGR AS        +     ++ K++G           + V+  R+   +E    +A F+ + +++        S Q +  + L+++    N   TR  EV P  + +NS   +++        + +     W GK       E+ +++A         ++   EG EP  FW  LGGK  Y    +          RLF  SN+ G F A+E  ++F QDDL ++DVMLLD   Q+YLW G   +D EK+ +   A+ Y + H A    D    + + ++  EP  F   FH W P K
Sbjct:   18 PGLQIWRVENMELVPCPSKT-----FGQFFEGDSYVILYT---HKTSNNFSYDIHYWLGKSTSQDEMGAAAIYTTQMDDHLGGVAVQHRETQGHESATFQGYFKQGIIYKKGGVA-SGMKQVETNTYNIRRLLHVKGNKHVVAGEVEMSWNSFNKGDVFLLDLGSL-IIQWNGPKSNRMERLRGMNLAKDIRDRERGGRAQVAVVEGDDEQSSEEAMKLMKQSLGERPKNIKEAIPDEI-VDEKLKTAIKLYHISDAQGSLVVQEVAVKP--LTQDLLKTEDCYLLDQGGIKIFIWKGKKASKAERTESLKMAEAYVKAKGYPVSTYIETVSEGAESSVFKQLFQKWTDKGQTVGMGTTHNPGKIAKVEQVKFDATSM-------------------HARPDIAAQQKMVDDGSGEAEVWR-IEDNELAP---------------VDRKWLGHFYGGDCYLILYKY-----------------EVSSKFHYILYMWQGRHASTAELTACAYQAVI-LDQKYNG-----------EPVQV-RVPMGKEPMHLMAIFKGKMIVYEEGSSREGSSQSRPSVRLFHVH-GTNEFNTRATEVPPRSSSLNSNDVFVL--------STDKCCYLWYGKGCSGDEREMAKSLADIISKREKQVIA--EGQEPADFWVNLGGKSQYASNKRLQDENISITPRLFECSNQTGRFIATE-ITNFNQDDLDEDDVMLLDIWDQVYLWIGKGANDTEKREAVVTAQEYLKSHPAGRDLD--TPVLVVKQGFEPPTFTGWFHAWDPQK 720          

HSP 2 Score: 63.5438 bits (153), Expect = 1.896e-9
Identity = 78/315 (24.76%), Postives = 135/315 (42.86%), Query Frame = 2
Query: 1976 AKPNLDYS-KLFDDDVGIEPGIELWDMDD--FYPRRITDELPLGTFFDGDCYIILHTSLDEKSHTSLNHSIYYWIGSQASLDKVTASAVHAVYLRNYLSTNCRCERTEQGDESPEFVALFEGNIIVCEGARGQTGFLKTEDKEHRKKMYRLFGADK-SISIYSLDPTPENLDSKFVYLFDESSTRLFLWIGNKSRLMLQTKGRLLADNINQTERKGQSEIITERENSESDEFKNSLQSSSGIDSLDWSNLSSKEVSIDWKPPTPILYDVKLGRGYLEMPQIELPNGRLVKSLLEAKHVYILDSNGDMFVWIGDMA 2908
            A+P++    K+ DD  G     E+W ++D    P    D   LG F+ GDCY+IL+     +  +  ++ +Y W G  AS  ++TA A  AV L    +      R   G E    +A+F+G +IV E    + G   +       +++ + G ++ +     + P   +L+S  V++        +LW G       +   + LAD I++ E+    ++I   E  E  +F  +L   S   S     L  + +SI     TP L++     G     +I   N    +  L+   V +LD    +++WIG  A
Sbjct:  384 ARPDIAAQQKMVDDGSG---EAEVWRIEDNELAP---VDRKWLGHFYGGDCYLILYKY---EVSSKFHYILYMWQGRHASTAELTACAYQAVILDQKYNGEPVQVRVPMGKEPMHLMAIFKGKMIVYEEGSSREG---SSQSRPSVRLFHVHGTNEFNTRATEVPPRSSSLNSNDVFVLSTDKC-CYLWYGKGCSGDEREMAKSLADIISKREK----QVIA--EGQEPADFWVNLGGKSQYASN--KRLQDENISI-----TPRLFECSNQTGRFIATEITNFN----QDDLDEDDVMLLDIWDQVYLWIGKGA 668          
BLAST of Protein flightless-1 vs. Ensembl Zebrafish
Match: vil1 (villin 1 [Source:ZFIN;Acc:ZDB-GENE-040426-799])

HSP 1 Score: 190.66 bits (483), Expect = 3.842e-49
Identity = 193/795 (24.28%), Postives = 335/795 (42.14%), Query Frame = 2
Query: 2030 PGIELWDMDDFY----PRRITDELPLGTFFDGDCYIILHTSLDEKSHTSLNHSIYYWIGSQASLDKVTASAVHAVYLRNYLSTNCRCERTEQGDESPEFVALFEGNIIVCEGARGQTGFLKTEDKEHRKKMYRLFGADKSISIYSLDPTPENLDSKFVYLFDESSTRLFLWIGNKSRLMLQTKGRLLADNINQTERKGQSEIITERENSE--SDEFKNSLQSSSGIDSLDWSNLSSKEVSIDWKPPTPI-LYDVKLGRGYLEMPQIELPNGRLVKSLLEAKHVYILDSNG-DMFVWIGDMAPKFLKFAGXXXXXXXXXXXXXXXXXXXTVCCQTSEPQIFKMQFADWVD---TCAVDFTRS------VESVRKRGVNLXXXXXXXXXXXXXRAFFMPRERPMPLEDAKAIMEDCNEDLVGNNMDSNDGKPFKIKQFVYLNRNWVLVEDKWIGHFFNQDCYIVHAEYWXXXXXXXXXXXXXXXXXXXSRIQTVIYFWQGREASDIPWLQFNFSLKKEMEIKFSGMDNMSTTKDSFKKVETKRMFQQQEISTFLAHFQHRFVIHLGKYQDRYSDQRKNRIELYYLRENGNALCTRTIEVKPMIAFVNSCFHYIMKIPAAASKTENDQIICWIGKNSDSHYDEVLQAVAADTFPESSDILTVKEGAEPGIFWQALGGKKNYDHEAQFMS-----FSRLFRLSNEQGFFCASEKCSDFCQDDLADEDVMLLDTGSQIYLWFGNRTSDVEKKLSYKAAKLY-QEHMARIQPDRIRQLKITQKKKEPHNFRRCFHGWGPFK 4345
            PG+++W +++      P +       G FF+GD Y+IL+T    K+  + ++ I+YW+G   S D++ A+A++   + ++L       R  QG ES  F   F+  II  +G    +G  + E   +  +       +K +    ++ +  + +   V+L D  S  +  W G KS  M + +G  LA +I   ER G++++     + E  S+E    ++ S G    +       E+ +D K  T I LY +   +G L + ++ +    L + LL+ +  Y+LD  G  +F+W G  A K  +   LK+A   ++              + +E  +FK  F  W D   T  +  T +      VE V+    ++                     RP      K + +   E  V   ++ N+  P               V+ KW+GHF+  DCY++  +Y                 E +S+   ++Y WQGR AS        +     ++ K++G           + V+  R+   +E    +A F+ + +++        S Q +  + L+++    N   TR  EV P  + +NS   +++        + +     W GK       E+ +++A         ++   EG EP  FW  LGGK  Y    +          RLF  SN+ G F A+E  ++F QDDL ++DVMLLD   Q+YLW G   +D EK+ +   A+ Y + H A    D    + + ++  EP  F   FH W P K
Sbjct:   18 PGLQIWRVENMELVPCPSKT-----FGQFFEGDSYVILYT---HKTSNNFSYDIHYWLGKSTSQDEMGAAAIYTTQMDDHLGGVAVQHRETQGHESATFQGYFKQGIIYKKGGVA-SGMKQVETNTYNIRRLLHVKGNKHVVAGEVEMSWNSFNKGDVFLLDLGSL-IIQWNGPKSNRMERLRGMNLAKDIRDRERGGRAQVAVVEGDDEQSSEEAMKLMKQSLGERPKNIKEAIPDEI-VDEKLKTAIKLYHISDAQGSLVVQEVAVKP--LTQDLLKTEDCYLLDQGGIKIFIWKGKKASKAERTESLKMAEAYVKAKGYPVSTYIETVSEGAESSVFKQLFQKWTDKGQTVGMGTTHNPGKIAKVEQVKFDATSM-------------------HARPDIAAQQKMVDDGSGEAEVWR-IEDNELAP---------------VDRKWLGHFYGGDCYLILYKY-----------------EVSSKFHYILYMWQGRHASTAELTACAYQAVI-LDQKYNG-----------EPVQV-RVPMGKEPMHLMAIFKGKMIVYEEGSSREGSSQSRPSVRLFHVH-GTNEFNTRATEVPPRSSSLNSNDVFVL--------STDKCCYLWYGKGCSGDEREMAKSLADIISKREKQVIA--EGQEPADFWVNLGGKSQYASNKRLQDENISITPRLFECSNQTGRFIATE-ITNFNQDDLDEDDVMLLDIWDQVYLWIGKGANDTEKREAVVTAQEYLKSHPAGRDLD--TPVLVVKQGFEPPTFTGWFHAWDPQK 720          

HSP 2 Score: 63.5438 bits (153), Expect = 1.896e-9
Identity = 78/315 (24.76%), Postives = 135/315 (42.86%), Query Frame = 2
Query: 1976 AKPNLDYS-KLFDDDVGIEPGIELWDMDD--FYPRRITDELPLGTFFDGDCYIILHTSLDEKSHTSLNHSIYYWIGSQASLDKVTASAVHAVYLRNYLSTNCRCERTEQGDESPEFVALFEGNIIVCEGARGQTGFLKTEDKEHRKKMYRLFGADK-SISIYSLDPTPENLDSKFVYLFDESSTRLFLWIGNKSRLMLQTKGRLLADNINQTERKGQSEIITERENSESDEFKNSLQSSSGIDSLDWSNLSSKEVSIDWKPPTPILYDVKLGRGYLEMPQIELPNGRLVKSLLEAKHVYILDSNGDMFVWIGDMA 2908
            A+P++    K+ DD  G     E+W ++D    P    D   LG F+ GDCY+IL+     +  +  ++ +Y W G  AS  ++TA A  AV L    +      R   G E    +A+F+G +IV E    + G   +       +++ + G ++ +     + P   +L+S  V++        +LW G       +   + LAD I++ E+    ++I   E  E  +F  +L   S   S     L  + +SI     TP L++     G     +I   N    +  L+   V +LD    +++WIG  A
Sbjct:  384 ARPDIAAQQKMVDDGSG---EAEVWRIEDNELAP---VDRKWLGHFYGGDCYLILYKY---EVSSKFHYILYMWQGRHASTAELTACAYQAVILDQKYNGEPVQVRVPMGKEPMHLMAIFKGKMIVYEEGSSREG---SSQSRPSVRLFHVHGTNEFNTRATEVPPRSSSLNSNDVFVLSTDKC-CYLWYGKGCSGDEREMAKSLADIISKREK----QVIA--EGQEPADFWVNLGGKSQYASN--KRLQDENISI-----TPRLFECSNQTGRFIATEITNFN----QDDLDEDDVMLLDIWDQVYLWIGKGA 668          
BLAST of Protein flightless-1 vs. Ensembl Zebrafish
Match: vil1 (villin 1 [Source:ZFIN;Acc:ZDB-GENE-040426-799])

HSP 1 Score: 190.66 bits (483), Expect = 3.842e-49
Identity = 193/795 (24.28%), Postives = 335/795 (42.14%), Query Frame = 2
Query: 2030 PGIELWDMDDFY----PRRITDELPLGTFFDGDCYIILHTSLDEKSHTSLNHSIYYWIGSQASLDKVTASAVHAVYLRNYLSTNCRCERTEQGDESPEFVALFEGNIIVCEGARGQTGFLKTEDKEHRKKMYRLFGADKSISIYSLDPTPENLDSKFVYLFDESSTRLFLWIGNKSRLMLQTKGRLLADNINQTERKGQSEIITERENSE--SDEFKNSLQSSSGIDSLDWSNLSSKEVSIDWKPPTPI-LYDVKLGRGYLEMPQIELPNGRLVKSLLEAKHVYILDSNG-DMFVWIGDMAPKFLKFAGXXXXXXXXXXXXXXXXXXXTVCCQTSEPQIFKMQFADWVD---TCAVDFTRS------VESVRKRGVNLXXXXXXXXXXXXXRAFFMPRERPMPLEDAKAIMEDCNEDLVGNNMDSNDGKPFKIKQFVYLNRNWVLVEDKWIGHFFNQDCYIVHAEYWXXXXXXXXXXXXXXXXXXXSRIQTVIYFWQGREASDIPWLQFNFSLKKEMEIKFSGMDNMSTTKDSFKKVETKRMFQQQEISTFLAHFQHRFVIHLGKYQDRYSDQRKNRIELYYLRENGNALCTRTIEVKPMIAFVNSCFHYIMKIPAAASKTENDQIICWIGKNSDSHYDEVLQAVAADTFPESSDILTVKEGAEPGIFWQALGGKKNYDHEAQFMS-----FSRLFRLSNEQGFFCASEKCSDFCQDDLADEDVMLLDTGSQIYLWFGNRTSDVEKKLSYKAAKLY-QEHMARIQPDRIRQLKITQKKKEPHNFRRCFHGWGPFK 4345
            PG+++W +++      P +       G FF+GD Y+IL+T    K+  + ++ I+YW+G   S D++ A+A++   + ++L       R  QG ES  F   F+  II  +G    +G  + E   +  +       +K +    ++ +  + +   V+L D  S  +  W G KS  M + +G  LA +I   ER G++++     + E  S+E    ++ S G    +       E+ +D K  T I LY +   +G L + ++ +    L + LL+ +  Y+LD  G  +F+W G  A K  +   LK+A   ++              + +E  +FK  F  W D   T  +  T +      VE V+    ++                     RP      K + +   E  V   ++ N+  P               V+ KW+GHF+  DCY++  +Y                 E +S+   ++Y WQGR AS        +     ++ K++G           + V+  R+   +E    +A F+ + +++        S Q +  + L+++    N   TR  EV P  + +NS   +++        + +     W GK       E+ +++A         ++   EG EP  FW  LGGK  Y    +          RLF  SN+ G F A+E  ++F QDDL ++DVMLLD   Q+YLW G   +D EK+ +   A+ Y + H A    D    + + ++  EP  F   FH W P K
Sbjct:   18 PGLQIWRVENMELVPCPSKT-----FGQFFEGDSYVILYT---HKTSNNFSYDIHYWLGKSTSQDEMGAAAIYTTQMDDHLGGVAVQHRETQGHESATFQGYFKQGIIYKKGGVA-SGMKQVETNTYNIRRLLHVKGNKHVVAGEVEMSWNSFNKGDVFLLDLGSL-IIQWNGPKSNRMERLRGMNLAKDIRDRERGGRAQVAVVEGDDEQSSEEAMKLMKQSLGERPKNIKEAIPDEI-VDEKLKTAIKLYHISDAQGSLVVQEVAVKP--LTQDLLKTEDCYLLDQGGIKIFIWKGKKASKAERTESLKMAEAYVKAKGYPVSTYIETVSEGAESSVFKQLFQKWTDKGQTVGMGTTHNPGKIAKVEQVKFDATSM-------------------HARPDIAAQQKMVDDGSGEAEVWR-IEDNELAP---------------VDRKWLGHFYGGDCYLILYKY-----------------EVSSKFHYILYMWQGRHASTAELTACAYQAVI-LDQKYNG-----------EPVQV-RVPMGKEPMHLMAIFKGKMIVYEEGSSREGSSQSRPSVRLFHVH-GTNEFNTRATEVPPRSSSLNSNDVFVL--------STDKCCYLWYGKGCSGDEREMAKSLADIISKREKQVIA--EGQEPADFWVNLGGKSQYASNKRLQDENISITPRLFECSNQTGRFIATE-ITNFNQDDLDEDDVMLLDIWDQVYLWIGKGANDTEKREAVVTAQEYLKSHPAGRDLD--TPVLVVKQGFEPPTFTGWFHAWDPQK 720          

HSP 2 Score: 63.5438 bits (153), Expect = 1.896e-9
Identity = 78/315 (24.76%), Postives = 135/315 (42.86%), Query Frame = 2
Query: 1976 AKPNLDYS-KLFDDDVGIEPGIELWDMDD--FYPRRITDELPLGTFFDGDCYIILHTSLDEKSHTSLNHSIYYWIGSQASLDKVTASAVHAVYLRNYLSTNCRCERTEQGDESPEFVALFEGNIIVCEGARGQTGFLKTEDKEHRKKMYRLFGADK-SISIYSLDPTPENLDSKFVYLFDESSTRLFLWIGNKSRLMLQTKGRLLADNINQTERKGQSEIITERENSESDEFKNSLQSSSGIDSLDWSNLSSKEVSIDWKPPTPILYDVKLGRGYLEMPQIELPNGRLVKSLLEAKHVYILDSNGDMFVWIGDMA 2908
            A+P++    K+ DD  G     E+W ++D    P    D   LG F+ GDCY+IL+     +  +  ++ +Y W G  AS  ++TA A  AV L    +      R   G E    +A+F+G +IV E    + G   +       +++ + G ++ +     + P   +L+S  V++        +LW G       +   + LAD I++ E+    ++I   E  E  +F  +L   S   S     L  + +SI     TP L++     G     +I   N    +  L+   V +LD    +++WIG  A
Sbjct:  384 ARPDIAAQQKMVDDGSG---EAEVWRIEDNELAP---VDRKWLGHFYGGDCYLILYKY---EVSSKFHYILYMWQGRHASTAELTACAYQAVILDQKYNGEPVQVRVPMGKEPMHLMAIFKGKMIVYEEGSSREG---SSQSRPSVRLFHVHGTNEFNTRATEVPPRSSSLNSNDVFVLSTDKC-CYLWYGKGCSGDEREMAKSLADIISKREK----QVIA--EGQEPADFWVNLGGKSQYASN--KRLQDENISI-----TPRLFECSNQTGRFIATEITNFN----QDDLDEDDVMLLDIWDQVYLWIGKGA 668          
BLAST of Protein flightless-1 vs. Ensembl Zebrafish
Match: avil (advillin [Source:ZFIN;Acc:ZDB-GENE-060421-6683])

HSP 1 Score: 189.504 bits (480), Expect = 6.685e-49
Identity = 201/780 (25.77%), Postives = 320/780 (41.03%), Query Frame = 2
Query: 2096 GTFFDGDCYIILHTSLDEKSHTSLNHSIYYWIGSQASLDKVTASAVHAVYLRNYLSTNCRCERTEQGDESPEFVALFEGNIIVCEGARGQTGFLKTEDKEHRKKMYRLFGADKSISIYSLDPTPENLDSKFVYLFDESSTRLFLWIGNKSRLMLQTKGRLLADNINQTERKGQSEIITERENSES-------------DEFKNSLQSSSGIDSLDWSNLSSKEVSIDWKPPTPILYDVKLGRGYLEMPQIELPNGRLVKSLLEAKHVYILDSNG-DMFVWIGDMAPKFLKFAGXXXXXXXXXXXXXXXXXXXTVCCQTSEPQIFKMQFADWVDTCAVDFTRSVESVRKRGVNLXXXXXXXXXXXXXRAFFMPRERPMPLEDAKAIMEDCNEDLVGNNMDSNDGKPFKIKQFVYLNRNWVLVEDKWIGHFFNQDCYIVHAEYWXXXXXXXXXXXXXXXXXXXSRIQTVIYFWQGREASDIPWLQFNFSLKKEMEIKFSGMDNMSTTKDSFKKVETKRMFQQQEISTFLAHFQHRFVIHLGKYQDRYSDQRKNRIELYYLRENGNALCTRTIEVKPMIAFVNSCFHYIMKIPAAASKTENDQIICWIGKNSDSHYDEVLQAVAAD---TFPESSDILTVKEGAEPGIFWQALGGKKNYDHEAQFMSFS-----RLFRLSNEQGFFCASEKCSDFCQDDLADEDVMLLDTGSQIYLWFGNRTSDVEKKLSYKAAKLY-QEHMARIQPDRIRQLKITQKKKEPHNFRRCFHGWGPFKEAMDWSG 4366
            G FFDGDCY++L T    KS  ++++ I+YWIGS +S+D+  A+A++AV L  +L +     R  Q  ES  F   F+  II   G    +G    E   +  +        + ++   ++ + ++ D+  V+L D   T +  W G +S    + KG +LA +I   ER G++EI     ++E+              E  ++L S +  D  D   ++              LY V    G +++   E+    L + LL     YILD  G  +FVW G MA K  + A +  A E ++L            C   E  +FK  F +W      D T+ +      G             +    F   R   MP   A+  M D           S + + ++I+     N     V     G F+  DCY++   Y                 E   R   ++Y W+GR AS             + E+       ++  +    +     +   +E   F + F+ + VI+ G    +   + +  + L+ +    +   TR +EV  + A +NS   +++K            +  W GK S    DE  +A+A D       S  ++   EG EP  FWQ+LGG+  Y  + +    +     RLF  SN+ G F A+E  + F QDDL ++DVMLLDT  QI+LW GN  +DVE++        Y + H     PD    + I ++  EP  F   F  W P K    WSG
Sbjct:   33 GQFFDGDCYLLLSTC---KSGKTISYDIHYWIGSASSIDEQGAAAMYAVQLDEFLGSTPVQHREVQQHESSMFCGYFKQGIIYKSGGVA-SGMNHVETNTYNIQRLLHVKGRRKVTGTEVEVSWKSFDTGSVFLLDLGKT-IIQWNGPESNTQERLKGMMLAKDIRDRERGGRAEIGVIEGDAEAAAPLLMQVMLSILGERPSTLPSGTPDDVTDREQMAKL-----------TLYHVSDANGTMQI--TEIATSPLTQDLLNHDDCYILDQGGVSIFVWKGKMANKAERQAAMTRALEFIKLKNYPLSTKVESICDGGESALFKQLFKNWT---VKDQTQGLGRTHTVG---------KIADVPQEKFDASRMHMMPEVAAQERMVDDG---------SGEKQVWRIE-----NLELAEVSKATHGFFYGGDCYLILYSY-----------------EVNGRKNYILYMWRGRHAS-------------QDEVTACAYHAVTVDQQYGGQPVQVSVTMGKEPRHFTSIFKGKMVIYEGGTSRKGPVEPEPPVRLFQIC-GSHPSSTRAVEVPALAASLNSNDVFLLK--------SQSGVYLWYGKGSSG--DE--RAMAKDLSVIMGRSEQVMA--EGQEPEEFWQSLGGRTPYASDRRLQQVTLEHQPRLFECSNKTGRFTATE-VTQFTQDDLREDDVMLLDTWDQIFLWMGNEANDVERRECVPTCAEYLRTHPGSRDPD--TPIVIIKQGFEPPTFTGWFTAWDPSK----WSG 716          
BLAST of Protein flightless-1 vs. Ensembl Xenopus
Match: rin2 (Ras and Rab interactor 2 [Source:Xenbase;Acc:XB-GENE-484799])

HSP 1 Score: 830.091 bits (2143), Expect = 0.000e+0
Identity = 532/1327 (40.09%), Postives = 785/1327 (59.16%), Query Frame = 2
Query:  512 SKSVSQFLLGIDLSCVEIKDNDCSEAFSNMTRIQWLKLVSTGLEQIPKGVEKLTQLQRLTISKNNINKLSGDWCTELKALRVFNARKNKLTDDSLPEQLFNNPQLQVVDLSFNLLTEVPAGLVEAKSLLVLNLSDNQIKNVSKDLFANCVSLMILDLSNNQIVGFPTXXXXXXXXXXXXXXXXXXXXXXXRSINGXXXXXXXXXXXXXXXXENIPSDLDKLPCLQDLDISDNNLPKVPQTIYEITSLTKLNLSGNEIDELSGLVDCWPNLEVXXXXXXXXXXXPSFITRLSKLKKLYVDENRLTFNGIPPGIGKLSNLEVFSASENLLENIPEGLCRCGQLKHLNLRMNKLVTLPDAINVLIESLKTFNIENNPNLKMPPKLVEVDLKSKYAFYNIDFSLETQMQLARGAPAKASSKSVTQKHK---FTQDTASRIRRLRRKKIDEKSEKGSDSKRVLEGMQKVAKDKD-AIMEDREKEEKLLSAKKWQDAIAKPNLDYSKLFDDDVGIEPGIELWDMDDFYPRRITDELPLGTFFDGDCYIILHTSLDEKSHTSLNHSIYYWIGSQASLDKVTASAVHAVYLRNYLSTNCRCERTEQGDESPEFVALFEGNIIVCEGARGQTGFLKTEDKEHRKKMYRLFGADKSISIYSLDPTPENLDSKFVYLFDESSTRLFLWIGNKSRLMLQTKGRLLADNINQTERKGQSEIITERENSESDEFKNSLQSSSGIDSLDWSNLSSKE------VSIDWKPPTPILYDVKLGRGYLEMPQIE---------------LPNGRLVKSLLEAKHVYILDSNGDMFVWIGDMAPKFLKFAGXXXXXXXXXXXXXXXXXXXTVCCQTSEPQIFKMQFADWVDTCAVDFTRSVESVRKRG---VNLXXXXXXXXXXXXXRAFFMPRERPMPLEDAKAIMEDCNEDLVGNNMDSNDGKPFKIKQFVYLNRNWVLVEDKWIGHFFNQDCYIVHAEYWXXXXXXXXXXXXXXXXXXXS------------------RIQTVIYFWQGREASDIPWLQFNFSLKKEMEIKFSGMDNMSTTKDSFKKVETKRMFQQQEISTFLAHFQHRFVIHLGKYQDRYSDQRKNRIELYYLRENGNALCTRTIEVKPMIAFVNSCFHYIMKIPAAASKTENDQII-CWIGKNSDSHYDEVLQAVAADTFPESSDILTVKEGAEP-GIFWQALGGKKNYDHEAQFMSFSRLFRLSNEQGFFCASEKCSDFCQDDLADEDVMLLDTGSQIYLWFGNRTSDVEKKLSYKAAKLYQEHMARIQPDRIRQLKITQKKKEPHNFRRCFHGWGPFKE 4348
            +  V  F+ G+DLS  + K     E   +M+ ++WLKL  TGL  +P+ +  L +L+ L++S N++  L G+  + L  LR   AR N L +  +P+ +F    L V+DLS+N LTE P  L  AK++LVLNLS N I N+   LF N   L+ LDLS+N++   P  +RR  +LQ+L L+NNPL  +QLR +  +  L TL L NT R   N+P+ L+ L CL D+D+S N + ++P+ +Y + SL +LNLS N+I E+S  +D W  LE LNL+RN+L SLPS I +L+KLKKLY++ N++ F+GIP GIGKLSNLE F A+ N LE IPE LCRC +L+ L L  N+LVTLP+A++ L + L+  ++  NP+L MPPK    D  S+  FYNIDFSL+ Q++LA  +PA  ++ +     +    T+D ++R  RLRR+K    + +   +K+VL+GM  VA++K+  I E+ + +   L A++W   + KP+LDYS+ F +DVG  PG+ +W +++F P ++ DE   G F++ DCYI+L T LD  S+ +L+  IYYWIG +A+LDK   SA+HAV LRNYL    R  R E GDES EF  +F  +I   EG    +GF   ED ++  ++YR++G  K+I +  +     +LD +FV+L D     +++W G+++ L   TK RL A+ IN+ ERKG++EII      E+ EF              W  L  +       V  D++PP P LY V LG GYLE+PQI                +P  RL+ +LL+ K VYILD + D+F+WIG  + + ++ A LKL  EL  +L R          + +E Q+FK +F +W D   VD+TR+ ESV + G     +    EKD+MK D+ A F+PR+ PMP+ +A+ + E+ NEDL G            ++ FV   + +  + ++  GHF  QDCY+    YW   E+D+ + ++    +                       Q V+YFWQGREAS++ WL F FSL+K+ E  F G            K+E  RM QQQE + FL+HF+ +F+IH GK   R S     +  LY++R NG+ALCTR I++    + +NS F +I+K+P  +   +N  I+  W+G+ +D    ++ + +    F ++     + EG EP   FW  +GG+K YD +A +M  +RLFR SNE+G+F  SEKCSDFCQDDLAD+D+MLLD G ++Y+W G +TS VE KLS KA ++Y +HM     +  R+L++ +K  EPH F RCFH WG F++
Sbjct:    3 ATGVLPFIRGVDLSGNDFKGGYFPEHVKSMSSLRWLKLNRTGLCYLPEELSSLHKLEHLSVSHNSLTTLHGE-LSSLPCLRAIVARANSLKNSGIPDDIFQLDDLSVLDLSYNQLTECPRELENAKNMLVLNLSHNSIDNIPNQLFINLTDLIYLDLSDNKLDSLPPQMRRLVHLQTLILNNNPLLHAQLRQLPAMTALQTLHLRNTQRTQSNMPTSLEVLTCLSDVDLSMNEMTRIPECLYTLASLKRLNLSSNQISEISLCIDQWAQLETLNLARNQLTSLPSAICKLAKLKKLYLNSNKMDFDGIPSGIGKLSNLEEFMAANNNLELIPESLCRCSKLRKLVLNKNRLVTLPEAVHFLTD-LEVLDVRENPSLVMPPK--PADRTSE--FYNIDFSLQNQLRLAGASPATVAAAAAAGGKRSCSATKDPSARKMRLRRRK---DTSQDDQAKQVLKGMSDVAEEKNKKIQENGDMKYTDLKARRWDQGLEKPHLDYSEFFTEDVGQIPGVTVWQIENFIPTQV-DETFHGRFYEADCYIVLKTYLD--SNGALHWEIYYWIGQEATLDKKACSAIHAVNLRNYLGAEGRTIREEMGDESEEFSQVFYNDISYIEGGTA-SGFYTVEDTQYITRLYRIYGK-KNIRLEPMPLKSSSLDPRFVFLLDH-GMDIYVWRGSQATLSNTTKARLFAEKINKNERKGKAEIILLTHEMETAEF--------------WELLGGQPEELKPCVPDDFQPPRPKLYKVGLGLGYLELPQINYKISVEHKKRPKIELMPEMRLLHTLLDTKSVYILDCHSDIFIWIGRKSSRLVRAAALKLGQELCSMLHRPKHAMVIRNLEGTECQVFKSKFRNWDDVLKVDYTRNAESVVQGGGLTGKVKKDAEKDQMKADLTALFLPRQPPMPISEAEQLTEEWNEDLDG------------MEGFVLEGKKFARLPEEEFGHFNTQDCYVFLCRYWIPIEQDEEEEQKSKKRKIHGDGEEDEDEEDEEDKQPEEDFQCVVYFWQGREASNMGWLTFTFSLQKKFESLFPG------------KLEVVRMTQQQENAKFLSHFKRKFIIHKGK---RKSKDVGLQPSLYHVRTNGSALCTRCIQINTDCSLLNSEFCFILKVPFES--IDNQGIVYTWVGRAADPDEAKLSEDIMNHMFDDTYSKQVINEGEEPENFFWVGIGGQKAYDEDADYMKHARLFRCSNEKGYFSVSEKCSDFCQDDLADDDIMLLDNGKEVYMWVGTQTSQVEIKLSLKACQVYIQHMRAKDAEHPRKLRLVRKGNEPHAFTRCFHAWGAFRK 1271          
BLAST of Protein flightless-1 vs. Ensembl Xenopus
Match: rin2 (Ras and Rab interactor 2 [Source:Xenbase;Acc:XB-GENE-484799])

HSP 1 Score: 816.994 bits (2109), Expect = 0.000e+0
Identity = 526/1324 (39.73%), Postives = 775/1324 (58.53%), Query Frame = 2
Query:  512 SKSVSQFLLGIDLSCVEIKDNDCSEAFSNMTRIQWLKLVSTGLEQIPKGVEKLTQLQRLTISKNNINKLSGDWCTELKALRVFNARKNKLTDDSLPEQLFNNPQLQVVDLSFNLLTEVPAGLVEAKSLLVLNLSDNQIKNVSKDLFANCVSLMILDLSNNQIVGFPTXXXXXXXXXXXXXXXXXXXXXXXRSINGXXXXXXXXXXXXXXXXENIPSDLDKLPCLQDLDISDNNLPKVPQTIYEITSLTKLNLSGNEIDELSGLVDCWPNLEVXXXXXXXXXXXPSFITRLSKLKKLYVDENRLTFNGIPPGIGKLSNLEVFSASENLLENIPEGLCRCGQLKHLNLRMNKLVTLPDAINVLIESLKTFNIENNPNLKMPPKLVEVDLKSKYAFYNIDFSLETQMQLARGAPAKASSKSVTQKHKFTQDTASRIRRLRRKKIDEKSEKGSDSKRVLEGMQKVAKDKD-AIMEDREKEEKLLSAKKWQDAIAKPNLDYSKLFDDDVGIEPGIELWDMDDFYPRRITDELPLGTFFDGDCYIILHTSLDEKSHTSLNHSIYYWIGSQASLDKVTASAVHAVYLRNYLSTNCRCERTEQGDESPEFVALFEGNIIVCEGARGQTGFLKTEDKEHRKKMYRLFGADKSISIYSLDPTPENLDSKFVYLFDESSTRLFLWIGNKSRLMLQTKGRLLADNINQTERKGQSEIITERENSESDEFKNSLQSSSGIDSLDWSNLSSKE------VSIDWKPPTPILYDVKLGRGYLEMPQIE---------------LPNGRLVKSLLEAKHVYILDSNGDMFVWIGDMAPKFLKFAGXXXXXXXXXXXXXXXXXXXTVCCQTSEPQIFKMQFADWVDTCAVDFTRSVESVRKRG---VNLXXXXXXXXXXXXXRAFFMPRERPMPLEDAKAIMEDCNEDLVGNNMDSNDGKPFKIKQFVYLNRNWVLVEDKWIGHFFNQDCYIVHAEYWXXXXXXXXXXXXXXXXXXXS------------------RIQTVIYFWQGREASDIPWLQFNFSLKKEMEIKFSGMDNMSTTKDSFKKVETKRMFQQQEISTFLAHFQHRFVIHLGKYQDRYSDQRKNRIELYYLRENGNALCTRTIEVKPMIAFVNSCFHYIMKIPAAASKTENDQII-CWIGKNSDSHYDEVLQAVAADTFPESSDILTVKEGAEP-GIFWQALGGKKNYDHEAQFMSFSRLFRLSNEQGFFCASEKCSDFCQDDLADEDVMLLDTGSQIYLWFGNRTSDVEKKLSYKAAKLYQEHMARIQPDRIRQLKITQKKKEPHNFRRCFHGWGPFKE 4348
            +  V  F+ G+DLS  + K     E   +M+ ++WLKL  TGL  +P+ +  L +L+ L++S N++  L G+  + L  LR   AR N L +  +P+ +F    L V+DLS+N LTE P  L  AK++LVLNLS N I N+   LF N   L+ LDLS+N++   P  +RR  +LQ+L L+NNPL  +QLR +  +  L TL L NT R   N+P+ L+ L CL D+D+S N + ++P+ +Y + SL +LNLS N+I E+S  +D W  LE LNL+RN+L SLPS I +L+KLKKLY++ N++ F+GIP GIGKLSNLE F A+ N LE IPE LCRC +L+ L L  N+LVTLP+A++ L + L+  ++  NP+L MPPK    D  S+  FYNIDFSL+ Q++LA GA     + +       T+D ++R  RLRR+K    + +   +K+VL+GM  VA++K+  I E+ + +   L A++W   + KP+LDYS+ F +DVG  PG+ +W +++F P ++ DE   G F++ DCYI+L T LD  S+ +L+  IYYWIG +A+LDK   SA+HAV LRNYL    R  R E GDES EF  +F  +I   EG    +GF   ED ++      +F +++ +++            +FV+L D     +++W G+++ L   TK RL A+ IN+ ERKG++EII      E+ EF              W  L  +       V  D++PP P LY V LG GYLE+PQI                +P  RL+ +LL+ K VYILD + D+F+WIG  + + ++ A LKL  EL  +L R          + +E Q+FK +F +W D   VD+TR+ ESV + G     +    EKD+MK D+ A F+PR+ PMP+ +A+ + E+ NEDL G            ++ FV   + +  + ++  GHF  QDCY+    YW   E+D+ + ++    +                       Q V+YFWQGREAS++ WL F FSL+K+ E  F G            K+E  RM QQQE + FL+HF+ +F+IH GK   R S     +  LY++R NG+ALCTR I++    + +NS F +I+K+P  +   +N  I+  W+G+ +D    ++ + +    F ++     + EG EP   FW  +GG+K YD +A +M  +RLFR SNE+G+F  SEKCSDFCQDDLAD+D+MLLD G ++Y+W G +TS VE KLS KA ++Y +HM     +  R+L++ +K  EPH F RCFH WG F++
Sbjct:    3 ATGVLPFIRGVDLSGNDFKGGYFPEHVKSMSSLRWLKLNRTGLCYLPEELSSLHKLEHLSVSHNSLTTLHGE-LSSLPCLRAIVARANSLKNSGIPDDIFQLDDLSVLDLSYNQLTECPRELENAKNMLVLNLSHNSIDNIPNQLFINLTDLIYLDLSDNKLDSLPPQMRRLVHLQTLILNNNPLLHAQLRQLPAMTALQTLHLRNTQRTQSNMPTSLEVLTCLSDVDLSMNEMTRIPECLYTLASLKRLNLSSNQISEISLCIDQWAQLETLNLARNQLTSLPSAICKLAKLKKLYLNSNKMDFDGIPSGIGKLSNLEEFMAANNNLELIPESLCRCSKLRKLVLNKNRLVTLPEAVHFLTD-LEVLDVRENPSLVMPPK--PADRTSE--FYNIDFSLQNQLRLA-GASPATVAAAAAAGGSATKDPSARKMRLRRRK---DTSQDDQAKQVLKGMSDVAEEKNKKIQENGDMKYTDLKARRWDQGLEKPHLDYSEFFTEDVGQIPGVTVWQIENFIPTQV-DETFHGRFYEADCYIVLKTYLD--SNGALHWEIYYWIGQEATLDKKACSAIHAVNLRNYLGAEGRTIREEMGDESEEFSQVFYNDISYIEGGTA-SGFYTVEDTQYITSRLYIFSSERGLTL--------PFSPRFVFLLDH-GMDIYVWRGSQATLSNTTKARLFAEKINKNERKGKAEIILLTHEMETAEF--------------WELLGGQPEELKPCVPDDFQPPRPKLYKVGLGLGYLELPQINYKISVEHKKRPKIELMPEMRLLHTLLDTKSVYILDCHSDIFIWIGRKSSRLVRAAALKLGQELCSMLHRPKHAMVIRNLEGTECQVFKSKFRNWDDVLKVDYTRNAESVVQGGGLTGKVKKDAEKDQMKADLTALFLPRQPPMPISEAEQLTEEWNEDLDG------------MEGFVLEGKKFARLPEEEFGHFNTQDCYVFLCRYWIPIEQDEEEEQKSKKRKIHGDGEEDEDEEDEEDKQPEEDFQCVVYFWQGREASNMGWLTFTFSLQKKFESLFPG------------KLEVVRMTQQQENAKFLSHFKRKFIIHKGK---RKSKDVGLQPSLYHVRTNGSALCTRCIQINTDCSLLNSEFCFILKVPFES--IDNQGIVYTWVGRAADPDEAKLSEDIMNHMFDDTYSKQVINEGEEPENFFWVGIGGQKAYDEDADYMKHARLFRCSNEKGYFSVSEKCSDFCQDDLADDDIMLLDNGKEVYMWVGTQTSQVEIKLSLKACQVYIQHMRAKDAEHPRKLRLVRKGNEPHAFTRCFHAWGAFRK 1260          
BLAST of Protein flightless-1 vs. Ensembl Xenopus
Match: rin2 (Ras and Rab interactor 2 [Source:Xenbase;Acc:XB-GENE-484799])

