Glutathione S-transferase

Overview
NameGlutathione S-transferase
Smed IDSMED30019092
Length (bp)968
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Glutathione S-transferase (SMED30019092) t-SNE clustered cells

Violin plots show distribution of expression levels for Glutathione S-transferase (SMED30019092) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Glutathione S-transferase (SMED30019092) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Glutathione S-transferase (SMED30019092) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Glutathione S-transferase vs. Ensembl Human
Match: GSTM4 (glutathione S-transferase mu 4 [Source:HGNC Symbol;Acc:HGNC:4636])

HSP 1 Score: 239.195 bits (609), Expect = 3.924e-78
Identity = 111/232 (47.84%), Postives = 161/232 (69.40%), Query Frame = 3
Query:   45 MAPMLGYWKLRGLAQPIRLLLEYTGEEYQEKLYELGNAPDFNRDEWLNEKFSLGLSFPNLPYLIEGDFKLTQSSAILRYIAEKHDMGS*INKFQFNFIY*LVGSSVEERAIVNMVADEIQDLRMSFVRLCYSPDFIKLKDDYISQLPSRLKLFSDFLGSKQWLIGEKLSYPDFIFYDILDGIKMLSPNCLDDFENIKTYMIRFEKLDPIAKYLKSNKYIRKPLYSKAASFGG 740
            M+  LGYW +RGLA  IRLLLEYT   Y+EK Y +G+APD++R +WLNEKF LGL FPNLPYLI+G  K+TQS+AIL YIA KH+               L G + EE+  V+++ ++  D+     R+CYSPDF KLK +Y+ +LP+ ++ FS FLG + W +G+K+++ DF+ YD+LD  ++  PNCLD F N+K ++ RFE L+ I+ Y+KS++++ KPLY++ A +G 
Sbjct:    1 MSMTLGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYIARKHN---------------LCGETEEEKIRVDILENQAMDVSNQLARVCYSPDFEKLKPEYLEELPTMMQHFSQFLGKRPWFVGDKITFVDFLAYDVLDLHRIFEPNCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPKPLYTRVAVWGN 217          
BLAST of Glutathione S-transferase vs. Ensembl Human
Match: GSTM5 (glutathione S-transferase mu 5 [Source:HGNC Symbol;Acc:HGNC:4637])

HSP 1 Score: 236.884 bits (603), Expect = 3.529e-77
Identity = 114/230 (49.57%), Postives = 158/230 (68.70%), Query Frame = 3
Query:   45 MAPMLGYWKLRGLAQPIRLLLEYTGEEYQEKLYELGNAPDFNRDEWLNEKFSLGLSFPNLPYLIEGDFKLTQSSAILRYIAEKHDMGS*INKFQFNFIY*LVGSSVEERAIVNMVADEIQDLRMSFVRLCYSPDFIKLKDDYISQLPSRLKLFSDFLGSKQWLIGEKLSYPDFIFYDILDGIKMLSPNCLDDFENIKTYMIRFEKLDPIAKYLKSNKYIRKPLYSKAASF 734
            M   LGYW +RGLA  IRLLLEYT   Y EK Y LG+APD++R +WLNEKF LGL FPNLPYLI+G  K+TQS+AILRYIA KH+               L G + EE+  V+++ +++ D  M  VRLCY PDF KLK  Y+ +LP +LKL+S+FLG + W  G+K+++ DF+ YD+LD  ++  P CLD F N+K ++ RFE L  I+ Y+KS++++R  L+ K+A++
Sbjct:    1 MPMTLGYWDIRGLAHAIRLLLEYTDSSYVEKKYTLGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILRYIARKHN---------------LCGETEEEKIRVDILENQVMDNHMELVRLCYDPDFEKLKPKYLEELPEKLKLYSEFLGKRPWFAGDKITFVDFLAYDVLDMKRIFEPKCLDAFLNLKDFISRFEGLKKISAYMKSSQFLRGLLFGKSATW 215          
BLAST of Glutathione S-transferase vs. Ensembl Human
Match: GSTM4 (glutathione S-transferase mu 4 [Source:HGNC Symbol;Acc:HGNC:4636])