HSP 1 Score: 807.749 bits (2085), Expect = 0.000e+0
Identity = 528/1326 (39.82%), Postives = 774/1326 (58.37%), Query Frame = 2
Query:  512 SKSVSQFLLGIDLSCVEIKDNDCSEAFSNMTRIQWLKLVSTGLEQIPKGVEKLTQLQRLTISKNNINKLSGDWCTELKALRVFNARKNKLTDDSLPEQLFNNPQLQVVDLSFNLLTEVPAGLVEAKSLLVLNLSDNQIKNVSKDLFANCVSLMILDLSNNQIVGFPTXXXXXXXXXXXXXXXXXXXXXXXRSINGXXXXXXXXXXXXXXXXENIPSDLDKLPCLQDLDISDNNLPKVPQTIYEITSLTKLNLSGNEIDELSGLVDCWPNLEVXXXXXXXXXXXPSFITRLSKLKKLYVDENRLTFNGIPPGIGKLSNLEVFSASENLLENIPEGLCRCGQLKHLNLRMNKLVTLPDAINVLIESLKTFNIENNPNLKMPPKLVEVDLKSKYAFYNIDFSLETQMQLARGAPAKASSKSVTQKHKFTQDTASRIRRLRRKKIDEKSEKGSDSKRVLEGMQKVAKDKD-AIMEDREKEEKLLSAKKWQDAIAKPNLDYSKLFDDDVGIEPGIELWDMDDFYPRRITDELPLGTFFDGDCYIILHTSLDEKSHTSLNHSIYYWIGSQASLDKVTASAVHAVYLRNYLSTNCRCERTEQGDESPEFVALFEGNIIVCEGARGQTGFLKTEDKEHRKKMYRLFGADKSISIYSLDPTPENLDSKFVYL--FDESSTRLFLWIGNKSRLMLQTKGRLLADNINQTERKGQSEIITERENSESDEFKNSLQSSSGIDSLDWSNLSSKE------VSIDWKPPTPILYDVKLGRGYLEMPQIE---------------LPNGRLVKSLLEAKHVYILDSNGDMFVWIGDMAPKFLKFAGXXXXXXXXXXXXXXXXXXXTVCCQTSEPQIFKMQFADWVDTCAVDFTRSVESVRKRG---VNLXXXXXXXXXXXXXRAFFMPRERPMPLEDAKAIMEDCNEDLVGNNMDSNDGKPFKIKQFVYLNRNWVLVEDKWIGHFFNQDCYIVHAEYWXXXXXXXXXXXXXXXXXXXS------------------RIQTVIYFWQGREASDIPWLQFNFSLKKEMEIKFSGMDNMSTTKDSFKKVETKRMFQQQEISTFLAHFQHRFVIHLGKYQDRYSDQRKNRIELYYLRENGNALCTRTIEVKPMIAFVNSCFHYIMKIPAAASKTENDQII-CWIGKNSDSHYDEVLQAVAADTFPESSDILTVKEGAEP-GIFWQALGGKKNYDHEAQFMSFSRLFRLSNEQGFFCASEKCSDFCQDDLADEDVMLLDTGSQIYLWFGNRTSDVEKKLSYKAAKLYQEHMARIQPDRIRQLKITQKKKEPHNFRRCFHGWGPFKE 4348
            +  V  F+ G+DLS  + K     E   +M+ ++WLKL  TGL  +P+ +  L +L+ L++S N++  L G+  + L  LR   AR N L +  +P+ +F    L V+DLS+N LTE P  L  AK++LVLNLS N I N+   LF N   L+ LDLS+N++   P  +RR  +LQ+L L+NNPL  +QLR +  +  L TL L NT R   N+P+ L+ L CL D+D+S N + ++P+ +Y + SL +LNLS N+I E+S  +D W  LE LNL+RN+L SLPS I +L+KLKKLY++ N++ F+GIP GIGKLSNLE F A+ N LE IPE LCRC +L+ L L  N+LVTLP+A++ L + L+  ++  NP+L MPPK    D  S+  FYNIDFSL+ Q++LA GA     + +       T+D ++R  RLRR+K    + +   +K+VL+GM  VA++K+  I E+ + +   L A++W   + KP+LDYS+ F +DVG  PG+ +W +++F P ++ DE   G F++ DCYI+L T LD  S+ +L+  IYYWIG +A+LDK   SA+HAV LRNYL    R  R E GDES EF  +F  +I   EG    +GF   ED ++  ++YR++G  K+I +  +     +LD +FV     +  S R+       +   L    RL A+ IN+ ERKG++EII      E+ EF              W  L  +       V  D++PP P LY V LG GYLE+PQI                +P  RL+ +LL+ K VYILD + D+F+WIG  + + ++ A LKL  EL  +L R          + +E Q+FK +F +W D   VD+TR+ ESV + G     +    EKD+MK D+ A F+PR+ PMP+ +A+ + E+ NEDL G            ++ FV   + +  + ++  GHF  QDCY+    YW   E+D+ + ++    +                       Q V+YFWQGREAS++ WL F FSL+K+ E  F G            K+E  RM QQQE + FL+HF+ +F+IH GK   R S     +  LY++R NG+ALCTR I++    + +NS F +I+K+P  +   +N  I+  W+G+ +D    ++ + +    F ++     + EG EP   FW  +GG+K YD +A +M  +RLFR SNE+G+F  SEKCSDFCQDDLAD+D+MLLD G ++Y+W G +TS VE KLS KA ++Y +HM     +  R+L++ +K  EPH F RCFH WG F++
Sbjct:    3 ATGVLPFIRGVDLSGNDFKGGYFPEHVKSMSSLRWLKLNRTGLCYLPEELSSLHKLEHLSVSHNSLTTLHGE-LSSLPCLRAIVARANSLKNSGIPDDIFQLDDLSVLDLSYNQLTECPRELENAKNMLVLNLSHNSIDNIPNQLFINLTDLIYLDLSDNKLDSLPPQMRRLVHLQTLILNNNPLLHAQLRQLPAMTALQTLHLRNTQRTQSNMPTSLEVLTCLSDVDLSMNEMTRIPECLYTLASLKRLNLSSNQISEISLCIDQWAQLETLNLARNQLTSLPSAICKLAKLKKLYLNSNKMDFDGIPSGIGKLSNLEEFMAANNNLELIPESLCRCSKLRKLVLNKNRLVTLPEAVHFLTD-LEVLDVRENPSLVMPPK--PADRTSE--FYNIDFSLQNQLRLA-GASPATVAAAAAAGGSATKDPSARKMRLRRRK---DTSQDDQAKQVLKGMSDVAEEKNKKIQENGDMKYTDLKARRWDQGLEKPHLDYSEFFTEDVGQIPGVTVWQIENFIPTQV-DETFHGRFYEADCYIVLKTYLD--SNGALHWEIYYWIGQEATLDKKACSAIHAVNLRNYLGAEGRTIREEMGDESEEFSQVFYNDISYIEGGTA-SGFYTVEDTQYITRLYRIYGK-KNIRLEPMPLKSSSLDPRFVLSAPLEPRSHRI-------TNCSLSLSFRLFAEKINKNERKGKAEIILLTHEMETAEF--------------WELLGGQPEELKPCVPDDFQPPRPKLYKVGLGLGYLELPQINYKISVEHKKRPKIELMPEMRLLHTLLDTKSVYILDCHSDIFIWIGRKSSRLVRAAALKLGQELCSMLHRPKHAMVIRNLEGTECQVFKSKFRNWDDVLKVDYTRNAESVVQGGGLTGKVKKDAEKDQMKADLTALFLPRQPPMPISEAEQLTEEWNEDLDG------------MEGFVLEGKKFARLPEEEFGHFNTQDCYVFLCRYWIPIEQDEEEEQKSKKRKIHGDGEEDEDEEDEEDKQPEEDFQCVVYFWQGREASNMGWLTFTFSLQKKFESLFPG------------KLEVVRMTQQQENAKFLSHFKRKFIIHKGK---RKSKDVGLQPSLYHVRTNGSALCTRCIQINTDCSLLNSEFCFILKVPFES--IDNQGIVYTWVGRAADPDEAKLSEDIMNHMFDDTYSKQVINEGEEPENFFWVGIGGQKAYDEDADYMKHARLFRCSNEKGYFSVSEKCSDFCQDDLADDDIMLLDNGKEVYMWVGTQTSQVEIKLSLKACQVYIQHMRAKDAEHPRKLRLVRKGNEPHAFTRCFHAWGAFRK 1263          
BLAST of Protein flightless-1 vs. Ensembl Xenopus
Match: rin2 (Ras and Rab interactor 2 [Source:Xenbase;Acc:XB-GENE-484799])

HSP 1 Score: 427.943 bits (1099), Expect = 2.114e-132
Identity = 285/661 (43.12%), Postives = 417/661 (63.09%), Query Frame = 2
Query:  512 SKSVSQFLLGIDLSCVEIKDNDCSEAFSNMTRIQWLKLVSTGLEQIPKGVEKLTQLQRLTISKNNINKLSGDWCTELKALRVFNARKNKLTDDSLPEQLFNNPQLQVVDLSFNLLTEVPAGLVEAKSLLVLNLSDNQIKNVSKDLFANCVSLMILDLSNNQIVGFPTXXXXXXXXXXXXXXXXXXXXXXXRSINGXXXXXXXXXXXXXXXXENIPSDLDKLPCLQDLDISDNNLPKVPQTIYEITSLTKLNLSGNEIDELSGLVDCWPNLEVXXXXXXXXXXXPSFITRLSKLKKLYVDENRLTFNGIPPGIGKLSNLEVFSASENLLENIPEGLCRCGQLKHLNLRMNKLVTLPDAINVLIESLKTFNIENNPNLKMPPKLVEVDLKSKYAFYNIDFSLETQMQLARGAPAKASSKSVTQKHKFTQDTASRIRRLRRKKIDEKSEKGSDSKRVLEGMQKVAKDKD-AIMEDREKEEKLLSAKKWQDAIAKPNLDYSKLFDDDVGIEPGIELWDMDDFYPRRITDELPLGTFFDGDCYIILHTSLDEKSHTSLNHSIYYWIGSQASLDKVTASAVHAVYLRNYLSTNCRCERTEQGDESPEFVALFEGNIIVCEGARGQTGFLKTEDKEHRKKMYRLFGADKSISIYSLDPTPENLDSKFV 2491
            +  V  F+ G+DLS  + K     E   +M+ ++WLKL  TGL  +P+ +  L +L+ L++S N++  L G+  + L  LR   AR N L +  +P+ +F    L V+DLS+N LTE P  L  AK++LVLNLS N I N+   LF N   L+ LDLS+N++   P  +RR  +LQ+L L+NNPL  +QLR +  +  L TL L NT R   N+P+ L+ L CL D+D+S N + ++P+ +Y + SL +LNLS N+I E+S  +D W  LE LNL+RN+L SLPS I +L+KLKKLY++ N++ F+GIP GIGKLSNLE F A+ N LE IPE LCRC +L+ L L  N+LVTLP+A++ L + L+  ++  NP+L MPPK    D  S+  FYNIDFSL+ Q++LA GA     + +       T+D ++R  RLRR+K    + +   +K+VL+GM  VA++K+  I E+ + +   L A++W   + KP+LDYS+ F +DVG  PG+ +W +++F P ++ DE   G F++ DCYI+L T LD  S+ +L+  IYYWIG +A+LDK   SA+HAV LRNYL    R  R E GDES EF  +F  +I   EG    +GF   ED ++  ++YR++G  K+I +  +     +LD +FV
Sbjct:    3 ATGVLPFIRGVDLSGNDFKGGYFPEHVKSMSSLRWLKLNRTGLCYLPEELSSLHKLEHLSVSHNSLTTLHGE-LSSLPCLRAIVARANSLKNSGIPDDIFQLDDLSVLDLSYNQLTECPRELENAKNMLVLNLSHNSIDNIPNQLFINLTDLIYLDLSDNKLDSLPPQMRRLVHLQTLILNNNPLLHAQLRQLPAMTALQTLHLRNTQRTQSNMPTSLEVLTCLSDVDLSMNEMTRIPECLYTLASLKRLNLSSNQISEISLCIDQWAQLETLNLARNQLTSLPSAICKLAKLKKLYLNSNKMDFDGIPSGIGKLSNLEEFMAANNNLELIPESLCRCSKLRKLVLNKNRLVTLPEAVHFLTD-LEVLDVRENPSLVMPPK--PADRTSE--FYNIDFSLQNQLRLA-GASPATVAAAAAAGGSATKDPSARKMRLRRRK---DTSQDDQAKQVLKGMSDVAEEKNKKIQENGDMKYTDLKARRWDQGLEKPHLDYSEFFTEDVGQIPGVTVWQIENFIPTQV-DETFHGRFYEADCYIVLKTYLD--SNGALHWEIYYWIGQEATLDKKACSAIHAVNLRNYLGAEGRTIREEMGDESEEFSQVFYNDISYIEGGTA-SGFYTVEDTQYITRLYRIYGK-KNIRLEPMPLKSSSLDPRFV 648          
BLAST of Protein flightless-1 vs. Ensembl Xenopus
Match: agpat2 (1-acylglycerol-3-phosphate O-acyltransferase 2 [Source:Xenbase;Acc:XB-GENE-940771])

HSP 1 Score: 210.305 bits (534), Expect = 1.436e-55
Identity = 199/762 (26.12%), Postives = 332/762 (43.57%), Query Frame = 2
Query: 2096 GTFFDGDCYIILHTSLDEKSHTSLNHSIYYWIGSQASLDKVTASAVHAVYLRNYLSTNCRCERTEQGDESPEFVALFEGNIIVCEGARGQTGFLKTEDKEHRKKMYRLFGADKSISIYSLDPTPENLDSKFVYLFDESSTRLFLWIGNKSRLMLQTKGRLLADNINQTERKGQSEI--ITERENSESDEFKNSLQSSSGIDSLDWSNLSSKEVSIDWKPPTPILYDVKLGRGYLEMPQIELPNGRLVKSLLEAKHVYILDSNGD-MFVWIGDMAPKFLKFAGXXXXXXXXXXXXXXXXXXXTVCCQTSEPQIFKMQFADWVDTCAVDFTRSVESVRKRGVNLXXXXXXXXXXXXXRAFFMPRERPMPLEDAKAIMEDCNEDLVGNNMDSNDGKPFKIKQFVYLNRNWVLVEDKWIGHFFNQDCYIVHAEYWXXXXXXXXXXXXXXXXXXXSRIQTVIYFWQGREASDIPWLQFNFSLKKEMEIKFSGMDNMSTTKDSFKKVETKRMFQQQEISTFLAHFQHRFVIHLGKYQDRYSDQRKNRIELYYLRENGNALC-TRTIEVKPMIAFVNSCFHYIMKIPAAASKTENDQIICWIGKNSDSHYDEVLQAVAADTFPESSDILTVKEGAEPGIFWQALGGKKNYDHEAQFMS-----FSRLFRLSNEQGFFCASEKCSDFCQDDLADEDVMLLDTGSQIYLWFGNRTSDVEKKLSYKAAKLYQEHMARIQP---DRIRQLKITQKKKEPHNFRRCFHGWGPFK 4345
            G F++GDCY++LHT   +KS +SL + I+YWIG ++S D+ ++ A++ V L +YL  +    R  QG ES  F   F+  II  +G    +G    E   +  K        ++++   +D + E+ +S  V+L D   T +  W G KS +  + KG LLA +I   ER G+ +I  I   +   S E ++ L ++ G  + +    +  EV+   +    +LY V    G +E+   E+    LV+ LL     YI+D  G  ++VW G  A K  K   +  A E +++       +       +E  +FK  F  WV             V+ + V +             +A+ + +   +  E     +   N  +       +DG   K++ +   N   V VE +W G+F+  DCY+V   Y                     +   V+Y WQGR AS             + E+  S    +   +D   +    R+   +E   F+A F+ + VI  G    + + + +  + L+ +  NG+    T+ +EV    + +NS   +++K  + +          W GK S     E+ + +AA       ++  + EG E   FW+ LGGK  Y ++ +          RLF  SN+ G F  +E  ++F QDDL   DVM+LDT  QI+LW G+  +D+EKK +   A+ Y     +  P   D    + I ++  EP  F   F  W P K
Sbjct:   19 GNFYEGDCYLLLHT---KKSGSSLFYDIHYWIGKESSKDEQSSVAIYTVQLDDYLGGSPVQHREVQGYESDCFRGYFKQGIIYKKGGVA-SGMKHVETNTYDVKRLLHVKGKRNVTATEVDLSWESFNSGDVFLLDLGRT-VIQWNGAKSNMAERIKGMLLAKDIRDRERGGRMDIRVIEGDQEDASPELRDLLINTLGKRTHNIGPGTPDEVADQKQKANIMLYHVSDSGGQMEV--TEVATRPLVQDLLNHNDCYIIDQGGTKIYVWKGKGATKAEKLTAMSKALEFIKMKAYPHSTNVETVNDGAESAMFKQLFQKWV-------------VKDQSVGMG------------KAYIVNKIAKVSQEKFDTSLLHANPAVAAQERMVDDGSG-KVEVWRIENLELVPVETQWHGYFYGGDCYLVLYTY-----------------HVNKKAHHVVYIWQGRHAS-------------QDELAASAFLAVKLDQDFGGEPVQVRVCMGKEPRHFMAIFKGKLVIFEGGTSRKGNKEPERLVRLFQV--NGSEPSNTKAVEVPTFGSSLNSNDVFLLKTQSES--------YLWYGKGSSGDEREMAKQLAA--ILSGGNVEMLAEGHETAQFWETLGGKAPYANDKRLQQEVTDFHPRLFECSNKTGRFIVTE-VTNFNQDDLEQTDVMILDTWDQIFLWIGSEANDIEKKEALTTAQEY----LKTHPSGRDSETPILIVKQGFEPPIFTGWFLAWDPQK 700          

HSP 2 Score: 74.7146 bits (182), Expect = 1.052e-12
Identity = 76/305 (24.92%), Postives = 141/305 (46.23%), Query Frame = 2
Query: 2000 KLFDDDVGIEPGIELWDMDDFYPRRITDELPLGTFFDGDCYIILHT-SLDEKSHTSLNHSIYYWIGSQASLDKVTASAVHAVYLRNYLSTNCRCERTEQGDESPEFVALFEGNIIVCEGARGQTGFLKTEDKEHRKKMYRLFGADKSISIYSLDPT-PENLDSKFVYLFDESSTRLFLWIGNKSRLMLQTKGRLLADNINQTERKGQSEIITERENSESDEFKNSLQSSSGIDSLDWSNLSSKEVSIDWKPPTPILYDVKLGRGYLEMPQIELPNGRLVKSLLEAKHVYILDSNGDMFVWIGDMA 2908
            ++ DD  G    +E+W +++     +  +   G F+ GDCY++L+T  +++K+H    H +Y W G  AS D++ ASA  AV L           R   G E   F+A+F+G +++ EG   + G    ++ E   +++++ G++ S +     PT   +L+S  V+L  ++ +  +LW G  S        R +A  +      G  E++   E  E+ +F  +L   +      ++N   K +  +     P L++     G   + ++   N    +  LE   V ILD+   +F+WIG  A
Sbjct:  373 RMVDDGSG---KVEVWRIENLELVPVETQWH-GYFYGGDCYLVLYTYHVNKKAH----HVVYIWQGRHASQDELAASAFLAVKLDQDFGGEPVQVRVCMGKEPRHFMAIFKGKLVIFEGGTSRKG---NKEPERLVRLFQVNGSEPSNTKAVEVPTFGSSLNSNDVFLL-KTQSESYLWYGKGS----SGDEREMAKQLAAILSGGNVEMLA--EGHETAQFWETLGGKA-----PYAN--DKRLQQEVTDFHPRLFECSNKTGRFIVTEVTNFN----QDDLEQTDVMILDTWDQIFLWIGSEA 648          
BLAST of Protein flightless-1 vs. Ensembl Mouse
Match: Flii (flightless I actin binding protein [Source:MGI Symbol;Acc:MGI:1342286])

HSP 1 Score: 808.52 bits (2087), Expect = 0.000e+0
Identity = 530/1325 (40.00%), Postives = 776/1325 (58.57%), Query Frame = 2
Query:  512 SKSVSQFLLGIDLSCVEIKDNDCSEAFSNMTRIQWLKLVSTGLEQIPKGVEKLTQLQRLTISKNNINKLSGDWCTELKALRVFNARKNKLTDDSLPEQLFNNPQLQVVDLSFNLLTEVPAGLVEAKSLLVLNLSDNQIKNVSKDLFANCVSLMILDLSNNQIVGFPTXXXXXXXXXXXXXXXXXXXXXXXRSINGXXXXXXXXXXXXXXXXENIPSDLDKLPCLQDLDISDNNLPKVPQTIYEITSLTKLNLSGNEIDELSGLVDCWPNLEVXXXXXXXXXXXPSFITRLSKLKKLYVDENRLTFNGIPPGIGKLSNLEVFSASENLLENIPEGLCRCGQLKHLNLRMNKLVTLPDAINVLIESLKTFNIENNPNLKMPPKLVEVDLKSKYAFYNIDFSLETQMQLARGAPAKASSKSVTQKHKFTQDTASRIRRLRRKKIDEKSEKGSDSKRVLEGMQKVAKDKDAIMEDR-EKEEKLLSAKKWQDAIAKPNLDYSKLFDDDVGIEPGIELWDMDDFYPRRITDELPLGTFFDGDCYIILHTSLDEKSHTSLNHSIYYWIGSQASLDKVTASAVHAVYLRNYLSTNCRCERTEQGDESPEFVALFEGNIIVCEGARGQTGFLKTEDKEHRKKMYRLFGADKSISIYSLDPTP---ENLDSKFVYLFDESSTRLFLWIGNKSRLMLQTKGRLLADNINQTERKGQSEIITERENSESDEFKNSLQSSSGIDSLDWSNLSSKEVSIDWKPPTPILYDVKLGRGYLEMPQIE---------------LPNGRLVKSLLEAKHVYILDSNGDMFVWIGDMAPKFLKFAGXXXXXXXXXXXXXXXXXXXTVCCQTSEPQIFKMQFADWVDTCAVDFTRSVESVRK----RGVNLXXXXXXXXXXXXXRAFFMPRERPMPLEDAKAIMEDCNEDLVGNNMDSNDGKPFKIKQFVYLNRNWVLVEDKWIGHFFNQDCYIVHAEYWXXXXXXXXXXXXXXXXXXXSR-------------------IQTVIYFWQGREASDIPWLQFNFSLKKEMEIKFSGMDNMSTTKDSFKKVETKRMFQQQEISTFLAHFQHRFVIHLGKYQDRYSDQRKNRIELYYLRENGNALCTRTIEVKPMIAFVNSCFHYIMKIPAAASKTENDQ--IICWIGKNSDSHYDEVLQAVAADTFPESSDILTVKEGAEP-GIFWQALGGKKNYDHEAQFMSFSRLFRLSNEQGFFCASEKCSDFCQDDLADEDVMLLDTGSQIYLWFGNRTSDVEKKLSYKAAKLYQEHMARIQPDRIRQLKITQKKKEPHNFRRCFHGWGPFKEA 4351
            +  V  F+ G+DLS  + K     E    MT ++WLKL  TGL  +P+ +  L +L+ L++S N++  L G+  + L +LR   AR N L +  +P+ +F    L V+DLS N LTE P  L  AK++LVLNLS N I ++   LF N   L+ LDLS N++   P  +RR  +LQ+L L+ NPL  +QLR +  +  L TL L NT R   N+P+ L+ L  L D+D+S N+L +VP+ +Y + SL +LNLS N+I ELS  +D W +LE LNLSRN+L SLPS I +L+KLKKLY++ N+L F+G+P GIGKL++LE F A+ N LE IPE LCRC +LK L L  N+LVTLP+AI+ L E ++  ++  NP+L MPPK  +        +YNIDFSL+ Q++LA    + A+  +       ++D  +R  RLRR+K    S +   +K+VL+GM  VA++K+   E+  +        ++W   + KP LDYS+ F +DVG  PG+ +W +++F P  + +E   G F++ DCYI+L T LD+    SLN  IYYWIG +A+LDK   SA+HAV LRNYL   CR  R E GDES EF+ +F+ +I   EG    +GF   ED  +  +MYR++G  K+I    L+P P    +LD +FV+L D+    +++W G ++ L   TK RL A+ IN+ ERKG++EI    +  E   F + L    G +  +  N     V  D+ PP P LY V LG GYLE+PQI                +P  RL++SLL+ + VYILD   D+F+W+G  +P+ ++ A LKL  EL  +L R      +   + +E Q+FK +F +W D   VD+TR+ E+V +     G    D  + D+MK D+ A F+PR+ PMPL +A+ +ME+ NEDL G            ++ FV   R +  + ++  GHF+ QDCY+    YW   E ++ +  ED   + ++                     Q ++YFWQGREAS++ WL F FSL+K+ E  F G            K+E  RM QQQE   FL+HF+ +F+IH GK   R   Q   +  LY +R NG+ALCTR I++    + +NS F +I+K+P    ++E++Q  +  W+G+ SD    ++ + +    F  S     + EG EP   FW  +G +K YD +A++M  +RLFR SNE+G+F  +EKCSDFCQDDLAD+D+MLLD G ++Y+W G +TS VE KLS KA ++Y +H    + +R R+L++ +K  E   F RCFH W  F++A
Sbjct:    3 ATGVLPFVRGVDLSGNDFKGGYFPENVKAMTSLRWLKLNRTGLCYLPEELAALQKLEHLSVSHNHLTTLHGE-LSSLPSLRAIVARANSLKNSGVPDDIFKLDDLSVLDLSHNQLTECPRELENAKNMLVLNLSHNGIDSIPNQLFINLTDLLYLDLSENRLESLPPQMRRLVHLQTLVLNGNPLLHAQLRQLPAMMALQTLHLRNTQRTQSNLPTSLEGLSNLSDVDLSCNDLTRVPECLYTLPSLRRLNLSSNQIAELSLCIDQWVHLETLNLSRNQLTSLPSAICKLTKLKKLYLNSNKLDFDGLPSGIGKLTSLEEFMAANNNLELIPESLCRCPKLKKLVLNKNRLVTLPEAIHFLTE-IQVLDVRENPSLVMPPKPAD----RTAEWYNIDFSLQNQLRLA--GASPATVAAAAAVGSGSKDPLARKMRLRRRK---DSAQDVQAKQVLKGMSDVAQEKNKNQEESIDARAPGGKVRRWDQGLEKPRLDYSEFFTEDVGQLPGLTIWQIENFVP-VLVEEAFHGKFYEADCYIVLKTFLDDSG--SLNWEIYYWIGGEATLDKKACSAIHAVNLRNYLGAECRTVREEMGDESEEFLQVFDNDISYIEGGTA-SGFYTVEDTHYVTRMYRVYGK-KNI---KLEPVPLKGSSLDPRFVFLLDQ-GLDIYVWRGAQATLSNTTKARLFAEKINKNERKGKAEITLLVQGQEPPGFWDVL----GGEPSEIKN----HVPDDFWPPQPKLYKVGLGLGYLELPQINYKLSVEHKKRPKVELMPGMRLLQSLLDTRCVYILDCWSDVFIWLGRKSPRLVRAAALKLGQELCGMLHRPRHTVVSRSLEGTEAQVFKAKFKNWDDVLTVDYTRNAEAVLQGQGLSGKVKRDTEKTDQMKADLTALFLPRQPPMPLAEAEQLMEEWNEDLDG------------MEGFVLEGRKFTRLPEEEFGHFYTQDCYVFLCRYWVPVEYEEEEKTEDKEGKASAEAREGEEAAAEAEEKQPEEDFQCIVYFWQGREASNMGWLTFTFSLQKKFESLFPG------------KLEVVRMTQQQENPKFLSHFKRKFIIHRGK---RKVTQGTLQPTLYQIRTNGSALCTRCIQINTDSSLLNSEFCFILKVPF---ESEDNQGIVYAWVGRASDPDEAKLAEDILNTMFDASYSKQVINEGEEPENFFWVGIGAQKPYDDDAEYMKHTRLFRCSNEKGYFAVTEKCSDFCQDDLADDDIMLLDNGQEVYMWVGTQTSQVEIKLSLKACQVYIQHTRSKEHERPRRLRLVRKGNEQRAFTRCFHAWSTFRQA 1269          
BLAST of Protein flightless-1 vs. Ensembl Mouse
Match: Vil1 (villin 1 [Source:MGI Symbol;Acc:MGI:98930])

HSP 1 Score: 184.882 bits (468), Expect = 2.693e-47
Identity = 199/795 (25.03%), Postives = 323/795 (40.63%), Query Frame = 2
Query: 2030 PGIELWDMDDFYPRRITDELPLGTFFDGDCYIILHTSLDEKSHTSLNHSIYYWIGSQASLDKVTASAVHAVYLRNYLSTNCRCERTEQGDESPEFVALFEGNIIVCEGARGQTGFLKTEDKEHRKKMYRLFGADKSISIYSLDPTPENLDSKFVYLFDESSTRLFLWIGNKSRLMLQTKGRLLADNINQTERKGQS--EIITERENSESDEFKNSLQSSSGIDSLDWSNLSSKEVSIDWKPPTPILYDVKLGRGYLEMPQIELPNGRLVKSLLEAKHVYILDSNG-DMFVWIGDMAPKFLKFAGXXXXXXXXXXXXXXXXXXXTVCCQTSEPQIFKMQFADWV---DTCAVDFTRSVESVRKRGVNLXXXXXXXXXXXXXRAFFMPRERPMPLEDAK--AIMEDCNEDLVGNNMDSNDGKPFKIKQFVYLNRNWVLVEDKWIGHFFNQDCYIVHAEYWXXXXXXXXXXXXXXXXXXXSRIQTVIYFWQGREASDIPWLQFNFSLKKEMEIKFSGMDNMSTTKDSFKKVETKRMFQQQEISTFLAHFQHRFVIHLGKYQDRYSDQRKNRIE------LYYLRENGNALCTRTIEVKPMIAFVNSCFHYIMKIPAAASKTENDQIICWIGKNSDSHYDEVLQAVAADTFPESSDILTVKEGAEPGIFWQALGGKKNY------DHEAQFMSFSRLFRLSNEQGFFCASEKCSDFCQDDLADEDVMLLDTGSQIYLWFGNRTSDVEKKLSYKAAKLYQEHMARIQP---DRIRQLKITQKKKEPHNFRRCFHGWGPFK 4345
            PGI++W ++      +      G+FFDGDCY++L      K+ ++L++ I+YWIG  +S D+  A+A++   + +YL       R  QG+ES  F + F+  +++ +G    +G    E      +        +++    ++ + ++ +   V+L D     +  W G +S  M + +G  LA  I   ER G++   ++   +  +S +    +    G      + +S   V    K     LY V    G L +   E+    L + LL+ +  YILD  G  +FVW G  A    +   +  A   ++           V    +E  IF+  F  W     T  +  T +V SV K                              +E  K  A+       +       +DG   +++ +   +   V VE KW+GHF+  DCY++   Y                     +   ++Y WQG +AS             + EI  S    +   +    +    R+   +E    ++ F+ R V++ G         RKN +E      L+ +R   NA  T+  EV      +NS   +I+K P+            W GK       E+ + VA DT   +   + V EG EP  FW ALGGK  Y        E Q ++  RLF  SN+ G F A+E   DF QDDL +EDV LLD   Q++ W G   ++ EKK    AA   QE++ +  P   D    + + ++  EP  F   F  W PFK
Sbjct:   17 PGIQIWRIEAMQMVPVPSST-FGSFFDGDCYVVLAI---HKTSSTLSYDIHYWIGQDSSQDEQGAAAIYTTQMDDYLKGRAVQHREVQGNESETFRSYFKQGLVIRKGGVA-SGMKHVETNSCDVQRLLHVKGKRNVLAGEVEMSWKSFNRGDVFLLDLGKL-IIQWNGPESNRMERLRGMALAKEIRDQERGGRTYVGVVDGEKEGDSPQLMAIMNHVLGPRKELKAAISDSVVEPAAKAALK-LYHVSDSEGKLVVR--EVATRPLTQDLLKHEDCYILDQGGLKIFVWKGKNANAQERSGAMSQALNFIKAKQYPPSTQVEVQNDGAESPIFQQLFQKWTVPNRTSGLGKTHTVGSVAK------------------------------VEQVKFDALTMHVQPQVAAQQKMVDDGSG-EVQVWRIEDLELVPVESKWLGHFYGGDCYLLLYTY-----------------LIGEKQHYLLYIWQGSQAS-------------QDEIAASAYQAVLLDQKYNDEPVQIRVTMGKEPPHLMSIFKGRMVVYQG------GTSRKNNLEPVPSTRLFQVR-GTNADNTKAFEVTARATSLNSNDVFILKTPSCC--------YLWCGKGCSGDEREMAKMVA-DTISRTEKQVVV-EGQEPANFWMALGGKAPYANTKRLQEENQVIT-PRLFECSNQTGRFLATE-IFDFNQDDLEEEDVFLLDVWDQVFFWIGKHANEEEKK---AAATTVQEYL-KTHPGNRDLETPIIVVKQGHEPPTFTGWFLAWDPFK 718          

HSP 2 Score: 80.4925 bits (197), Expect = 1.244e-14
Identity = 77/305 (25.25%), Postives = 144/305 (47.21%), Query Frame = 2
Query: 2000 KLFDDDVGIEPGIELWDMDDFYPRRITDELPLGTFFDGDCYIILHTSL-DEKSHTSLNHSIYYWIGSQASLDKVTASAVHAVYLRNYLSTNCRCERTEQGDESPEFVALFEGNIIVCEGARGQTGFLKTEDKEHRKKMYRLFGADK-SISIYSLDPTPENLDSKFVYLFDESSTRLFLWIGNKSRLMLQTKGRLLADNINQTERKGQSEIITERENSESDEFKNSLQSSSGIDSLDWSNLSSKEVSIDWKPPTPILYDVKLGRGYLEMPQIELPNGRLVKSLLEAKHVYILDSNGDMFVWIGDMA 2908
            K+ DD  G    +++W ++D     +  +  LG F+ GDCY++L+T L  EK H    + +Y W GSQAS D++ ASA  AV L    +      R   G E P  +++F+G ++V +G   +   L   +     +++++ G +  +   + +     +L+S  V++    S   +LW G       +   +++AD I++TE+    +++ E +  E   F  +L   +      ++N  +K +  + +  TP L++     G     +I   N    +  LE + V++LD    +F WIG  A
Sbjct:  391 KMVDDGSG---EVQVWRIEDLELVPVESKW-LGHFYGGDCYLLLYTYLIGEKQH----YLLYIWQGSQASQDEIAASAYQAVLLDQKYNDEPVQIRVTMGKEPPHLMSIFKGRMVVYQGGTSRKNNL---EPVPSTRLFQVRGTNADNTKAFEVTARATSLNSNDVFILKTPSC-CYLWCGKGCSGDEREMAKMVADTISRTEK----QVVVEGQ--EPANFWMALGGKA-----PYAN--TKRLQEENQVITPRLFECSNQTGRFLATEIFDFN----QDDLEEEDVFLLDVWDQVFFWIGKHA 666          
BLAST of Protein flightless-1 vs. Ensembl Mouse
Match: Scin (scinderin [Source:MGI Symbol;Acc:MGI:1306794])

HSP 1 Score: 172.94 bits (437), Expect = 6.589e-44
Identity = 195/784 (24.87%), Postives = 326/784 (41.58%), Query Frame = 2
Query: 2018 VGIEPGIELWDMD--DFYPRRITDELPLGTFFDGDCYIILHTSLDEKSHTSLNHSIYYWIGSQASLDKVTASAVHAVYLRNYLSTNCRCERTEQGDESPEFVALFEGNIIVCEG--ARGQTGFLKTEDKEHRKKMYRLFGADKSISIYSLDPTPENLDSKFVYLFDESSTRLFLWIGNKSRLMLQTKGRLLADNINQTERKGQSEIITERENSESDEFKNSLQSSSGIDSLDWSNLSSKEVSIDWKPPTPILYDVKLGRGYLEMPQIELPNGRLVKSLLEAKHVYILDSNG--DMFVWIGDMAPKFLKFAGXXXXXXXXXXXXXXXXXXXTVCCQTSEPQIFKMQFADWVDTCAVDFTRSVESVRKRGVNLXXXXXXXXXXXXXRAFFMPRERPMPLEDAKAIMEDCNEDLVGNNMDSNDGKPFKIKQFVYLNRNWVLVEDKWIGHFFNQDCYIVHAEYWXXXXXXXXXXXXXXXXXXXSRIQTVIYFWQGREASDIPWLQFNFSLKKEMEIKFSGMDNMSTTKDSFKKVETKRMFQQQEISTFLAHFQHR-FVIHLGKYQDRYSDQRKNRIELYYLRENGNALCTRTIEVKPMIAFVNSCFHYIMKIPAAASKTENDQIICWIGKNSDSHYDEVLQAVAADTFPESSDILTVKEGAEPGIFWQALGGKKNYDHEAQFMSFS-----RLFRLSNEQGFFCASEKCSDFCQDDLADEDVMLLDTGSQIYLWFGNRTSDVEKKLSYKAAKLYQEHMARIQPDRIRQLKITQKKKEPHNFRRCFHGW 4333
             G + G+++W ++  +  P     +   G F+ GD Y++LHT+   KS    ++ +++W+G + S D+ TA+A+  V + +YL       R  QG ES +FV  F+G +    G  A G    L T D   ++ ++      + +    +  + E+ +    ++ D   T ++ W G+      + K   +A  I   ERKG+S++I   E SE  E    L     +   D  +    ++S         LY V    G +++  +   N      +L ++  +ILD      +FVW G  A    +   +K A E L+ +  S+     V  +  E  IFK  F DW D    D    V    K                      + + + +P  DA  +          N +D   G    ++ +   N   V ++    G F+  DCYI+   Y                     R Q +IY WQG  A+               E+  S    +   +    +    R+ Q +E +  L+ F+ +  +I+      +          L+ +R N  A  TR +EV      +NS   +++K+P       N+  I WIGK +    ++  + VA     ++S I   +EG EP  FW +LGG+ +Y       + +     RL+  SN+ G F   E   +F QDDLA++DVMLLD   QI++W G   ++VEKK S K+AK+Y E     + D+   + I ++  EP  F   F GW
Sbjct:   13 AGQQAGLQVWRVEKLELVP---VPQGAYGDFYVGDAYLVLHTT---KSSRGFSYRLHFWLGKECSQDESTAAAIFTVQMDDYLGGKPVQSRELQGYESTDFVGYFKGGLKYKAGGVASGLNHVL-TNDLTAKRLLH--VKGRRVVRATEVPLSWESFNKGDCFIID-LGTEIYQWCGSSCNKYERLKASQVAIGIRDNERKGRSQLIVVEEGSEPSELMKVLGRKPELPDGDNDDDVVADIS---NRKMAKLYMVSDASGSMKVTLVAEEN-PFSMGMLLSEECFILDHGAAKQIFVWKGKNANPQERKTAMKTAEEFLQKMKYSTNTQIQVLPEGGETPIFKQFFKDWKDKDQSDGFGKVYITEK----------------------VAQIKQIPF-DASKLHSSPQMAAQHNMVDDGSGG---VEIWRVENSGRVQIDPSSYGEFYGGDCYIILYTY--------------------PRGQ-IIYTWQGANAT-------------RDELTMSAFLTVQLDRSLGGQAVQVRVSQGKEPAHLLSLFKDKPLIIYKNGTSKKEGQAPAPPTRLFQVRRN-LASITRIVEVDVDANSLNSNDTFVLKLP------RNNGFI-WIGKGASQEEEKGAEYVADVLKCKASRI---QEGKEPEEFWNSLGGRGDYQTSPLLETRAEDHPPRLYGCSNKTGRFIIEEVPGEFTQDDLAEDDVMLLDAWEQIFIWIGKDANEVEKKESVKSAKMYLETDPSGR-DKRTPIVIIKQGHEPPTFTGWFLGW 710          

HSP 2 Score: 75.485 bits (184), Expect = 3.585e-13
Identity = 79/303 (26.07%), Postives = 123/303 (40.59%), Query Frame = 2
Query: 2003 LFDDDVGIEPGIELWDMDDFYPRRITDELPLGTFFDGDCYIILHTSLDEKSHTSLNHSIYYWIGSQASLDKVTASAVHAVYLRNYLSTNCRCERTEQGDESPEFVALFEGNIIVCEGARGQTGFLKTEDKEHRKKMYRLFGADKSIS----IYSLDPTPENLDSKFVYLFDESSTRLFLWIGNKSRLMLQTKGRLLADNINQTERKGQSEIITERENSESDEFKNSLQSSSGIDSLDWSNLSSKEVSIDWKPPTPILYDVKLGRGYLEMPQIELPNGRLVKSLLEAKHVYILDSNGDMFVWIG 2899
            + DD  G   G+E+W +++   R   D    G F+ GDCYIIL+T             IY W G+ A+ D++T SA   V L   L       R  QG E    ++LF+   ++      + G  K E +       RLF   ++++    I  +D    +L+S   ++        F+WIG  +    +     +AD +     + Q       E  E +EF NSL         D+      E   +  PP       K GR  +E    E+P G   +  L    V +LD+   +F+WIG
Sbjct:  390 MVDDGSG---GVEIWRVEN-SGRVQIDPSSYGEFYGGDCYIILYT-------YPRGQIIYTWQGANATRDELTMSAFLTVQLDRSLGGQAVQVRVSQGKEPAHLLSLFKDKPLIIY----KNGTSKKEGQAPAPPT-RLFQVRRNLASITRIVEVDVDANSLNSNDTFVLKLPRNNGFIWIGKGASQEEEKGAEYVADVLKCKASRIQ-------EGKEPEEFWNSLGGRG-----DYQTSPLLETRAEDHPPRLYGCSNKTGRFIIE----EVP-GEFTQDDLAEDDVMLLDAWEQIFIWIG 659          
BLAST of Protein flightless-1 vs. Ensembl Mouse
Match: Avil (advillin [Source:MGI Symbol;Acc:MGI:1333798])

HSP 1 Score: 167.933 bits (424), Expect = 7.716e-42
Identity = 192/757 (25.36%), Postives = 319/757 (42.14%), Query Frame = 2
Query: 2096 GTFFDGDCYIILHTSLDEKSHTSLNHSIYYWIGSQASLDKVTASAVHAVYLRNYLSTNCRCERTEQGDESPEFVALFEGNIIVCEGARGQTGFLKTEDKEHRKKMYRLFGADKSISIYSLDPTPENLDSKFVYLFDESSTRLFLWIGNKSRLMLQTKGRLLADNINQTERKGQSEI--ITERENSESDEFKNSLQSSSGIDSLDWSNLSSKEVSIDWKPPTPILYDVKLGRGYLEMPQIELPNGRLVKSLLEAKHVYILDSNGD-MFVWIGDMAPKFLKFAGXXXXXXXXXXXXXXXXXXXTVCCQTSEPQIFKMQFADWVDTCAVDFTRSVESVRKRGVNLXXXXXXXXXXXXXRAFFMPRERPMPLEDAKAIMEDCNEDLVGNNMDSNDGKPFKIKQFVYLNRNWVLVEDKWIGHFFNQDCYIVHAEYWXXXXXXXXXXXXXXXXXXXSRIQTVIYFWQGREASDIPWLQFNFSLKKEMEIKFSGMDNMSTTKDSFKKVETKRMFQQQEISTFLAHFQHRFVIHLGKYQDRYSDQRKNRIELYYLRENGNALCTRTIEVKPMIAFVNSCFHYIMKIPAAASKTENDQIICWIGKNSDSHYDEVLQAVAADTFPESSDILTVKEGAEPGIFWQALGGKKNYDHEAQFMSFS-----RLFRLSNEQGFFCASEKCSDFCQDDLADEDVMLLDTGSQIYLWFGNRTSDVEKKLSYKAAKLY-QEHMARIQPDRIRQLKITQKKKEPHNFRRCFHGWGP 4339
            G F++GDCYI+L T    +  + L+ +I++WIG  +S D+ + +A++   L +YL  +    R  Q  ES  F   F+  II  +G    +G    E   +  K        ++I    ++ + ++ +   V+L D     +  W G +S    + K  LLA +I   ER G++EI  I   + + S      LQ + G  S+    +S  E+    +  + +LY V    G L +   E+    LV+ LL     YILD +G  ++VW G  A K  K A +  A + +++    S  +       +E  +FK  F  W             SV+ +   L             + F   +   +  +     +     ++       +DGK  +++ +   N   V VE +W G F+  DCY+V   Y                 +   +   ++Y WQGR AS    L  +     E++ +F G             V+  R+   +E   F+A F+ + VI+ G    + +++    + L+ +  N  +  T+ +EV    + +NS   ++++  A        +   W GK S    DE   A          +  TV EG EP  FW  LGGK  Y ++ +    +     RLF  SN+ G F  +E  +DF Q+DL+  DVMLLDT  Q++LW G   +  EKK +   A+ Y   H +   PD    + I ++  EP  F   F  W P
Sbjct:   35 GNFYEGDCYIVLST---RRVGSLLSQNIHFWIGKDSSQDEQSCAAIYTTQLDDYLGGSPVQHREVQYHESDTFRGYFKQGIIYKKGGVA-SGMKHVETNTYDVKRLLHVKGKRNIQATEVEMSWDSFNRGDVFLLDLGMV-IIQWNGPESNSGERLKAMLLAKDIRDRERGGRAEIGVIEGDKEAASPGLMTVLQDTLGRRSMIKPAVSD-EIMDQQQKSSIMLYHVSDTAGQLSV--TEVATRPLVQDLLNHDDCYILDQSGTKIYVWKGKGATKVEKQAAMSKALDFIKMKGYPSSTNVETVNDGAESAMFKQLFQKW-------------SVKDQTTGLG------------KIFSTGKIAKIFQDKFDVSLLHTKPEVAAQERMVDDGKG-QVEVWRIENLELVPVEYQWHGFFYGGDCYLVLYTY-----------------DVNGKPHYILYIWQGRHASRDE-LAASAYRAVEVDQQFDG-----------APVQV-RVSMGKEPRHFMAIFKGKLVIYEGGTSRKGNEEPDPPVRLFQIHGNDKS-NTKAVEVSASASSLNSNDVFLLRTQA--------EHYLWYGKGSSG--DERAMAKELVDLLCDGNADTVAEGQEPPEFWDLLGGKTAYANDKRLQQETLDVQVRLFECSNKTGRFLVTE-VTDFTQEDLSPGDVMLLDTWDQVFLWIGAEANATEKKGALSTAQEYLVTHPSGRDPD--TPILIIKQGFEPPTFTGWFLAWDP 713          
BLAST of Protein flightless-1 vs. Ensembl Mouse
Match: Avil (advillin [Source:MGI Symbol;Acc:MGI:1333798])

HSP 1 Score: 167.933 bits (424), Expect = 7.716e-42
Identity = 192/757 (25.36%), Postives = 319/757 (42.14%), Query Frame = 2
Query: 2096 GTFFDGDCYIILHTSLDEKSHTSLNHSIYYWIGSQASLDKVTASAVHAVYLRNYLSTNCRCERTEQGDESPEFVALFEGNIIVCEGARGQTGFLKTEDKEHRKKMYRLFGADKSISIYSLDPTPENLDSKFVYLFDESSTRLFLWIGNKSRLMLQTKGRLLADNINQTERKGQSEI--ITERENSESDEFKNSLQSSSGIDSLDWSNLSSKEVSIDWKPPTPILYDVKLGRGYLEMPQIELPNGRLVKSLLEAKHVYILDSNGD-MFVWIGDMAPKFLKFAGXXXXXXXXXXXXXXXXXXXTVCCQTSEPQIFKMQFADWVDTCAVDFTRSVESVRKRGVNLXXXXXXXXXXXXXRAFFMPRERPMPLEDAKAIMEDCNEDLVGNNMDSNDGKPFKIKQFVYLNRNWVLVEDKWIGHFFNQDCYIVHAEYWXXXXXXXXXXXXXXXXXXXSRIQTVIYFWQGREASDIPWLQFNFSLKKEMEIKFSGMDNMSTTKDSFKKVETKRMFQQQEISTFLAHFQHRFVIHLGKYQDRYSDQRKNRIELYYLRENGNALCTRTIEVKPMIAFVNSCFHYIMKIPAAASKTENDQIICWIGKNSDSHYDEVLQAVAADTFPESSDILTVKEGAEPGIFWQALGGKKNYDHEAQFMSFS-----RLFRLSNEQGFFCASEKCSDFCQDDLADEDVMLLDTGSQIYLWFGNRTSDVEKKLSYKAAKLY-QEHMARIQPDRIRQLKITQKKKEPHNFRRCFHGWGP 4339
            G F++GDCYI+L T    +  + L+ +I++WIG  +S D+ + +A++   L +YL  +    R  Q  ES  F   F+  II  +G    +G    E   +  K        ++I    ++ + ++ +   V+L D     +  W G +S    + K  LLA +I   ER G++EI  I   + + S      LQ + G  S+    +S  E+    +  + +LY V    G L +   E+    LV+ LL     YILD +G  ++VW G  A K  K A +  A + +++    S  +       +E  +FK  F  W             SV+ +   L             + F   +   +  +     +     ++       +DGK  +++ +   N   V VE +W G F+  DCY+V   Y                 +   +   ++Y WQGR AS    L  +     E++ +F G             V+  R+   +E   F+A F+ + VI+ G    + +++    + L+ +  N  +  T+ +EV    + +NS   ++++  A        +   W GK S    DE   A          +  TV EG EP  FW  LGGK  Y ++ +    +     RLF  SN+ G F  +E  +DF Q+DL+  DVMLLDT  Q++LW G   +  EKK +   A+ Y   H +   PD    + I ++  EP  F   F  W P
Sbjct:   35 GNFYEGDCYIVLST---RRVGSLLSQNIHFWIGKDSSQDEQSCAAIYTTQLDDYLGGSPVQHREVQYHESDTFRGYFKQGIIYKKGGVA-SGMKHVETNTYDVKRLLHVKGKRNIQATEVEMSWDSFNRGDVFLLDLGMV-IIQWNGPESNSGERLKAMLLAKDIRDRERGGRAEIGVIEGDKEAASPGLMTVLQDTLGRRSMIKPAVSD-EIMDQQQKSSIMLYHVSDTAGQLSV--TEVATRPLVQDLLNHDDCYILDQSGTKIYVWKGKGATKVEKQAAMSKALDFIKMKGYPSSTNVETVNDGAESAMFKQLFQKW-------------SVKDQTTGLG------------KIFSTGKIAKIFQDKFDVSLLHTKPEVAAQERMVDDGKG-QVEVWRIENLELVPVEYQWHGFFYGGDCYLVLYTY-----------------DVNGKPHYILYIWQGRHASRDE-LAASAYRAVEVDQQFDG-----------APVQV-RVSMGKEPRHFMAIFKGKLVIYEGGTSRKGNEEPDPPVRLFQIHGNDKS-NTKAVEVSASASSLNSNDVFLLRTQA--------EHYLWYGKGSSG--DERAMAKELVDLLCDGNADTVAEGQEPPEFWDLLGGKTAYANDKRLQQETLDVQVRLFECSNKTGRFLVTE-VTDFTQEDLSPGDVMLLDTWDQVFLWIGAEANATEKKGALSTAQEYLVTHPSGRDPD--TPILIIKQGFEPPTFTGWFLAWDP 713          
BLAST of Protein flightless-1 vs. UniProt/SwissProt
Match: sp|Q24020|FLII_DROME (Protein flightless-1 OS=Drosophila melanogaster OX=7227 GN=fliI PE=2 SV=1)

HSP 1 Score: 904.049 bits (2335), Expect = 0.000e+0
Identity = 534/1302 (41.01%), Postives = 798/1302 (61.29%), Query Frame = 2
Query:  518 SVSQFLLGIDLSCVEIKDNDCSEAFSN----MTRIQWLKLVSTGLEQIPKGVEKLTQLQRLTISKNNINKLSGDWCTELKALRVFNARKNKLTDDSLPEQLFNNPQLQVVDLSFNLLTEVPAGLVEAKSLLVLNLSDNQIKNVSKDLFANCVSLMILDLSNNQIVGFPTXXXXXXXXXXXXXXXXXXXXXXXRSINGXXXXXXXXXXXXXXXXENIPSDLDKLPCLQDLDISDNNLPKVPQTIYEITSLTKLNLSGNEIDELSGLVDCWPNLEVXXXXXXXXXXXPSFITRLSKLKKLYVDENRLTFNGIPPGIGKLSNLEVFSASENLLENIPEGLCRCGQLKHLNLRMNKLVTLPDAINVLIESLKTFNIENNPNLKMPPKLVEVDLKSKYAFYNIDFSLETQMQLARGAPAKASSKSVTQKHKFTQDTASRIRRLRRKKIDEKSEKGSDSKRVLEGMQKVAKDKD----AIMEDREKEEKLLSAKKWQDAIAKPNLDYSKLFDDDVGIEPGIELWDMDDFYPRRITDELPLGTFFDGDCYIILHTSLDEKSHTSLNHSIYYWIGSQASLDKVTASAVHAVYLRNYLSTNCRCERTEQGDESPEFVALFEGNIIVCEGARGQTGFLKTEDKEHRKKMYRLFGADKSISIYSLDPTPENLDSKFVYLFDESSTRLFLWIGNKSRLMLQTKGRLLADNINQTERKGQSEIITERENSESDEFKNSLQSSSGIDSLDWSNLSSKEVSIDWKPPTPILYDVKLGRGYLEMPQIELPNGRLVKSLLEAKHVYILDSNGDMFVWIGDMAPKFLKFAGXXXXXXXXXXXXXXXXXXXTVCCQTSEPQIFKMQFADWVDTCAVDFTRSVESVRKRGVNLXXXXXXXXXXXXXRAFFMPRERPMPLEDAKAIMEDCNEDLVGNNMDSNDGKPFKIKQFVYLNRNWVLVEDKWIGHFFNQDCYIVHAEYWX-----------XXXXXXXXXXXXXXXXXXSRIQTVIYFWQGREASDIPWLQFNFSLKKEMEIKFSGMDNMSTTKDSFKKVETKRMFQQQEISTFLAHFQHRFVIHLGKYQDR-YSDQRKNRIELYYLRENGNALCTRTIEVKPMIAFVNSCFHYIMKIPAAASKTENDQ----IICWIGKNSDSHYDEVLQAVAADTFPES-SDILTVKEGAEP-GIFWQALGGKKNYDHEAQFMSFSRLFRLSNEQGFFCASEKCSDFCQDDLADEDVMLLDTGSQIYLWFGNRTSDVEKKLSYKAAKLYQEHMARIQPDRIRQLKITQKKKEPHNFRRCFHGWGPFK 4345
            SV  F+ G+D +      ND S  F +    M+R+QWL L  T L +IP+ +  L +L+ L+++ N + K+ G+  TEL  LR  + R N+L +  +P +LF+  +L  +DLS N L EVP GL  AK+L+VLNLS+NQI+++   LF +   L+ LDLS+N++   P   RR  NL++L+LS+NPL + QLR +  L+ L  L +S T R L N P+ +D L  L +LD+S N+LPK+P  +Y + +L +LNLS NE+ EL+  V+ W  LE LNLSRN+L +LP+ + +L KL++L V++N+L F GIP GIGKL  LEVFSA+ NLLE +PEGLCRCG LK LNL  N+L+TLPDAI+ L+E L   ++ NNP L MPPK  E    +   FYNIDFSL+TQ++LA  A   +   S T K     D+ +R  RLRR     +SE   D+ +VL+GM+ VAKDKD    A+ ED + E   L  K+W +++ KP LDYSK F+ D G  PG+ +W++++F P +I +E+  G F++GDCYI+L T  D+     L+  I++WIG++A+LDK   +A+HAV LRN+L   CR  R EQGDES +F++LFE  +I  EG R  TGF   E+  H  ++Y +     +I +  + P   +LD +  ++ D   T +++W+G +S+  L +K RL+A+ I++TERK + EI  ER+  ES EF   L  +S  +  D +    + V  D++P  P LY V+LG GYLE+PQ+ELP  +L  +LL +KHVYILD   D+FVW G  + + ++ A +KL+ EL  ++ R          + +E QIF+ +FA W +  AVDFTR+ +SV K G NL     + + + D+ A FMPR+  MPL +A+ + E+ N DL              ++ FV  N+ +V + ++ +G F+  +CY+    Y                     ++    ++    IQ V+YFWQGR A ++ WL F F+L+K+ +  F             +++E  R+FQQQE   F++HF+ +F+IH GK +D+ ++ + K+ +E ++LR NG AL TR I++ P    +NS F YI+ +P    +TE+D     +  WIG  + +   +++Q +A   F      +  + EG EP   FW ALGG+K YD +A++M+++RLFR SNE+G++  +EKC+DFCQDDLAD+D+M+LD G  ++LW G R S+VE KL+YK+A++Y +HM   QP+R R+L +T K KE   F +CFHGW  FK
Sbjct:    2 SVLPFVRGVDFT-----KNDFSATFPSSMRQMSRVQWLTLDRTQLAEIPEELGHLQKLEHLSLNHNRLEKIFGE-LTELSCLRSLDLRHNQLKNSGIPPELFHLEELTTLDLSHNKLKEVPEGLERAKNLIVLNLSNNQIESIPTPLFIHLTDLLFLDLSHNRLETLPPQTRRLINLKTLDLSHNPLELFQLRQLPSLQSLEVLKMSGTQRTLLNFPTSIDSLANLCELDLSHNSLPKLPDCVYNVVTLVRLNLSDNELTELTAGVELWQRLESLNLSRNQLVALPAALCKLPKLRRLLVNDNKLNFEGIPSGIGKLGALEVFSAANNLLEMVPEGLCRCGALKQLNLSCNRLITLPDAIH-LLEGLDQLDLRNNPELVMPPKPSEASKATSLEFYNIDFSLQTQLRLAGAAVPPSMPSSATPK-----DSTARKIRLRR---GPRSEGDQDAAKVLKGMKDVAKDKDNEAGAVPEDGKPES--LKPKRWDESLEKPQLDYSKFFEKDDGQLPGLTIWEIENFLPNKI-EEVVHGKFYEGDCYIVLKTKFDDLG--LLDWEIFFWIGNEATLDKRACAAIHAVNLRNFLGARCRTVREEQGDESEQFLSLFETEVIYIEGGRTATGFYTIEEMIHITRLYLVHAYGATIHLEPVAPAITSLDPRHAFVLD-LGTHIYIWMGERSKNTLNSKARLMAEKISKTERKNKCEIQLERQGEESAEFWQGLGMTS--EEADAAEPPKEHVPEDYQPVQPRLYQVQLGMGYLELPQVELPEQKLCHTLLNSKHVYILDCYTDLFVWFGKKSTRLVRAAAVKLSRELFNMMDRPDYALVMRVPEGNEMQIFRTKFAGWDEVMAVDFTRTAKSVAKTGANLTQWARQQETRTDLAALFMPRQSAMPLAEAEQLEEEWNYDLE------------MMEAFVLENKKFVRLPEEELGRFYTGECYVFLCRYCIPIEEPENGSEDGANPAADVSKSSANNQPEDEIQCVVYFWQGRNAGNMGWLTFTFTLQKKFKAMFG------------EELEVVRIFQQQENLKFMSHFKRKFIIHTGKRKDKAHTAKGKSPVEFFHLRSNGGALTTRLIQINPDAVHLNSTFCYILHVPF---ETEDDSQSGIVYVWIGSKACNEEAKLVQDIAEQMFNSPWVSLQILNEGDEPENFFWVALGGRKPYDTDAEYMNYTRLFRCSNERGYYTVAEKCADFCQDDLADDDIMILDNGEHVFLWMGPRCSEVEVKLAYKSAQVYIQHMRIKQPERPRKLFLTMKNKESRRFTKCFHGWSAFK 1253          
BLAST of Protein flightless-1 vs. UniProt/SwissProt
Match: sp|Q13045|FLII_HUMAN (Protein flightless-1 homolog OS=Homo sapiens OX=9606 GN=FLII PE=1 SV=2)

HSP 1 Score: 816.224 bits (2107), Expect = 0.000e+0
Identity = 533/1325 (40.23%), Postives = 778/1325 (58.72%), Query Frame = 2
Query:  512 SKSVSQFLLGIDLSCVEIKDNDCSEAFSNMTRIQWLKLVSTGLEQIPKGVEKLTQLQRLTISKNNINKLSGDWCTELKALRVFNARKNKLTDDSLPEQLFNNPQLQVVDLSFNLLTEVPAGLVEAKSLLVLNLSDNQIKNVSKDLFANCVSLMILDLSNNQIVGFPTXXXXXXXXXXXXXXXXXXXXXXXRSINGXXXXXXXXXXXXXXXXENIPSDLDKLPCLQDLDISDNNLPKVPQTIYEITSLTKLNLSGNEIDELSGLVDCWPNLEVXXXXXXXXXXXPSFITRLSKLKKLYVDENRLTFNGIPPGIGKLSNLEVFSASENLLENIPEGLCRCGQLKHLNLRMNKLVTLPDAINVLIESLKTFNIENNPNLKMPPKLVEVDLKSKYAFYNIDFSLETQMQLARGAPAKASSKSVTQKHKFTQDTASRIRRLRRKKIDEKSEKGSDSKRVLEGMQKVAKDKDAIMEDREKEEKLLSAK--KWQDAIAKPNLDYSKLFDDDVGIEPGIELWDMDDFYPRRITDELPLGTFFDGDCYIILHTSLDEKSHTSLNHSIYYWIGSQASLDKVTASAVHAVYLRNYLSTNCRCERTEQGDESPEFVALFEGNIIVCEGARGQTGFLKTEDKEHRKKMYRLFGADKSISIYSLDPTP---ENLDSKFVYLFDESSTRLFLWIGNKSRLMLQTKGRLLADNINQTERKGQSEIITERENSESDEFKNSLQSSSGIDSLDWSNLSSKEVSIDWKPPTPILYDVKLGRGYLEMPQIE---------------LPNGRLVKSLLEAKHVYILDSNGDMFVWIGDMAPKFLKFAGXXXXXXXXXXXXXXXXXXXTVCCQTSEPQIFKMQFADWVDTCAVDFTRSVESVRK----RGVNLXXXXXXXXXXXXXRAFFMPRERPMPLEDAKAIMEDCNEDLVGNNMDSNDGKPFKIKQFVYLNRNWVLVEDKWIGHFFNQDCYIVHAEYWXXXXXXXXXXXXXXXXXXXSR-----------------IQTVIYFWQGREASDIPWLQFNFSLKKEMEIKFSGMDNMSTTKDSFKKVETKRMFQQQEISTFLAHFQHRFVIHLGKYQDRYSDQRKNRIELYYLRENGNALCTRTIEVKPMIAFVNSCFHYIMKIPAAASKTENDQ--IICWIGKNSDSHYDEVLQAVAADTFPESSDILTVKEGAEP-GIFWQALGGKKNYDHEAQFMSFSRLFRLSNEQGFFCASEKCSDFCQDDLADEDVMLLDTGSQIYLWFGNRTSDVEKKLSYKAAKLYQEHMARIQPDRIRQLKITQKKKEPHNFRRCFHGWGPFKEAM 4354
            +  V  F+ G+DLS  + K     E    MT ++WLKL  TGL  +P+ +  L +L+ L++S NN+  L G+  + L +LR   AR N L +  +P+ +F    L V+DLS N LTE P  L  AK++LVLNLS N I  +   LF N   L+ LDLS N++   P  +RR  +LQ+L L+ NPL  +QLR +  +  L TL L +T R   N+P+ L+ L  L D+D+S N+L +VP+ +Y + SL +LNLS N+I ELS  +D W ++E LNLSRN+L SLPS I +LSKLKKLY++ N+L F+G+P GIGKL+NLE F A+ N LE +PE LCRC +L+ L L  N LVTLP+AI+ L E ++  ++  NPNL MPPK  +        +YNIDFSL+ Q++LA    + A+  +        +D  +R  RLRR+K    S +   +K+VL+GM  VA++K+   E+   + +  S K  +W   + KP LDYS+ F +DVG  PG+ +W +++F P  + +E   G F++ DCYI+L T LD+    SLN  IYYWIG +A+LDK   SA+HAV LRNYL   CR  R E GDES EF+ +F+ +I   EG    +GF   ED  +  +MYR++G  K+I    L+P P    +LD +FV+L D     +++W G ++ L   TK RL A+ IN+ ERKG++EI    +  E  EF  +L            +   K V  D+ PP P LY V LG GYLE+PQI                +P  RL++SLL+ + VYILD   D+F+W+G  +P+ ++ A LKL  EL  +L R    + +   + +E Q+FK +F +W D   VD+TR+ E+V +     G    D  +KD+MK D+ A F+PR+ PM L +A+ +ME+ NEDL G            ++ FV   + +  + ++  GHF+ QDCY+    YW   E ++ + +ED  ++   +                  Q ++YFWQGREAS++ WL F FSL+K+ E  F G            K+E  RM QQQE   FL+HF+ +F+IH GK   R + Q   +  LY +R NG+ALCTR I++    + +NS F +I+K+P    ++E++Q  +  W+G+ SD    ++ + +    F  S     + EG EP   FW  +G +K YD +A++M  +RLFR SNE+G+F  +EKCSDFCQDDLAD+D+MLLD G ++Y+W G +TS VE KLS KA ++Y +HM   + +R R+L++ +K  E H F RCFH W  F +A+
Sbjct:    3 ATGVLPFVRGVDLSGNDFKGGYFPENVKAMTSLRWLKLNRTGLCYLPEELAALQKLEHLSVSHNNLTTLHGE-LSSLPSLRAIVARANSLKNSGVPDDIFKLDDLSVLDLSHNQLTECPRELENAKNMLVLNLSHNSIDTIPNQLFINLTDLLYLDLSENRLESLPPQMRRLVHLQTLVLNGNPLLHAQLRQLPAMTALQTLHLRSTQRTQSNLPTSLEGLSNLADVDLSCNDLTRVPECLYTLPSLRRLNLSSNQITELSLCIDQWVHVETLNLSRNQLTSLPSAICKLSKLKKLYLNSNKLDFDGLPSGIGKLTNLEEFMAANNNLELVPESLCRCPKLRKLVLNKNHLVTLPEAIHFLTE-IEVLDVRENPNLVMPPKPAD----RAAEWYNIDFSLQNQLRLA--GASPATVAAAAAAGSGPKDPMARKMRLRRRK---DSAQDDQAKQVLKGMSDVAQEKNKKQEE-SADARAPSGKVRRWDQGLEKPRLDYSEFFTEDVGQLPGLTIWQIENFVP-VLVEEAFHGKFYEADCYIVLKTFLDDSG--SLNWEIYYWIGGEATLDKKACSAIHAVNLRNYLGAECRTVREEMGDESEEFLQVFDNDISYIEGGTA-SGFYTVEDTHYVTRMYRVYG-KKNI---KLEPVPLKGTSLDPRFVFLLDR-GLDIYVWRGAQATLSSTTKARLFAEKINKNERKGKAEITLLVQGQELPEFWEALGGE--------PSEIKKHVPEDFWPPQPKLYKVGLGLGYLELPQINYKLSVEHKQRPKVELMPRMRLLQSLLDTRCVYILDCWSDVFIWLGRKSPRLVRAAALKLGQELCGMLHRPRHATVSRSLEGTEAQVFKAKFKNWDDVLTVDYTRNAEAVLQSPGLSGKVKRDAEKKDQMKADLTALFLPRQPPMSLAEAEQLMEEWNEDLDG------------MEGFVLEGKKFARLPEEEFGHFYTQDCYVFLCRYWVPVEYEEEEKKEDKEEKAEGKEGEEATAEAEEKQPEEDFQCIVYFWQGREASNMGWLTFTFSLQKKFESLFPG------------KLEVVRMTQQQENPKFLSHFKRKFIIHRGK---RKAVQGAQQPSLYQIRTNGSALCTRCIQINTDSSLLNSEFCFILKVPF---ESEDNQGIVYAWVGRASDPDEAKLAEDILNTMFDTSYSKQVINEGEEPENFFWVGIGAQKPYDDDAEYMKHTRLFRCSNEKGYFAVTEKCSDFCQDDLADDDIMLLDNGQEVYMWVGTQTSQVEIKLSLKACQVYIQHMRSKEHERPRRLRLVRKGNEQHAFTRCFHAWSAFCKAL 1268          
BLAST of Protein flightless-1 vs. UniProt/SwissProt
Match: sp|Q9JJ28|FLII_MOUSE (Protein flightless-1 homolog OS=Mus musculus OX=10090 GN=Flii PE=1 SV=1)

HSP 1 Score: 808.52 bits (2087), Expect = 0.000e+0
Identity = 530/1325 (40.00%), Postives = 776/1325 (58.57%), Query Frame = 2
Query:  512 SKSVSQFLLGIDLSCVEIKDNDCSEAFSNMTRIQWLKLVSTGLEQIPKGVEKLTQLQRLTISKNNINKLSGDWCTELKALRVFNARKNKLTDDSLPEQLFNNPQLQVVDLSFNLLTEVPAGLVEAKSLLVLNLSDNQIKNVSKDLFANCVSLMILDLSNNQIVGFPTXXXXXXXXXXXXXXXXXXXXXXXRSINGXXXXXXXXXXXXXXXXENIPSDLDKLPCLQDLDISDNNLPKVPQTIYEITSLTKLNLSGNEIDELSGLVDCWPNLEVXXXXXXXXXXXPSFITRLSKLKKLYVDENRLTFNGIPPGIGKLSNLEVFSASENLLENIPEGLCRCGQLKHLNLRMNKLVTLPDAINVLIESLKTFNIENNPNLKMPPKLVEVDLKSKYAFYNIDFSLETQMQLARGAPAKASSKSVTQKHKFTQDTASRIRRLRRKKIDEKSEKGSDSKRVLEGMQKVAKDKDAIMEDR-EKEEKLLSAKKWQDAIAKPNLDYSKLFDDDVGIEPGIELWDMDDFYPRRITDELPLGTFFDGDCYIILHTSLDEKSHTSLNHSIYYWIGSQASLDKVTASAVHAVYLRNYLSTNCRCERTEQGDESPEFVALFEGNIIVCEGARGQTGFLKTEDKEHRKKMYRLFGADKSISIYSLDPTP---ENLDSKFVYLFDESSTRLFLWIGNKSRLMLQTKGRLLADNINQTERKGQSEIITERENSESDEFKNSLQSSSGIDSLDWSNLSSKEVSIDWKPPTPILYDVKLGRGYLEMPQIE---------------LPNGRLVKSLLEAKHVYILDSNGDMFVWIGDMAPKFLKFAGXXXXXXXXXXXXXXXXXXXTVCCQTSEPQIFKMQFADWVDTCAVDFTRSVESVRK----RGVNLXXXXXXXXXXXXXRAFFMPRERPMPLEDAKAIMEDCNEDLVGNNMDSNDGKPFKIKQFVYLNRNWVLVEDKWIGHFFNQDCYIVHAEYWXXXXXXXXXXXXXXXXXXXSR-------------------IQTVIYFWQGREASDIPWLQFNFSLKKEMEIKFSGMDNMSTTKDSFKKVETKRMFQQQEISTFLAHFQHRFVIHLGKYQDRYSDQRKNRIELYYLRENGNALCTRTIEVKPMIAFVNSCFHYIMKIPAAASKTENDQ--IICWIGKNSDSHYDEVLQAVAADTFPESSDILTVKEGAEP-GIFWQALGGKKNYDHEAQFMSFSRLFRLSNEQGFFCASEKCSDFCQDDLADEDVMLLDTGSQIYLWFGNRTSDVEKKLSYKAAKLYQEHMARIQPDRIRQLKITQKKKEPHNFRRCFHGWGPFKEA 4351
            +  V  F+ G+DLS  + K     E    MT ++WLKL  TGL  +P+ +  L +L+ L++S N++  L G+  + L +LR   AR N L +  +P+ +F    L V+DLS N LTE P  L  AK++LVLNLS N I ++   LF N   L+ LDLS N++   P  +RR  +LQ+L L+ NPL  +QLR +  +  L TL L NT R   N+P+ L+ L  L D+D+S N+L +VP+ +Y + SL +LNLS N+I ELS  +D W +LE LNLSRN+L SLPS I +L+KLKKLY++ N+L F+G+P GIGKL++LE F A+ N LE IPE LCRC +LK L L  N+LVTLP+AI+ L E ++  ++  NP+L MPPK  +        +YNIDFSL+ Q++LA    + A+  +       ++D  +R  RLRR+K    S +   +K+VL+GM  VA++K+   E+  +        ++W   + KP LDYS+ F +DVG  PG+ +W +++F P  + +E   G F++ DCYI+L T LD+    SLN  IYYWIG +A+LDK   SA+HAV LRNYL   CR  R E GDES EF+ +F+ +I   EG    +GF   ED  +  +MYR++G  K+I    L+P P    +LD +FV+L D+    +++W G ++ L   TK RL A+ IN+ ERKG++EI    +  E   F + L    G +  +  N     V  D+ PP P LY V LG GYLE+PQI                +P  RL++SLL+ + VYILD   D+F+W+G  +P+ ++ A LKL  EL  +L R      +   + +E Q+FK +F +W D   VD+TR+ E+V +     G    D  + D+MK D+ A F+PR+ PMPL +A+ +ME+ NEDL G            ++ FV   R +  + ++  GHF+ QDCY+    YW   E ++ +  ED   + ++                     Q ++YFWQGREAS++ WL F FSL+K+ E  F G            K+E  RM QQQE   FL+HF+ +F+IH GK   R   Q   +  LY +R NG+ALCTR I++    + +NS F +I+K+P    ++E++Q  +  W+G+ SD    ++ + +    F  S     + EG EP   FW  +G +K YD +A++M  +RLFR SNE+G+F  +EKCSDFCQDDLAD+D+MLLD G ++Y+W G +TS VE KLS KA ++Y +H    + +R R+L++ +K  E   F RCFH W  F++A
Sbjct:    3 ATGVLPFVRGVDLSGNDFKGGYFPENVKAMTSLRWLKLNRTGLCYLPEELAALQKLEHLSVSHNHLTTLHGE-LSSLPSLRAIVARANSLKNSGVPDDIFKLDDLSVLDLSHNQLTECPRELENAKNMLVLNLSHNGIDSIPNQLFINLTDLLYLDLSENRLESLPPQMRRLVHLQTLVLNGNPLLHAQLRQLPAMMALQTLHLRNTQRTQSNLPTSLEGLSNLSDVDLSCNDLTRVPECLYTLPSLRRLNLSSNQIAELSLCIDQWVHLETLNLSRNQLTSLPSAICKLTKLKKLYLNSNKLDFDGLPSGIGKLTSLEEFMAANNNLELIPESLCRCPKLKKLVLNKNRLVTLPEAIHFLTE-IQVLDVRENPSLVMPPKPAD----RTAEWYNIDFSLQNQLRLA--GASPATVAAAAAVGSGSKDPLARKMRLRRRK---DSAQDVQAKQVLKGMSDVAQEKNKNQEESIDARAPGGKVRRWDQGLEKPRLDYSEFFTEDVGQLPGLTIWQIENFVP-VLVEEAFHGKFYEADCYIVLKTFLDDSG--SLNWEIYYWIGGEATLDKKACSAIHAVNLRNYLGAECRTVREEMGDESEEFLQVFDNDISYIEGGTA-SGFYTVEDTHYVTRMYRVYGK-KNI---KLEPVPLKGSSLDPRFVFLLDQ-GLDIYVWRGAQATLSNTTKARLFAEKINKNERKGKAEITLLVQGQEPPGFWDVL----GGEPSEIKN----HVPDDFWPPQPKLYKVGLGLGYLELPQINYKLSVEHKKRPKVELMPGMRLLQSLLDTRCVYILDCWSDVFIWLGRKSPRLVRAAALKLGQELCGMLHRPRHTVVSRSLEGTEAQVFKAKFKNWDDVLTVDYTRNAEAVLQGQGLSGKVKRDTEKTDQMKADLTALFLPRQPPMPLAEAEQLMEEWNEDLDG------------MEGFVLEGRKFTRLPEEEFGHFYTQDCYVFLCRYWVPVEYEEEEKTEDKEGKASAEAREGEEAAAEAEEKQPEEDFQCIVYFWQGREASNMGWLTFTFSLQKKFESLFPG------------KLEVVRMTQQQENPKFLSHFKRKFIIHRGK---RKVTQGTLQPTLYQIRTNGSALCTRCIQINTDSSLLNSEFCFILKVPF---ESEDNQGIVYAWVGRASDPDEAKLAEDILNTMFDASYSKQVINEGEEPENFFWVGIGAQKPYDDDAEYMKHTRLFRCSNEKGYFAVTEKCSDFCQDDLADDDIMLLDNGQEVYMWVGTQTSQVEIKLSLKACQVYIQHTRSKEHERPRRLRLVRKGNEQRAFTRCFHAWSTFRQA 1269          
BLAST of Protein flightless-1 vs. UniProt/SwissProt
Match: sp|P34268|FLII_CAEEL (Protein flightless-1 homolog OS=Caenorhabditis elegans OX=6239 GN=fli-1 PE=2 SV=2)

HSP 1 Score: 718.768 bits (1854), Expect = 0.000e+0
Identity = 494/1298 (38.06%), Postives = 748/1298 (57.63%), Query Frame = 2
Query:  509 MSKSVSQFLLGIDLSCVEIKDNDCSEAFSNMTRIQWLKLVSTGLEQIPKGVEKLTQLQRLTISKNNINKLSGDWCTELKALRVFNARKNKLTDDSLPEQLFNNPQLQVVDLSFNLLTEVPAGLVEAKSLLVLNLSDNQIKNVSKDLFANCVSLMILDLSNNQIVGFPTXXXXXXXXXXXXXXXXXXXXXXXRSINGXXXXXXXXXXXXXXXXENIPSDLDKLPCLQDLDISDNNLPKVPQTIYEITSLTKLNLSGNEIDELSGLVDCWPNLEVXXXXXXXXXXXPSFITRLSKLKKLYVDENRLTFNGIPPGIGKLSNLEVFSASENLLENIPEGLCRCGQLKHLNLRMNKLVTLPDAINVLIESLKTFNIENNPNLKMPPKLVEVDLKSKYAFYNIDFSLETQMQLARGAPAKASSKSVTQKHKFTQDTASRIRRLRRKKIDEKSEKGSDSKRVLEGMQKVAKDKDAIMEDREKEEKLL----SAKKWQDAIAK--PNLDYSKLFDDDVGIEPGIELWDMDDFYPRRITDELPLGTFFDGDCYIILHTSLDEKSHTSLNHSIYYWIGSQASLDKVTASAVHAVYLRNYLSTNCRCERTEQGDESPEFVALFEGNIIVCEGARGQTGFLKTEDKEHRKKMYRLFGADKSISIYSLDPTP---ENLDSKFVYLFDESSTRLFLWIGNKSRLMLQTKGRLLADNINQTERKGQSEIITERENSESDEFKNSLQSSSGIDSLDWSNLSSKEVSIDWKPPTPILYDVKLGRGYLEMPQIELPNGRLVKSLLEAKHVYILDSNGDMFVWIGDMAPKFLKFAGXXXXXXXXXXXXXXXXXXXTVCCQTSEPQIFKMQFADWVDTCAVDFTRSVESVRKRGVNLXXXXXXXXXXXXXRAFFMPRERPMPLEDAKAIMEDCNEDLVGNNMDSNDGKPFKIKQFVYLNRNWVLVEDKWIGHFFNQDCYIVHAEYWXXXXXXXXXXXXXXXXXXXSR-IQTVIYFWQGREASDIPWLQFNFSLKKEMEIKFSGMDNMSTTKDSFKKVETKRMFQQQEISTFLAHFQHRFVIHLGKYQDRYSDQRKNRIELYYLRENGNALCTRTIEVKPMIAFVNSCFHYIMKIPAAASKTENDQ--IICWIGKNSDSHYDEVLQAVAADTFPESSD----ILTVKEGAEPGIFWQALGGKKNYDHEAQFMSFSRLFRLSNEQGFFCASEKCSDFCQDDLADEDVMLLDTGSQIYLWFGNRTSDVEKKLSYKAAKLYQEHMARIQPDRIRQLKITQKKKEPHNFRRCFHGWGPFKEAM 4354
            MS  V QF+ GID S  +   +        MT++ WLKL  + LEQ+P  + +   L+ L ++ N +  + G+  ++L  LR    R N L    +P  +F    L ++DLS N L EVP  L  AK  +VLNLS N I+ +   + AN + L+ LDLSNN++   P  +RR   LQSL LSNNPL+  QL+ +  +  L+ L +SNT+R L+NIP  LD +  L+D+D S+NNLP VP+ ++++ +L KLNLSGN+I++L+     W NLE LN+S N+L  LP  + +L++L KLY   N+LTF GIP GIGKL  L V   S N LE +PEG+ RC +L+ L L  N+L+TLP+ I+ L+  LK  ++  N NL MPPK    D + K AFYNIDFSLE Q ++A    + +SS S        QD  +R +   R++  +  ++ +D  +V++GM K+A    A+ E +++EE+      SA  W+  I K   ++DYS +FD+DVG + G+ +W++++FYP  I DE   G F+D D Y++L T+   ++   L H+I+YW+G  ASLDK   SAVHAV LRN+L+  CR +R E  DE+ EF+ LF   I+  EG R  +GF  TE   H  ++YR   A  + +   ++P P   E+LD +F +L D   T +++W G KSR+ +  K RL A+ +N+ +RKG+SEI T R+     EF  +L  +             + V   +      LY V +G G+LE+PQ+ELP G   + +L +K V++LDSN D+F+WIG  A + LK AG KL  EL +++ R          +  E  +F+ +FA W +   VD+TR+ +SV++       + + + M+ D+ A F+ R+  M  E+++ +MEDCN DL              ++ FV   + +V +  K  G F+  DCY+    Y  +PEED+   +E   D++     + V+YFWQGR+AS++ WL F F L+   E  F         KD   K+E  RM+QQQE   FL+HF+ +F+I  G+ +    +      EL+ +R NG+++C RTI+V      + S F ++++IP    + +  +  +  W+GK+SD    E  + VA+D      D    I+ V+EG E   FW+ LGGKK Y+ ++ F+  +RLFR +NE+G+F  SEK  DFCQDDL D+D+M+LD G  ++LW G R+SD+E KLSY+AA++Y   M     ++ R+  +  + +E   FR+CFH W   KE M
Sbjct:    1 MSTGVLQFVKGIDFSGNDFSGDRFPHDVEQMTQMTWLKLNDSKLEQVPDELSRCANLEHLQMAHNQLISVHGE-LSDLPRLRSVIVRDNNLKTAGIPTDIFRMKDLTIIDLSRNQLREVPTNLEYAKGSIVLNLSYNNIETIPNSVCANLIDLLFLDLSNNKLDMLPPQIRRLSMLQSLKLSNNPLNHFQLKQLPSMTSLSVLHMSNTNRTLDNIPPTLDDMHNLRDVDFSENNLPIVPEALFKLRNLRKLNLSGNKIEKLNMTEGEWENLETLNMSHNQLTVLPDCVVKLTRLTKLYAANNQLTFEGIPSGIGKLIQLTVLHLSYNKLELVPEGISRCVKLQKLKLDHNRLITLPEGIH-LLPDLKVLDLHENENLVMPPK--PNDARKKLAFYNIDFSLEHQRKIAGQMTSPSSSISSVHSGGARQDALARRKEFIRRRKQQADQQSAD--KVIQGMSKIAGVGAALTEKQQEEEERQLEAKSAVNWKKNIEKNRRHIDYSDIFDEDVGSDEGMWVWEIENFYPS-IMDEAFHGQFYDADAYLVLKTT--REASGQLRHAIFYWLGEHASLDKGMCSAVHAVGLRNHLNATCRTQREEMNDETEEFLTLFGEEIVYIEGGRTISGFYTTEKPAHLTRLYR---AGVNGTAVEMEPVPLSVESLDPRFCFLLDAGET-IWIWSGYKSRITVSNKARLFAERLNKRDRKGKSEIETCRQARCPPEFWQALTGNPDKPQ----GAIVEHVPEGFVAERKKLYKVNIGMGFLELPQVELPKGIAKQDMLGSKGVFVLDSNSDIFLWIGKKANRLLKMAGQKLVVELHQMIDRPDYAQVYRETEGEESMMFRSKFAGWDEIVPVDYTRTSDSVQRVPDLKVIVKKDNMMRADLAALFLERQPSMSYEESEELMEDCNYDLE------------LMESFVLEGKKFVKLPQKEFGIFYTMDCYVFLCRYAVMPEEDEEGEDEHDEDDKPEMDFKCVVYFWQGRDASNMGWLNFTFQLQPNFEEIF---------KD---KLEVVRMYQQQENHKFLSHFKRKFLIKRGR-RGLTKNLGGKWPELFQMRANGSSVCNRTIQVDCQANQLCSAFCHMLRIPFKEIEEDGHRGVVYVWMGKDSDPREHEFARQVASDLVVRDDDNDFRIVEVQEGEENEEFWKVLGGKKKYETDSSFVKHTRLFRCTNEKGYFAISEKTVDFCQDDLDDDDIMILDNGDAVFLWIGARSSDIEAKLSYQAAQVYHASMRMKANEKPRKFMLAVRGRESCRFRKCFHAWSKMKEPM 1256          
BLAST of Protein flightless-1 vs. UniProt/SwissProt
Match: sp|Q62468|VILI_MOUSE (Villin-1 OS=Mus musculus OX=10090 GN=Vil1 PE=1 SV=3)