HSP 1 Score: 236.113 bits (601), Expect = 5.393e-77
Identity = 109/232 (46.98%), Postives = 161/232 (69.40%), Query Frame = 3
Query:   45 MAPMLGYWKLRGLAQPIRLLLEYTGEEYQEKLYELGNAPDFNRDEWLNEKFSLGLSFPNLPYLIEGDFKLTQSSAILRYIAEKHDMGS*INKFQFNFIY*LVGSSVEERAIVNMVADEIQDLRMSFVRLCYSPDFIKLKDDYISQLPSRLKLFSDFLGSKQWLIGEKLSYPDFIFYDILDGIKMLSPNCLDDFENIKTYMIRFEKLDPIAKYLKSNKYIRKPLYSKAASFGG 740
            M+  LGYW +RGLA  IRLLLEYT   Y+EK Y +G+APD++R +WLNEKF LGL FPNLPYLI+G  K+TQS+AIL YIA KH+               L G + EE+  V+++ ++  D+     R+CYSPDF KLK +Y+ +LP+ ++ FS FLG + W +G+K+++ DF+ YD+LD  ++  PNCLD F N+K ++ RFE L+ I+ Y+KS++++ +P+++K A +G 
Sbjct:    1 MSMTLGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYIARKHN---------------LCGETEEEKIRVDILENQAMDVSNQLARVCYSPDFEKLKPEYLEELPTMMQHFSQFLGKRPWFVGDKITFVDFLAYDVLDLHRIFEPNCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFTKMAVWGN 217          
BLAST of Glutathione S-transferase vs. Ensembl Human
Match: GSTM2 (glutathione S-transferase mu 2 [Source:HGNC Symbol;Acc:HGNC:4634])

HSP 1 Score: 234.187 bits (596), Expect = 3.005e-76
Identity = 111/232 (47.84%), Postives = 159/232 (68.53%), Query Frame = 3
Query:   45 MAPMLGYWKLRGLAQPIRLLLEYTGEEYQEKLYELGNAPDFNRDEWLNEKFSLGLSFPNLPYLIEGDFKLTQSSAILRYIAEKHDMGS*INKFQFNFIY*LVGSSVEERAIVNMVADEIQDLRMSFVRLCYSPDFIKLKDDYISQLPSRLKLFSDFLGSKQWLIGEKLSYPDFIFYDILDGIKMLSPNCLDDFENIKTYMIRFEKLDPIAKYLKSNKYIRKPLYSKAASFGG 740
            M   LGYW +RGLA  IRLLLEYT   Y+EK Y +G+APD++R +WLNEKF LGL FPNLPYLI+G  K+TQS+AILRYIA KH+               L G S +E+   +++ ++  D RM   +LCY PDF KLK +Y+  LP  LKL+S FLG + W +G+K+++ DFI YD+L+  ++  P+CLD F N+K ++ RFE L+ I+ Y+KS++++ +P+++K A +G 
Sbjct:    1 MPMTLGYWNIRGLAHSIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGTHKITQSNAILRYIARKHN---------------LCGESEKEQIREDILENQFMDSRMQLAKLCYDPDFEKLKPEYLQALPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFTKMAVWGN 217          
BLAST of Glutathione S-transferase vs. Ensembl Human
Match: GSTM1 (glutathione S-transferase mu 1 [Source:HGNC Symbol;Acc:HGNC:4632])