HSP 1 Score: 184.882 bits (468), Expect = 1.884e-46
Identity = 199/795 (25.03%), Postives = 323/795 (40.63%), Query Frame = 2
Query: 2030 PGIELWDMDDFYPRRITDELPLGTFFDGDCYIILHTSLDEKSHTSLNHSIYYWIGSQASLDKVTASAVHAVYLRNYLSTNCRCERTEQGDESPEFVALFEGNIIVCEGARGQTGFLKTEDKEHRKKMYRLFGADKSISIYSLDPTPENLDSKFVYLFDESSTRLFLWIGNKSRLMLQTKGRLLADNINQTERKGQS--EIITERENSESDEFKNSLQSSSGIDSLDWSNLSSKEVSIDWKPPTPILYDVKLGRGYLEMPQIELPNGRLVKSLLEAKHVYILDSNG-DMFVWIGDMAPKFLKFAGXXXXXXXXXXXXXXXXXXXTVCCQTSEPQIFKMQFADWV---DTCAVDFTRSVESVRKRGVNLXXXXXXXXXXXXXRAFFMPRERPMPLEDAK--AIMEDCNEDLVGNNMDSNDGKPFKIKQFVYLNRNWVLVEDKWIGHFFNQDCYIVHAEYWXXXXXXXXXXXXXXXXXXXSRIQTVIYFWQGREASDIPWLQFNFSLKKEMEIKFSGMDNMSTTKDSFKKVETKRMFQQQEISTFLAHFQHRFVIHLGKYQDRYSDQRKNRIE------LYYLRENGNALCTRTIEVKPMIAFVNSCFHYIMKIPAAASKTENDQIICWIGKNSDSHYDEVLQAVAADTFPESSDILTVKEGAEPGIFWQALGGKKNY------DHEAQFMSFSRLFRLSNEQGFFCASEKCSDFCQDDLADEDVMLLDTGSQIYLWFGNRTSDVEKKLSYKAAKLYQEHMARIQP---DRIRQLKITQKKKEPHNFRRCFHGWGPFK 4345
            PGI++W ++      +      G+FFDGDCY++L      K+ ++L++ I+YWIG  +S D+  A+A++   + +YL       R  QG+ES  F + F+  +++ +G    +G    E      +        +++    ++ + ++ +   V+L D     +  W G +S  M + +G  LA  I   ER G++   ++   +  +S +    +    G      + +S   V    K     LY V    G L +   E+    L + LL+ +  YILD  G  +FVW G  A    +   +  A   ++           V    +E  IF+  F  W     T  +  T +V SV K                              +E  K  A+       +       +DG   +++ +   +   V VE KW+GHF+  DCY++   Y                     +   ++Y WQG +AS             + EI  S    +   +    +    R+   +E    ++ F+ R V++ G         RKN +E      L+ +R   NA  T+  EV      +NS   +I+K P+            W GK       E+ + VA DT   +   + V EG EP  FW ALGGK  Y        E Q ++  RLF  SN+ G F A+E   DF QDDL +EDV LLD   Q++ W G   ++ EKK    AA   QE++ +  P   D    + + ++  EP  F   F  W PFK
Sbjct:   17 PGIQIWRIEAMQMVPVPSST-FGSFFDGDCYVVLAI---HKTSSTLSYDIHYWIGQDSSQDEQGAAAIYTTQMDDYLKGRAVQHREVQGNESETFRSYFKQGLVIRKGGVA-SGMKHVETNSCDVQRLLHVKGKRNVLAGEVEMSWKSFNRGDVFLLDLGKL-IIQWNGPESNRMERLRGMALAKEIRDQERGGRTYVGVVDGEKEGDSPQLMAIMNHVLGPRKELKAAISDSVVEPAAKAALK-LYHVSDSEGKLVVR--EVATRPLTQDLLKHEDCYILDQGGLKIFVWKGKNANAQERSGAMSQALNFIKAKQYPPSTQVEVQNDGAESPIFQQLFQKWTVPNRTSGLGKTHTVGSVAK------------------------------VEQVKFDALTMHVQPQVAAQQKMVDDGSG-EVQVWRIEDLELVPVESKWLGHFYGGDCYLLLYTY-----------------LIGEKQHYLLYIWQGSQAS-------------QDEIAASAYQAVLLDQKYNDEPVQIRVTMGKEPPHLMSIFKGRMVVYQG------GTSRKNNLEPVPSTRLFQVR-GTNADNTKAFEVTARATSLNSNDVFILKTPSCC--------YLWCGKGCSGDEREMAKMVA-DTISRTEKQVVV-EGQEPANFWMALGGKAPYANTKRLQEENQVIT-PRLFECSNQTGRFLATE-IFDFNQDDLEEEDVFLLDVWDQVFFWIGKHANEEEKK---AAATTVQEYL-KTHPGNRDLETPIIVVKQGHEPPTFTGWFLAWDPFK 718          

HSP 2 Score: 80.4925 bits (197), Expect = 8.702e-14
Identity = 77/305 (25.25%), Postives = 144/305 (47.21%), Query Frame = 2
Query: 2000 KLFDDDVGIEPGIELWDMDDFYPRRITDELPLGTFFDGDCYIILHTSL-DEKSHTSLNHSIYYWIGSQASLDKVTASAVHAVYLRNYLSTNCRCERTEQGDESPEFVALFEGNIIVCEGARGQTGFLKTEDKEHRKKMYRLFGADK-SISIYSLDPTPENLDSKFVYLFDESSTRLFLWIGNKSRLMLQTKGRLLADNINQTERKGQSEIITERENSESDEFKNSLQSSSGIDSLDWSNLSSKEVSIDWKPPTPILYDVKLGRGYLEMPQIELPNGRLVKSLLEAKHVYILDSNGDMFVWIGDMA 2908
            K+ DD  G    +++W ++D     +  +  LG F+ GDCY++L+T L  EK H    + +Y W GSQAS D++ ASA  AV L    +      R   G E P  +++F+G ++V +G   +   L   +     +++++ G +  +   + +     +L+S  V++    S   +LW G       +   +++AD I++TE+    +++ E +  E   F  +L   +      ++N  +K +  + +  TP L++     G     +I   N    +  LE + V++LD    +F WIG  A
Sbjct:  391 KMVDDGSG---EVQVWRIEDLELVPVESKW-LGHFYGGDCYLLLYTYLIGEKQH----YLLYIWQGSQASQDEIAASAYQAVLLDQKYNDEPVQIRVTMGKEPPHLMSIFKGRMVVYQGGTSRKNNL---EPVPSTRLFQVRGTNADNTKAFEVTARATSLNSNDVFILKTPSC-CYLWCGKGCSGDEREMAKMVADTISRTEK----QVVVEGQ--EPANFWMALGGKA-----PYAN--TKRLQEENQVITPRLFECSNQTGRFLATEIFDFN----QDDLEEEDVFLLDVWDQVFFWIGKHA 666          
BLAST of Protein flightless-1 vs. TrEMBL
Match: G4V8P7 (Putative flightless-I OS=Schistosoma mansoni OX=6183 GN=Smp_165930 PE=4 SV=1)

HSP 1 Score: 1096.26 bits (2834), Expect = 0.000e+0
Identity = 635/1287 (49.34%), Postives = 864/1287 (67.13%), Query Frame = 2
Query:  581 SEAFSNMTRIQWLKLVSTGLEQ--IPKGVEKLTQLQRLTISKNNINKLSG--DWCTELKALRVFNARKNKLTD-DSLPEQLFNNPQLQVVDLSFNLLTEVPAGLVEAKSLLVLNLSDNQIKNVSKDLFANCVSLMILDLSNNQIVGFPTXXXXXXXXXXXXXXXXXXXXXXXRSINGXXXXXXXXXXXXXXXXENIPSDLDKLPCLQDLDISDNNLPKVPQTIYEITSLTKLNLSGNEIDELSGLVDCWPNLEVXXXXXXXXXXXPSFITRLSKLKKLYVDENRLTFNGIPPGIGKLSNLEVFSASENLLENIPEGLCRCGQLKHLNLRMNKLVTLPDAINVLIESLKTFNIENNPNLKMPPKLVEVDLKSKYAFYNIDFSLETQMQLARGAPAKASSKSVTQKHKFTQDTASRIRRLRRKKIDEKSEKGSDSKRVLEGMQKVAKDKDAIMEDREKEE----KLLSAKKWQDAIAKPNLDYSKLFDDDVGIEPGIELWDMDDFYPRRITDELPLGTFFDGDCYIILHTSLDEKSHTSLNHSIYYWIGSQASLDKVTASAVHAVYLRNYLSTNCRCERTEQGDESPEFVALFEGNIIVCEGARGQTGFLKTEDKEHRKKMYRLFGADKSISIYSLDPTPENLDSKFVYLFDESSTRLFLWIGNKSRLMLQTKGRLLADNINQTERKGQSEIITERENSESDEF---KNSLQSSSGIDSLDWSNLSSKEVSIDWKPPTPILYDVKLGRGYLEMPQIELPNGRLVKSLLEAKHVYILDSNGDMFVWIGDMAPKFLKFAGXXXXXXXXXXXXXXXX-XXXTVCCQTSEPQIFKMQFADWVDTCAVDFTRSVESVRKRGVNLXXXXXXXXXXXXXRAFFMPRERPMPLEDAKAIMEDCNEDLVGNNMDSNDGKPFKIKQFVYLNRNWVLVEDKWIGHFFNQDCYIVHAEYW----XXXXXXXXXXXXXXXXXXXSRIQTVIYFWQGREASDIPWLQFNFSLKKEMEIKFS-GMDNMSTTKDSFKKVETKRMFQQQEISTFLAHFQHRFVIHLGKYQDRYSDQRKNRIELYYLRENGNALCTRTIEVKPMIAFVNSCFHYIMKIPA------AASKTENDQIICWIGKNSDSHYDEVLQAVAADTFPE-SSDILTVKEGAEPGIFWQALGGKKNYDHEAQFMSFSRLFRLSNEQGFFCASEKCSDFCQDDLADEDVMLLDTGSQIYLWFGNRTSDVEKKLSYKAAKLYQEHMARIQPDRIRQLKITQKKKEPHNFRRCFHGWGPFKEAMDWSG 4366
            +E   +M R+QWLKL + GL++  +PK +  L QL+ L++ +N +  L     W   L +LR+   RKN+LT  D++P  LF    LQVVD S N LT++P G+ +AK LL LNLS+NQI  +S DLF  C  LM LDL NN++   P  LRR  +LQ L L NNPL  +QLRS+  LK+L  L LS T RRL+NIP++LDKL  L +LD+S N L K+P+ +  + +L KLNL+ NE+ +LS L   WP LE LNLS N+L  LP+ + RLS L+KLYV+ N+LTF GIP GIGKL +LE+F AS N LE IPE LCRCG+LK L L  N+L+TLPDAI+ L ESL  F ++NNP LK+PPK  E+   +  AFYNIDFSL+ Q+++ RG PA       T+     +D A+R+RR    +       G DSK VLEGMQ++AK+K+ ++E +E E     + L+A++WQD +A+P LDY+ +FD+D GI PG+++W++D FYP+R+ D++  G   +GDCY+IL T++   ++     +IYYWIGS+++ DK T +A+HAV LRN+L   CR +R E+GDES EFVALF+GN+IV +GARG+TGF+  ED     + YRLFG +K + I S+  T  +LDSKF YL D  S  L+LWIG  SR ++QTKGRLLA+ I+  ER+G++ I  E E  ES+ F      +             +S   +  DW+ P PILYDV++GRGYLE+PQ+EL NG L K LL++KHVYILDS G +F+W+G+ + KFL+FAG KLA +L+ ++PRS        C Q +E QIFK QF DW +  AVDFTR+ +SV +RGV+++ I+EKDK   D+RA   PRE P+  E+A  +M + N++L+    ++       ++QF+ ++  W+LVE++W G FFNQD YI+ A YW    E  E  + D + D  DE+++  +TV+YFWQGREASD+ WLQF FS++K+M+ + S   +N+S       KV  KR+ QQQE + FLAHFQ +F+IH G Y+DR    R  RI++YY+R NGN + TR IEVKP +  +NSCF YI+K+PA         +T+   +  W G  S S   E+   ++   F    +D   V EG+EP +FWQ LGG+K YD  A F+++ RLFRLSNEQG+FCASEKC+DFCQDDLA +DVMLLDTGSQIYLW+  RTSDVE+KLS +AAKLYQ H+ ++QPDR RQLK+T K  EPH FR+CFHGWGP+ E  DWSG
Sbjct:   53 TEILQDMCRLQWLKLRNVGLKEKFLPKEITHLQQLESLSLVRNELTSLCSIKGWPNVLPSLRMITCRKNELTSRDAIPADLFECNNLQVVDFSCNQLTQLPNGIEKAKGLLALNLSNNQIALISPDLFVQCTELMFLDLGNNKLENLPAQLRRCCSLQQLILCNNPLRHAQLRSVTALKQLEVLNLSGTERRLDNIPNELDKLERLIELDLSCNLLTKIPEPVLSLKNLRKLNLAHNELSDLSTLTGDWPKLEYLNLSYNQLIHLPTGLIRLSCLRKLYVNNNQLTFGGIPSGIGKLQDLEIFDASHNELETIPESLCRCGRLKRLILNSNRLLTLPDAIHYLKESLDVFEVDNNPQLKIPPKPPELQKGAGLAFYNIDFSLDAQLRMMRGKPALN-----TETTHHPKDPAARLRR---LRRRRGEGVGKDSKCVLEGMQRIAKEKEELLEQKEHEVEEETRKLAARRWQDLLARPRLDYTGIFDEDTGIHPGVQMWELDQFYPKRVEDDVLQGHLLNGDCYVILQTTI--SNNQVFEWTIYYWIGSRSTKDKQTCAAIHAVNLRNFLGAECRTKREEEGDESSEFVALFDGNLIVLDGARGETGFIHVEDDVVVPRFYRLFGTEKRLKIVSMPLTHLSLDSKFSYLLDAQS-HLYLWIGKNSRPIIQTKGRLLAEKISVRERRGEASIHIEPETRESNAFWAIITEINYPPAPVVHPPKVISRDFIPTDWQLPQPILYDVQMGRGYLELPQVELENGLLSKRLLDSKHVYILDSGGQLFLWMGEKSSKFLRFAGYKLALQLMGVMPRSRLDSLLQPCTQGAETQIFKCQFCDWDEALAVDFTRTADSVARRGVDINKILEKDKPATDLRALLAPRETPLTNEEALQMMAEWNDELIEPPEENIVESSSALQQFIMVDGKWILVENRWFGQFFNQDSYILIARYWDYDDENKELSESDNQGDDIDEDSNLTKTVVYFWQGREASDLSWLQFEFSVRKDMQARLSQNPENVSRPL----KVVFKRVKQQQEDTMFLAHFQRQFIIHSGHYRDRAEPSRLERIQMYYIRANGNLISTRCIEVKPSVVNLNSCFTYIIKVPAHIVSVLEKKQTDKCHVYVWTGSKSSSEDKELAGRLSEKMFSWIPADFHIVPEGSEPPLFWQVLGGQKKYDTSADFLTYGRLFRLSNEQGYFCASEKCADFCQDDLAPDDVMLLDTGSQIYLWWSKRTSDVEQKLSLQAAKLYQSHLRQMQPDRPRQLKLTVKNAEPHLFRQCFHGWGPYHEPKDWSG 1324          
BLAST of Protein flightless-1 vs. TrEMBL
Match: A0A4Z2DTC0 (Protein flightless-1 isoform 1 OS=Schistosoma japonicum OX=6182 GN=EWB00_005999 PE=4 SV=1)

HSP 1 Score: 1082.78 bits (2799), Expect = 0.000e+0
Identity = 638/1349 (47.29%), Postives = 866/1349 (64.20%), Query Frame = 2
Query:  581 SEAFSNMTRIQWLKLVSTGLEQ--IPKGVEKLTQLQRLTISKNNINKLSG--DWCTELKALRVFNARKNKLTD-DSLPEQLFNNPQLQVVDLSFNLLTEVPAGLVEAKSLLVLNLSDNQIKNVSKDLFANCVSLMILDLSNNQIVGFPTXXXXXXXXXXXXXXXXXXXXXXXRSINGXXXXXXXXXXXXXXXXENIPSDLDKLPCLQDLDISDNNLPKVPQTIYEITSLTKLNLSGNEIDELSGLVDCWPNLEVXXXXXXXXXXXPSFITRLSKLKKLYVDENRLTFNGIPPGIGKLSNLEVFSASENLLENIPEGLCRCGQLKHLNLRMNKLVTLPDAINVLIESLKTFNIENNPNLKMPPKLVEVDLKSKYAFYNIDFSLETQMQLARGAPAKASSKSVTQKHKFTQDTASRIRRLRRKKIDEKSEKGSDSKRVLEGMQKVAKDKDAIMEDREKEE----KLLSAKKWQDAIAKPNLDYSKLFDDDVGIEPGIELWDMDDFYPRRITDELPLGTFFDGDCYIILHTSLDEKSHTSLNHSIYYWIGSQASLDKVTASAVHAVYLRNYLSTNCRCERTEQGDESPEFVALFEGNIIVCEGARGQTGFLKTEDKEHRKKMYRLFGADKSISIYSLDPTPENLDSKFVYLFDESSTRLFLWIGNKSRLMLQTKGRLLADNINQTERKGQSEIITERENSESDEFKNSLQSSSGIDSLDWSNLSS-------------KEVSI-------------------DWKPPTPILYDVKLGRGYLEMPQIELPNGRLVKSLLEAKHVYILDSNGDMFVWIGDMAPKFLKFAGXXXXXXXXXXXXXXXXXXXTV---------------------------------CCQTSEPQIFKMQFADWVDTCAVDFTRSVESVRKRGVNLXXXXXXXXXXXXXRAFFMPRERPMPLEDAKAIMEDCNEDLVGNNMDSNDGKPFKIKQFVYLNRNWVLVEDKWIGHFFNQDCYIVHAEYW----XXXXXXXXXXXXXXXXXXXSRIQTVIYFWQGREASDIPWLQFNFSLKKEMEIKFSGMDNMSTTKDSFK--KVETKRMFQQQEISTFLAHFQHRFVIHLGKYQDRYSDQRKNRIELYYLRENGNALCTRTIEVKPMIAFVNSCFHYIMKIPA------AASKTENDQIICWIGKNSDSHYDEVLQAVAADTFPE-SSDILTVKEGAEPGIFWQALGGKKNYDHEAQFMSFSRLFRLSNEQGFFCASEKCSDFCQDDLADEDVMLLDTGSQIYLWFGNRTSDVEKKLSYKAAKLYQEHMARIQPDRIRQLKITQKKKEPHNFRRCFHGWGPFKEAMDWSG 4366
            +E   +M R+QWLKL + GL++  +PK +  L QL+ L++++N +  L     W   L +LR+   RKN+LT+ D++P  LF    LQVVD SFN LT++P G+ +AK LL LNLS+NQI  +S DLF  C  LM LDL NN++   P  LRR  +LQ L L NNPL  +QLRS+  LK+L  L LS T RR++NIP++LD+L  L +LD+S N L K+P+ +  + +L KL+L+ NE+ +LS L   WP LE LNLS N+L  LP+ + RLS L+KLYV+ N+LTF GIP GIGKL +LE+F AS N LE IPE LCRCG+LK L L  N+L+TLPDAI+ L ESL  F ++NNP LK+PPK  E+   +  AFYNIDFSL+ Q+++ RG PA       T+  +  +D ASR+   RR +       G  SK VLEGMQ++AK+K+ ++E +E E     + L+A++WQD  A+P LDY+ +FD+D G+ PG+++W++D FYPRR+ DE+  G  F+GDCY+IL T++       L  +IYYWIGS++S DK T +A+HAV LRN L   CR +R  +GDES +F+ALF GN+IV +GARG+TGF+  ED     ++YRLFG +K + I S+  T  +LDSKF YL D  S  L+LWIG  SR ++QTKGRLLA+ I+  ER+G++ I  E E  ES+ F   +        L   N +S             KEV+                    DW+ P PILYDV++GRGYLE+PQ+EL N  L K LL++KHVYILDS G +F+W+G+ + KFL+FAG KLA +L+ L+PRS      +                                 C Q +E QIFK QF+DW +  AVDFTR+ +SV +RGV+++ I+EKDK+  D+R    PRE P+  E+A  +M + N++L+    +        ++QF+ ++  W+ VE +W G FFNQD YI+ A YW    E  E    D + D  D++++  +TV+YFWQGREASD+ WLQF FS++K+M+ + S        +D  +  KV  KR+ QQQE + FLAHFQ +F+IH G Y+DR    R   I++YYLR NGN + TR IE+KP    +NSCF YI+K+PA         KT+   +  WIG  + S   E+   ++   F     D   V EG+EP +FWQ LGG+KNYD  A+F+++ RLFRLSN+QG+FCASEKC+DFCQDDLA +DVMLLDTGSQIYLW+  RTSDVE+KLS +AAKLYQ HM ++QPDR RQLK+T K  EPH FRRCFHGWGPF+E  DWSG
Sbjct: 1489 TEILQDMCRLQWLKLKNVGLKEKFLPKEITHLEQLESLSLARNELTSLCSIKGWPNVLPSLRMITCRKNELTNRDAIPADLFECSNLQVVDFSFNHLTQLPNGIEKAKGLLALNLSNNQIALISPDLFVQCTELMFLDLGNNKLENLPAQLRRCCSLQQLILCNNPLRHAQLRSVTALKQLEVLNLSGTERRVDNIPNELDRLERLIELDLSCNLLTKIPEPVLLLRNLRKLHLAHNELSDLSTLTGDWPRLEYLNLSYNQLTHLPTGLIRLSCLRKLYVNNNQLTFGGIPSGIGKLQDLEIFDASHNELETIPESLCRCGRLKRLILNSNRLLTLPDAIHYLKESLDVFEVDNNPQLKIPPKPPELQKGAGLAFYNIDFSLDAQLRMMRGKPALN-----TETVQHAKDPASRL---RRLRRLRGESVGKGSKCVLEGMQRIAKEKEVLLEQKEHEAEEETRKLAARRWQDLFARPRLDYTGIFDEDTGVTPGVQIWELDQFYPRRVEDEVLQGHLFNGDCYVILKTAVSISQ--VLEWAIYYWIGSRSSKDKQTCAAIHAVNLRNLLGAECRTKREAEGDESSDFLALFGGNLIVLDGARGETGFIHVEDDVVVPRLYRLFGTEKRLKIVSMPLTHYSLDSKFSYLLDAQS-HLYLWIGKNSRSIMQTKGRLLAEKISVRERRGEASIHIEPETRESNPFWAIVTGVWVPAPLPKPNNTSDHVLKPVDNYEENKEVNYPPAPIVQPPKAESRDFIPQDWRLPHPILYDVQMGRGYLELPQVELENDILSKKLLDSKHVYILDSGGQLFLWMGEKSSKFLRFAGYKLALQLIGLMPRSRLGGLELLFTESNMSLLSQTLLNEDQLDWWNDFTDSLLQPCTQGAETQIFKCQFSDWDEALAVDFTRTADSVARRGVDINQILEKDKLTTDLRTLLAPRETPLTNEEALQMMTEWNDELIEPPEEFVVEPSSALQQFIMVDGKWMPVESQWFGQFFNQDSYILIARYWDYDDENKELSGSDNQGDDADDDSNLTKTVVYFWQGREASDLNWLQFEFSVRKDMQARLS-----QNPEDVSRPLKVIFKRVKQQQEDTMFLAHFQRQFIIHSGHYRDRVDSSRSELIQMYYLRANGNLISTRCIEIKPSAMNLNSCFTYIIKVPAHIVSIFEKKKTDKCLVYIWIGSKASSEDKELAVRLSNKIFNSIPVDFHIVPEGSEPPLFWQVLGGQKNYDRSAEFLTYGRLFRLSNDQGYFCASEKCADFCQDDLAPDDVMLLDTGSQIYLWWSKRTSDVEQKLSLQAAKLYQSHMRQMQPDRPRQLKLTVKNAEPHLFRRCFHGWGPFREPKDWSG 2821          
BLAST of Protein flightless-1 vs. TrEMBL
Match: A0A3Q0KS46 (Putative flightless-I OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 1082.4 bits (2798), Expect = 0.000e+0
Identity = 642/1352 (47.49%), Postives = 874/1352 (64.64%), Query Frame = 2
Query:  581 SEAFSNMTRIQWLKLVSTGLEQ--IPKGVEKLTQLQRLTISKNNINKLSG--DWCTELKALRVFNARKNKLTD-DSLPEQLFNNPQLQVVDLSFNLLTEVPAGLVEAKSLLVLNLSDNQIKNVSKDLFANCVSLMILDLSNNQIVGFPTXXXXXXXXXXXXXXXXXXXXXXXRSINGXXXXXXXXXXXXXXXXENIPSDLDKLPCLQDLDISDNNLPKVPQTIYEITSLTKLNLSGNEIDELSGLVDCWPNLEVXXXXXXXXXXXPSFITRLSKLKKLYVDENRLTFNGIPPGIGKLSNLEVFSASENLLENIPEGLCRCGQLKHLNLRMNKLVTLPDAINVLIESLKTFNIENNPNLKMPPKLVEVDLKSKYAFYNIDFSLETQMQLARGAPAKASSKSVTQKHKFTQDTASRIRRLRRKKIDEKSEKGSDSKRVLEGMQKVAKDKDAIMEDREKEE----KLLSAKKWQDAIAKPNLDYSKLFDDDVGIEPGIELWDMDDFYPRRITDELPLGTFFDGDCYIILHTSLDEKSHTSLNHSIYYWIGSQASLDKVTASAVHAVYLRNYLSTNCRCERTEQGDESPEFVALFEGNIIVCEGARGQTGFLKTEDKEHRKKMYRLFGADKSISIYSLDPTPENLDSKFVYLFDESSTRLFLWIGNKSRLMLQTKGRLLADNINQTERKGQSEIITERENSESDEF-----------------KNSLQSSSGIDSLDWSNLSSKEVS-------------------IDWKPPTPILYDVKLGRGYLEMPQIELPNGRLVKSLLEAKHVYILDSNGDMFVWIGDMAPKFLKFAGXXXXXXXXXXXXXXXXXXXTV---------------------------------CCQTSEPQIFKMQFADWVDTCAVDFTRSVESVRKRGVNLXXXXXXXXXXXXXRAFFMPRERPMPLEDAKAIMEDCNEDLVGNNMDSNDGKPFKIKQFVYLNRNWVLVEDKWIGHFFNQDCYIVHAEYW----XXXXXXXXXXXXXXXXXXXSRIQTVIYFWQGREASDIPWLQFNFSLKKEMEIKFS-GMDNMSTTKDSFKKVETKRMFQQQEISTFLAHFQHRFVIHLGKYQDRYSDQRKNRIELYYLRENGNALCTRTIEVKPMIAFVNSCFHYIMKIPA------AASKTENDQIICWIGKNSDSHYDEVLQAVAADTFPE-SSDILTVKEGAEPGIFWQALGGKKNYDHEAQFMSFSRLFRLSNEQGFFCASEKCSDFCQDDLADEDVMLLDTGSQIYLWFGNRTSDVEKKLSYKAAKLYQEHMARIQPDRIRQLKITQKKKEPHNFRRCFHGWGPFKEAMDWSG 4366
            +E   +M R+QWLKL + GL++  +PK +  L QL+ L++ +N +  L     W   L +LR+   RKN+LT  D++P  LF    LQVVD S N LT++P G+ +AK LL LNLS+NQI  +S DLF  C  LM LDL NN++   P  LRR  +LQ L L NNPL  +QLRS+  LK+L  L LS T RRL+NIP++LDKL  L +LD+S N L K+P+ +  + +L KLNL+ NE+ +LS L   WP LE LNLS N+L  LP+ + RLS L+KLYV+ N+LTF GIP GIGKL +LE+F AS N LE IPE LCRCG+LK L L  N+L+TLPDAI+ L ESL  F ++NNP LK+PPK  E+   +  AFYNIDFSL+ Q+++ RG PA       T+     +D A+R+   RR +       G DSK VLEGMQ++AK+K+ ++E +E E     + L+A++WQD +A+P LDY+ +FD+D GI PG+++W++D FYP+R+ D++  G   +GDCY+IL T++   ++     +IYYWIGS+++ DK T +A+HAV LRN+L   CR +R E+GDES EFVALF+GN+IV +GARG+TGF+  ED     + YRLFG +K + I S+  T  +LDSKF YL D  S  L+LWIG  SR ++QTKGRLLA+ I+  ER+G++ I  E E  ES+ F                  NS Q    I  LD ++  +KE++                    DW+ P PILYDV++GRGYLE+PQ+EL NG L K LL++KHVYILDS G +F+W+G+ + KFL+FAG KLA +L+ ++PRS      +                                 C Q +E QIFK QF DW +  AVDFTR+ +SV +RGV+++ I+EKDK   D+RA   PRE P+  E+A  +M + N++L+    ++       ++QF+ ++  W+LVE++W G FFNQD YI+ A YW    E  E  + D + D  DE+++  +TV+YFWQGREASD+ WLQF FS++K+M+ + S   +N+S       KV  KR+ QQQE + FLAHFQ +F+IH G Y+DR    R  RI++YY+R NGN + TR IEVKP +  +NSCF YI+K+PA         +T+   +  W G  S S   E+   ++   F    +D   V EG+EP +FWQ LGG+K YD  A F+++ RLFRLSNEQG+FCASEKC+DFCQDDLA +DVMLLDTGSQIYLW+  RTSDVE+KLS +AAKLYQ H+ ++QPDR RQLK+T K  EPH FR+CFHGWGP+ E  DWSG
Sbjct:   53 TEILQDMCRLQWLKLRNVGLKEKFLPKEITHLQQLESLSLVRNELTSLCSIKGWPNVLPSLRMITCRKNELTSRDAIPADLFECNNLQVVDFSCNQLTQLPNGIEKAKGLLALNLSNNQIALISPDLFVQCTELMFLDLGNNKLENLPAQLRRCCSLQQLILCNNPLRHAQLRSVTALKQLEVLNLSGTERRLDNIPNELDKLERLIELDLSCNLLTKIPEPVLSLKNLRKLNLAHNELSDLSTLTGDWPKLEYLNLSYNQLIHLPTGLIRLSCLRKLYVNNNQLTFGGIPSGIGKLQDLEIFDASHNELETIPESLCRCGRLKRLILNSNRLLTLPDAIHYLKESLDVFEVDNNPQLKIPPKPPELQKGAGLAFYNIDFSLDAQLRMMRGKPALN-----TETTHHPKDPAARL---RRLRRRRGEGVGKDSKCVLEGMQRIAKEKEELLEQKEHEVEEETRKLAARRWQDLLARPRLDYTGIFDEDTGIHPGVQMWELDQFYPKRVEDDVLQGHLLNGDCYVILQTTI--SNNQVFEWTIYYWIGSRSTKDKQTCAAIHAVNLRNFLGAECRTKREEEGDESSEFVALFDGNLIVLDGARGETGFIHVEDDVVVPRFYRLFGTEKRLKIVSMPLTHLSLDSKFSYLLDAQS-HLYLWIGKNSRPIIQTKGRLLAEKISVRERRGEASIHIEPETRESNAFWAIITGVWVPAPLPKPTTNSDQKDHIIKPLD-NHEENKEINYPPAPVVHPPKVISRDFIPTDWQLPQPILYDVQMGRGYLELPQVELENGLLSKRLLDSKHVYILDSGGQLFLWMGEKSSKFLRFAGYKLALQLMGVMPRSRLGGLELLFTESNMPTLTQTLLNNDHVDWWNDFTDSLLQPCTQGAETQIFKCQFCDWDEALAVDFTRTADSVARRGVDINKILEKDKPATDLRALLAPRETPLTNEEALQMMAEWNDELIEPPEENIVESSSALQQFIMVDGKWILVENRWFGQFFNQDSYILIARYWDYDDENKELSESDNQGDDIDEDSNLTKTVVYFWQGREASDLSWLQFEFSVRKDMQARLSQNPENVSRP----LKVVFKRVKQQQEDTMFLAHFQRQFIIHSGHYRDRAEPSRLERIQMYYIRANGNLISTRCIEVKPSVVNLNSCFTYIIKVPAHIVSVLEKKQTDKCHVYVWTGSKSSSEDKELAGRLSEKMFSWIPADFHIVPEGSEPPLFWQVLGGQKKYDTSADFLTYGRLFRLSNEQGYFCASEKCADFCQDDLAPDDVMLLDTGSQIYLWWSKRTSDVEQKLSLQAAKLYQSHLRQMQPDRPRQLKLTVKNAEPHLFRQCFHGWGPYHEPKDWSG 1388          
BLAST of Protein flightless-1 vs. TrEMBL
Match: A0A4Z2DTI5 (Protein flightless-1 isoform 2 OS=Schistosoma japonicum OX=6182 GN=EWB00_005999 PE=4 SV=1)

HSP 1 Score: 1081.63 bits (2796), Expect = 0.000e+0
Identity = 638/1349 (47.29%), Postives = 866/1349 (64.20%), Query Frame = 2
Query:  581 SEAFSNMTRIQWLKLVSTGLEQ--IPKGVEKLTQLQRLTISKNNINKLSG--DWCTELKALRVFNARKNKLTD-DSLPEQLFNNPQLQVVDLSFNLLTEVPAGLVEAKSLLVLNLSDNQIKNVSKDLFANCVSLMILDLSNNQIVGFPTXXXXXXXXXXXXXXXXXXXXXXXRSINGXXXXXXXXXXXXXXXXENIPSDLDKLPCLQDLDISDNNLPKVPQTIYEITSLTKLNLSGNEIDELSGLVDCWPNLEVXXXXXXXXXXXPSFITRLSKLKKLYVDENRLTFNGIPPGIGKLSNLEVFSASENLLENIPEGLCRCGQLKHLNLRMNKLVTLPDAINVLIESLKTFNIENNPNLKMPPKLVEVDLKSKYAFYNIDFSLETQMQLARGAPAKASSKSVTQKHKFTQDTASRIRRLRRKKIDEKSEKGSDSKRVLEGMQKVAKDKDAIMEDREKEE----KLLSAKKWQDAIAKPNLDYSKLFDDDVGIEPGIELWDMDDFYPRRITDELPLGTFFDGDCYIILHTSLDEKSHTSLNHSIYYWIGSQASLDKVTASAVHAVYLRNYLSTNCRCERTEQGDESPEFVALFEGNIIVCEGARGQTGFLKTEDKEHRKKMYRLFGADKSISIYSLDPTPENLDSKFVYLFDESSTRLFLWIGNKSRLMLQTKGRLLADNINQTERKGQSEIITERENSESDEFKNSLQSSSGIDSLDWSNLSS-------------KEVSI-------------------DWKPPTPILYDVKLGRGYLEMPQIELPNGRLVKSLLEAKHVYILDSNGDMFVWIGDMAPKFLKFAGXXXXXXXXXXXXXXXXXXXTV---------------------------------CCQTSEPQIFKMQFADWVDTCAVDFTRSVESVRKRGVNLXXXXXXXXXXXXXRAFFMPRERPMPLEDAKAIMEDCNEDLVGNNMDSNDGKPFKIKQFVYLNRNWVLVEDKWIGHFFNQDCYIVHAEYW----XXXXXXXXXXXXXXXXXXXSRIQTVIYFWQGREASDIPWLQFNFSLKKEMEIKFSGMDNMSTTKDSFK--KVETKRMFQQQEISTFLAHFQHRFVIHLGKYQDRYSDQRKNRIELYYLRENGNALCTRTIEVKPMIAFVNSCFHYIMKIPA------AASKTENDQIICWIGKNSDSHYDEVLQAVAADTFPE-SSDILTVKEGAEPGIFWQALGGKKNYDHEAQFMSFSRLFRLSNEQGFFCASEKCSDFCQDDLADEDVMLLDTGSQIYLWFGNRTSDVEKKLSYKAAKLYQEHMARIQPDRIRQLKITQKKKEPHNFRRCFHGWGPFKEAMDWSG 4366
            +E   +M R+QWLKL + GL++  +PK +  L QL+ L++++N +  L     W   L +LR+   RKN+LT+ D++P  LF    LQVVD SFN LT++P G+ +AK LL LNLS+NQI  +S DLF  C  LM LDL NN++   P  LRR  +LQ L L NNPL  +QLRS+  LK+L  L LS T RR++NIP++LD+L  L +LD+S N L K+P+ +  + +L KL+L+ NE+ +LS L   WP LE LNLS N+L  LP+ + RLS L+KLYV+ N+LTF GIP GIGKL +LE+F AS N LE IPE LCRCG+LK L L  N+L+TLPDAI+ L ESL  F ++NNP LK+PPK  E+   +  AFYNIDFSL+ Q+++ RG PA       T+  +  +D ASR+   RR +       G  SK VLEGMQ++AK+K+ ++E +E E     + L+A++WQD  A+P LDY+ +FD+D G+ PG+++W++D FYPRR+ DE+  G  F+GDCY+IL T++       L  +IYYWIGS++S DK T +A+HAV LRN L   CR +R  +GDES +F+ALF GN+IV +GARG+TGF+  ED     ++YRLFG +K + I S+  T  +LDSKF YL D  S  L+LWIG  SR ++QTKGRLLA+ I+  ER+G++ I  E E  ES+ F   +        L   N +S             KEV+                    DW+ P PILYDV++GRGYLE+PQ+EL N  L K LL++KHVYILDS G +F+W+G+ + KFL+FAG KLA +L+ L+PRS      +                                 C Q +E QIFK QF+DW +  AVDFTR+ +SV +RGV+++ I+EKDK+  D+R    PRE P+  E+A  +M + N++L+    +        ++QF+ ++  W+ VE +W G FFNQD YI+ A YW    E  E    D + D  D++++  +TV+YFWQGREASD+ WLQF FS++K+M+ + S        +D  +  KV  KR+ QQQE + FLAHFQ +F+IH G Y+DR    R   I++YYLR NGN + TR IE+KP    +NSCF YI+K+PA         KT+   +  WIG  + S   E+   ++   F     D   V EG+EP +FWQ LGG+KNYD  A+F+++ RLFRLSN+QG+FCASEKC+DFCQDDLA +DVMLLDTGSQIYLW+  RTSDVE+KLS +AAKLYQ HM ++QPDR RQLK+T K  EPH FRRCFHGWGPF+E  DWSG
Sbjct: 1469 TEILQDMCRLQWLKLKNVGLKEKFLPKEITHLEQLESLSLARNELTSLCSIKGWPNVLPSLRMITCRKNELTNRDAIPADLFECSNLQVVDFSFNHLTQLPNGIEKAKGLLALNLSNNQIALISPDLFVQCTELMFLDLGNNKLENLPAQLRRCCSLQQLILCNNPLRHAQLRSVTALKQLEVLNLSGTERRVDNIPNELDRLERLIELDLSCNLLTKIPEPVLLLRNLRKLHLAHNELSDLSTLTGDWPRLEYLNLSYNQLTHLPTGLIRLSCLRKLYVNNNQLTFGGIPSGIGKLQDLEIFDASHNELETIPESLCRCGRLKRLILNSNRLLTLPDAIHYLKESLDVFEVDNNPQLKIPPKPPELQKGAGLAFYNIDFSLDAQLRMMRGKPALN-----TETVQHAKDPASRL---RRLRRLRGESVGKGSKCVLEGMQRIAKEKEVLLEQKEHEAEEETRKLAARRWQDLFARPRLDYTGIFDEDTGVTPGVQIWELDQFYPRRVEDEVLQGHLFNGDCYVILKTAVSISQ--VLEWAIYYWIGSRSSKDKQTCAAIHAVNLRNLLGAECRTKREAEGDESSDFLALFGGNLIVLDGARGETGFIHVEDDVVVPRLYRLFGTEKRLKIVSMPLTHYSLDSKFSYLLDAQS-HLYLWIGKNSRSIMQTKGRLLAEKISVRERRGEASIHIEPETRESNPFWAIVTGVWVPAPLPKPNNTSDHVLKPVDNYEENKEVNYPPAPIVQPPKAESRDFIPQDWRLPHPILYDVQMGRGYLELPQVELENDILSKKLLDSKHVYILDSGGQLFLWMGEKSSKFLRFAGYKLALQLIGLMPRSRLGGLELLFTESNMSLLSQTLLNEDQLDWWNDFTDSLLQPCTQGAETQIFKCQFSDWDEALAVDFTRTADSVARRGVDINQILEKDKLTTDLRTLLAPRETPLTNEEALQMMTEWNDELIEPPEEFVVEPSSALQQFIMVDGKWMPVESQWFGQFFNQDSYILIARYWDYDDENKELSGSDNQGDDADDDSNLTKTVVYFWQGREASDLNWLQFEFSVRKDMQARLS-----QNPEDVSRPLKVIFKRVKQQQEDTMFLAHFQRQFIIHSGHYRDRVDSSRSELIQMYYLRANGNLISTRCIEIKPSAMNLNSCFTYIIKVPAHIVSIFEKKKTDKCLVYIWIGSKASSEDKELAVRLSNKIFNSIPVDFHIVPEGSEPPLFWQVLGGQKNYDRSAEFLTYGRLFRLSNDQGYFCASEKCADFCQDDLAPDDVMLLDTGSQIYLWWSKRTSDVEQKLSLQAAKLYQSHMRQMQPDRPRQLKLTVKNAEPHLFRRCFHGWGPFREPKDWSG 2801          
BLAST of Protein flightless-1 vs. TrEMBL
Match: A0A4S2LTT2 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_004895 PE=4 SV=1)

HSP 1 Score: 1077.39 bits (2785), Expect = 0.000e+0
Identity = 637/1395 (45.66%), Postives = 891/1395 (63.87%), Query Frame = 2
Query:  509 MSKSVSQFLLGIDLSCVE------------------------IKDND------CSEAFSNMTRIQWLKLVSTGLE--QIPKGVEKLTQLQRLTISKNNINKLSG--DWCTELKALRVFNARKNKLTD-DSLPEQLFNNPQLQVVDLSFNLLTEVPAGLVEAKSLLVLNLSDNQIKNVSKDLFANCVSLMILDLSNNQIVGFPTXXXXXXXXXXXXXXXXXXXXXXXRSINGXXXXXXXXXXXXXXXXENIPSDLDKLPCLQDLDISDNNLPKVPQTIYEITSLTKLNLSGNEIDELSGLVDCWPNLEVXXXXXXXXXXXPSFITRLSKLKKLYVDENRLTFNGIPPGIGKLSNLEVFSASENLLENIPEGLCRCGQLKHLNLRMNKLVTLPDAINVLIESLKTFNIENNPNLKMPPKLVEVDLKSKYAFYNIDFSLETQMQLARGAPAKASSKSVTQKHKFTQDTASRIRRLRRKKIDEKSEKGSDSKRVLEGMQKVAKDKDAIMEDREKEE----KLLSAKKWQDAIAKPNLDYSKLFDDDVGIEPGIELWDMDDFYPRRITDELPLGTFFDGDCYIILHTSLDEKSHTSLNHSIYYWIGSQASLDKVTASAVHAVYLRNYLSTNCRCERTEQGDESPEFVALFEGNIIVCEGARGQTGFLKTEDKEHRKKMYRLFGADKSISIYSLDPTPENLDSKFVYLFDESSTRLFLWIGNKSRLMLQTKGRLLADNINQTERKGQSEIITERENSESDEF----------------------KNSLQSSSGIDSLDWSNLSSKE-----------VSIDWKPPTPILYDVKLGRGYLEMPQIELPNGRLVKSLLEAKHVYILDSNGDMFVWIGDMAPKFLKFAGXXXXXXXXXXX----------------------------XXXXXXXXTVCCQTSEPQIFKMQFADWVDTCAVDFTRSVESVRKRGVNLXXXXXXXXXXXXXRAFFMPRERPMPLEDAKAIMEDCNEDLVGNNMDSNDGKPFK-IKQFVYLNRNWVLVEDKWIGHFFNQDCYIVHAEYWXXXXXXXXXXXXXXXXXXXSRIQTVIYFWQGREASDIPWLQFNFSLKKEMEIKFSGMDNMSTTKDSFKKVETKRMFQQQEISTFLAHFQHRFVIHLGKYQDRYSDQRKNRIELYYLRENGNALCTRTIEVKPMIAFVNSCFHYIMKIP----AAASKTENDQIICWIGKNSDSHYDE--VLQAVAADTF--PESSDILTVKEGAEPGIFWQALGGKKNYDHEAQFMSFSRLFRLSNEQGFFCASEKCSDFCQDDLADEDVMLLDTGSQIYLWFGNRTSDVEKKLSYKAAKLYQEHMARIQPDRIRQLKITQKKKEPHNFRRCFHGWGPFKEAMDWSG 4366
            M+K+V ++L G+D+S V                         + D+D       ++  ++M R+QWLKL   GL   ++P  + +LT+L+ L++++N++ +LS    W T L ALR    R N+LTD D++P ++F  P LQVVD S N LT VP G+ +AK LLVLNLS N+I ++S D+F  C  LM+LDLS+N++   P  LRR   LQ L LSNNPL  +QLRS+  LK+L  L L+ T RRL+NIP +LDK+  L++LD+S+N L ++P+ +  + +L KLNL  NEI +LS + D WP LE LNL  N+L+ LP+ +TRL+ L++LY++ N+L+F+GIP GIGKLS+LE+F AS N LENIPE LCRCG+L+ L L  N+L+TLPDAI+ L ESL  F ++ NP LK PPK  E+   +  A+YNIDFSLETQ++   G PA+   K    K     DTAS   R  R++ D+ +E  +DS  VLEGMQ++A+DK+ ++  RE++E    + LSAK+WQD +++P LDYS +FD D GI PG+E+W++D+FYP+R+ +E   G  FDGDCY++L T +   ++ +L  +IYYWIGSQA++DK T +A+HAV LRN+L    R  R EQ DES EF+ALF+G ++V EG+ G+TGF   E +    K+YRLFG +K + I S+  +P +LD KF YL D  S  L+LW+G  SR+M++TKGRLLA+ I+  ER+G++ I  E +  ESD F                       +  Q    ++ L   +                +S +WK P PILYDV++G+GYLE+PQ++L  G L K+LL+ KHVY+LDS G++FVW+G+ + +F++ AG KLA EL  L+                               SR  P VC Q +EPQIF+ QF DW +  AVDFTR+ ESV KRG +L+ I+EKDK   D+RA F PRER +  +++  +M D N +LV       D  P   ++QF+ L+  WV VE +W GHFFNQD YIV A YW+  E  +    +   +  + R +TV+YFWQGRE SD+ WL FNFS++K+ME + S          S  +VE KR+ QQQE   FL+HF  + VIH G+YQDR S+ R  R ++YY+R NGN + TRT+E+KP    +N+ F Y++K+P    A+   + +  +  WIG  +D+H D+  +   +A   F  PE++ I  +  G EP  FW+ LGG+K YD  A F+ ++RLFRLSN+QG+FCASEKCSDFCQDDLADED M+LDTG  IY+W+G +TSDVE+KLS +AAKLYQ+HM+ +Q DR R+LK+T K  EP+ FRRCFHGWGPF+E  DWSG
Sbjct:    1 MTKAVVEYLRGLDVSGVSFGYGEPSSTDGRRPRKDRAANDSSVGDHDMQPFRPSTDVLASMCRLQWLKLRDVGLRDGRLPPELSQLTKLENLSLARNSLTRLSSLKGWPTTLPALRSLVCRNNELTDGDAIPSEIFECPHLQVVDFSRNNLTNVPKGIEKAKGLLVLNLSSNRITSISSDVFVQCTDLMLLDLSDNRLESLPAQLRRCNALQQLILSNNPLRHAQLRSLAALKQLEVLHLAGTERRLDNIPGELDKVEKLKELDLSNNMLTRIPEPVLSLRTLRKLNLEKNEITDLSQVTDNWPKLEYLNLGHNQLSQLPAGLTRLTSLRRLYINNNQLSFSGIPSGIGKLSDLEIFDASYNELENIPESLCRCGRLRRLILTCNRLLTLPDAIHYLRESLDVFEVDGNPLLKFPPKPPELVKGAGRAYYNIDFSLETQIRQICGKPAETPDKGYHAK-----DTAS-RLRRLRRRRDDVAE--TDSSCVLEGMQRIARDKETLLRQREQQEEEEYQHLSAKRWQDQLSRPELDYSNIFDADTGIAPGVEVWEVDEFYPKRVDEECAQGRMFDGDCYVVLDTRM--SANQTLEWTIYYWIGSQATMDKQTCAAIHAVNLRNFLGAEGRTHREEQNDESDEFLALFDGKLMVLEGSHGETGFFHVEAQAVIPKLYRLFGQEKRLQIVSMPLSPLSLDPKFCYLIDAQS-ELYLWLGADSRVMVRTKGRLLAEKISVRERRGEAAIHLEAQGRESDAFWAIITDQWTPAPLPTAVMKVDEDSHHQRKQRVNGLSADHPPPPNVKPPKNVPRDFISANWKLPQPILYDVRMGKGYLELPQVDLKLGLLSKTLLDPKHVYLLDSGGELFVWVGEKSARFIRSAGYKLAQELSGLMPRGCFGGAEAELTSKSKDKTAKELREAWSTFSRPPPQVCTQGAEPQIFRAQFVDWEEALAVDFTRTSESVAKRGADLNAILEKDKPTTDLRALFAPRERALEWDESLQLMADWNNELV--EQIGPDLTPVSALQQFIMLDGKWVPVEPQWFGHFFNQDSYIVIARYWDDEEPMEDSEPDGPDEAASDRTKTVVYFWQGRETSDVQWLTFNFSVRKDMETRLS---INPVEGGSPLRVEFKRIHQQQEDLLFLSHFHRQLVIHTGRYQDRLSEARLARTQVYYIRANGNPISTRTVEIKPSGTQLNTHFTYLVKVPKCQLASDESSTDAHVWAWIG--ADAHPDDKALTTTIATRIFFQPETT-IEYLYPGTEPKNFWKCLGGQKPYDRSADFLQYARLFRLSNDQGYFCASEKCSDFCQDDLADEDAMMLDTGDLIYIWWGKKTSDVEQKLSLQAAKLYQKHMSNVQRDRPRKLKLTTKNVEPYQFRRCFHGWGPFREPKDWSG 1376          
BLAST of Protein flightless-1 vs. Ensembl Cavefish
Match: flii (FLII actin remodeling protein [Source:NCBI gene;Acc:103034676])

HSP 1 Score: 850.507 bits (2196), Expect = 0.000e+0
Identity = 543/1308 (41.51%), Postives = 785/1308 (60.02%), Query Frame = 2
Query:  512 SKSVSQFLLGIDLSCVEIKDNDCSEAFSNMTRIQWLKLVSTGLEQIPKGVEKLTQLQRLTISKNNINKLSGDWCTELKALRVFNARKNKLTDDSLPEQLFNNPQLQVVDLSFNLLTEVPAGLVEAKSLLVLNLSDNQIKNVSKDLFANCVSLMILDLSNNQIVGFPTXXXXXXXXXXXXXXXXXXXXXXXRSINGXXXXXXXXXXXXXXXXENIPSDLDKLPCLQDLDISDNNLPKVPQTIYEITSLTKLNLSGNEIDELSGLVDCWPNLEVXXXXXXXXXXXPSFITRLSKLKKLYVDENRLTFNGIPPGIGKLSNLEVFSASENLLENIPEGLCRCGQLKHLNLRMNKLVTLPDAINVLIESLKTFNIENNPNLKMPPKLVEVDLKSKYAFYNIDFSLETQMQLARGAPAKASSKSVTQKHKFTQDTASRIRRLRRKKIDEKSEKGSDSKRVLEGMQKVAKDKD-AIMEDREKEEKLLSAKKWQDAIAKPNLDYSKLFDDDVGIEPGIELWDMDDFYPRRITDELPLGTFFDGDCYIILHTSLDEKSHTSLNHSIYYWIGSQASLDKVTASAVHAVYLRNYLSTNCRCERTEQGDESPEFVALFEGNIIVCEGARGQTGFLKTEDKEHRKKMYRLFGADKSISIYSLDPTPENLDSKFVYLFDESSTRLFLWIGNKSRLMLQTKGRLLADNINQTERKGQSEIITERENSESDEFKNSLQSSSGIDSLDWSNLSSKEVSIDWKPPTPILYDVKLGRGYLEMPQIE---------------LPNGRLVKSLLEAKHVYILDSNGDMFVWIGDMAPKFLKFAGXXXXXXXXXXXXXXXXXXXTVCCQTSEPQIFKMQFADWVDTCAVDFTRSVESVRK----RGVNLXXXXXXXXXXXXXRAFFMPRERPMPLEDAKAIMEDCNEDLVGNNMDSNDGKPFKIKQFVYLNRNWVLVEDKWIGHFFNQDCYIVHAEYWXXXXXXXXXXXXXXXXXX------XSRIQTVIYFWQGREASDIPWLQFNFSLKKEMEIKFSGMDNMSTTKDSFKKVETKRMFQQQEISTFLAHFQHRFVIHLGKYQDRYSDQRKNRIELYYLRENGNALCTRTIEVKPMIAFVNSCFHYIMKIPAAASKTENDQII-CWIGKNSDSHYDEVLQAVAADTFPESSDILTVKEGAEP-GIFWQALGGKKNYDHEAQFMSFSRLFRLSNEQGFFCASEKCSDFCQDDLADEDVMLLDTGSQIYLWFGNRTSDVEKKLSYKAAKLYQEHMARIQPDRIRQLKITQKKKEPHNFRRCFHGWGPFKEA 4351
            +  V  F+ G+DLS  + K     E   +MT ++WLKL  TGL  +P+ +  L +L+ L++S N++  L G+  + L  LR   AR N L +  +P+ +F    L V+DLSFN L+E+P  L  ++++LVLNLS N I N+   LF N   L+ LDLS+N++   P  +RR  +LQ+L L+NNPL  +QLR +  +  L TL L NT R   N+P+ L+ L  L D+D+S N+L +VP+ +Y + SL +LNLS N+I ELS  +D W  LE LNLSRN+L SLPS I +LSKLKKLY++ N+L F+G+P G+GKLSNL  F A+ N LE IPEGLCRCG+LK L L  N+LVTLP+AI+ L   L+  ++  NPNL MPPK V+        +YNIDFSL+ Q++LA  +PA  ++       +   D  +R  RLRR+K    S +   +K+VL+GM  VA++K+ +I E+ + +   L +K+W   + KP LDYS++F +DVG  PG+ +W +++F P ++ DE   G F++ DCYIIL T LD+    +LN  I+YWIG +A+LDK   SA+HAV LRNYL   CR  R E GDES EF A+F+  I   EG    +GF   ED ++  ++YR++G  K+I + S+     +LD +FV+L D +   +++W G  + L   TK RL A+ IN+ ERKG++EI T  +N E  EF   L                K V  D+ P  P LY V LG GYLE+PQI                LP  RL++SLL+ K VYILD   ++F+WIG  +P+ ++ A LKL  EL  +L R          + +E Q+FK +F +W D   VD+TR+ ESV++     G    D  +KD+MK D+ A F+PR+  MPL +A+ +ME+ NEDL G            ++ FV   + +  + ++  GHF  QDCY+    YW   E +D   +    + E          Q V+YFWQGREAS++ WL F FSL+K+ E  F G            K+E  RM QQQE   FL+HF+ +F+IH GK + +  + + +   LY++R NG+ALCTRTI++    + +NS F +I+K+P  +  T+N  I+  W+G+ +D    ++ + +    F ++     + EG EP   FW  +G +K YD +A++M ++RLFR SNE+G+F  SEKCSDFCQDDLAD+D+MLLD G ++Y+W GN+TS VE KLS KA ++Y +HM     +  R+L++ +K  EPH F RCFH W  F+ A
Sbjct:    3 ATGVLPFIRGVDLSGNDFKGGYFPEHVKSMTSLRWLKLNRTGLCYLPEELSSLQKLEHLSVSHNSLTTLHGE-LSSLPNLRAVVARANNLKNSGVPDDIFQLDDLSVLDLSFNQLSEIPRDLENSRNMLVLNLSHNSIDNIPNQLFINLTDLLYLDLSDNKLDSLPPQMRRLVHLQTLILNNNPLMHAQLRQLPAMVALQTLHLRNTQRTQSNMPTSLEGLTNLADVDLSCNDLTRVPECLYSLASLKRLNLSSNQISELSLCIDQWTQLETLNLSRNQLTSLPSAICKLSKLKKLYLNSNKLDFDGVPSGVGKLSNLVEFMAANNNLELIPEGLCRCGKLKKLVLNKNRLVTLPEAIHFL-SDLQVLDVRENPNLVMPPKPVD----RAAEWYNIDFSLQNQLRLAGASPATVAAAGGGNSPR---DPMARKMRLRRRK---DSAQDDQAKQVLKGMSDVAQEKNKSIEENGDLKYSDLKSKRWDKNLEKPPLDYSEIFTEDVGHIPGVSVWQIENFLPVQV-DETFHGKFYEADCYIILKTFLDDNG--ALNWHIFYWIGQEATLDKKAGSAIHAVNLRNYLGAECRTIREEMGDESEEFSAVFDNEISYIEGGTA-SGFYTVEDSQYCTRLYRVYGK-KNIRLESVPLKASSLDPRFVFLLD-TGLDIYVWRGANATLSGTTKARLFAEKINKNERKGKAEITTLMQNQEPPEFWEVLGGQP--------EEIKKHVPDDFSPVRPKLYKVGLGLGYLELPQINYKLSVEHKEKLKLDVLPELRLLQSLLDTKGVYILDCWSEVFIWIGRKSPRLVRAAALKLGQELCGMLHRPKHAVVIRNLEGTECQVFKSKFKNWDDVLRVDYTRNAESVKQADGLSGKVKKDAEQKDQMKADLTALFLPRQPSMPLSEAEQMMEEWNEDLDG------------MEGFVLEGKKFARLPEEEFGHFHTQDCYVFLCRYWVPVEYEDDKEKGKAEEAEDEDKQPEEDFQCVVYFWQGREASNMGWLTFTFSLQKKFESLFPG------------KLEVVRMTQQQENLKFLSHFKRKFIIHKGKRKLKVDNVQPS---LYHIRTNGSALCTRTIQITTDSSNLNSEFCFILKVPFES--TDNQGIVYTWVGRAADPDEAKLAEDIMNSMFDDTYSKQVINEGEEPENFFWVGIGSQKQYDEDAEYMKYARLFRCSNEKGYFSVSEKCSDFCQDDLADDDIMLLDNGKEVYMWVGNQTSQVEIKLSLKACQVYIQHMRSKDAEHPRKLRLVRKGNEPHCFTRCFHAWSTFRTA 1255          
BLAST of Protein flightless-1 vs. Ensembl Cavefish
Match: flii (FLII actin remodeling protein [Source:NCBI gene;Acc:103034676])

HSP 1 Score: 686.797 bits (1771), Expect = 0.000e+0
Identity = 469/1331 (35.24%), Postives = 697/1331 (52.37%), Query Frame = 2
Query:  512 SKSVSQFLLGIDLSCVEIKDNDCSEAFSNMTRIQWLKLVSTGLEQIPKGVEKLTQLQRLTISKNNINKLSGDWCTELKALRVFNARKNKLTDDSLPEQLFNNPQLQVVDLSFNLLTEVPAGLVEAKSLLVLNLSDNQIKN--VSKDLFANCVSLMILDLSNNQIVGFPTXXXXXXXXXXXXXXXXXXXXXXXRSINGXXXXXXXXXXXXXXXXENIPSDLDKLPCLQDLDISDNNLPKVPQTIY-EITSLTKLNLSGNEIDELSGLVDCWPNLEVXXX-----XXXXXXXXPSFITRLSKLKKLYVDENRLTFNGIPPGIGKLSNLEV---------------FSASENLLENIPEGLCRCGQLKHLNLRMNKLVTLPDAINVLIESLKTFNIENNPNLKMPPKLVEVDLKSKYAFYNIDFSLETQMQLARGAPAKASSKSVTQKHKFTQDTASRIRRLRRKKIDEKSEKGSDSKRVLEGMQKVAKDKD-AIMEDREKEEKLLSAKKWQDAIAKPNLDYSKLFDDDVGIEPGIELWDMDDFYPRRITDELPLGTFFDGDCYIILHTSLDEKSHTSLNHSIYYWIGSQASLDKVTASAVHAVYLRNYLSTNCRCERTEQGDESPEFVALFEGNIIVCEGARGQTGFLKTEDKEHRKKMYRLFGADKSISIYSLDPTPENLDSKFVYLFDESSTRLFLWIGNKSRLMLQTKGRLLADNINQTERKGQSEIITERENSESDEFKNSLQSSSGIDSLDWSNLSSKEVSIDWKPPTPILYDVKLGRGYLEMPQIE---------------LPNGRLVKSLLEAKHVYILDSNGDMFVWIGDMAPKFLKFAGXXXXXXXXXXXXXXXXXXXTVCCQTSEPQIFKMQFADWVDTCAVDFTRSVESVRK----RGVNLXXXXXXXXXXXXXRAFFMPRERPMPLEDAKAIMEDCNEDLVGNNMDSNDGKPFKIKQFVYLNRNWVLVEDKWIGHFFNQDCYIVHAEYWXXXXXXXXXXXXXXXXXX------XSRIQTVIYFWQGREASDIPWLQFNFSLKKEMEIKFSGMDNMSTTKDSFKKVETKRMFQQQEISTFLAHFQHRFVIHLGKYQDRYSDQRKNRIELYYLRENGNALCTRTIEVKPMIAFVNSCFHYIMKIPAAASKTENDQII-CWIGKNSDSHYDEVLQAVAADTFPESSDILTVKEGAEP-GIFWQALGGKKNYDHEAQFMSFSRLFRLSNEQGFFCASEKCSDFCQDDLADEDVMLLDTGSQIYLWFGNRTSDVEKKLSYKAAKLYQEHMARIQPDRIRQLKITQKKKEPHNFRRCFHGWGPFKEA 4351
            +  V  F+ G+DLS  + K     E   +MT ++WLKL  TGL                              C                    LPE+L +  +L+ + +S N LT +   L    +L  +    N +KN  V  D+F     L +LDLS NQ+                                                   IP DL+    +  L++S N++  +P  ++  +T L  L+LS N++D L   +    +L+ L L        +L  LP+ +     L+ L++   + T + +P  +  L+NL V               +  + N LE IPEGLCRCG+LK L L  N+LVTLP+AI+ L   L+  ++  NPNL MPPK V+        +YNIDFSL+ Q++LA  +PA  ++       +   D  +R  RLRR+K    S +   +K+VL+GM  VA++K+ +I E+ + +   L +K+W   + KP LDYS++F +DVG  PG+ +W +++F P ++ DE   G F++ DCYIIL T LD+    +LN  I+YWIG +A+LDK   SA+HAV LRNYL   CR  R E GDES EF A+F+  I   EG    +GF   ED ++  ++YR++G  K+I + S+     +LD +FV+L D +   +++W G  + L   TK RL A+ IN+ ERKG++EI T  +N E  EF   L                K V  D+ P  P LY V LG GYLE+PQI                LP  RL++SLL+ K VYILD   ++F+WIG  +P+ ++ A LKL  EL  +L R          + +E Q+FK +F +W D   VD+TR+ ESV++     G    D  +KD+MK D+ A F+PR+  MPL +A+ +ME+ NEDL G            ++ FV   + +  + ++  GHF  QDCY+    YW   E +D   +    + E          Q V+YFWQGREAS++ WL F FSL+K+ E  F G            K+E  RM QQQE   FL+HF+ +F+IH GK + +  + + +   LY++R NG+ALCTRTI++    + +NS F +I+K+P  +  T+N  I+  W+G+ +D    ++ + +    F ++     + EG EP   FW  +G +K YD +A++M ++RLFR SNE+G+F  SEKCSDFCQDDLAD+D+MLLD G ++Y+W GN+TS VE KLS KA ++Y +HM     +  R+L++ +K  EPH F RCFH W  F+ A
Sbjct:    3 ATGVLPFIRGVDLSGNDFKGGYFPEHVKSMTSLRWLKLNRTGL------------------------------CY-------------------LPEELSSLQKLEHLSVSHNSLTTLHGELSSLPNLRAVVARANNLKNSGVPDDIF-QLDDLSVLDLSFNQL-------------------------------------------------SEIPRDLENSRNMLVLNLSHNSIDNIPNQLFINLTDLLYLDLSDNKLDSLPPQMRRLVHLQTLILNNNPLMHAQLRQLPAMVA----LQTLHLRNTQRTQSNMPTSLEGLTNLAVVRVPWVYPCLILDQLYIHTNNNLELIPEGLCRCGKLKKLVLNKNRLVTLPEAIHFL-SDLQVLDVRENPNLVMPPKPVD----RAAEWYNIDFSLQNQLRLAGASPATVAAAGGGNSPR---DPMARKMRLRRRK---DSAQDDQAKQVLKGMSDVAQEKNKSIEENGDLKYSDLKSKRWDKNLEKPPLDYSEIFTEDVGHIPGVSVWQIENFLPVQV-DETFHGKFYEADCYIILKTFLDDNG--ALNWHIFYWIGQEATLDKKAGSAIHAVNLRNYLGAECRTIREEMGDESEEFSAVFDNEISYIEGGTA-SGFYTVEDSQYCTRLYRVYGK-KNIRLESVPLKASSLDPRFVFLLD-TGLDIYVWRGANATLSGTTKARLFAEKINKNERKGKAEITTLMQNQEPPEFWEVLGGQP--------EEIKKHVPDDFSPVRPKLYKVGLGLGYLELPQINYKLSVEHKEKLKLDVLPELRLLQSLLDTKGVYILDCWSEVFIWIGRKSPRLVRAAALKLGQELCGMLHRPKHAVVIRNLEGTECQVFKSKFKNWDDVLRVDYTRNAESVKQADGLSGKVKKDAEQKDQMKADLTALFLPRQPSMPLSEAEQMMEEWNEDLDG------------MEGFVLEGKKFARLPEEEFGHFHTQDCYVFLCRYWVPVEYEDDKEKGKAEEAEDEDKQPEEDFQCVVYFWQGREASNMGWLTFTFSLQKKFESLFPG------------KLEVVRMTQQQENLKFLSHFKRKFIIHKGKRKLKVDNVQPS---LYHIRTNGSALCTRTIQITTDSSNLNSEFCFILKVPFES--TDNQGIVYTWVGRAADPDEAKLAEDIMNSMFDDTYSKQVINEGEEPENFFWVGIGSQKQYDEDAEYMKYARLFRCSNEKGYFSVSEKCSDFCQDDLADDDIMLLDNGKEVYMWVGNQTSQVEIKLSLKACQVYIQHMRSKDAEHPRKLRLVRKGNEPHCFTRCFHAWSTFRTA 1176          
BLAST of Protein flightless-1 vs. Ensembl Cavefish
Match: scinla (gelsolin-like [Source:NCBI gene;Acc:103039625])

HSP 1 Score: 188.734 bits (478), Expect = 4.333e-49
Identity = 195/780 (25.00%), Postives = 320/780 (41.03%), Query Frame = 2
Query: 2018 VGIEPGIELWDMDDFYPRRITDELPLGTFFDGDCYIILHTSLDEKSHTSLNHSIYYWIGSQASLDKVTASAVHAVYLRNYLSTNCRCERTEQGDESPEFVALFEGNIIVCEGARGQTGFLKTEDKEHRKKMYRLFGADKSISIYSLDPTPENLDSKFVYLFDESSTRLFLWIGNKSRLMLQTKGRLLADNINQTERKGQSEIITERENSESDEFKNSLQSSSGIDSLDWSNLSSKEVSIDWKPPTPILYDVKLGRGYLEMPQIELPNGRLVKSLLEAKHVYILDSNGD--MFVWIGDMAPKFLKFAGXXXXXXXXXXXXXXXXXXXTVCCQTSEPQIFKMQFADWVDTCAVDFTRSVESVRKRGVNLXXXXXXXXXXXXXRAFFMPRERPMPLEDAKAIMEDCNEDLVGNNMDSNDGKPFKIKQFVYLNRNWVLVEDKWIGHFFNQDCYIVHAEYWXXXXXXXXXXXXXXXXXXXSRIQTVIYFWQGREASDIPWLQFNFSLKKEMEIKFSGMDNMSTTKDSFKKVETKRMFQQQEISTFLAHFQHR-FVIHLGKYQDRYSDQRKNRIELYYLRENGNALCTRTIEVKPMIAFVNSCFHYIMKIPAAASKTENDQIICWIGKNSDSHYDEVLQAVAADTFPESSDILTVKEGAEPGIFWQALGGKKNYDHEAQF---MSFSRLFRLSNEQGFFCASEKCSDFCQDDLADEDVMLLDTGSQIYLWFGNRTSDVEKKLSYKAAKLYQEHMARIQPDRIRQLKITQKKK--EPHNFRRCFHGW 4333
             G EPG+++W ++    + +  +L  G F+ GD YI+L+T+       + ++SI+ W+G++ S D+  A+A+ A  L ++L       R  Q +ES  F+  F+  I   +G    +GF      +   K        ++I    +  T  + +    ++ D     ++ W G++     + K   +A +I   ER G++ +    + SE     + L     I +         + ++D       LY V    G +    +   +    + +L     YILD+  D  +FVW G  A    + A +K A + +            V     E  +FK  F++W D          E     G                +A+ + R   +P     A     N+ +   +   +DG   K++ +     + VLV+   +G F+  DCY++   Y                  +  R Q +IY WQGR+ +     Q   +    + +K    D+M  +          R+ Q QE    ++ F+ +  +I LG    +    R     L+++R++ +   TR +EV P  A +N+   +++K P        D +  W G  +    +E+  A    TF   S    V EG EP  FW ALGGKK Y   +     +   RLF  SN+ G     E   DF Q DLA +DVMLLDT SQI+LW GN  ++VEK  S K AK Y +      P   R   IT  K+  EP  F   F  W
Sbjct:   10 AGKEPGLQVWRVEKMDLKPVPKQL-YGNFYTGDAYILLYTT------AAPSYSIHMWLGNECSQDESGAAAIFATQLDDFLGGGPVQFREVQNNESLAFLGYFKSGIKYKQGGVA-SGFQHVVTNDMNVKRLLHVKGRRAIRATEVPLTWASFNRGDCFIIDLGKD-IYQWCGSECNRFERLKASQVAIDIRDNERNGRARLQMVEDGSEPQAITDVLGPRPNIPAG-----RPDDEAVDKANRKGSLYMVSDAAGSMRASLVAQ-SSPFKQEMLSPSECYILDNGIDSKIFVWKGPTANAAERKAAMKAAEQFIREKNYPKNTQIQVMPAGGETTLFKQFFSNWKDK---------EQTTGPG----------------KAYSIGRIAQVPQIPFNAASLHSNKAMAAQHGMVDDGSG-KVQVWRVEGGDKVLVDSSTLGQFYGGDCYLILYSY-----------------HQGGREQHIIYTWQGRKCT-----QDELAASAFLTVKLD--DSMGGSPVQV------RVSQGQEPPHLMSLFKGKPMMIFLGGTSRKGGQSRTGSTRLFHIRQS-STRATRAVEVDPTAANLNTNDVFVLKSP--------DSMFLWRGHGATE--EELAAAKFVCTFLGGS-ASEVIEGKEPAAFWSALGGKKEYQTSSSLQKTVKPPRLFGCSNKTGRLIVEEVPGDFSQADLATDDVMLLDTWSQIFLWIGNEANEVEKSGSAKIAKDYVDS----DPAGRRGTPITTIKQGFEPPTFTGWFQAW 702          
BLAST of Protein flightless-1 vs. Ensembl Cavefish
Match: scinla (gelsolin-like [Source:NCBI gene;Acc:103039625])

HSP 1 Score: 188.348 bits (477), Expect = 6.435e-49
Identity = 195/780 (25.00%), Postives = 320/780 (41.03%), Query Frame = 2
Query: 2018 VGIEPGIELWDMDDFYPRRITDELPLGTFFDGDCYIILHTSLDEKSHTSLNHSIYYWIGSQASLDKVTASAVHAVYLRNYLSTNCRCERTEQGDESPEFVALFEGNIIVCEGARGQTGFLKTEDKEHRKKMYRLFGADKSISIYSLDPTPENLDSKFVYLFDESSTRLFLWIGNKSRLMLQTKGRLLADNINQTERKGQSEIITERENSESDEFKNSLQSSSGIDSLDWSNLSSKEVSIDWKPPTPILYDVKLGRGYLEMPQIELPNGRLVKSLLEAKHVYILDSNGD--MFVWIGDMAPKFLKFAGXXXXXXXXXXXXXXXXXXXTVCCQTSEPQIFKMQFADWVDTCAVDFTRSVESVRKRGVNLXXXXXXXXXXXXXRAFFMPRERPMPLEDAKAIMEDCNEDLVGNNMDSNDGKPFKIKQFVYLNRNWVLVEDKWIGHFFNQDCYIVHAEYWXXXXXXXXXXXXXXXXXXXSRIQTVIYFWQGREASDIPWLQFNFSLKKEMEIKFSGMDNMSTTKDSFKKVETKRMFQQQEISTFLAHFQHR-FVIHLGKYQDRYSDQRKNRIELYYLRENGNALCTRTIEVKPMIAFVNSCFHYIMKIPAAASKTENDQIICWIGKNSDSHYDEVLQAVAADTFPESSDILTVKEGAEPGIFWQALGGKKNYDHEAQF---MSFSRLFRLSNEQGFFCASEKCSDFCQDDLADEDVMLLDTGSQIYLWFGNRTSDVEKKLSYKAAKLYQEHMARIQPDRIRQLKITQKKK--EPHNFRRCFHGW 4333
             G EPG+++W ++    + +  +L  G F+ GD YI+L+T+       + ++SI+ W+G++ S D+  A+A+ A  L ++L       R  Q +ES  F+  F+  I   +G    +GF      +   K        ++I    +  T  + +    ++ D     ++ W G++     + K   +A +I   ER G++ +    + SE     + L     I +         + ++D       LY V    G +    +   +    + +L     YILD+  D  +FVW G  A    + A +K A + +            V     E  +FK  F++W D          E     G                +A+ + R   +P     A     N+ +   +   +DG   K++ +     + VLV+   +G F+  DCY++   Y                  +  R Q +IY WQGR+ +     Q   +    + +K    D+M  +          R+ Q QE    ++ F+ +  +I LG    +    R     L+++R++ +   TR +EV P  A +N+   +++K P        D +  W G  +    +E+  A    TF   S    V EG EP  FW ALGGKK Y   +     +   RLF  SN+ G     E   DF Q DLA +DVMLLDT SQI+LW GN  ++VEK  S K AK Y +      P   R   IT  K+  EP  F   F  W
Sbjct:   31 AGKEPGLQVWRVEKMDLKPVPKQL-YGNFYTGDAYILLYTT------AAPSYSIHMWLGNECSQDESGAAAIFATQLDDFLGGGPVQFREVQNNESLAFLGYFKSGIKYKQGGVA-SGFQHVVTNDMNVKRLLHVKGRRAIRATEVPLTWASFNRGDCFIIDLGKD-IYQWCGSECNRFERLKASQVAIDIRDNERNGRARLQMVEDGSEPQAITDVLGPRPNIPAG-----RPDDEAVDKANRKGSLYMVSDAAGSMRASLVAQ-SSPFKQEMLSPSECYILDNGIDSKIFVWKGPTANAAERKAAMKAAEQFIREKNYPKNTQIQVMPAGGETTLFKQFFSNWKDK---------EQTTGPG----------------KAYSIGRIAQVPQIPFNAASLHSNKAMAAQHGMVDDGSG-KVQVWRVEGGDKVLVDSSTLGQFYGGDCYLILYSY-----------------HQGGREQHIIYTWQGRKCT-----QDELAASAFLTVKLD--DSMGGSPVQV------RVSQGQEPPHLMSLFKGKPMMIFLGGTSRKGGQSRTGSTRLFHIRQS-STRATRAVEVDPTAANLNTNDVFVLKSP--------DSMFLWRGHGATE--EELAAAKFVCTFLGGS-ASEVIEGKEPAAFWSALGGKKEYQTSSSLQKTVKPPRLFGCSNKTGRLIVEEVPGDFSQADLATDDVMLLDTWSQIFLWIGNEANEVEKSGSAKIAKDYVDS----DPAGRRGTPITTIKQGFEPPTFTGWFQAW 723          
BLAST of Protein flightless-1 vs. Ensembl Cavefish
Match: vil1 (villin 1 [Source:NCBI gene;Acc:103028195])

HSP 1 Score: 188.734 bits (478), Expect = 1.576e-48
Identity = 192/793 (24.21%), Postives = 326/793 (41.11%), Query Frame = 2
Query: 2030 PGIELWDMDDFYPRRITDELPLGTFFDGDCYIILHTSLDEKSHTSLNHSIYYWIGSQASLDKVTASAVHAVYLRNYLSTNCRCERTEQGDESPEFVALFEGNIIVCEGARGQTGFLKTEDKEHRKKMYRLFGADKSISIYSLDPTPENLDSKFVYLFDESSTRLFLWIGNKSRLMLQTKGRLLADNINQTERKGQSEIITERENSESDEFKNSLQSSSGIDSLDWSNLSSKEVSIDWKPPTPI-LYDVKLGRGYLEMPQIELPNGRLVKSLLEAKHVYILDSNG-DMFVWIGDMAPKFLKFAGXXXXXXXXXXXXXXXXXXXTVCCQTSEPQIFKMQFADWVDTCAVDFTRSVESVRKRGVNLXXXXXXXXXXXXXRAFFMPRERPMPLEDAKAIMEDCNEDLVGNNMDSNDGKPFKIKQFVYLNRNWVLVEDKWIGHFFNQDCYIVHAEYWXXXXXXXXXXXXXXXXXXXSRIQTVIYFWQGREASDIPWLQFNFSLKKEMEIKFSGMDNMSTTKDSFKKVETKRMFQQQEISTFLAHFQHRFVIHLGKYQDRYSDQRKNRIELYYLRENGNALCTRTIEVKPMIAFVNSCFHYIMKIPAAASKTENDQIICWIGKNSDSHYDEVLQAVAADTFPESSDILT------VKEGAEPGIFWQALGGKKNYD-----HEAQFMSFSRLFRLSNEQGFFCASEKCSDFCQDDLADEDVMLLDTGSQIYLWFGNRTSDVEKKLSYKAAKLY-QEHMARIQPDRIRQLKITQKKKEPHNFRRCFHGWGPFKEAMDWSG 4366
            PG+++W +++        +   G FF+GD Y+ L+T   +K+ +S ++ I++W+G + S+D+  A+A++   + ++L       R  QG ESP F+  F+  II  +G    +G  + E      +        K++    +D +  + +   V+L D  +  +  W G +S  M + KG  LA +I   ER G+++++    + E+   K        +           +  +D K  + I L+ +    G L + ++ +    L + LL  +  Y+LD  G  +FVW G  + K  +   L  A    +                SE  +FK  F  W             +V+ + V +       K+    +  F          D  ++      DL       +DG   + + +   N   V V+ KW+GHF+  DCY++   Y                 E + +   ++Y WQGR AS               E+  S    +   +    +    R+   +E    +A F+ R V++        S   +  + L+++    N   TR  EV P  A +NS   +++  P             W GK       E+ +++A        DI++      + EG EP  FW  LGGK  Y       E       RLF  SN+ G F A+E  ++F QDDL + DVMLLD   Q++LW GN ++D EKK +  +A+ Y + H A   PD    + + ++  EP  F   FH W P      WSG
Sbjct:   19 PGLQIWRVENMELVPCPSKT-YGQFFEGDSYVTLYT---QKTSSSYSYDIHFWLGKETSVDEQGAAAIYTTLMDDHLGGVAVQHREAQGYESPTFLGYFKNGIIYKKGGVA-SGMKQVETNVSDVRRLLHVKGKKNVVAGEVDMSWNSFNKGDVFLLDLGNG-IIQWNGPQSNRMERLKGMNLAKDIRDRERGGRAQVVVVEGDDEASSPKAMEVMMKFLGERREIKDPIPDEVVDEKLKSSIKLFHISDASGNLVVKEVAVK--PLTQDLLNQEDCYLLDQGGIRIFVWKGRKSSKKERSEALDKAEAYKKAKGYPPSTYVETVNDGSESSVFKQLFQKW-------------TVKGQTVGMGTTHSPGKIAKVEQVKF----------DVTSM--HARPDLAAQYKMVDDGTG-EAETWRIENNEPVPVDRKWLGHFYGGDCYLILYTY-----------------EVSGKKHYLLYIWQGRHAST-------------AELTASAYQAVILDQKYNGEPVQVRVPMGKEPMHLMAIFKGRMVVYEDGSSRGDSTYVQPTVRLFHVH-GSNEFNTRATEVPPRSASLNSNDVFVLSTPTCC--------YLWYGKGCSGDEREMSKSLA--------DIISKREKQVIAEGQEPADFWVQLGGKSQYASGKRLQEENLQITPRLFECSNKTGTFIATE-IANFNQDDLDESDVMLLDVWDQVFLWIGNGSNDTEKKEAVLSAQEYLKSHPAGRDPD--TPILVVKQSFEPPTFTGWFHAWDPSL----WSG 723          