HSP 1 Score: 230.72 bits (587), Expect = 9.220e-75
Identity = 109/231 (47.19%), Postives = 158/231 (68.40%), Query Frame = 3
Query:   45 MAPMLGYWKLRGLAQPIRLLLEYTGEEYQEKLYELGNAPDFNRDEWLNEKFSLGLSFPNLPYLIEGDFKLTQSSAILRYIAEKHDMGS*INKFQFNFIY*LVGSSVEERAIVNMVADEIQDLRMSFVRLCYSPDFIKLKDDYISQLPSRLKLFSDFLGSKQWLIGEKLSYPDFIFYDILDGIKMLSPNCLDDFENIKTYMIRFEKLDPIAKYLKSNKYIRKPLYSKAASFG 737
            M  +LGYW +RGLA  IRLLLEYT   Y+EK Y +G+APD++R +WLNEKF LGL FPNLPYLI+G  K+TQS+AIL YIA KH+               L G + EE+  V+++ ++  D  M    +CY+P+F KLK  Y+ +LP +LKL+S+FLG + W  G K+++ DF+ YD+LD  ++  P CLD F N+K ++ RFE L+ I+ Y+KS++++ +P++SK A +G
Sbjct:    1 MPMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYIARKHN---------------LCGETEEEKIRVDILENQTMDNHMQLGMICYNPEFEKLKPKYLEELPEKLKLYSEFLGKRPWFAGNKITFVDFLVYDVLDLHRIFEPKCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFSKMAVWG 216          
BLAST of Glutathione S-transferase vs. Ensembl Celegans
Match: gst-23 (Glutathione S-Transferase [Source:UniProtKB/TrEMBL;Acc:P91505])

HSP 1 Score: 83.9593 bits (206), Expect = 5.221e-19
Identity = 68/218 (31.19%), Postives = 110/218 (50.46%), Query Frame = 3
Query:   45 MAPMLGYWKLRGLAQPIRLLLEYTGEEYQEKLYELGNAPDFNRDEWLNEKFSLGLSFPNLPYLIEGDFKLTQSSAILRYIAEKHDMGS*INKFQFNFIY*LVGSSVEERAIVNMVADEIQDLRMSFVRLCYSPDFIKLKDDYISQ-LPSRL----KLFSDFLGSKQWLIGEKLSYPDFIFYDILDGIKMLSPNCLDDFENIKTYMIRFEKLDPIAKYL 683
            M   L Y+ +RGLA+PIRLLL       QE  +E       +R+EW   K ++   F  LP L  G   + QS+AILR++                 IY L GS+  E + ++M ++ ++DLR  +  +  + D+   K+ YI++ LP  L    KLF  F   + ++ G+KLSY D+  +++LD   +L+P  L+    +K +  RF +   +  YL
Sbjct:    1 MTLKLTYFDIRGLAEPIRLLLND-----QEIPFEDNR---ISREEWAEMKSTM--IFAQLPCLHIGTETIVQSAAILRHLGR---------------IYGLNGSTESETSFIDMFSEGLRDLRTKYFTMIKT-DYEDGKEAYITETLPGELLRIEKLFCTFNNGENFVSGDKLSYADYALFELLDIHLILTPTALNGTPALKRFHGRFAERPNMRLYL 192          
BLAST of Glutathione S-transferase vs. Ensembl Celegans
Match: gst-1 (Glutathione S-transferase P [Source:UniProtKB/Swiss-Prot;Acc:P10299])

HSP 1 Score: 81.6481 bits (200), Expect = 4.246e-18
Identity = 63/228 (27.63%), Postives = 106/228 (46.49%), Query Frame = 3
Query:   45 MAPMLGYWKLRGLAQPIRLLLEYTGEEYQEKLYELGNAPDFNRDEWLNEKFSLGLSFPNLPYLIEGDFKLTQSSAILRYIAEKHDMGS*INKFQFNFIY*LVGSSVEERAIVNMVADEIQDLRMSFVRLCYSPDFIKLKDDYISQ-LPSRL----KLFSDFLGSKQWLIGEKLSYPDFIFYDILDGIKMLSPNCLDDFENIKTYMIRFEKLDPIAKYLKSNKYIRKPL 713
            M   L Y+ + GLA+PIRLLL      Y++             ++W + K  +   F  +P L+ GD ++ QS AI+R++A  + +                GS+  E   ++M  + ++DL   +  + Y  ++   K  YI   LP  L    KLF  +   + ++IG+K SY D++ ++ LD   +L+PN LD    +K +  RF +   I  YL     I  P+
Sbjct:    1 MTLKLTYFDIHGLAEPIRLLLADKQVAYEDH--------RVTYEQWADIKPKM--IFGQVPCLLSGDEEIVQSGAIIRHLARLNGLN---------------GSNETETTFIDMFYEGLRDLHTKYTTMIYR-NYEDGKAPYIKDVLPGELARLEKLFHTYKNGEHYVIGDKESYADYVLFEELDIHLILTPNALDGVPALKKFHERFAERPNIKAYLNKRAAINPPV 202          
BLAST of Glutathione S-transferase vs. Ensembl Celegans
Match: gst-1 (Glutathione S-transferase P [Source:UniProtKB/Swiss-Prot;Acc:P10299])