HSP 2 Score: 71.633 bits (174), Expect = 5.826e-12
Identity = 81/314 (25.80%), Postives = 142/314 (45.22%), Query Frame = 2
Query: 1976 AKPNLDYS-KLFDDDVGIEPGIELWDMDDFYPRRITDELPLGTFFDGDCYIILHT-SLDEKSHTSLNHSIYYWIGSQASLDKVTASAVHAVYLRNYLSTNCRCERTEQGDESPEFVALFEGNIIVCE--GARGQTGFLKTEDKEHRKKMYRLFGADK-SISIYSLDPTPENLDSKFVYLFDESSTRLFLWIGNKSRLMLQTKGRLLADNINQTERKGQSEIITERENSESDEFKNSLQSSSGIDSLDWSNLSSKEVSIDWKPPTPILYDVKLGRGYLEMPQIELPNGRLVKSLLEAKHVYILDSNGDMFVWIGD 2902
            A+P+L    K+ DD  G     E W +++  P  + D   LG F+ GDCY+IL+T  +  K H    + +Y W G  AS  ++TASA  AV L    +      R   G E    +A+F+G ++V E   +RG + +++        +++ + G+++ +     + P   +L+S  V++   + T  +LW G       +   + LAD I++ E+    ++I E +  E  +F   L   S   S     L  + + I     TP L++     G     +I        +  L+   V +LD    +F+WIG+
Sbjct:  384 ARPDLAAQYKMVDDGTG---EAETWRIENNEPVPV-DRKWLGHFYGGDCYLILYTYEVSGKKH----YLLYIWQGRHASTAELTASAYQAVILDQKYNGEPVQVRVPMGKEPMHLMAIFKGRMVVYEDGSSRGDSTYVQP-----TVRLFHVHGSNEFNTRATEVPPRSASLNSNDVFVLS-TPTCCYLWYGKGCSGDEREMSKSLADIISKREK----QVIAEGQ--EPADFWVQLGGKSQYAS--GKRLQEENLQI-----TPRLFECSNKTGTFIATEI----ANFNQDDLDESDVMLLDVWDQVFLWIGN 666          
BLAST of Protein flightless-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008894.1 (pep scaffold:Pmarinus_7.0:GL484493:7018:36468:1 gene:ENSPMAG00000008055.1 transcript:ENSPMAT00000008894.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 421.779 bits (1083), Expect = 1.116e-131
Identity = 277/657 (42.16%), Postives = 404/657 (61.49%), Query Frame = 2
Query:  512 SKSVSQFLLGIDLSCVEIKDNDCSEAFSNMTRIQWLKLVSTGLEQIPKGVEKLTQLQRLTISKNNINKLSGDWCTELKALRVFNARKNKLTDDSLPEQLFNNPQLQVVDLSFNLLTEVPAGLVEAKSLLVLNLSDNQIKNVSKDLFANCVSLMILDLSNNQIVGFPTXXXXXXXXXXXXXXXXXXXXXXXRSINGXXXXXXXXXXXXXXXXENIPSDLDKLPCLQDLDISDNNLPKVPQTIYEITSLTKLNLSGNEIDELSGLVDCWPNLEVXXXXXXXXXXXPSFITRLSKLKKLYVDENRLTFNGIPPGIGKLSNLEVFSASENLLENIPEGLCRCGQLKHLNLRMNKLVTLPDAINVLIESLKTFNIENNPNLKMPPKLVEVDLKSKYAFYNIDFSLETQMQLARGAPAKASSKSVTQKHKFTQDTASRIRRLRRKKIDEKSEKGSDSKRVLEGMQKVAKDKD-AIMEDREKEEKLLSAKKWQDAIAKPNLDYSKLFDDDVGIEPGIELWDMDDFYPRRITDELPLGTFFDGDCYIILHTSLDEKSHTSLNHSIYYWIGSQASLDKVTASAVHAVYLRNYLSTNCRCERTEQGDESPEFVALFEGNIIVCEGARGQTGFLKTEDKEHRKKMYRLFGADKSISIYSLDPTPENLD 2479
            S  V  F+ GIDLS  + K  +  E    M+ ++WLKL  TGL  +P+ +  L +L+ L++S N +  L  D  T L  LR   AR N+LT+  +P  +FN   L V+DLS N LTEVP  L  AK++LVLNLS N I+ +   LF N   ++ LDLSNN++   P  +RR  +LQ+L L+NNPL  +QLR +  +  L TL + NT R L N+P+ L+ L  L D+D+S N L +VP+ +Y +++L +LNLS N I ELS  +D W  L+ LNLSRN+L SLPS I++L+KL+KL+V+ NRL F GIP  + KL NLE F A++N LE IPE LCRC +LK L L  N+L+TLP+ ++ L + L+  ++  NPNL MPPK  +         YNIDFSL+ Q++LA  +PA  ++    Q  K        + R  R +    S +   +K+VL+GM  VA DK+  + E  +     + +++W + +AKP LDYS++F +DVG  PG+ +W +++F P ++T+E   G F+D DCYI+L T +DE    ++   IYYWIG++A+LDK   +A+HAV LRN+L    R +R E  DES EF+A+F+G+I   EG    +GF   E+  H  ++YR  G  +SI + ++     +LD
Sbjct:    3 STGVLPFVRGIDLSGNDFKGGNFPERIGAMSSLRWLKLNHTGLSYLPEELAVLQKLEHLSVSHNQLTTLHSD-ITALPCLRAIVARANQLTNPGVPPDIFNLEDLSVLDLSHNQLTEVPNELENAKNMLVLNLSHNSIETIPTQLFINLTDVLYLDLSNNRLDSLPPQMRRLVHLQTLMLNNNPLLHAQLRQLTAMTALETLHMRNTQRTLSNLPTQLEALTHLADVDLSHNELARVPECLYTLSALRRLNLSDNHITELSLCMDQWTQLQTLNLSRNQLTSLPSSISKLAKLRKLFVNSNRLDFEGIPSSVWKLGNLEQFVAADNNLELIPESLCRCAKLKKLVLNKNRLITLPELVHYLTD-LEVLDVRENPNLVMPPKPAD----RSENLYNIDFSLQNQLRLAGASPAAIAAAGGGQPAK------DHVARKLRLRRRRDSSQDDQAKQVLKGMSDVAHDKNKTLAEGGDVRYTEVKSRRWDEGLAKPQLDYSEIFTEDVGQIPGVSVWHIENFVP-QLTEEYYHGKFYDADCYIVLRTFIDENG--AIAWEIYYWIGAKATLDKKACAAIHAVNLRNFLGAEGRSQREEMDDESEEFLAVFDGSISYIEGGTS-SGFFTVEENAHIIRLYRCHGT-QSIHLEAVALKGSSLD 642          
BLAST of Protein flightless-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002072.1 (pep scaffold:Pmarinus_7.0:GL481283:15294:22438:1 gene:ENSPMAG00000001882.1 transcript:ENSPMAT00000002072.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 202.986 bits (515), Expect = 1.256e-57
Identity = 160/370 (43.24%), Postives = 228/370 (61.62%), Query Frame = 2
Query:  512 SKSVSQFLLGIDLSCVEIKDNDCSEAFSNMTRIQWLKLVSTGLEQIPKGVEKLTQLQRLTISKNNINKLSGDWCTELKALRVFNARKNKLTDDSLPEQLFNNPQLQVVDLSFNLLTEVPAGLVEAKSLL---------VLNLSDNQIKNVSKDLFANCVSLMILDLSNNQIVGFPTXXXXXXXXXXXXXXXXXXXXXXXRSINGXXXXXXXXXXXXXXXXENIPSDLDKLPCLQDLDISDNNLPKVPQTIYEITSLTKLNLSGNEIDELSGLVDCWPNLEVXXXXXXXXXXXPSFITRLSKLKKLYVDENRLTFNGIPPGIGKLSNLEVFSASENLLENIPEGLCRCGQLKHLNLRMNKLVTLPDAINVL 1594
            S  V  F+ G+DLS    K     E+  +M+ ++WLKL  TGL  +P+ + KL +L+ L++S N+IN L G+  + L  LR   AR N L +  +P  +F     Q+ DLS  L  +  + L   +S L         +++ S +   ++   LF N   L+ LDLSNN++   P  +RR  +LQ+L L+NNPL  +QLR +  L KL TL L NT R   N+P+ LD L  L D+D+S N++P +P+ +Y +++L +LNLS N+I E+S  +D W N+E LNLSRN+L  LP  + +LSKL+KL+++ NRL F GIP GIGKL NLE FSA+ N LE IPEGLCRC +LK L L  N LVTLP+ ++ L
Sbjct:    4 STGVLPFVRGVDLSGNSFKGGYFPESVEDMSSLRWLKLNHTGLCYLPEELGKLEKLEYLSVSHNSINTLHGE-ISHLPCLRAIVARANNLKNSGVPNDIF-----QLEDLSVLLTLKNNSTLKCLQSWLAWLIIIIIVMIHGSCSIGPSLHSQLFINITDLLYLDLSNNRLQSLPPQMRRLVHLQTLILNNNPLQHAQLRQLPALTKLQTLHLRNTQRSPNNMPASLDALSHLTDVDLSCNDMPSIPECLYALSTLRRLNLSDNQISEMSLCMDHWTNMETLNLSRNKLTMLPMAVCKLSKLRKLFINSNRLNFEGIPSGIGKLQNLEQFSAANNSLELIPEGLCRCRKLKKLILNKNCLVTLPETVHFL 367          
BLAST of Protein flightless-1 vs. Ensembl Sea Lamprey
Match: avil (advillin [Source:ZFIN;Acc:ZDB-GENE-060421-6683])

HSP 1 Score: 176.407 bits (446), Expect = 2.846e-45
Identity = 202/797 (25.35%), Postives = 317/797 (39.77%), Query Frame = 2
Query: 2033 GIELWDMDDFYPRRITDELPLGTFFDGDCYIILHTSLDEKSHTSLNHSIYYWIGSQASLDKVTASAVHAVYLRNYLSTNCRCERTEQGDESPEFVALFEGNIIVCEGARGQTGFLKTEDKEHRKKMYRLFGADKSISIYSLDPTPENLDSKFVYLFDESSTRLFLWIGNKSRLMLQTKGRLLADNINQTERKGQSEIITERENSE--SDEFKNSLQSSSGIDSLDWSNLSSKEVSIDWKPPTPILYDVKLGRGYLEMPQIELPNGRLVKSLLEAKHVYILDSNG-DMFVWIGDMAPKFLKFAGXXXXXXXXXXXXXXXXXXXTVCCQTSEPQIFKMQFADWVDTCAVDFTRSVESVRKRGVNLXXXXXXXXXXXXXRAFFMPRE-RPMPLEDAKAIMEDCNEDLVGNNMDSNDGKPFKIKQFVYLNRNWVLVEDKWIGHFFNQDCYIVHAEYWXXXXXXXXXXXXXXXXXXXSRIQTVIYFWQGREASDIPWLQFNFSLKKEMEIKFSGMDNMSTTKDSFKKVETKRMFQQQEISTFLAHFQHRFVIHLGKYQDRYSDQRKNRI--------ELYYLRENGNALCTRTIEVKPMIAFVNSCFHYIMKIPAAASKTENDQIIC--WIGKNSDSHYDEVLQAVAADTFPESSDILTVKEGAEPGIFWQALGGKKNYDHEAQFMS-----FSRLFRLSNEQGFFCASEKCSDFCQDDLADEDVMLLDTGSQIYLWFGNRTSDVEKKLSYKAAKLY-QEHMARIQPDRIRQLKITQKKKEPHNFRRCFHGWGPFKEAMDWS 4363
            G+ +W ++      +  +   G+FF+GDCYIIL       S T   + ++YW+G ++S D+  A+A++   L + L       R  QG ES  F   F+  ++  +G    +GF  TE   +  +        K+++   ++ + ++     V+L D     +  W G  S  + + KG  LA +I   ER G+++I     N E  S E    L ++ G    D S  S  E +   +     LY V    G L +   E+    L + LL     YILD  G  ++VW G  + K  + A +K A   ++        +       +E  IFK  F  W +             R +   +       K+    +  F P      P   A+  M D           S   + F+I+           VE +  G F+  DCY+V   Y                    +++  ++Y WQGR A+             + E+  S    ++  +    +    R+   +E   FLA F  + +I+    Q   S    N I         L+ +R   +   T+ +EV    + +NS   +++          N ++ C  W GK       E+ +++A        D  TV EG EP  FW ALGGK  Y  E +          RLF  S + G F  +E  SDF QDDL ++DVMLLDT  Q++LW G   SD EKK S   A  Y + H     PD    + I ++  EP  F   F  W    +A  WS
Sbjct:   13 GLHIWRVEKMELAAVPQKA-YGSFFEGDCYIILSAKKAGSSPTP-TYDVHYWVGQESSQDEQAAAAMYTTQLDDALGGFPVQHREYQGHESEVFRGYFKSGVVYKKGGVA-SGFHHTETNSYNVQRLLHIKGRKAVTATEVNLSWDSFSRGDVFLLDLGKV-IIQWNGPDSNRVEKIKGMQLASDIRDRERGGRAQIGVVEGNDEDSSPELMAVLTAALGERHGDLSPGSPDEPTDHSRKANVKLYHVSEKGGNLMVE--EVATRPLTQDLLNHDDCYILDQGGIKIYVWKGRGSSKEERQAAMKRALGYIKAKGYPVSTNVETVADGAESAIFKQLFQHWTE-------------RGQTQGMGKTYTVGKIARVEQVKFDPTVLHAKPEVAAQHRMVDDG---------SGTAEMFRIEDL-----ELKPVEKRLHGQFYGGDCYLVLYTY-----------------TSNNKLAYLLYMWQGRHAT-------------QDEVAASAYQAVALDQKYGGEPVQVRVVMGKEPKHFLAIFHGKLIIYEMVAQGGTSRAGGNDIGGAAPPTTRLFQVRGT-DEFNTKAVEVPARASALNSNDVFVL----------NAEVACFLWCGKGCSGDEREMARSLADGL--TRRDKQTVLEGQEPPEFWAALGGKAPYASEKRMQVEEAEVQPRLFECSTQTGRFVVTE-ISDFSQDDLDEDDVMLLDTWDQVFLWVGQGASDAEKKESMTTAADYLRTHPGARDPD--TPIIIVKQGFEPPTFTGWFLAW----DAHKWS 726          

HSP 2 Score: 74.3294 bits (181), Expect = 1.566e-13
Identity = 77/318 (24.21%), Postives = 135/318 (42.45%), Query Frame = 2
Query: 1976 AKPNLDYS-KLFDDDVGIEPGIELWDMDDFYPRRITDELPLGTFFDGDCYIILHTSLDEKSHTSLNHSIYYWIGSQASLDKVTASAVHAVYLRNYLSTNCRCERTEQGDESPEFVALFEGNIIVCEG-ARGQTGFLKTED----KEHRKKMYRLFGADK-SISIYSLDPTPENLDSKFVYLFDESSTRLFLWIGNKSRLMLQTKGRLLADNINQTERKGQSEIITERENSESDEFKNSLQSSSGIDSLDWSNLSSKEVSIDWKPPTPILYDVKLGRGYLEMPQIELPNGRLVKSLLEAKHVYILDSNGDMFVWIGDMA 2908
            AKP +    ++ DD  G     E++ ++D   + +   L  G F+ GDCY++L+T     S+  L + +Y W G  A+ D+V ASA  AV L           R   G E   F+A+F G +I+ E  A+G T      D         +++++ G D+ +     +      L+S  V++ + +    FLW G       +   R LAD + + +++      T  E  E  EF  +L   +          S K + ++     P L++     G   + +I        +  L+   V +LD+   +F+W+G  A
Sbjct:  380 AKPEVAAQHRMVDDGSGT---AEMFRIEDLELKPVEKRL-HGQFYGGDCYLVLYTY---TSNNKLAYLLYMWQGRHATQDEVAASAYQAVALDQKYGGEPVQVRVVMGKEPKHFLAIFHGKLIIYEMVAQGGTSRAGGNDIGGAAPPTTRLFQVRGTDEFNTKAVEVPARASALNSNDVFVLN-AEVACFLWCGKGCSGDEREMARSLADGLTRRDKQ------TVLEGQEPPEFWAALGGKA-------PYASEKRMQVEEAEVQPRLFECSTQTGRFVVTEIS----DFSQDDLDEDDVMLLDTWDQVFLWVGQGA 672          
BLAST of Protein flightless-1 vs. Ensembl Sea Lamprey
Match: scrib (scribble planar cell polarity protein [Source:NCBI gene;Acc:368473])

HSP 1 Score: 83.1889 bits (204), Expect = 3.174e-16
Identity = 101/346 (29.19%), Postives = 172/346 (49.71%), Query Frame = 2
Query:  665 KLTQLQRLTISKNNINKLSGDWCTELKALRVFNARKNKLTDDSLPEQLFNNPQLQVVDLSFNLLTEVPAGLVEAKSLLVLNLSDNQIKNVSKDLFANCVSLMILDLSNNQIVGFPTXXXXXXXXXXXXXXXXXXXXXXXRSINGXXXXXXXXXXX--XXXXXENIPSDLDKLPCLQDLDISDNNLPKVPQTIYEITSLTKLNLSGNEIDELSGLVDCWPNLEVXXXXXXXXXXXPSFITRLSKLKKLYVDENRLTFNGIPPGIGKLSNLEVFSASENLLENIPEGLCRCGQLKHLNLRMNKLVTLPDAINVLIESLKTFNIENNPNLKMPPKLVEVDLKSKYAFYN 1696
            +L  L++L +S N + +L  D    +  L   +  +N + +  +P+ +     L+VVD S N LT +P G  + KSL+ L+L+D  ++ +  D+  N  +L+ L+L  N +   PT+L     L+ L+L NN L      ++ G       +        +LE +PS++ +L  L  LDIS N L ++P  I  + +LT    S N ++EL   +    +L +L   +NRL  LP  I     L +L + EN+L    +P  IGKL+ L   +  +N L +IP  +  CG L  L+LR N+L  +P  I+     +   ++  N    +P +L ++ LK+ +   N
Sbjct:    4 RLHNLRKLGLSDNELQRLPPDIANFMH-LVDLDMSRNDIAE--IPDSIKLCTCLEVVDFSGNPLTRLPEGFTQLKSLIYLSLNDVSLQGLPDDI-GNLSNLVTLELRENLLKTLPTSLHLLVKLEQLDLGNNEL-----ETLPGSLGSLPNVRELWLDGNQLEALPSEIGELRRLVCLDISQNRLERLPDAIGGLAALTDFLASQNHLEELPEELGKLKHLSILKADQNRLTHLPEAIGDCENLTELILTENQLVT--LPASIGKLTKLTNLNLDKNRLNSIPPEIGGCGALNVLSLRDNRLTQVPGEISG-ASQIHVLDLAGNRLENLPIELAKLSLKALWLSEN 337          

HSP 2 Score: 73.9442 bits (180), Expect = 2.173e-13
Identity = 81/265 (30.57%), Postives = 126/265 (47.55%), Query Frame = 2
Query:  803 QLFNNPQLQVVDLSFNLLTEVPAGLVEAKSLLVLNLSDNQIKNVSKDLFANCVSLMILDLSNNQIVGFPTXXXXXXXXXXXXXXXXXXXXXXXRSINGXXXXXXXXXXXXXXXXENIPSDLDKLPCLQDLDISDNNLPKVPQTIYEITSLTKLNLSGNEIDELSGLVDCWPNLEVXXXXXXXXXXXPSFITRLSKLKKLYVDENRLTFNGIPPGIGKLSNLEVFSASENLLENIPEGLCRCGQLKHLNL---RMNKLVTLPDAIN 1588
            Q F    L+ + LS N L  +P  +     L+ L++S N I  +  D    C  L ++D S N +   P    +  +L  L             S+N                L+ +P D+  L  L  L++ +N L  +P +++ +  L +L+L  NE++ L G +   PN+  L L  N+L +LPS I  L +L  L + +NRL    +P  IG L+ L  F AS+N LE +PE L   G+LKHL++     N+L  LP+AI 
Sbjct:    1 QFFRLHNLRKLGLSDNELQRLPPDIANFMHLVDLDMSRNDIAEIP-DSIKLCTCLEVVDFSGNPLTRLPEGFTQLKSLIYL-------------SLN-------------DVSLQGLPDDIGNLSNLVTLELRENLLKTLPTSLHLLVKLEQLDLGNNELETLPGSLGSLPNVRELWLDGNQLEALPSEIGELRRLVCLDISQNRLER--LPDAIGGLAALTDFLASQNHLEELPEEL---GKLKHLSILKADQNRLTHLPEAIG 233          
BLAST of Protein flightless-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004940.1 (pep scaffold:Pmarinus_7.0:GL476356:339323:347865:-1 gene:ENSPMAG00000004448.1 transcript:ENSPMAT00000004940.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 81.2629 bits (199), Expect = 6.457e-16
Identity = 107/370 (28.92%), Postives = 180/370 (48.65%), Query Frame = 2
Query:  599 MTRIQWLKLVSTGLEQIPKGVEKLTQLQRLTISKNNINKLSGDWCTELKALRVFNARKNKLTDDSLPEQLFNNPQLQVVDLSFNLLTEVPAGLVEAKSLLVLNLSDNQIKNVSKDLFANCVSLMILDLSNNQIVGFPTXXXXXXXXXXXXXXXXXXXXXXXRSINGXXX-XXXXXXXXXXXXXENIPSDL-DKLPCLQDLDISDNNLPKVPQTIYEITSLTKLNLSGNEIDELSGLVDCWPNLEVXXXXXXXXXXXPSFITRLSKLKKLYVDENRLTFNGIPPGIGKLSNLEVFSASENLLENIPEGLCRCGQLKHLNLRMNKLVTLPDAINVLIESLKTFNIENNPNLKMPPKLVEVDLKSKYAFYNID 1702
            +T +  L L    + Q+ K +  L++L  L++ +N I  L  +   EL++L   +   N+L  + LPE++ N  Q+  +DL  N L ++P  +    SL  L L  N++  V   L ANC  L  L+L NN I   P       +L +L+      +  Q   + G  +  T   L+     +  IP  +  +   L  L++ DN L  +P  I    S+ +LNL+ N++ ++   +    +LE+L LS N L  LP  +  L KL++L ++EN+L    +P  I  L +L+    + N L ++P G+     L HL +  N+L  +P+ I  L E+L+   + +NPNL   P   E+ L SK    +I+
Sbjct:  140 LTSLTVLYLRFNRITQVEKDIGNLSKLTMLSVRENKIKLLPAEI-GELRSLLTLDVAHNQL--EHLPEEIGNCVQVTNLDLQHNELLDLPDSIGNLASLNRLGLRYNRLSAVPTTL-ANCTELEDLNLENNNISTLP--EGLLSSLVNLSSLTLARNCFQAYPVGGPSQFTTVYSLNMEHNHIGKIPFGIFSRAKALSKLNMKDNQLTSLPLDIGTWKSMVELNLATNQLTKIPDDISELTSLEILVLSNNLLRKLPHGLGNLRKLRELDLEENKL--ESLPNEIAYLKDLQKLVLTNNQLTSLPRGIGHLCSLTHLMVGENQLTHVPEEIGTL-ENLEELYLNDNPNLHNLP--FELALCSKLLIMSIE 498          

HSP 2 Score: 64.3142 bits (155), Expect = 1.586e-10
Identity = 50/145 (34.48%), Postives = 85/145 (58.62%), Query Frame = 2
Query: 1151 IPSDLDKLPCLQDLDISDNNLPKVPQTIYEITSLTKLNLSGNEIDELSGLVDCWPNLEVXXXXXXXXXXXPSFITRLSKLKKLYVDENRLTFNGIPPGIGKLSNLEVFSASENLLENIPEGLCRCGQLKHLNLRMNKLVTLPDAI 1585
            +P+++  L  L  L +++N+L  +P T+  +TSL  L+L  N++  +  +V    +L VL L  NR+  +   I  LSKL  L V EN++    +P  IG+L +L     + N LE++PE +  C Q+ +L+L+ N+L+ LPD+I
Sbjct:   87 LPTEIGCLVNLVTLALNENSLTGLPDTLTGLTSLRMLDLRHNKLRSIPPVVYRLTSLTVLYLRFNRITQVEKDIGNLSKLTMLSVRENKIKL--LPAEIGELRSLLTLDVAHNQLEHLPEEIGNCVQVTNLDLQHNELLDLPDSI 229          

HSP 3 Score: 58.151 bits (139), Expect = 1.316e-8
Identity = 86/341 (25.22%), Postives = 145/341 (42.52%), Query Frame = 2
Query:  575 DCSEAFSNMTRIQWLKLVSTGLEQIPKGVEKLTQLQRLTISKNNINKLSGDWCTELKALRVFNARKNKLTDDSL--PEQLFNNPQLQVVDLSFNLLTEVPAGLV-EAKSLLVLNLSDNQIKNVSKDLFANCVSLMILDLSNNQIVGFPTXXXXXXXXXXXXXXXXXXXXXXXRSINGXXXXXXXXXXXXXXXXENIPSDLDKLPCLQDLDISDNNLPKVPQTIYEITSLTKLNLSGNEIDELSGLVDCWPNLEVXXXXXXXXXXXPSFITRLSKLKKLYVDENRLTFNGIPPGIGKLSNLEVFSASENL-LENIPEGLCRCGQLKHLNLRMNKLVTLPDAI 1585
            D  ++  N+  +  L L    L  +P  +   T+L+ L +  NNI+ L     + L  L      +N      +  P Q      +  +++  N + ++P G+   AK+L  LN+ DNQ+ ++  D+     S++ L+L+ NQ+                                                   IP D+ +L  L+ L +S+N L K+P  +  +  L +L+L  N+++ L   +    +L+ L L+ N+L SLP  I  L  L  L V EN+LT   +P  IG L NLE    ++N  L N+P  L  C +L  +++    L  LP  I
Sbjct:  224 DLPDSIGNLASLNRLGLRYNRLSAVPTTLANCTELEDLNLENNNISTLPEGLLSSLVNLSSLTLARNCFQAYPVGGPSQFTT---VYSLNMEHNHIGKIPFGIFSRAKALSKLNMKDNQLTSLPLDI-GTWKSMVELNLATNQLT-------------------------------------------------KIPDDISELTSLEILVLSNNLLRKLPHGLGNLRKLRELDLEENKLESLPNEIAYLKDLQKLVLTNNQLTSLPRGIGHLCSLTHLMVGENQLTH--VPEEIGTLENLEELYLNDNPNLHNLPFELALCSKLLIMSIENCPLSQLPGPI 509          

HSP 4 Score: 55.0694 bits (131), Expect = 1.059e-7
Identity = 48/147 (32.65%), Postives = 78/147 (53.06%), Query Frame = 2
Query: 1190 LDISDNNLPKVPQTIYEITSLTKLNLSGNEIDELSGLVDCWPNLEVXXXXXXXXXXXPSFITRLSKLKKLYVDENRLTFNGIPPGIGKLSNLEVFSASENLLENIPEGLCRCGQLKHLNLRMNKLVTLPDAINVLIESLKTFNIENN 1630
            LD++  ++  +P  I E+T LT+L L GN +  L   + C  NL  L L+ N L  LP  +T L+ L+ L +  N+L    IPP + +L++L V     N +  + + +    +L  L++R NK+  LP  I  L  SL T ++ +N
Sbjct:   54 LDLAKRSIASLPPNIKELTQLTELYLYGNRLPCLPTEIGCLVNLVTLALNENSLTGLPDTLTGLTSLRMLDLRHNKL--RSIPPVVYRLTSLTVLYLRFNRITQVEKDIGNLSKLTMLSVRENKIKLLPAEIGEL-RSLLTLDVAHN 197          

HSP 5 Score: 51.2174 bits (121), Expect = 1.806e-6
Identity = 48/165 (29.09%), Postives = 72/165 (43.64%), Query Frame = 2
Query: 1151 IPSDLDKLPCLQDLDISDNNLPKVPQTIYEITSLTKLNLSGNEIDELSGLVDCWPNLEVXXXXXXXXXXXPSFITRLSKLKKLYVDENRLT---------------------FNGIPPGIGKLSNLEVFSASENLLENIPEGLCRCGQLKHLNLRMNKLVTLPDA 1582
            +P  L  L  L+ LD+  N L  +P  +Y +TSLT L L  N I ++   +     L +L++  N++  LP+ I  L  L  L V  N+L                         +P  IG L++L       N L  +P  L  C +L+ LNL  N + TLP+ 
Sbjct:  110 LPDTLTGLTSLRMLDLRHNKLRSIPPVVYRLTSLTVLYLRFNRITQVEKDIGNLSKLTMLSVRENKIKLLPAEIGELRSLLTLDVAHNQLEHLPEEIGNCVQVTNLDLQHNELLDLPDSIGNLASLNRLGLRYNRLSAVPTTLANCTELEDLNLENNNISTLPEG 274          
BLAST of Protein flightless-1 vs. Ensembl Yeast
Match: CYR1 (Adenylate cyclase; required for cAMP production and cAMP-dependent protein kinase signaling; the cAMP pathway controls a variety of cellular processes, including metabolism, cell cycle, stress response, stationary phase, and sporulation [Source:SGD;Acc:S000003542])

HSP 1 Score: 56.6102 bits (135), Expect = 3.541e-8
Identity = 93/342 (27.19%), Postives = 158/342 (46.20%), Query Frame = 2
Query:  617 LKLVSTGLEQIPKGVEKLTQLQRLTISKNNINKLSGDWCTELKALRVFNARKNKLTDDSLPEQLFNNPQLQVVDLSFNLLTEVPAGLVEAKSLLVLNLSDNQIKNVSKDLFANCVSLMILDLSNNQI--VGFPTXXXXXXXXXXXXXXXXXXXXXXXRSINGXXXXXXXXXXXXXXXXENIPSDLDKLPCLQDLDISDNNLPKVPQTIYEITSLTKLNLSGNEIDELSGLVDCWP-NLEVXXXXXXXXXXXPS-FITRLSKLKKLYVDENRLTFNGIPPGIGKLSNLEVFSASENLLENIPEGLCRCGQLKHLNLRMNKLVTLPDAINVLIESLKTFNIENN 1630
            L++V+    + P  + K  +L  L + +N I K+      +L  L + N + N+L  +SLP        LQ++DLS N     P  +    +LL ++LS N+I+++ +      V L  ++LS+N++  +G                  +   M+ LR++N               R   I S       LQ+L ++DN +     T   +  L  L +  N I  +S   D +P N+  L L++ +L+S+P   +T+LS L+KL +++N LT   +P  I KL+ L   S + N LE IP  L +   L+ L+L  N +    D +  L   L + NI +N
Sbjct:  845 LRMVNIRASKFPSNITKAYKLVSLELQRNFIRKVPNS-IMKLSNLTILNLQCNEL--ESLPAGFVELKNLQLLDLSSNKFMHYPEVINYCTNLLQIDLSYNKIQSLPQST-KYLVKLAKMNLSHNKLNFIG------------------DLSEMTDLRTLN--------------LRYNRISSIKTNASNLQNLFLTDNRISNFEDT---LPKLRALEIQENPITSIS-FKDFYPKNMTSLTLNKAQLSSIPGELLTKLSFLEKLELNQNNLT--RLPQEISKLTKLVFLSVARNKLEYIPPELSQLKSLRTLDLHSNNIRDFVDGMENL--ELTSLNISSN 1142          
BLAST of Protein flightless-1 vs. Ensembl Nematostella
Match: EDO33460 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SS67])

HSP 1 Score: 538.495 bits (1386), Expect = 9.376e-172
Identity = 367/914 (40.15%), Postives = 530/914 (57.99%), Query Frame = 2
Query:  599 MTRIQWLKLVSTGLEQIPKGVEKLTQLQRLTISKNNINKLSGDWCTELKALRVFNARKNKLTDDSLPEQLFNNPQLQVVDLSFNLLTEVPAGLVEAKSLLVLNLSDNQIKNVSKDLFANCVSLMILDLSNNQIVGFPTXXXXXXXXXXXXXXXXXXXXXXXRSINGXXXXXXXXXXXXXXXXENIPSDLDKLPCLQDLDISDNNLPKVPQTIYEITSLTKLNLSGNEIDELSGLVDCWPNLEVXXXXXXXXXXXPSFITRLSKLKKLYVDENRLTFNGIPPGIGKLSNLEVFSASENLLENIPEGLCRCGQLKHLNLRMNKLVTLPDAINVLIESLKTFNIENNPNLKMPPKLVEVDLKSKYAFYNIDFSLETQMQLARGAPAKAS-SKSVTQKHKFT---QDTASRIRRLRRKKIDEKSEKGSDSKRVLEGMQKVAKDKDAIMEDREKEEKLLSAKKWQDAIAKPNLDYSKLFDDDVGIEPGIELWDMDDFYPRRITDELPLGTFFDGDCYIILHTSLDEKSHTSLNHSIYYWIGSQASLDKVTASAVHAVYLRNYLSTNCRCERTEQGDESPEFVALFEGNIIVCEGARGQTGFLKTEDKEHRKKMYRLFGADKSISIYSLDPTPENLDSKFVYLFDESSTRLFLWIGNKSRLMLQTKGRLLADNINQTERKGQSEIITERENSESDEFKNSLQSSSGIDSLDWSNLSSKEVSIDWKPPTPILYDVKLGRGYLEMPQ----------IELPNGRLVKSLLEAKHVYILDSNGDMFVWIGDMAPKFLKFAGXXXXXXXXXXXXXXXXXXXTVCCQTSEPQIFKMQFADWVDTCAVDFTRSVESVRKRGVNLXXXXXXX---------XXXXXXRAFFMPRERPMPLEDAKAIMEDCNEDLVGNNMDSNDGKPF 3271
            M+ ++WLKL   GLE +P  +  L +L+ L++ +N +N + GD  T LK LRV NAR N+L +  +P  +F    L  VD S+N L EVP  L  AK+L+VL+LS+N+I  +   LF N + L+ LDLS+N +   P  LRR  NLQ+L L+NNPL  +QLR +  L +L TL L NT R + N P+ L+ L  L DLD+S N+LP+VP+ +Y I+SL ++NLS N I ELS L+D W  LE LN+SRN+L SLP  + +L K+K+L+++ N + F G+P GIGKL NLEVF A+ N LE IPEGLCRC +L+ L L  N+L TLP+ I+ L  +L   ++ NNP L+MP K V  +L S   FYNIDFSL+ Q+++A GAP      +S +    F+   +D  +R  R+R ++   +S          +G++ +      +         +   +KW +A+ KPNL+Y   FDD  G E G+++W +++F P  + DE   G F++ DCYIIL T LDE     L   IYYWIG +ASLDK   SA+HAV LRN+L    R  R EQGDES EF  LF+ +I   EG    +GF   ED+ +  +++RL   DK + +  + P   +LD  F ++ D +  ++++W G K++   +TK RL  + IN+ ERK ++EII      E  EF   L       ++       +E S+D  P  P +Y V LG GYLE+PQ           ELP G L + LL+ K+VYI+D N ++FVWIG  + + ++ A +KL+ EL  ++ R S    T   Q +E Q+FK +F  W D  AVD+TRS E+V K    L                  K+D+ A F  R++P+P  + + ++E+ NEDL G      +GK F
Sbjct:    1 MSNLRWLKLNKAGLETLPDELSHLPKLEHLSVKENKLNNIHGDLST-LKHLRVINARNNELKNSGIPGDIFGLEDLLTVDFSYNQLHEVPPELENAKALIVLSLSNNKISVIPNQLFINLIDLIYLDLSDNCLETIPPQLRRLVNLQTLILNNNPLLHAQLRQLPSLSQLHTLHLRNTQRTIMNFPNKLEGLANLADLDLSHNDLPRVPEPVYLISSLKRVNLSHNAITELSSLIDTWTQLEHLNVSRNQLTSLPVALCKLVKIKRLFLNGNNINFEGLPTGIGKLYNLEVFMAAYNQLECIPEGLCRCIKLRKLILHSNRLFTLPEGIHFLT-NLDELDVRNNPELEMPSKPVPDELGSGAEFYNIDFSLQNQLRIATGAPLPPQPCRSTSALFIFSTAHKDAYARKLRMRGRRHHSQS----------DGLKVLPISCHTLPFKGWTNYVIKEGRKWNEALVKPNLNYHDFFDDQTGQEIGMQVWQIENFLPVHV-DEDFYGKFYEADCYIILKTELDETDQ--LFWQIYYWIGKEASLDKKACSAIHAVNLRNFLGAETRTIREEQGDESEEFHELFDNDIAYIEGGTA-SGFYSVEDQIYITRLFRLL-KDKRVLLEPVLPDVSSLDPTFTFILD-AGLKIYIWSGAKAKRTTKTKARLFVEKINKNERKNKAEIIMCMTGDEPGEFWRLLNGRPAEGTIT----VKEEYSVD--PKRPNIYKVALGLGYLELPQGMLASEGSGKFELPGGVLSQKLLDTKNVYIMDCNTEIFVWIGRKSARLVRAAAMKLSQELCSMIERPSFSIVTRTLQGAESQLFKSKFVGWDDVLAVDYTRSAETVSKLSKQLGTTNITSKDAQDKLKQVAKVDLSALFTTRQQPIPDSEQQQLVEEWNEDLDGMECFVLEGKKF 890          

HSP 2 Score: 50.8322 bits (120), Expect = 5.400e-6
Identity = 42/144 (29.17%), Postives = 63/144 (43.75%), Query Frame = 2
Query:  581 SEAFSNMTRIQWLKLVSTGLEQIPKGVEKLTQLQRLTISKNNINKLSGDWCTELKALRVFNARKNKLTDDSLPEQLFNNPQLQVVDLSFNLLTEVPAGLVEAKSLLVLNLSDNQIKNVSKDLFANCVSLMILDLSNNQIVGFPT 1012
            ++ F N+  + +L L    LE IP  + +L  LQ L ++ N +          L  L   + R  + T  + P +L     L  +DLS N L  VP  +    SL  +NLS N I  +S  L      L  L++S NQ+   P 
Sbjct:  113 NQLFINLIDLIYLDLSDNCLETIPPQLRRLVNLQTLILNNNPLLHAQLRQLPSLSQLHTLHLRNTQRTIMNFPNKLEGLANLADLDLSHNDLPRVPEPVYLISSLKRVNLSHNAITELS-SLIDTWTQLEHLNVSRNQLTSLPV 255          
BLAST of Protein flightless-1 vs. Ensembl Nematostella
Match: EDO38108 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SE09])

HSP 1 Score: 173.711 bits (439), Expect = 1.571e-49
Identity = 81/179 (45.25%), Postives = 120/179 (67.04%), Query Frame = 2
Query: 3809 IMKIPAAASKTENDQIICWIGKNSDSHYDEVLQAVAADTFPESSDILTVKEGAEP-GIFWQALGGKKNYDHEAQFMSFSRLFRLSNEQGFFCASEKCSDFCQDDLADEDVMLLDTGSQIYLWFGNRTSDVEKKLSYKAAKLYQEHMARIQPDRIRQLKITQKKKEPHNFRRCFHGWGPF 4342
            I+K+P   +  E+  I  WIG        E  + +  + +     I  + EG EP   FW ALGG+K++D +A ++++ RLFR SNE+G+F  SEKC+DFCQDDLA +DVM+LDTG ++++W G  +SDVEKKL  K+A++Y +H+ ++Q   IR+L++T K +E H F+RCFHGWG F
Sbjct:    2 ILKVPFE-NYAEDGIIYVWIGGKVTEADAEHAKELGQEIWDSGYTIQIINEGEEPENFFWVALGGRKDHDKDADYLNYCRLFRCSNEKGYFSVSEKCTDFCQDDLAGDDVMILDTGHEVFVWMGMESSDVEKKLGIKSAQVYIQHLLQLQSGPIRKLRLTLKAQEGHLFKRCFHGWGQF 179          
BLAST of Protein flightless-1 vs. Ensembl Nematostella
Match: EDO34638 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNP8])

HSP 1 Score: 93.2041 bits (230), Expect = 2.586e-22
Identity = 43/96 (44.79%), Postives = 73/96 (76.04%), Query Frame = 3
Query:  120 LSQNLLTLLKPSIIETDKKVEEIRKSQIELRNQIELLAKNLTDINENLAIPLNIDSYLKKLNNCKRRLTLINNILQNSQDRVTKLQSNISKESKRR 407
            L++ L+ L KP+I E D KV  +R+SQ+E+R+QI+ L++ L  ++E   IP+++D Y+KKL N +R++ L+NNILQN+Q+R+ +L  N++KE+ +R
Sbjct:   18 LAEGLMHLFKPAIEELDTKVHSVRQSQVEVRSQIDKLSEELHRLSELQDIPVDLDVYVKKLMNSRRKIMLVNNILQNAQERLGRLHLNVTKETAKR 113          
BLAST of Protein flightless-1 vs. Ensembl Nematostella
Match: EDO38658 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCC4])

HSP 1 Score: 101.293 bits (251), Expect = 6.306e-22
Identity = 130/499 (26.05%), Postives = 217/499 (43.49%), Query Frame = 2
Query: 2018 VGIEPGIELWDMDDFYPRRITDELP--LGTFFDGDCYIILHTSLDEKSHTSLNHSIYYWIGSQASLDKVTASAVHAVYLRNYLSTNCRCERTEQGDESPEFVALFEGNIIVCEGARGQTGFLKTEDKEHRKKMYRLFGADKSISIYSLDPTPENLDSKFVYLFDESSTRLFLWIGNKSRLMLQTKGRLLADNINQTERKGQSE--IITE-RENSESDEFKNSLQSSSGI--DSLDWSNLSSKEVSIDWKPPTPILYDVKLGRGYLEMPQIELPNGRLVKSLLEAKHVYILD-SNGDMFVWIGDMAPKFLKFAGXXXXXXXXXXXXXXXXXXXTVCCQTSEPQIFKMQFADWVDT-CAVDFTRSVES-VRKRGVNLXXXXXXXXXXXXXRAFFMPRERPMPLEDAKAIMEDCNEDLVGNNMDSNDGKPFKIKQFVYLNRNWVLVEDKWIGHFFNQDCYIVHAEYWXXXXXXXXXXXXXXXXXXXSRIQTVIYFWQGREAS 3484
             G +PG+E+W ++     ++  + P   GTF+ GD YI L T L E SH  L   I++W+G   S D+    A   V L ++L       R  Q  ES +F++ F+ +I   EG   ++GF K +   ++K+++ + G         ++   ++L+   V++ D+    ++ W G++   + + KG  +A  I   ER G+++  II E ++     +F ++L S   I  DS D +       S         LY V    G LEM +IE     L KS L+    +ILD  +  +FVW+G    K  K A +K   + +E     +    T   +  E  IFK  F+ W D    V   R+ +S + K+  +  D                 R++P   E  K I+ D           S   K ++++     + + VLV  +  G FF+ DCY++   Y                 +   R   +IYFWQG ++S
Sbjct:   10 AGQKPGLEIWRIEKL---KVVAQDPKTYGTFYSGDSYICLSTRLVE-SH--LEWDIHFWLGKNTSQDEAGVCAYKTVELDDHLGGGPVQYREVQDHESRKFLSHFK-DIKYLEGGM-ESGFRKVQRDVYQKRLFHIKGKRNVRVQQVVELHYKSLNKGDVFILDD-GLNIYCWNGSQCSRVERMKGIDVAKRIRDEERGGRAQVHIIDECKDKGLESKFFDALGSRGEIAEDSGDDAEFEKTSQS------AVTLYQVSDASGELEMREIEAKP--LKKSNLDTNDCFILDCGSSGVFVWVGKGCTKNEKSAAMKNGIDFIEKKGYPNWTQVTRVVEGGETPIFKQFFSGWTDADSQVGLGRAFKSKIAKQSYDKFDATS-----------LHDRKKP---EXKKQILADDG---------SGVAKIWRVE-----DHDLVLVPLELHGLFFSGDCYVIMYTY-----------------KVNMRESVIIYFWQGVQSS 446          

HSP 2 Score: 60.8474 bits (146), Expect = 3.179e-9
Identity = 44/148 (29.73%), Postives = 70/148 (47.30%), Query Frame = 2
Query: 1979 KPNLDYSKLFDDDVGIEPGIELWDMDDFYPRRITDELPLGTFFDGDCYIILHTSLDEKSHTSLNHSIYYWIGSQASLDKVTASAVHAVYLRNYLSTNCRCERTEQGDESPEFVALFEGNIIVCEGARGQTGFLKTEDKEHRKKMYRLF 2422
            KP      L DD  G+    ++W ++D     +  EL  G FF GDCY+I++T    K +   +  IY+W G Q+S D+  ASA+ A  +   +       R  Q  E   F+ +F G +I+ EG +G       E+  +  +  R+F
Sbjct:  378 KPEXKKQILADDGSGV---AKIWRVEDHDLVLVPLELH-GLFFSGDCYVIMYTY---KVNMRESVIIYFWQGVQSSTDEKAASAMLADQIDKKMGGIATQVRVVQYKEPEHFLRIFRGRLIILEGGKGAGFRAGCEEDTYDHEGKRMF 518          
BLAST of Protein flightless-1 vs. Ensembl Nematostella
Match: EDO49234 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGU9])

HSP 1 Score: 91.2781 bits (225), Expect = 3.071e-19
Identity = 74/300 (24.67%), Postives = 146/300 (48.67%), Query Frame = 2
Query: 2018 VGIEPGIELWDMDDFYPRRITDELPLGTFFDGDCYIILHTSLDEKSHTSLNHSIYYWIGSQASLDKVTASAVHAVYLRNYLSTNCRCERTEQGDESPEFVALFEGNIIVCEGARGQTGFLKTEDKEHRKKMYRLFGAD-KSISIYSLDPTPENLDSKFVYLFDESSTRLFLWIGNKSRLMLQTKGRLLADNINQTERKGQS--EIITERENSESDEFKNSLQSSSGIDSLDWSNLSSKEVSIDWKPPTPILYDVKLGRGYLEMPQIELPNGRLVKSLLEAKHVYILDSNGDMFVWIGDMA 2908
             G   G+++W ++ F  + +  +   G F+DGD YIIL+T  D +      + +++WIG  ++ D+   +A   V L  YL+      R  QG ES  F++ F+   I+  G +  +GF     + ++ ++ R++G   KS+ +  +    ++L+S  V++ D+  T ++ W G       + +    A+ + ++ER G+   E+I E E+  S  F   L            +L  KE   D+    P+L  V    G +++ +++   GR+ ++  + K V++ D+   +FV+ G+ A
Sbjct:   42 AGKREGLQIWRVEQFKVKSVLRD-DYGKFYDGDSYIILNTYKDPE-EDEFKYDVHFWIGQDSTQDEYGTAAYKTVELDIYLNDKPVQHREVQGHESKLFMSYFDSLTILKGGVK--SGFKHVRPEVYQPRLLRVYGTTPKSVKVEEVPFVRKSLNSDDVFILDKGKT-IYQWNGKDCDKDEKFRAAQEANRL-KSERGGRPVIEVIDEGED-RSAPFYRFL-----------PDLPCKEEKGDYDDFEPVLLRVSDASGQMKLTEMKKGKGRITRNDFDEKDVFLFDTGNVLFVYSGNKA 323          
BLAST of Protein flightless-1 vs. Ensembl Medaka
Match: flii (FLII actin remodeling protein [Source:NCBI gene;Acc:101162930])

HSP 1 Score: 853.588 bits (2204), Expect = 0.000e+0
Identity = 537/1320 (40.68%), Postives = 786/1320 (59.55%), Query Frame = 2
Query:  512 SKSVSQFLLGIDLSCVEIKDNDCSEAFSNMTRIQWLKLVSTGLEQIPKGVEKLTQLQRLTISKNNINKLSGDWCTELKALRVFNARKNKLTDDSLPEQLFNNPQLQVVDLSFNLLTEVPAGLVEAKSLLVLNLSDNQIKNVSKDLFANCVSLMILDLSNNQIVGFPTXXXXXXXXXXXXXXXXXXXXXXXRSINGXXXXXXXXXXXXXXXXENIPSDLDKLPCLQDLDISDNNLPKVPQTIYEITSLTKLNLSGNEIDELSGLVDCWPNLEVXXXXXXXXXXXPSFITRLSKLKKLYVDENRLTFNGIPPGIGKLSNLEVFSASENLLENIPEGLCRCGQLKHLNLRMNKLVTLPDAINVLIESLKTFNIENNPNLKMPPKLVEVDLKSKYAFYNIDFSLETQMQLARGAPAKASSKSVTQKHKFTQDTASRIRRLRRKKIDEKSEKGSDSKRVLEGMQKVAKDKDAIMEDREKEEKLLSAKKWQDAIAKPNLDYSKLFDDDVGIEPGIELWDMDDFYPRRITDELPLGTFFDGDCYIILHTSLDEKSHTSLNHSIYYWIGSQASLDKVTASAVHAVYLRNYLSTNCRCERTEQGDESPEFVALFEGNIIVCEGARGQTGFLKTEDKEHRKKMYRLFGADKSISIYSLDPTPENLDSKFVYLFDESSTRLFLWIGNKSRLMLQTKGRLLADNINQTERKGQSEIITERENSESDEFKNSLQSSSGIDSLDWSNLSS------KEVSIDWKPPTPILYDVKLGRGYLEMPQIE----------------LPNGRLVKSLLEAKHVYILDSNGDMFVWIGDMAPKFLKFAGXXXXXXXXXXXXXXXXXXXTVCCQTSEPQIFKMQFADWVDTCAVDFTRSVESVRK----RGVNLXXXXXXXXXXXXXRAFFMPRERPMPLEDAKAIMEDCNEDLVGNNMDSNDGKPFKIKQFVYLNRNWVLVEDKWIGHFFNQDCYIVHAEYWXXXXXXXXXXXXXXXXXXXSR-----------IQTVIYFWQGREASDIPWLQFNFSLKKEMEIKFSGMDNMSTTKDSFKKVETKRMFQQQEISTFLAHFQHRFVIHLGKYQDRYSDQRKNRIELYYLRENGNALCTRTIEVKPMIAFVNSCFHYIMKIPAAASKTENDQII-CWIGKNSDSHYDEVLQAVAADTFPESSDILTVKEGAEP-GIFWQALGGKKNYDHEAQFMSFSRLFRLSNEQGFFCASEKCSDFCQDDLADEDVMLLDTGSQIYLWFGNRTSDVEKKLSYKAAKLYQEHMARIQPDRIRQLKITQKKKEPHNFRRCFHGWGPFKEAM 4354
            +  V  F+ G+DLS  + K     E    M+ ++WLKL  TGL  +P+ +  L +L+ L++S N++  L G+  + L  LR   AR N L +  +P+ +F    L V+DLS+N LTE+P  L  ++++LVLNLS N I  +   LF N   L+ LDLSNN++   P  +RR  +LQ+L L+NNPL  +QLR +  +  L TL L NT R   N+P+ L+ L  L D+D+S N+L ++P+ +Y ++SL +LNLS N+I ELS  +D W  LE LNLSRN+L SLPS I +LSKLKKLY++ N+L F+G+PPG+GKLS+L  F A+ N LE IPEGLCRCG+LK L L  N+LVTLP+ I+ L + L+  ++  NPNL MPPK  +        +YNIDFSL+ Q++LA  +PA  ++         ++D  +R  RLRR+K      +   +K+VL+GM  VA++K  + E+ + +   L  ++W  ++ KP LDYS+ F +DVG  PG+ +W +++F P ++ DE   G F++ DCYIIL T LD+    +LN  I+YWIG +A+LDK   SA+HAV LRN+L   CR  R E G+ES EF A+F  +I   EG    +GF   ED  +  ++YR++G  K+I + S+     +LD +FV+L D S   +F+W G  + L   TK RL A+ IN+ ERKG++EI+T  ++ E  EF              W  L        K V  ++ P  P LY V LG GYLE+PQI                 LP  RL++SLL+ K VYILD   D+F+WIG  +P+ ++ A LKL  E+  +L R    S T   + +E Q+FK +F +W D   VD+TR+ E+V++    +G    D  +KD+MK D+ A F+PR+ PM L +A+ +ME+ NEDL G            ++ FV   + +  + ++  GHFF QDCY+    YW   E ++ + ++       +             Q V+YFWQGR+AS++ WL F FSL+K+ E  F G            K++  RM QQQE   FL+HF+ +F+IH GK   R  D    +  LY++R NG+ALCTRTI++      +NS F +I+K+P  +  T+N  I+  W+G+ +D    ++ + +    F E+     + EG EP   FW  +G +K YD +A++M  +RLFR SNE+G+F  SEKCSDFCQDDLAD+D+MLLD G ++Y+W G +TS VE KLS KA ++Y +HM   + ++ R+L++ +K  EPH F RCFH WGPFK  +
Sbjct:    3 ATGVLPFIRGVDLSGNDFKGGYFPEHVKCMSSLRWLKLNRTGLCYLPEELASLQKLEHLSVSHNSLTTLHGE-LSSLPNLRAVVARANNLKNSGVPDDIFQLDDLSVLDLSYNQLTEIPRDLENSRNMLVLNLSHNSIDAIPNQLFINLTDLLYLDLSNNKLDSLPPQMRRLVHLQTLILNNNPLMHAQLRQLPAMVALQTLHLRNTQRVQSNMPTSLEGLTQLADVDLSCNDLTRIPECLYSLSSLKRLNLSSNQISELSLCIDQWNQLETLNLSRNQLTSLPSAICKLSKLKKLYINSNKLDFDGVPPGVGKLSSLVEFMAANNNLELIPEGLCRCGKLKKLVLNKNRLVTLPETIHYLTD-LEVLDVRENPNLVMPPKPTD----RAAEWYNIDFSLQNQLRLAGASPATVAAAGGGAN---SRDHLARKMRLRRRK---DCSQDDQAKQVLKGMSDVAQEKKTMEENGDPKYGDLKTRRWDKSLEKPQLDYSEFFLEDVGQVPGVSVWQIENFIPVQV-DEAFHGKFYEADCYIILKTFLDDNG--ALNWHIFYWIGQEATLDKKAGSAIHAVNLRNFLGAECRTIREEMGEESEEFSAVFNQDISYIEGGTS-SGFYTVEDTNYPLRLYRVYGK-KNIRLESVPVKGSSLDPRFVFLLD-SELEIFIWRGANATLSSTTKARLFAEKINKNERKGKAEILTVTQSQEPPEF--------------WELLGGQPEEIKKHVPDNFSPVRPKLYKVGLGLGYLELPQINYKLSVEHKDHKVKLDTLPELRLLQSLLDTKCVYILDCWSDVFIWIGRKSPRLVRAAALKLGQEICSMLHRPKHASVTRNLEGTESQVFKSKFKNWDDVLKVDYTRAAETVQQNDNLQGKVKKDAEQKDQMKADLTALFLPRQPPMALSEAEQLMEEWNEDLDG------------MEGFVLEGKKFARLPEEEFGHFFTQDCYVFLCRYWVPVEYEEEEKDKKEGGGGGADEEEEEKQPEEDFQCVVYFWQGRQASNMGWLTFTFSLQKKFESLFPG------------KLKVVRMTQQQENLKFLSHFKRKFIIHKGK---RKQDNDSVQPSLYHIRTNGSALCTRTIQIGTDSGNLNSEFCFILKVPFES--TDNQGIVYTWVGRAADPDEAKLAEDIMNSMFDETYSKQVINEGEEPENFFWVGIGSQKPYDEDAEYMKHARLFRCSNEKGYFSVSEKCSDFCQDDLADDDIMLLDNGKEVYMWVGTQTSQVEIKLSLKACQVYIQHMRSKEAEQPRKLRLVRKGNEPHCFTRCFHAWGPFKTPL 1261          
BLAST of Protein flightless-1 vs. Ensembl Medaka
Match: avil (advillin [Source:NCBI gene;Acc:101170835])

HSP 1 Score: 201.445 bits (511), Expect = 9.180e-53
Identity = 208/792 (26.26%), Postives = 337/792 (42.55%), Query Frame = 2
Query: 2030 PGIELWDMDDFYPRRITDELPLGTFFDGDCYIILHTSLDEKSHTSLNHSIYYWIGSQASLDKVTASAVHAVYLRNYLSTNCRCERTEQGDESPEFVALFEGNIIVCEGARGQTGFLKTEDKEHRKKMYRLFGADKSISIYSLDPTPENLDSKFVYLFDESSTRLFLWIGNKSRLMLQTKGRLLADNINQTERKGQSEIITERENSESDEFKNSLQSSSGIDSLDWSNLSSKEVSIDWKPPTPILYDVKLGRGYL--------EMPQIELPNGRLVKSLLEAKHVYILDSNG-DMFVWIGDMAPKFLKFAGXXXXXXXXXXXXXXXXXXXTVCCQTSEPQIFKMQFADWVDTCAVDFTRSVESVRKRGVNLXXXXXXXXXXXXXRAFFMPRERPMPLEDAKAIMEDCNEDLVGNNMDSNDGKPFKIKQFVYLNRNWVLVEDKWIGHFFNQDCYIVHAEYWXXXXXXXXXXXXXXXXXXXSRIQTVIYFWQGREASDIPWLQFNFSLKKEMEIKFSGMDNMSTTKDSFKKVETKRMFQQQEISTFLAHFQHRFVIHLGKYQDRYSDQRKNRIELYYLRENGNALC-TRTIEVKPMIAFVNSCFHYIMKIPAAASKTENDQIICWIGKNSD----SHYDEVLQAVAADTFPESSDILTVKEGAEPGIFWQALGGKKNYDHEAQFMSF-----SRLFRLSNEQGFFCASEKCSDFCQDDLADEDVMLLDTGSQIYLWFGNRTSDVEKKLSYKAAKLY-QEHMARIQPDRIRQLKITQKKKEPHNFRRCFHGWGPFK 4345
            PGI +W ++      +  E   G F++GDCY++L T    K    L++ I+YWIGS++S D+  A+AV+ V L  YL ++    R  Q  ES  F   F+  II  +G    TG    E   +  K        K +    ++ + ++ +   V+L D   T +  W G KS    + KG LLA +I   ER G++E+ T    +E    K S Q    ++S     L  +   +   PP       ++G+  L        +M   E+    LV+ LL+ +  Y+LD  G  +FVW G  A K  + A +  A + ++        +       +E  IFK  F  W      D T+ +  V  +G             +    F       MP   A+  M D             DG   +++ +   N   V V+ +W G+F+  DCY++   Y                    ++   ++Y WQGR A+             + E+       ++  +    +    R+   +E   F+A F+ + VI  G    + + + +  + L+ +  +G+ L  T+T EV  + A +NS   ++++     S+T   QI  W GK S     +   EV   +  D+   S +I  V EG EP  FW+ LGGK  Y    +          RLF  SN+ G F  +E  + F QDDL ++DVMLLDT  Q++LW G   +++E+K S   ++ Y + H     PD    + + ++  EP  F   F  W PFK
Sbjct:   12 PGIIIWRVEKM-ELVLVSEKTHGNFYEGDCYVLLST---HKVKNVLSYDIHYWIGSESSQDEQGAAAVYTVQLDEYLGSSPIQHREVQNHESDTFKGYFKNGIIYKKGGVA-TGMRHVETNTYDVKRLLHVKGKKRVIAQEVELSWKSFNLGDVFLLDTGKT-IIQWNGPKSNKQERHKGLLLAKDIRDRERGGRAEVRTVEGEAE----KQSPQEMEIMNSF----LGERTFKLTDGPPDETFDQEQMGKLSLYCVSDADGQMKVTEVATRPLVQDLLDHESCYLLDQGGAKIFVWKGKKANKAERQAAMARALDFIKTKNYPFTTNVETVNDGAESAIFKQLFQRW---TVKDQTQGLGKVNTKG---------KVAHVKQEKFDASLMHAMPEVAAQERMVD-------------DGSG-QVEVWRIENLEPVPVDRQWYGYFYGGDCYLILYTY-----------------LVNNKKCYLLYMWQGRHAT-------------QDELAACAFQAVALDQKYNDEPVQVRVTMGKEPRHFMALFKGKMVIFEGGTSRKGASEPEPPVRLFQV--HGSDLSNTKTFEVPALAASLNSNDVFLLR-----SQT---QIYLWCGKGSSGDERAMAKEVSSVICLDSQRSSEEI--VAEGQEPMEFWELLGGKAPYASSKRLQQVLLDYQPRLFECSNKTGRFIVTE-VTHFNQDDLNEDDVMLLDTWDQVFLWVGKDANEIERKESVATSQEYLRTHPGDRDPD--TPIIMIKQGFEPPTFTGWFTAWDPFK 718          

HSP 2 Score: 83.1889 bits (204), Expect = 1.677e-15
Identity = 76/301 (25.25%), Postives = 138/301 (45.85%), Query Frame = 2
Query: 2000 KLFDDDVGIEPGIELWDMDDFYPRRITDELPLGTFFDGDCYIILHTSLDEKSHTSLNHSIYYWIGSQASLDKVTASAVHAVYLRNYLSTNCRCERTEQGDESPEFVALFEGNIIVCEGARGQTGFLKTEDKEHRKKMYRLFGADKS-ISIYSLDPTPENLDSKFVYLFDESSTRLFLWIGNKSRLMLQTKGRLLADNINQTERKGQSEIITERENSESDEFKNSLQSSSGIDSLDWSNLSSKEVSIDWKPPTPILYDVKLGRGYLEMPQIELPNGRLVKSLLEAKHVYILDSNGDMFVWIG 2899
            ++ DD  G    +E+W +++  P  + D    G F+ GDCY+IL+T L       L   +Y W G  A+ D++ A A  AV L    +      R   G E   F+ALF+G +++ EG   + G     + E   +++++ G+D S    + +     +L+S  V+L   S T+++LW G  S    +   + ++  I    ++   EI+   E  E  EF   L    G  +   S+   ++V +D++P    L++     G   + ++   N    +  L    V +LD+   +F+W+G
Sbjct:  387 RMVDDGSG---QVEVWRIENLEPVPV-DRQWYGYFYGGDCYLILYTYLVNNKKCYL---LYMWQGRHATQDELAACAFQAVALDQKYNDEPVQVRVTMGKEPRHFMALFKGKMVIFEGGTSRKG---ASEPEPPVRLFQVHGSDLSNTKTFEVPALAASLNSNDVFLL-RSQTQIYLWCGKGSSGDERAMAKEVSSVICLDSQRSSEEIVA--EGQEPMEFWELL----GGKAPYASSKRLQQVLLDYQPR---LFECSNKTGRFIVTEVTHFN----QDDLNEDDVMLLDTWDQVFLWVG 663          
BLAST of Protein flightless-1 vs. Ensembl Medaka
Match: scinlb (gelsolin [Source:NCBI gene;Acc:101159773])

HSP 1 Score: 176.407 bits (446), Expect = 4.736e-45
Identity = 186/782 (23.79%), Postives = 327/782 (41.82%), Query Frame = 2
Query: 2012 DDVGIEPGIELWDMDDFYPRRITDELPLGTFFDGDCYIILHTSLDEKSHTSLNHSIYYWIGSQASLDKVTASAVHAVYLRNYLSTNCRCERTEQGDESPEFVALFEGNIIVCEGARGQTGFLKTEDKEHRKKMYRLFGADKSISIYSLDPTPENLDSKFVYLFDESSTRLFLWIGNKSRLMLQTKGRLLADNINQTERKGQSEIITERENSESDEFKNSLQSSSGIDSLDWSNLSSKEVSIDWKPPTPILYDVKLGRGYLEMPQIELPNGRLVKSLLEAKHVYILDSNGD--MFVWIGDMAPKFLKFAGXXXXXXXXXXXXXXXXXXXTVCCQTSEPQIFKMQFADWVDTCAVDFTRSVESVRKRGVNLXXXXXXXXXXXXXRAFFMPRERPMPLEDAKAIMEDCNEDLVGNNMDSNDGKPFKIKQFVYLNRNWVLVEDKWIGHFFNQDCYIVHAEYWXXXXXXXXXXXXXXXXXXXSRIQTVIYFWQGREASDIPWLQFNFSLKKEMEIKFSGMDNMSTTKDSFKKVETKRMFQQQEISTFLAHFQHRFVIHLGKYQDRYSDQ-RKNRIELYYLRENGNALCTRTIEVKPMIAFVNSCFHYIMKIPAAASKTENDQIICWIGKNSDSHYDEVLQAVAADTFPESSDILTVKEGAEPGIFWQALGGKKNYDHEAQFMSF---SRLFRLSNEQGFFCASEKCSDFCQDDLADEDVMLLDTGSQIYLWFGNRTSDVEKKLSYKAAKLYQEHMARIQPDRIRQLKITQKKK--EPHNFRRCFHGW 4333
            +  G EPG+++W +++   + +  +L  G+F+ GD Y++L T+       + +++I+ W+G + S D+  A+A+ A  + ++L       R  Q  ES  F+  F+  I   +G    +GF      +   K        ++I    ++ +  + +    ++ D     +++W G++S    + K   +  +I   ER G++++    E +E  E    L  ++ I      +   + V+ +       LY +    G +++  +   +    +++L  +  YILD+  D  +FVW G  A +  +   +  A + ++    S +    V  Q SE  +FK  F DW         R  E     G                +A+ + R   +      A M   N+ +   +   +DGK  K++ +   N   V V+    G F+  DCY++   Y                  + +R + +IY WQG + +     Q        + I+    D+M             R+ Q QE S  ++ FQ + +I L     R   Q +     L+++R++ +A  TR +EV P  + +N+   +++K P+A        +  W GK +    DE ++A              V E  EP  FW ALGGKK Y             RLF  SN+ G     E   DF Q DLA +DVM+LDT  Q+++W GN  ++ EK  + K AK Y +      P   R + IT  K+  EP  F   F  W
Sbjct:    8 EGAGKEPGLQVWRIENLDLKPVPKKL-YGSFYTGDAYLLLFTT------AAPSYNIHMWLGDECSQDESGAAAIFATQMDDFLGGGPVQFREVQNHESNAFLGYFKSGIKYQKGGVA-SGFQHVVTNDMNVKRLLQVKGRRAIRATEVEMSWSSFNKGDCFIVDLGKD-VYVWCGSESNRFERLKASQVGIDIRDNERNGRAKLHMVEEGAEPSELTEVLGPTTTIAPSTPDDDKVEAVNRN----NSALYMISDASGAMKV-TVVAQSSPFKQAMLSPEECYILDNGPDKNIFVWKGPKANEKERKQAMLAAQQFMKDKGYSQKTQIQVFPQGSETTLFKQFFCDW---------RDKEETTGPG----------------KAYTIGRIAKVEQVPFDASMLHSNKAMAAQHGMVDDGKG-KVQIWRVENGEKVPVDPASYGLFYGGDCYLILYSY-----------------RQGARERHLIYTWQGLKCT-----QDELGASAFLTIQLD--DSMGGAPVQV------RVTQGQEPSHLMSLFQGKPMIILSGGTSRKGGQSQAGSTRLFHIRQS-SAGATRAVEVNPTASNLNTNDVFVLKSPSA--------LYVWRGKGAS---DEEVKAAKHVVNFLGGTPSNVSENKEPADFWSALGGKKEYQTSKSLQGIIKPPRLFGCSNKTGRLVVEEVPGDFTQSDLATDDVMILDTWDQLFIWVGNEANEEEKNGAPKIAKDYVDS----DPAGRRGIPITTIKQGAEPPTFTGWFQAW 703          
BLAST of Protein flightless-1 vs. Ensembl Medaka
Match: vill (villin like [Source:NCBI gene;Acc:101155645])

HSP 1 Score: 174.481 bits (441), Expect = 7.315e-44
Identity = 189/794 (23.80%), Postives = 327/794 (41.18%), Query Frame = 2
Query: 2015 DVGIEPGIELWDMDDFYPRRITDELPLGTFFDGDCYIILHTSLDEKSHTSLNHSIYYWIGSQASLDKVTASAVHAVYLRNYLSTNCRCERTEQGDESPEFVALFEGNIIVCEGARGQTGFLKTEDKEHRKKMYRLFGADKSISIYSLDPTPENLDSKFVYLFDESSTRLFLWIGNKSRLMLQTKGRLLADNINQTERKGQSEI-ITERENS-ESDEFKNSLQSSSGIDSLDWSNLSSKEVSIDWKPPTPILYDVKLGRGYLEMPQIELPNGRLVKSLLEAKHVYILDSNGD-MFVWIGDMAPKFLKFAGXXXXXXXXXXXXXXXXXXXTVCCQTSEPQIFKMQFADWVDTCAVDFTRSVESVRKRGVNLXXXXXXXXXXXXXRAFFMPRERPMPLEDAKAIMEDCNEDLVGNNMDSNDGKPFKIKQFVYLNRNWVLVEDKWIGHFFNQDCYIVHAEYWXXXXXXXXXXXXXXXXXXXSRIQTVIYFWQGREASDIPWLQFNFSLKKEMEIKFSGMDNMSTTKDSFKKVETKRMFQQQEISTFLAHFQHRFVIHLGKYQDRYSDQRKNRIELYYLRENGNALCTRTIEVKPMIAFVNSCFHYIMKIPAAASKTENDQII-CWIGKNSDSHYDEVLQAVAADTFPESSDILTVKEGAEPGIFWQALGGKKNYD-----HEAQFMSFSRLFRLSNEQGFFCASEKCSDFCQDDLADEDVMLLDTGSQIYLWFGNRTSDVEKKLSYKAAKLY-QEHMARIQPDRIRQLKITQKKKEPHNFRRCFHGWGPFKEAMDWSG 4366
            ++  + G+++W +++     +  +   G FF+GDCYI+L+   ++ +  S++  ++YWIG+ +S D+  A+A++   L  YL  +    R  QG ESP+F + F+  II   G    +GF   +   +           K ++   ++ +  + ++  ++L D +   +  W G +S    + K  LLA +I   ER G+++I + E  N  ES E    + +  G       +    E     +  +  LY V    G L +   E+    L + LL +   +I+D  G  + VW G  A K  +   +  A   ++           V  +  E  +FK  F  W            E  + +G+     + K      ++   M       L   + +++D + D+            ++I+     N   V V+ K  G F+  DCY+V   Y                   +++ Q ++Y WQGR A+             + EI       ++            R+   +E   FLA F+ +F+I  G      +   ++   L+ +R   N + T+  EV    + +NS   +++K          D++   W GK      DE + A          D   V EG EP  FW ALGGK +Y       + + +   RLF  SN+ G F  +E   DF Q DL ++DVMLLDT  +++LW G   +  E   ++K+A+ Y + H A   PD    +   ++  EP  F   F  W P K    W G
Sbjct:   30 NISRKAGLQIWTINNMKMVSVPTK-AFGNFFEGDCYIVLNIRENKGAAQSID--VHYWIGNSSSQDEQGAAAIYVTQLDEYLGGSPVQYREVQGYESPQFRSYFKSGIIYKTGGV-SSGFTHVDTNSYNILRLMHVKGKKHVTAKEVEVSWNSFNNGDIFLLD-TGKLIVQWNGPQSNRTEKLKAVLLAQDIRDRERGGRAQIGVVEGSNERESPELMKIMTTVLGEKPNKLRDAIPDEKHDQMQTNSVRLYHVFENGGNLVVQ--EVATQPLTQDLLLSSDCFIVDHKGSSVMVWKGKRASKVERQEAMNRALGYIKAKNYPPSTGVEVMSEGGESAMFKHLFKSWT-----------EKGQTKGLGNTHTVGKIAKVDQVKFDVMELHAHPELAAQQRMVDDASGDVT----------VWRIE-----NLELVEVDPKTHGQFYGGDCYLVLYTY-----------------LRSNQKQYILYMWQGRHAT-------------QDEIAACAYQAVTVDSKYNGAPVQVRVVMGKEPRHFLAIFKGKFIIFEGGTGRAGAANPESSTRLFQVRGT-NEMNTKATEVPARASSLNSNDVFLLK---------TDRVCYLWYGKGCSG--DERVMAKTTSDVLFRQDKQVVMEGQEPANFWVALGGKSSYASDKRLQKEELIHSPRLFECSNQTGRFRMTE-VYDFAQSDLDEDDVMLLDTWEELFLWIGKHANKSETTDAWKSAQEYLRSHPAGRDPD--TPIISIKQGNEPPTFTGWFDAWDPLK----WKG 741          

HSP 2 Score: 73.9442 bits (180), Expect = 1.181e-12
Identity = 76/318 (23.90%), Postives = 136/318 (42.77%), Query Frame = 2
Query: 1976 AKPNLDYSKLFDDDVGIEPGIELWDMDDFYPRRITDELPLGTFFDGDCYIILHTSLDEKSHTSLNHSIYYWIGSQASLDKVTASAVHAVYLRNYLSTNCRCERTEQGDESPEFVALFEGNIIVCEGARGQTGFLKTEDKEHRKKMYRLFGADKSISIYSLDPT-PENLDSKFVYLFDESSTRLFLWIG----NKSRLMLQTKGRLLADNINQTERKGQSEIITERENSESDEFKNSLQSSSGIDSLDWSNLSSKEVSIDWKPPTPILYDVKLGRGYLEMPQIELPNGRLVKSLLEAKHVYILDSNGDMFVWIGDMAPK 2914
            A P L   +   DD   +  + +W +++     + D    G F+ GDCY++L+T L       +   +Y W G  A+ D++ A A  AV + +  +      R   G E   F+A+F+G  I+ EG  G+ G     + E   +++++ G ++  +  +  P    +L+S  V+L  ++    +LW G       R+M +T   +L     Q   +GQ          E   F  +L   S       S  S K +  +    +P L++     G   M ++        +S L+   V +LD+  ++F+WIG  A K
Sbjct:  402 AHPELAAQQRMVDDASGD--VTVWRIENLELVEV-DPKTHGQFYGGDCYLVLYTYLRSNQKQYI---LYMWQGRHATQDEIAACAYQAVTVDSKYNGAPVQVRVVMGKEPRHFLAIFKGKFIIFEGGTGRAG---AANPESSTRLFQVRGTNEMNTKATEVPARASSLNSNDVFLL-KTDRVCYLWYGKGCSGDERVMAKTTSDVLFRQDKQVVMEGQ----------EPANFWVALGGKS-------SYASDKRLQKEELIHSPRLFECSNQTGRFRMTEVY----DFAQSDLDEDDVMLLDTWEELFLWIGKHANK 688          
BLAST of Protein flightless-1 vs. Ensembl Medaka
Match: vill (villin like [Source:NCBI gene;Acc:101155645])

HSP 1 Score: 174.096 bits (440), Expect = 8.887e-44
Identity = 189/788 (23.98%), Postives = 324/788 (41.12%), Query Frame = 2
Query: 2033 GIELWDMDDFYPRRITDELPLGTFFDGDCYIILHTSLDEKSHTSLNHSIYYWIGSQASLDKVTASAVHAVYLRNYLSTNCRCERTEQGDESPEFVALFEGNIIVCEGARGQTGFLKTEDKEHRKKMYRLFGADKSISIYSLDPTPENLDSKFVYLFDESSTRLFLWIGNKSRLMLQTKGRLLADNINQTERKGQSEI-ITERENS-ESDEFKNSLQSSSGIDSLDWSNLSSKEVSIDWKPPTPILYDVKLGRGYLEMPQIELPNGRLVKSLLEAKHVYILDSNGD-MFVWIGDMAPKFLKFAGXXXXXXXXXXXXXXXXXXXTVCCQTSEPQIFKMQFADWVDTCAVDFTRSVESVRKRGVNLXXXXXXXXXXXXXRAFFMPRERPMPLEDAKAIMEDCNEDLVGNNMDSNDGKPFKIKQFVYLNRNWVLVEDKWIGHFFNQDCYIVHAEYWXXXXXXXXXXXXXXXXXXXSRIQTVIYFWQGREASDIPWLQFNFSLKKEMEIKFSGMDNMSTTKDSFKKVETKRMFQQQEISTFLAHFQHRFVIHLGKYQDRYSDQRKNRIELYYLRENGNALCTRTIEVKPMIAFVNSCFHYIMKIPAAASKTENDQII-CWIGKNSDSHYDEVLQAVAADTFPESSDILTVKEGAEPGIFWQALGGKKNYD-----HEAQFMSFSRLFRLSNEQGFFCASEKCSDFCQDDLADEDVMLLDTGSQIYLWFGNRTSDVEKKLSYKAAKLY-QEHMARIQPDRIRQLKITQKKKEPHNFRRCFHGWGPFKEAMDWSG 4366
            G+++W +++     +  +   G FF+GDCYI+L+   ++ +  S++  ++YWIG+ +S D+  A+A++   L  YL  +    R  QG ESP+F + F+  II   G    +GF   +   +           K ++   ++ +  + ++  ++L D +   +  W G +S    + K  LLA +I   ER G+++I + E  N  ES E    + +  G       +    E     +  +  LY V    G L +   E+    L + LL +   +I+D  G  + VW G  A K  +   +  A   ++           V  +  E  +FK  F  W            E  + +G+     + K      ++   M       L   + +++D + D+            ++I+     N   V V+ K  G F+  DCY+V   Y                   +++ Q ++Y WQGR A+             + EI       ++            R+   +E   FLA F+ +F+I  G      +   ++   L+ +R   N + T+  EV    + +NS   +++K          D++   W GK      DE + A          D   V EG EP  FW ALGGK +Y       + + +   RLF  SN+ G F  +E   DF Q DL ++DVMLLDT  +++LW G   +  E   ++K+A+ Y + H A   PD    +   ++  EP  F   F  W P K    W G
Sbjct:   18 GLQIWTINNMKMVSVPTK-AFGNFFEGDCYIVLNIRENKGAAQSID--VHYWIGNSSSQDEQGAAAIYVTQLDEYLGGSPVQYREVQGYESPQFRSYFKSGIIYKTGGV-SSGFTHVDTNSYNILRLMHVKGKKHVTAKEVEVSWNSFNNGDIFLLD-TGKLIVQWNGPQSNRTEKLKAVLLAQDIRDRERGGRAQIGVVEGSNERESPELMKIMTTVLGEKPNKLRDAIPDEKHDQMQTNSVRLYHVFENGGNLVVQ--EVATQPLTQDLLLSSDCFIVDHKGSSVMVWKGKRASKVERQEAMNRALGYIKAKNYPPSTGVEVMSEGGESAMFKHLFKSWT-----------EKGQTKGLGNTHTVGKIAKVDQVKFDVMELHAHPELAAQQRMVDDASGDVT----------VWRIE-----NLELVEVDPKTHGQFYGGDCYLVLYTY-----------------LRSNQKQYILYMWQGRHAT-------------QDEIAACAYQAVTVDSKYNGAPVQVRVVMGKEPRHFLAIFKGKFIIFEGGTGRAGAANPESSTRLFQVRGT-NEMNTKATEVPARASSLNSNDVFLLK---------TDRVCYLWYGKGCSG--DERVMAKTTSDVLFRQDKQVVMEGQEPANFWVALGGKSSYASDKRLQKEELIHSPRLFECSNQTGRFRMTE-VYDFAQSDLDEDDVMLLDTWEELFLWIGKHANKSETTDAWKSAQEYLRSHPAGRDPD--TPIISIKQGNEPPTFTGWFDAWDPLK----WKG 723          

HSP 2 Score: 73.559 bits (179), Expect = 1.481e-12
Identity = 76/318 (23.90%), Postives = 136/318 (42.77%), Query Frame = 2
Query: 1976 AKPNLDYSKLFDDDVGIEPGIELWDMDDFYPRRITDELPLGTFFDGDCYIILHTSLDEKSHTSLNHSIYYWIGSQASLDKVTASAVHAVYLRNYLSTNCRCERTEQGDESPEFVALFEGNIIVCEGARGQTGFLKTEDKEHRKKMYRLFGADKSISIYSLDPT-PENLDSKFVYLFDESSTRLFLWIG----NKSRLMLQTKGRLLADNINQTERKGQSEIITERENSESDEFKNSLQSSSGIDSLDWSNLSSKEVSIDWKPPTPILYDVKLGRGYLEMPQIELPNGRLVKSLLEAKHVYILDSNGDMFVWIGDMAPK 2914
            A P L   +   DD   +  + +W +++     + D    G F+ GDCY++L+T L       +   +Y W G  A+ D++ A A  AV + +  +      R   G E   F+A+F+G  I+ EG  G+ G     + E   +++++ G ++  +  +  P    +L+S  V+L  ++    +LW G       R+M +T   +L     Q   +GQ          E   F  +L   S       S  S K +  +    +P L++     G   M ++        +S L+   V +LD+  ++F+WIG  A K
Sbjct:  384 AHPELAAQQRMVDDASGD--VTVWRIENLELVEV-DPKTHGQFYGGDCYLVLYTYLRSNQKQYI---LYMWQGRHATQDEIAACAYQAVTVDSKYNGAPVQVRVVMGKEPRHFLAIFKGKFIIFEGGTGRAG---AANPESSTRLFQVRGTNEMNTKATEVPARASSLNSNDVFLL-KTDRVCYLWYGKGCSGDERVMAKTTSDVLFRQDKQVVMEGQ----------EPANFWVALGGKS-------SYASDKRLQKEELIHSPRLFECSNQTGRFRMTEVY----DFAQSDLDEDDVMLLDTWEELFLWIGKHANK 670          
BLAST of Protein flightless-1 vs. Planmine SMEST
Match: SMESG000020935.1 (SMESG000020935.1)

HSP 1 Score: 2309.26 bits (5983), Expect = 0.000e+0
Identity = 1245/1256 (99.12%), Postives = 1247/1256 (99.28%), Query Frame = 2
Query:  599 MTRIQWLKLVSTGLEQIPKGVEKLTQLQRLTISKNNINKLSGDWCTELKALRVFNARKNKLTDDSLPEQLFNNPQLQVVDLSFNLLTEVPAGLVEAKSLLVLNLSDNQIKNVSKDLFANCVSLMILDLSNNQIVGFPTXXXXXXXXXXXXXXXXXXXXXXXRSINGXXXXXXXXXXXXXXXXENIPSDLDKLPCLQDLDISDNNLPKVPQTIYEITSLTKLNLSGNEIDELSGLVDCWPNLEVXXXXXXXXXXXPSFITRLSKLKKLYVDENRLTFNGIPPGIGKLSNLEVFSASENLLENIPEGLCRCGQLKHLNLRMNKLVTLPDAINVLIESLKTFNIENNPNLKMPPKLVEVDLKSKYAFYNIDFSLETQMQLARGAPAKASSKSVTQKHKFTQDTASRIRRLRRKKIDEKSEKGSDSKRVLEGMQKVAKDKDAIMEDREKEEKLLSAKKWQDAIAKPNLDYSKLFDDDVGIEPGIELWDMDDFYPRRITDELPLGTFFDGDCYIILHTSLDEKSHTSLNHSIYYWIGSQASLDKVTASAVHAVYLRNYLSTNCRCERTEQGDESPEFVALFEGNIIVCEGARGQTGFLKTEDKEHRKKMYRLFGADKSISIYSLDPTPENLDSKFVYLFDESSTRLFLWIGNKSRLMLQTKGRLLADNINQTERKGQSEIITERENSESDEFKNSLQSSSGIDSLDWSNLSSKEVSIDWKPPTPILYDVKLGRGYLEMPQIELPNGRLVKSLLEAKHVYILDSNGDMFVWIGDMAPKFLKFAGXXXXXXXXXXXXXXXXXXXTVCCQTSEPQIFKMQFADWVDTCAVDFTRSVESVRKRGVNLXXXXXXXXXXXXXRAFFMPRERPMPLEDAKAIMEDCNEDLVGNNMDSNDGKPFKIKQFVYLNRNWVLVEDKWIGHFFNQDCYIVHAEYWXXXXXXXXXXXXXXXXXXXSRIQTVIYFWQGREASDIPWLQFNFSLKKEMEIKFSGMDNMSTTKDSFKKVETKRMFQQQEISTFLAHFQHRFVIHLGKYQDRYSDQRKNRIELYYLRENGNALCTRTIEVKPMIAFVNSCFHYIMKIPAAASKTENDQIICWIGKNSDSHYDEVLQAVAADTFPESSDILTVKEGAEPGIFWQALGGKKNYDHEAQFMSFSRLFRLSNEQGFFCASEKCSDFCQDDLADEDVMLLDTGSQIYLWFGNRTSDVEKKLSYKAAKLYQEHMARIQPDRIRQLKITQKKKEPHNFRRCFHGWGPFKEAMDWSG 4366
            MTRIQWLKLVSTGLEQIPKGVEKLTQLQRLTISKNNIN+LSGDWCTELKALRVFNARKNKLTDDSLPEQLFNNPQLQVVDLSFNLLTEVPAGLVEAKSLLVLNLSDNQIKNVSKDLFANCVSLMILDLSNNQIVGFPTNLRRSPNLQSLNLSNNPLSMSQLRSINGLKKLTTLLLSNTSRRLENIPSDLDKLPCLQDLDISDNNLPKVPQTIYEITSLTKLNLSGNEIDELSGLVDCWPNLEVLNLSRNRLNSLPSFITRLSKLKKLYVDENRLTFNGIPPGIGKLSNLEVFSASENLLENIPEGLCRCGQLKHLNLRMNKLVTLPDAINVLIESLKTFNIENNPNLKMPPKLVEVDLKSKYAFYNIDFSLETQMQLARGAPAKASSKSVTQK     DTASRIRRLRRKKIDEKSEKGSDSKRVLEGMQKVAKDKDAIMEDREKEEKLLSAKKWQDAIAKPNLDYSKLFDDDVGIEPGIELWDMDDFYPRRITDELPLGTFFDGDCYIILHTSLDEKSHTSLNHSIYYWIGSQASLDKVTASAVHAVYLRNYLSTNCRCERTEQGDESPEFVALFEGNIIVCEGARGQTGFLKTEDKEHRKKMYRLFGADKSISIYSLD TPENLDSKFVYLFDES TRLFLWIGNKSRLMLQTKGRLLADNINQTERKGQSEIITERENSESDEFKNSLQSSSGIDSLDWSNLSS+EVSIDWKPPTPILYDVKLGRGYLEMPQIELPNGRLVKSLLEAKHVYILDSNGDMFVWIGDMAPKFLKFAGLKLAYELLELLPRSSRLSPTVCCQTSEPQIFKMQFADWVDTCAVDFTRSVESVRKRGVNLDDIIEKDKMKIDMRAFFMPRERPMP EDAKAIMEDCNEDLVGNNMDSNDGKPFKIKQFVYLNRNWVLVEDKWIGHFFNQDCYIVHAEYWELPEEDDPDAEEDGTDEETSRIQTVIYFWQGREASDIPWLQFNFSLKKEMEIKFSGMDNMSTTKDSFKKVETKRMFQQQEISTFLAHFQHRFVIHLGKYQDRYSDQRKNRIELYYLRENGNALCTRTIEVKPMIAFVNSCFHYIMKIPAAASKTENDQIICWIGKNSDSHYDEVLQAVAADTFPES DILTVKEGAEPGIFWQALGGKKNYDHEAQFMSFSRLFRLSNEQGFFCASEKCSDFCQDDLADEDVMLLDTGSQIYLWFGNRTSDVEKKLSYKAAKLYQEHMARIQPDRIRQLKITQKKKEPHNFRRCFHGWGPFKEAMDWSG
Sbjct:    1 MTRIQWLKLVSTGLEQIPKGVEKLTQLQRLTISKNNINQLSGDWCTELKALRVFNARKNKLTDDSLPEQLFNNPQLQVVDLSFNLLTEVPAGLVEAKSLLVLNLSDNQIKNVSKDLFANCVSLMILDLSNNQIVGFPTNLRRSPNLQSLNLSNNPLSMSQLRSINGLKKLTTLLLSNTSRRLENIPSDLDKLPCLQDLDISDNNLPKVPQTIYEITSLTKLNLSGNEIDELSGLVDCWPNLEVLNLSRNRLNSLPSFITRLSKLKKLYVDENRLTFNGIPPGIGKLSNLEVFSASENLLENIPEGLCRCGQLKHLNLRMNKLVTLPDAINVLIESLKTFNIENNPNLKMPPKLVEVDLKSKYAFYNIDFSLETQMQLARGAPAKASSKSVTQK-----DTASRIRRLRRKKIDEKSEKGSDSKRVLEGMQKVAKDKDAIMEDREKEEKLLSAKKWQDAIAKPNLDYSKLFDDDVGIEPGIELWDMDDFYPRRITDELPLGTFFDGDCYIILHTSLDEKSHTSLNHSIYYWIGSQASLDKVTASAVHAVYLRNYLSTNCRCERTEQGDESPEFVALFEGNIIVCEGARGQTGFLKTEDKEHRKKMYRLFGADKSISIYSLDSTPENLDSKFVYLFDESPTRLFLWIGNKSRLMLQTKGRLLADNINQTERKGQSEIITERENSESDEFKNSLQSSSGIDSLDWSNLSSREVSIDWKPPTPILYDVKLGRGYLEMPQIELPNGRLVKSLLEAKHVYILDSNGDMFVWIGDMAPKFLKFAGLKLAYELLELLPRSSRLSPTVCCQTSEPQIFKMQFADWVDTCAVDFTRSVESVRKRGVNLDDIIEKDKMKIDMRAFFMPRERPMPWEDAKAIMEDCNEDLVGNNMDSNDGKPFKIKQFVYLNRNWVLVEDKWIGHFFNQDCYIVHAEYWELPEEDDPDAEEDGTDEETSRIQTVIYFWQGREASDIPWLQFNFSLKKEMEIKFSGMDNMSTTKDSFKKVETKRMFQQQEISTFLAHFQHRFVIHLGKYQDRYSDQRKNRIELYYLRENGNALCTRTIEVKPMIAFVNSCFHYIMKIPAAASKTENDQIICWIGKNSDSHYDEVLQAVAADTFPESLDILTVKEGAEPGIFWQALGGKKNYDHEAQFMSFSRLFRLSNEQGFFCASEKCSDFCQDDLADEDVMLLDTGSQIYLWFGNRTSDVEKKLSYKAAKLYQEHMARIQPDRIRQLKITQKKKEPHNFRRCFHGWGPFKEAMDWSG 1251          
BLAST of Protein flightless-1 vs. Planmine SMEST
Match: SMESG000020935.1 (SMESG000020935.1)

HSP 1 Score: 2065.43 bits (5350), Expect = 0.000e+0
Identity = 1123/1133 (99.12%), Postives = 1124/1133 (99.21%), Query Frame = 2
Query:  968 MILDLSNNQIVGFPTXXXXXXXXXXXXXXXXXXXXXXXRSINGXXXXXXXXXXXXXXXXENIPSDLDKLPCLQDLDISDNNLPKVPQTIYEITSLTKLNLSGNEIDELSGLVDCWPNLEVXXXXXXXXXXXPSFITRLSKLKKLYVDENRLTFNGIPPGIGKLSNLEVFSASENLLENIPEGLCRCGQLKHLNLRMNKLVTLPDAINVLIESLKTFNIENNPNLKMPPKLVEVDLKSKYAFYNIDFSLETQMQLARGAPAKASSKSVTQKHKFTQDTASRIRRLRRKKIDEKSEKGSDSKRVLEGMQKVAKDKDAIMEDREKEEKLLSAKKWQDAIAKPNLDYSKLFDDDVGIEPGIELWDMDDFYPRRITDELPLGTFFDGDCYIILHTSLDEKSHTSLNHSIYYWIGSQASLDKVTASAVHAVYLRNYLSTNCRCERTEQGDESPEFVALFEGNIIVCEGARGQTGFLKTEDKEHRKKMYRLFGADKSISIYSLDPTPENLDSKFVYLFDESSTRLFLWIGNKSRLMLQTKGRLLADNINQTERKGQSEIITERENSESDEFKNSLQSSSGIDSLDWSNLSSKEVSIDWKPPTPILYDVKLGRGYLEMPQIELPNGRLVKSLLEAKHVYILDSNGDMFVWIGDMAPKFLKFAGXXXXXXXXXXXXXXXXXXXTVCCQTSEPQIFKMQFADWVDTCAVDFTRSVESVRKRGVNLXXXXXXXXXXXXXRAFFMPRERPMPLEDAKAIMEDCNEDLVGNNMDSNDGKPFKIKQFVYLNRNWVLVEDKWIGHFFNQDCYIVHAEYWXXXXXXXXXXXXXXXXXXXSRIQTVIYFWQGREASDIPWLQFNFSLKKEMEIKFSGMDNMSTTKDSFKKVETKRMFQQQEISTFLAHFQHRFVIHLGKYQDRYSDQRKNRIELYYLRENGNALCTRTIEVKPMIAFVNSCFHYIMKIPAAASKTENDQIICWIGKNSDSHYDEVLQAVAADTFPESSDILTVKEGAEPGIFWQALGGKKNYDHEAQFMSFSRLFRLSNEQGFFCASEKCSDFCQDDLADEDVMLLDTGSQIYLWFGNRTSDVEKKLSYKAAKLYQEHMARIQPDRIRQLKITQKKKEPHNFRRCFHGWGPFKEAMDWSG 4366
            MILDLSNNQIVGFPTNLRRSPNLQSLNLSNNPLSMSQLRSINGLKKLTTLLLSNTSRRLENIPSDLDKLPCLQDLDISDNNLPKVPQTIYEITSLTKLNLSGNEIDELSGLVDCWPNLEVLNLSRNRLNSLPSFITRLSKLKKLYVDENRLTFNGIPPGIGKLSNLEVFSASENLLENIPEGLCRCGQLKHLNLRMNKLVTLPDAINVLIESLKTFNIENNPNLKMPPKLVEVDLKSKYAFYNIDFSLETQMQLARGAPAKASSKSVTQK     DTASRIRRLRRKKIDEKSEKGSDSKRVLEGMQKVAKDKDAIMEDREKEEKLLSAKKWQDAIAKPNLDYSKLFDDDVGIEPGIELWDMDDFYPRRITDELPLGTFFDGDCYIILHTSLDEKSHTSLNHSIYYWIGSQASLDKVTASAVHAVYLRNYLSTNCRCERTEQGDESPEFVALFEGNIIVCEGARGQTGFLKTEDKEHRKKMYRLFGADKSISIYSLD TPENLDSKFVYLFDES TRLFLWIGNKSRLMLQTKGRLLADNINQTERKGQSEIITERENSESDEFKNSLQSSSGIDSLDWSNLSS+EVSIDWKPPTPILYDVKLGRGYLEMPQIELPNGRLVKSLLEAKHVYILDSNGDMFVWIGDMAPKFLKFAGLKLAYELLELLPRSSRLSPTVCCQTSEPQIFKMQFADWVDTCAVDFTRSVESVRKRGVNLDDIIEKDKMKIDMRAFFMPRERPMP EDAKAIMEDCNEDLVGNNMDSNDGKPFKIKQFVYLNRNWVLVEDKWIGHFFNQDCYIVHAEYWELPEEDDPDAEEDGTDEETSRIQTVIYFWQGREASDIPWLQFNFSLKKEMEIKFSGMDNMSTTKDSFKKVETKRMFQQQEISTFLAHFQHRFVIHLGKYQDRYSDQRKNRIELYYLRENGNALCTRTIEVKPMIAFVNSCFHYIMKIPAAASKTENDQIICWIGKNSDSHYDEVLQAVAADTFPES DILTVKEGAEPGIFWQALGGKKNYDHEAQFMSFSRLFRLSNEQGFFCASEKCSDFCQDDLADEDVMLLDTGSQIYLWFGNRTSDVEKKLSYKAAKLYQEHMARIQPDRIRQLKITQKKKEPHNFRRCFHGWGPFKEAMDWSG
Sbjct:    1 MILDLSNNQIVGFPTNLRRSPNLQSLNLSNNPLSMSQLRSINGLKKLTTLLLSNTSRRLENIPSDLDKLPCLQDLDISDNNLPKVPQTIYEITSLTKLNLSGNEIDELSGLVDCWPNLEVLNLSRNRLNSLPSFITRLSKLKKLYVDENRLTFNGIPPGIGKLSNLEVFSASENLLENIPEGLCRCGQLKHLNLRMNKLVTLPDAINVLIESLKTFNIENNPNLKMPPKLVEVDLKSKYAFYNIDFSLETQMQLARGAPAKASSKSVTQK-----DTASRIRRLRRKKIDEKSEKGSDSKRVLEGMQKVAKDKDAIMEDREKEEKLLSAKKWQDAIAKPNLDYSKLFDDDVGIEPGIELWDMDDFYPRRITDELPLGTFFDGDCYIILHTSLDEKSHTSLNHSIYYWIGSQASLDKVTASAVHAVYLRNYLSTNCRCERTEQGDESPEFVALFEGNIIVCEGARGQTGFLKTEDKEHRKKMYRLFGADKSISIYSLDSTPENLDSKFVYLFDESPTRLFLWIGNKSRLMLQTKGRLLADNINQTERKGQSEIITERENSESDEFKNSLQSSSGIDSLDWSNLSSREVSIDWKPPTPILYDVKLGRGYLEMPQIELPNGRLVKSLLEAKHVYILDSNGDMFVWIGDMAPKFLKFAGLKLAYELLELLPRSSRLSPTVCCQTSEPQIFKMQFADWVDTCAVDFTRSVESVRKRGVNLDDIIEKDKMKIDMRAFFMPRERPMPWEDAKAIMEDCNEDLVGNNMDSNDGKPFKIKQFVYLNRNWVLVEDKWIGHFFNQDCYIVHAEYWELPEEDDPDAEEDGTDEETSRIQTVIYFWQGREASDIPWLQFNFSLKKEMEIKFSGMDNMSTTKDSFKKVETKRMFQQQEISTFLAHFQHRFVIHLGKYQDRYSDQRKNRIELYYLRENGNALCTRTIEVKPMIAFVNSCFHYIMKIPAAASKTENDQIICWIGKNSDSHYDEVLQAVAADTFPESLDILTVKEGAEPGIFWQALGGKKNYDHEAQFMSFSRLFRLSNEQGFFCASEKCSDFCQDDLADEDVMLLDTGSQIYLWFGNRTSDVEKKLSYKAAKLYQEHMARIQPDRIRQLKITQKKKEPHNFRRCFHGWGPFKEAMDWSG 1128          
BLAST of Protein flightless-1 vs. Planmine SMEST
Match: SMESG000013154.1 (SMESG000013154.1)

HSP 1 Score: 100.523 bits (249), Expect = 2.717e-21
Identity = 111/370 (30.00%), Postives = 179/370 (48.38%), Query Frame = 2
Query:  575 DCSEAFSNMTRIQWLKLVSTGLEQIPKGVEKLTQLQRLTISKNNINKLSGD--WCTELKALRVFNARKNKLTDDSLPEQLFNNPQLQVVDLSFNLLTEVPAGLVEAKSLLVLNLSDNQIKNVSKDLFANCVSLMILDLSNNQIVGFPTXXXXXXXXXXXXXXXXXXXXXXXRSINGXXXXXXXXXXXXXXXXENIPSDLDKLPCLQDLDISDNNLPKVPQTIYEITSLTKLNLSGNEIDELSGLVDCWPNLEVXXXXXXXXXXXPSFITRLSKLKKLYVDENRLTFNGIPPGIGKLSNLEVFSASENLLENIPEGLCRCGQLKHLNLRMNKLVTLPDAINVLIESLKTFNIENNPNLKMPPKLVEVDLKS 1678
            D  + F  +++++ L L    L  IP+ +     L  L +S+N+I+ +  +  +C EL++L + N   N+L     PE   +   L V++L+ N LTE+P        L  L L DN +K +    F+  V L ILDL  N+   FP +L +   L+ L+L NN L                          +N+P +L  L  LQ LD+S+N L  + + I  +  LT   LS N +D L   +     L +L + +N+L SL + I   SKL++LY+ EN LT   +P  +G+LS L   +   N L +IP  L +C +L  ++ R N +  LPD I  + + L   +I  N   ++P  + +  LK+
Sbjct:   51 DLPKNFFKLSKLRVLTLSDNELTYIPESIGNFNHLVELDVSRNHIDSVHYNIKFCNELRSLDLSNNPINRL-----PEGFSSLRNLIVLNLNDNSLTELPNDFGNLSLLQKLELRDNCLKTLPNS-FSKFVHLEILDLGGNEFQEFPKSLAKLSALRELSLDNNEL--------------------------QNLPQELGTLKNLQQLDVSENFLEVICEEIGNLEQLTDFALSQNSLDSLPNNIGNLKELTILKVDQNKLMSLTTHIGSCSKLQELYLTENLLT--KLPGSLGRLSKLVHLNVDRNNLNSIPPELSKCNELSIMSFRDNHIRRLPDEIGNM-KKLHVLDISINQIDRLPLSIAQCPLKA 385          
BLAST of Protein flightless-1 vs. Planmine SMEST
Match: SMESG000013154.1 (SMESG000013154.1)

HSP 1 Score: 100.523 bits (249), Expect = 2.727e-21
Identity = 111/370 (30.00%), Postives = 179/370 (48.38%), Query Frame = 2
Query:  575 DCSEAFSNMTRIQWLKLVSTGLEQIPKGVEKLTQLQRLTISKNNINKLSGD--WCTELKALRVFNARKNKLTDDSLPEQLFNNPQLQVVDLSFNLLTEVPAGLVEAKSLLVLNLSDNQIKNVSKDLFANCVSLMILDLSNNQIVGFPTXXXXXXXXXXXXXXXXXXXXXXXRSINGXXXXXXXXXXXXXXXXENIPSDLDKLPCLQDLDISDNNLPKVPQTIYEITSLTKLNLSGNEIDELSGLVDCWPNLEVXXXXXXXXXXXPSFITRLSKLKKLYVDENRLTFNGIPPGIGKLSNLEVFSASENLLENIPEGLCRCGQLKHLNLRMNKLVTLPDAINVLIESLKTFNIENNPNLKMPPKLVEVDLKS 1678
            D  + F  +++++ L L    L  IP+ +     L  L +S+N+I+ +  +  +C EL++L + N   N+L     PE   +   L V++L+ N LTE+P        L  L L DN +K +    F+  V L ILDL  N+   FP +L +   L+ L+L NN L                          +N+P +L  L  LQ LD+S+N L  + + I  +  LT   LS N +D L   +     L +L + +N+L SL + I   SKL++LY+ EN LT   +P  +G+LS L   +   N L +IP  L +C +L  ++ R N +  LPD I  + + L   +I  N   ++P  + +  LK+
Sbjct:   51 DLPKNFFKLSKLRVLTLSDNELTYIPESIGNFNHLVELDVSRNHIDSVHYNIKFCNELRSLDLSNNPINRL-----PEGFSSLRNLIVLNLNDNSLTELPNDFGNLSLLQKLELRDNCLKTLPNS-FSKFVHLEILDLGGNEFQEFPKSLAKLSALRELSLDNNEL--------------------------QNLPQELGTLKNLQQLDVSENFLEVICEEIGNLEQLTDFALSQNSLDSLPNNIGNLKELTILKVDQNKLMSLTTHIGSCSKLQELYLTENLLT--KLPGSLGRLSKLVHLNVDRNNLNSIPPELSKCNELSIMSFRDNHIRRLPDEIGNM-KKLHVLDISINQIDRLPLSIAQCPLKA 385          
BLAST of Protein flightless-1 vs. Planmine SMEST
Match: SMESG000015924.1 (SMESG000015924.1)

HSP 1 Score: 91.2781 bits (225), Expect = 5.314e-19
Identity = 76/275 (27.64%), Postives = 135/275 (49.09%), Query Frame = 2
Query: 2093 LGTFFDGDCYIILHTSLDEKSHTSLNHSIYYWIGSQASLDKVTASAVHAVYLRNYLSTNCRCERTEQGDESPEFVALFEGNIIVCEGARGQTGFLKTEDKEHRKKMYRLFGADKSISIYSLDPTPENLDSKFVYLFDESSTRLFLWIGNKSRLMLQTKGRLLADNINQTERKG--QSEIITERENSESDEFKNSLQSSSGI-DSLDWSNLSSKEVSIDWKPPTPILYDVKLGRGYLEMPQIELPNGRLVKSLLEAKHVYILDSNGDMFVWIGDMA 2908
             G FF+GD YI+L+    EK    L + I++WIG  ++ D+   +A   V L   L       R  Q  ES  F + F  NII  +G   ++GF     +E+  ++  + G   +I I  +  T +NL+S  V++FD  S  ++ WIG  +    + K +  A  +N ++R G  + E++ E + S + EF N L ++  I D  +  +L++ E           L+ +    G+L+  Q+   +G   KS +    V+I+D+   ++V++G+ A
Sbjct:   65 FGEFFEGDSYIVLNIYQKEK---ELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYFP-NIIYLKGG-CESGFRHVNTREYNPRLLHVRGEKNNIIISEVSSTKKNLNSDDVFIFDSGSC-IYQWIGKGANKDERFKAQQFAQQLN-SDRNGKLKIEVLDEGQMSPNHEFYNKLSNNEPIADDKNHKSLTAHEKK---------LFRISDETGHLKFEQV--ASGNFNKSNIHENDVFIIDNGQVIYVYVGEKA 321          
The following BLAST results are available for this feature:
BLAST of Protein flightless-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FLII0.000e+040.23FLII actin remodeling protein [Source:HGNC Symbol;... [more]
FLII0.000e+040.23FLII actin remodeling protein [Source:HGNC Symbol;... [more]
FLII0.000e+040.43FLII actin remodeling protein [Source:HGNC Symbol;... [more]
FLII0.000e+040.43FLII actin remodeling protein [Source:HGNC Symbol;... [more]
FLII0.000e+038.57FLII actin remodeling protein [Source:HGNC Symbol;... [more]
back to top
BLAST of Protein flightless-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fli-10.000e+038.06pep chromosome:WBcel235:III:8675297:8683732:-1 gen... [more]
let-4131.364e-1327.99pep chromosome:WBcel235:V:7972924:7977774:-1 gene:... [more]
let-4131.807e-1327.99pep chromosome:WBcel235:V:7972934:7977774:-1 gene:... [more]
gsnl-13.256e-1223.08Gelsolin-like protein 1 [Source:UniProtKB/Swiss-P... [more]
soc-22.409e-1126.92Leucine-rich repeat protein soc-2 [Source:UniProt... [more]
back to top
BLAST of Protein flightless-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fliI0.000e+041.01gene:FBgn0000709 transcript:FBtr0077192[more]
Gel2.413e-1823.37gene:FBgn0010225 transcript:FBtr0309257[more]
Gel2.527e-1823.37gene:FBgn0010225 transcript:FBtr0336707[more]
Gel2.527e-1823.37gene:FBgn0010225 transcript:FBtr0078971[more]
Gel2.715e-1823.37gene:FBgn0010225 transcript:FBtr0078973[more]
back to top
BLAST of Protein flightless-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
flii0.000e+041.30FLII actin remodeling protein [Source:ZFIN;Acc:ZDB... [more]
vil13.842e-4924.28villin 1 [Source:ZFIN;Acc:ZDB-GENE-040426-799][more]
vil13.842e-4924.28villin 1 [Source:ZFIN;Acc:ZDB-GENE-040426-799][more]
vil13.842e-4924.28villin 1 [Source:ZFIN;Acc:ZDB-GENE-040426-799][more]
avil6.685e-4925.77advillin [Source:ZFIN;Acc:ZDB-GENE-060421-6683][more]
back to top
BLAST of Protein flightless-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rin20.000e+040.09Ras and Rab interactor 2 [Source:Xenbase;Acc:XB-GE... [more]
rin20.000e+039.73Ras and Rab interactor 2 [Source:Xenbase;Acc:XB-GE... [more]
rin20.000e+039.82Ras and Rab interactor 2 [Source:Xenbase;Acc:XB-GE... [more]
rin22.114e-13243.12Ras and Rab interactor 2 [Source:Xenbase;Acc:XB-GE... [more]
agpat21.436e-5526.121-acylglycerol-3-phosphate O-acyltransferase 2 [So... [more]
back to top
BLAST of Protein flightless-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Flii0.000e+040.00flightless I actin binding protein [Source:MGI Sym... [more]
Vil12.693e-4725.03villin 1 [Source:MGI Symbol;Acc:MGI:98930][more]
Scin6.589e-4424.87scinderin [Source:MGI Symbol;Acc:MGI:1306794][more]
Avil7.716e-4225.36advillin [Source:MGI Symbol;Acc:MGI:1333798][more]
Avil7.716e-4225.36advillin [Source:MGI Symbol;Acc:MGI:1333798][more]
back to top
BLAST of Protein flightless-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q24020|FLII_DROME0.000e+041.01Protein flightless-1 OS=Drosophila melanogaster OX... [more]
sp|Q13045|FLII_HUMAN0.000e+040.23Protein flightless-1 homolog OS=Homo sapiens OX=96... [more]
sp|Q9JJ28|FLII_MOUSE0.000e+040.00Protein flightless-1 homolog OS=Mus musculus OX=10... [more]
sp|P34268|FLII_CAEEL0.000e+038.06Protein flightless-1 homolog OS=Caenorhabditis ele... [more]
sp|Q62468|VILI_MOUSE1.884e-4625.03Villin-1 OS=Mus musculus OX=10090 GN=Vil1 PE=1 SV=... [more]
back to top
BLAST of Protein flightless-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G4V8P70.000e+049.34Putative flightless-I OS=Schistosoma mansoni OX=61... [more]
A0A4Z2DTC00.000e+047.29Protein flightless-1 isoform 1 OS=Schistosoma japo... [more]
A0A3Q0KS460.000e+047.49Putative flightless-I OS=Schistosoma mansoni OX=61... [more]
A0A4Z2DTI50.000e+047.29Protein flightless-1 isoform 2 OS=Schistosoma japo... [more]
A0A4S2LTT20.000e+045.66Uncharacterized protein OS=Opisthorchis felineus O... [more]
back to top
BLAST of Protein flightless-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
flii0.000e+041.51FLII actin remodeling protein [Source:NCBI gene;Ac... [more]
flii0.000e+035.24FLII actin remodeling protein [Source:NCBI gene;Ac... [more]
scinla4.333e-4925.00gelsolin-like [Source:NCBI gene;Acc:103039625][more]
scinla6.435e-4925.00gelsolin-like [Source:NCBI gene;Acc:103039625][more]
vil11.576e-4824.21villin 1 [Source:NCBI gene;Acc:103028195][more]
back to top
BLAST of Protein flightless-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008894.11.116e-13142.16pep scaffold:Pmarinus_7.0:GL484493:7018:36468:1 ge... [more]
ENSPMAT00000002072.11.256e-5743.24pep scaffold:Pmarinus_7.0:GL481283:15294:22438:1 g... [more]
avil2.846e-4525.35advillin [Source:ZFIN;Acc:ZDB-GENE-060421-6683][more]
scrib3.174e-1629.19scribble planar cell polarity protein [Source:NCBI... [more]
ENSPMAT00000004940.16.457e-1628.92pep scaffold:Pmarinus_7.0:GL476356:339323:347865:-... [more]
back to top
BLAST of Protein flightless-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
CYR13.541e-827.19Adenylate cyclase; required for cAMP production an... [more]
back to top
BLAST of Protein flightless-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO334609.376e-17240.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO381081.571e-4945.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO346382.586e-2244.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO386586.306e-2226.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO492343.071e-1924.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein flightless-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
flii0.000e+040.68FLII actin remodeling protein [Source:NCBI gene;Ac... [more]
avil9.180e-5326.26advillin [Source:NCBI gene;Acc:101170835][more]
scinlb4.736e-4523.79gelsolin [Source:NCBI gene;Acc:101159773][more]
vill7.315e-4423.80villin like [Source:NCBI gene;Acc:101155645][more]
vill8.887e-4423.98villin like [Source:NCBI gene;Acc:101155645][more]
back to top
BLAST of Protein flightless-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000020935.10.000e+099.12SMESG000020935.1[more]
SMESG000020935.10.000e+099.12SMESG000020935.1[more]
SMESG000013154.12.717e-2130.00SMESG000013154.1[more]
SMESG000013154.12.727e-2130.00SMESG000013154.1[more]
SMESG000015924.15.314e-1927.64SMESG000015924.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019094 ID=SMED30019094|Name=Protein flightless-1|organism=Schmidtea mediterranea sexual|type=transcript|length=4553bp
TATAAATCTTATATGAGAAAATTTATCAAAATTGGATTTGAATGTCGAAT
TTTTTGAATGAAACAATAACTCCAGAAAACAAAATTACAGAACTCAGTGA
ACAAGAAATCAAAGCCAGATTATCTCAAAACCTTTTAACTTTATTAAAGC
CTAGTATTATTGAAACTGATAAAAAAGTTGAAGAAATTCGCAAAAGTCAA
ATTGAATTAAGAAATCAGATCGAATTATTAGCTAAAAACTTAACTGATAT
TAACGAAAATCTTGCAATACCCCTTAATATTGATTCATATTTGAAAAAGC
TTAATAATTGTAAACGTAGATTAACCTTAATTAATAACATATTGCAAAAC
TCACAGGATCGTGTTACTAAATTGCAATCAAACATTTCCAAAGAATCTAA
ACGCCGAATTATTCCGAAGAAAACCAAGCAATCACCACAAACTAACTGAT
TATCCCAAATTAACAATACATATATTGATATTAACTCTATTCAATCTAAC
TAATCCCAATGTCTAAATCCGTATCTCAATTTTTATTGGGCATTGATCTG
TCATGCGTCGAGATCAAAGACAATGATTGCAGTGAAGCCTTCAGTAATAT
GACGAGAATCCAGTGGTTGAAACTTGTCTCCACTGGGTTAGAACAAATCC
CAAAAGGTGTAGAAAAATTAACCCAACTCCAGCGTCTGACCATCAGTAAA
AACAATATCAATAAATTGTCCGGTGATTGGTGTACAGAATTGAAAGCTCT
TCGAGTGTTCAATGCAAGAAAGAACAAACTTACCGATGACAGTTTGCCAG
AACAGCTATTTAACAATCCACAATTGCAGGTTGTCGATTTAAGCTTTAAT
TTGTTGACCGAAGTGCCTGCGGGATTAGTTGAGGCAAAATCATTGCTAGT
TCTCAATCTTAGTGACAATCAAATCAAAAACGTTTCTAAAGATTTATTTG
CCAATTGCGTCAGTCTGATGATTTTAGATTTGAGTAACAATCAAATTGTT
GGATTTCCTACAAACCTCCGTAGATCACCGAATTTGCAATCATTGAATCT
CAGCAATAATCCTCTATCTATGTCCCAGTTGAGATCCATAAATGGACTCA
AAAAGTTAACAACCCTTTTACTCAGCAATACATCTCGACGCCTGGAAAAT
ATTCCTTCAGACCTTGACAAATTACCTTGTTTGCAAGATCTCGATATTTC
AGATAACAATTTACCCAAAGTTCCTCAAACTATTTATGAAATTACAAGTT
TAACCAAGCTCAATTTAAGCGGAAACGAAATCGATGAACTAAGCGGTCTT
GTGGATTGTTGGCCCAATCTGGAAGTGCTCAATCTTAGTCGGAATCGATT
GAACTCTTTGCCGTCTTTTATAACTCGTCTTTCAAAACTTAAAAAGCTTT
ACGTCGATGAAAATAGATTGACTTTCAACGGAATCCCACCGGGAATCGGT
AAACTATCAAATCTTGAAGTATTCAGTGCTTCTGAAAATTTGCTGGAAAA
TATTCCTGAAGGTCTGTGCCGGTGTGGCCAATTGAAACATTTAAATTTGC
GAATGAACAAGCTTGTTACGTTACCTGATGCAATAAACGTCCTAATAGAA
TCACTAAAGACATTCAATATAGAAAACAATCCAAATTTGAAAATGCCTCC
GAAACTCGTTGAAGTCGATTTGAAATCTAAATATGCATTTTATAATATTG
ATTTCTCACTCGAAACTCAAATGCAACTAGCTCGTGGAGCGCCTGCTAAA
GCCTCATCTAAAAGTGTAACGCAAAAGCATAAATTTACCCAGGATACAGC
TTCTCGAATTCGCAGATTGCGACGCAAGAAAATTGACGAAAAAAGTGAAA
AGGGTAGTGATAGTAAAAGGGTTTTGGAAGGAATGCAGAAAGTAGCCAAA
GACAAAGATGCGATAATGGAAGATCGAGAGAAAGAGGAGAAATTATTGTC
GGCAAAGAAATGGCAAGACGCTATTGCCAAACCGAATTTGGATTACAGCA
AATTGTTTGATGATGATGTCGGTATTGAACCTGGAATAGAGCTTTGGGAT
ATGGATGACTTTTATCCAAGGCGAATAACAGATGAATTGCCACTTGGAAC
ATTTTTTGATGGAGATTGTTATATTATTCTTCATACAAGCCTCGACGAAA
AATCTCATACTTCGCTCAATCATTCTATTTATTATTGGATTGGAAGTCAG
GCGTCTCTTGATAAAGTCACTGCTTCGGCTGTTCATGCAGTTTATCTCCG
TAATTATTTATCTACAAATTGCCGCTGTGAAAGAACTGAACAAGGAGACG
AAAGTCCTGAATTTGTAGCTTTATTCGAAGGAAACATAATAGTTTGTGAA
GGCGCCCGTGGACAAACCGGGTTTTTGAAAACTGAAGACAAAGAACATCG
TAAAAAAATGTACAGACTTTTTGGTGCTGACAAAAGCATATCAATTTATT
CTTTGGACCCTACTCCTGAAAATCTCGATAGCAAATTTGTTTATTTATTC
GATGAATCTTCAACACGTCTTTTTCTGTGGATTGGAAATAAAAGTCGTTT
GATGCTGCAAACTAAAGGTCGTCTACTAGCGGACAACATCAACCAAACTG
AGCGTAAGGGTCAGAGTGAAATTATAACAGAAAGAGAAAACTCTGAAAGT
GATGAATTTAAAAATAGCTTGCAATCAAGCTCAGGAATTGATTCACTTGA
TTGGAGTAATCTTTCTTCAAAGGAAGTTTCAATAGATTGGAAGCCACCAA
CGCCTATTCTTTACGATGTCAAATTAGGAAGGGGCTATCTTGAAATGCCA
CAGATTGAATTGCCAAATGGTCGCTTGGTAAAATCACTACTGGAAGCTAA
ACACGTTTATATTCTCGATTCAAATGGCGATATGTTTGTGTGGATAGGAG
ACATGGCACCAAAATTTTTGAAATTTGCCGGTCTTAAATTAGCTTATGAA
CTACTGGAATTATTACCAAGGTCCTCACGACTCAGTCCTACAGTTTGTTG
TCAGACATCTGAACCACAGATATTTAAAATGCAATTTGCTGATTGGGTAG
ATACTTGTGCTGTTGATTTCACGCGTTCAGTAGAATCAGTTCGGAAGCGT
GGAGTTAATTTAGATGACATCATTGAAAAGGATAAAATGAAAATTGACAT
GAGAGCTTTCTTTATGCCTAGGGAAAGGCCTATGCCATTGGAAGATGCTA
AAGCAATAATGGAAGATTGCAATGAAGATTTGGTGGGAAATAATATGGAT
TCAAATGATGGAAAACCTTTCAAAATCAAACAGTTTGTATATTTAAATAG
AAATTGGGTTCTTGTCGAAGATAAATGGATTGGACACTTTTTCAATCAAG
ATTGCTATATTGTCCATGCTGAATATTGGGAATTGCCAGAAGAAGATGAT
CCCGACGCAGAAGAAGATGGTACAGACGAGGAAACGTCTCGCATTCAAAC
TGTGATTTATTTCTGGCAAGGAAGGGAAGCCAGTGATATTCCGTGGTTGC
AATTCAATTTCTCCCTCAAGAAAGAAATGGAAATCAAATTCAGTGGAATG
GATAATATGTCGACAACAAAAGATTCCTTTAAAAAAGTCGAAACTAAACG
CATGTTTCAGCAACAAGAAATTTCCACATTTCTTGCTCATTTTCAGCACA
GATTTGTCATACATCTTGGTAAATATCAAGATCGTTACAGTGACCAAAGA
AAGAATAGAATAGAATTGTATTATTTGCGAGAAAATGGAAATGCACTTTG
CACCAGAACCATAGAAGTGAAACCAATGATTGCCTTTGTAAACTCTTGTT
TTCATTATATAATGAAAATTCCCGCGGCTGCCTCAAAAACTGAAAATGAC
CAAATTATTTGCTGGATCGGAAAGAATTCTGATTCCCATTATGATGAGGT
TTTACAGGCAGTTGCAGCAGATACTTTTCCAGAGAGTTCGGATATTTTAA
CGGTCAAGGAAGGCGCGGAACCGGGGATCTTTTGGCAGGCTTTAGGCGGT
AAAAAGAACTATGATCATGAGGCTCAATTTATGAGCTTTTCTCGTTTATT
CCGATTGAGCAATGAGCAGGGATTCTTTTGTGCCAGTGAAAAGTGCAGCG
ATTTCTGTCAGGACGATTTAGCGGATGAAGATGTGATGCTATTGGATACG
GGCAGTCAGATCTATCTGTGGTTTGGCAATCGAACCTCAGATGTTGAGAA
AAAGCTGTCATATAAGGCCGCCAAGTTATACCAGGAGCATATGGCTAGGA
TTCAACCGGACAGAATTAGACAGCTGAAAATCACACAGAAAAAGAAAGAG
CCACACAATTTTCGAAGATGTTTTCATGGCTGGGGCCCTTTCAAAGAAGC
TATGGATTGGTCGGGATGATTTATGATAAATTCCTTAGTCGATTTTTGAT
AATAATTTCTATTATTGATATATTGTTTGTTGATATATTTGTTCAATTTA
ATTATATTGCTTATTGATTTTTTAATTTTGATTATTTATTTAATTGAATT
TATTGATTTTTCTATTTTCCATTATTTATTGATTTTAATTATATTGCTTA
TTG
back to top

protein sequence of SMED30019094-orf-1

>SMED30019094-orf-1 ID=SMED30019094-orf-1|Name=SMED30019094-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=136bp
MSNFLNETITPENKITELSEQEIKARLSQNLLTLLKPSIIETDKKVEEIR
KSQIELRNQIELLAKNLTDINENLAIPLNIDSYLKKLNNCKRRLTLINNI
LQNSQDRVTKLQSNISKESKRRIIPKKTKQSPQTN*
back to top

protein sequence of SMED30019094-orf-2

>SMED30019094-orf-2 ID=SMED30019094-orf-2|Name=SMED30019094-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1287bp
MSKSVSQFLLGIDLSCVEIKDNDCSEAFSNMTRIQWLKLVSTGLEQIPKG
VEKLTQLQRLTISKNNINKLSGDWCTELKALRVFNARKNKLTDDSLPEQL
FNNPQLQVVDLSFNLLTEVPAGLVEAKSLLVLNLSDNQIKNVSKDLFANC
VSLMILDLSNNQIVGFPTNLRRSPNLQSLNLSNNPLSMSQLRSINGLKKL
TTLLLSNTSRRLENIPSDLDKLPCLQDLDISDNNLPKVPQTIYEITSLTK
LNLSGNEIDELSGLVDCWPNLEVLNLSRNRLNSLPSFITRLSKLKKLYVD
ENRLTFNGIPPGIGKLSNLEVFSASENLLENIPEGLCRCGQLKHLNLRMN
KLVTLPDAINVLIESLKTFNIENNPNLKMPPKLVEVDLKSKYAFYNIDFS
LETQMQLARGAPAKASSKSVTQKHKFTQDTASRIRRLRRKKIDEKSEKGS
DSKRVLEGMQKVAKDKDAIMEDREKEEKLLSAKKWQDAIAKPNLDYSKLF
DDDVGIEPGIELWDMDDFYPRRITDELPLGTFFDGDCYIILHTSLDEKSH
TSLNHSIYYWIGSQASLDKVTASAVHAVYLRNYLSTNCRCERTEQGDESP
EFVALFEGNIIVCEGARGQTGFLKTEDKEHRKKMYRLFGADKSISIYSLD
PTPENLDSKFVYLFDESSTRLFLWIGNKSRLMLQTKGRLLADNINQTERK
GQSEIITERENSESDEFKNSLQSSSGIDSLDWSNLSSKEVSIDWKPPTPI
LYDVKLGRGYLEMPQIELPNGRLVKSLLEAKHVYILDSNGDMFVWIGDMA
PKFLKFAGLKLAYELLELLPRSSRLSPTVCCQTSEPQIFKMQFADWVDTC
AVDFTRSVESVRKRGVNLDDIIEKDKMKIDMRAFFMPRERPMPLEDAKAI
MEDCNEDLVGNNMDSNDGKPFKIKQFVYLNRNWVLVEDKWIGHFFNQDCY
IVHAEYWELPEEDDPDAEEDGTDEETSRIQTVIYFWQGREASDIPWLQFN
FSLKKEMEIKFSGMDNMSTTKDSFKKVETKRMFQQQEISTFLAHFQHRFV
IHLGKYQDRYSDQRKNRIELYYLRENGNALCTRTIEVKPMIAFVNSCFHY
IMKIPAAASKTENDQIICWIGKNSDSHYDEVLQAVAADTFPESSDILTVK
EGAEPGIFWQALGGKKNYDHEAQFMSFSRLFRLSNEQGFFCASEKCSDFC
QDDLADEDVMLLDTGSQIYLWFGNRTSDVEKKLSYKAAKLYQEHMARIQP
DRIRQLKITQKKKEPHNFRRCFHGWGPFKEAMDWSG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0051015actin filament binding
GO:0003779actin binding
GO:0005515protein binding
GO:0042626ATPase activity, coupled to transmembrane movement of substances
GO:0005524ATP binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR029919FliI
IPR007122Villin/Gelsolin
IPR003591Leu-rich_rpt_typical-subtyp
IPR025875Leu-rich_rpt_4
IPR007123Gelsolin-like_dom
IPR029006ADF-H/Gelsolin-like_dom_sf
IPR032675LRR_dom_sf
IPR001611Leu-rich_rpt
IPR011527ABC1_TM_dom
IPR028119Snapin/Pallidin/Snn1
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0055085transmembrane transport
GO:0030036actin cytoskeleton organization
GO:0051014actin filament severing
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR007122Villin/GelsolinPRINTSPR00597GELSOLINcoord: 775..797
score: 34.58
coord: 589..609
score: 32.9
coord: 528..544
score: 43.32
IPR007122Villin/GelsolinSMARTSM00262VILL_6coord: 1179..1275
e-value: 3.6E-20
score: 83.0
coord: 921..1048
e-value: 2.3
score: 1.9
coord: 752..846
e-value: 2.4E-7
score: 40.4
coord: 630..724
e-value: 1.8E-5
score: 34.1
coord: 1068..1165
e-value: 0.023
score: 23.8
coord: 508..609
e-value: 4.0E-15
score: 66.2
IPR007122Villin/GelsolinPANTHERPTHR11977VILLINcoord: 28..1281
IPR003591Leucine-rich repeat, typical subtypeSMARTSM00369LRR_typ_2coord: 316..339
e-value: 0.77
score: 18.8
coord: 174..196
e-value: 270.0
score: 1.6
coord: 78..103
e-value: 58.0
score: 7.0
coord: 54..77
e-value: 23.0
score: 10.3
coord: 127..149
e-value: 10.0
score: 13.1
coord: 246..267
e-value: 120.0
score: 4.4
coord: 268..291
e-value: 5.3
score: 15.5
coord: 222..245
e-value: 19.0
score: 11.0
coord: 150..173
e-value: 94.0
score: 5.3
coord: 104..126
e-value: 17.0
score: 11.4
coord: 340..362
e-value: 94.0
score: 5.3
NoneNo IPR availableSMARTSM00364LRR_bac_2coord: 173..191
e-value: 600.0
score: 0.1
coord: 269..287
e-value: 11.0
score: 13.5
coord: 150..169
e-value: 140.0
score: 4.9
coord: 339..358
e-value: 74.0
score: 7.1
coord: 316..335
e-value: 130.0
score: 5.1
coord: 247..264
e-value: 190.0
score: 3.9
coord: 103..122
e-value: 380.0
score: 1.7
coord: 222..241
e-value: 160.0
score: 4.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 702..716
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 700..722
NoneNo IPR availableCDDcd11291gelsolin_S6_likecoord: 1179..1275
e-value: 2.9056E-34
score: 124.717
NoneNo IPR availableSUPERFAMILYSSF55753Actin depolymerizing proteinscoord: 625..723
NoneNo IPR availableSUPERFAMILYSSF55753Actin depolymerizing proteinscoord: 917..1076
NoneNo IPR availableSUPERFAMILYSSF55753Actin depolymerizing proteinscoord: 1067..1168
NoneNo IPR availableSUPERFAMILYSSF52047RNI-likecoord: 196..390
NoneNo IPR availableSUPERFAMILYSSF55753Actin depolymerizing proteinscoord: 503..641
NoneNo IPR availableSUPERFAMILYSSF55753Actin depolymerizing proteinscoord: 1154..1277
NoneNo IPR availableSUPERFAMILYSSF55753Actin depolymerizing proteinscoord: 746..848
NoneNo IPR availableSUPERFAMILYSSF52058L domain-likecoord: 11..262
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 2..124
e-value: 4.5E-21
score: 76.7
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 196..410
e-value: 6.4E-41
score: 141.9
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 125..195
e-value: 2.2E-13
score: 51.7
IPR029006ADF-H/Gelsolin-like domain superfamilyGENE3DG3DSA:3.40.20.10coord: 747..855
e-value: 7.0E-15
score: 56.8
IPR029006ADF-H/Gelsolin-like domain superfamilyGENE3DG3DSA:3.40.20.10coord: 913..1072
e-value: 8.2E-21
score: 76.1
IPR029006ADF-H/Gelsolin-like domain superfamilyGENE3DG3DSA:3.40.20.10coord: 626..731
e-value: 7.1E-15
score: 57.0
IPR029006ADF-H/Gelsolin-like domain superfamilyGENE3DG3DSA:3.40.20.10coord: 1073..1169
e-value: 4.9E-11
score: 44.6
IPR029006ADF-H/Gelsolin-like domain superfamilyGENE3DG3DSA:3.40.20.10coord: 1170..1284
e-value: 1.9E-29
score: 103.8
IPR029006ADF-H/Gelsolin-like domain superfamilyGENE3DG3DSA:3.40.20.10coord: 499..625
e-value: 2.6E-25
score: 90.6
IPR007123Gelsolin-like domainPFAMPF00626Gelsolincoord: 529..602
e-value: 2.2E-12
score: 46.7
coord: 1195..1268
e-value: 2.1E-9
score: 37.2
coord: 654..717
e-value: 6.1E-7
score: 29.3
IPR001611Leucine-rich repeatPFAMPF13855LRR_8coord: 33..91
e-value: 4.6E-7
score: 29.5
coord: 247..304
e-value: 2.6E-6
score: 27.1
coord: 104..163
e-value: 5.3E-11
score: 42.1
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 128..149
score: 7.419
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 270..291
score: 8.497
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 175..198
score: 6.996
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 152..174
score: 6.665
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 341..362
score: 6.695
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 224..245
score: 6.018
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 105..127
score: 5.733
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 247..268
score: 8.513
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 199..223
score: 4.847
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 318..339
score: 5.602
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 56..77
score: 5.802
IPR029919Protein flightless-1PANTHERPTHR11977:SF92PROTEIN FLIGHTLESS-1 HOMOLOGcoord: 28..1281