HSP 1 Score: 81.6481 bits (200), Expect = 4.246e-18
Identity = 63/228 (27.63%), Postives = 106/228 (46.49%), Query Frame = 3
Query:   45 MAPMLGYWKLRGLAQPIRLLLEYTGEEYQEKLYELGNAPDFNRDEWLNEKFSLGLSFPNLPYLIEGDFKLTQSSAILRYIAEKHDMGS*INKFQFNFIY*LVGSSVEERAIVNMVADEIQDLRMSFVRLCYSPDFIKLKDDYISQ-LPSRL----KLFSDFLGSKQWLIGEKLSYPDFIFYDILDGIKMLSPNCLDDFENIKTYMIRFEKLDPIAKYLKSNKYIRKPL 713
            M   L Y+ + GLA+PIRLLL      Y++             ++W + K  +   F  +P L+ GD ++ QS AI+R++A  + +                GS+  E   ++M  + ++DL   +  + Y  ++   K  YI   LP  L    KLF  +   + ++IG+K SY D++ ++ LD   +L+PN LD    +K +  RF +   I  YL     I  P+
Sbjct:    1 MTLKLTYFDIHGLAEPIRLLLADKQVAYEDH--------RVTYEQWADIKPKM--IFGQVPCLLSGDEEIVQSGAIIRHLARLNGLN---------------GSNETETTFIDMFYEGLRDLHTKYTTMIYR-NYEDGKAPYIKDVLPGELARLEKLFHTYKNGEHYVIGDKESYADYVLFEELDIHLILTPNALDGVPALKKFHERFAERPNIKAYLNKRAAINPPV 202          
BLAST of Glutathione S-transferase vs. Ensembl Celegans
Match: gst-10 (Glutathione S-transferase P 10 [Source:UniProtKB/Swiss-Prot;Acc:Q9N4X8])

HSP 1 Score: 77.0258 bits (188), Expect = 1.936e-16
Identity = 57/218 (26.15%), Postives = 103/218 (47.25%), Query Frame = 3
Query:   48 APMLGYWKLRGLAQPIRLLLEYTGEEYQEKLYELGNAPDFNRDEWLNEKFSLGLSFPNLPYLIEGDFKLTQSSAILRYIAEKHDMGS*INKFQFNFIY*LVGSSVEERAIVNMVADEIQDLRMSFVRLCYSPDFIKLKDDYISQLPSRLKLFSDFL--GSKQWLIGEKLSYPDFIFYDILDGIKMLSPNCLDDFENIKTYMIRFEKLDPIAKYLKSNK 695
             P L Y+ +RG  + IRLL    G ++++  +      D+  +EW  ++F  G+    LP L     ++ Q+ AI+R++   H +                GS+ +E   ++M  + ++D+RM +VR  Y  +  + +D     +P  L    +     S  ++IG K+SY D+I ++ LD   +L  N LD F  +K++  R  K   +  YL+  K
Sbjct:    3 VPQLYYFTIRGFGEYIRLLFLDNGIKFEDIRF------DYEGNEW--QEFKKGMLLGQLPCLKVDGQEIVQTGAIMRHLGRVHGLN---------------GSNEQEATFLDMFFEGVRDVRMKYVRYIYYDEGTR-EDCVNKTIPEALVKLEELFKAHSGDFIIGNKISYADYILFEELDVYHVLDANILDKFPTLKSFWERMWKRPNLNAYLEKRK 196          
BLAST of Glutathione S-transferase vs. Ensembl Celegans
Match: gst-25 (Glutathione S-Transferase [Source:UniProtKB/TrEMBL;Acc:O61750])

HSP 1 Score: 75.485 bits (184), Expect = 6.033e-16
Identity = 58/228 (25.44%), Postives = 109/228 (47.81%), Query Frame = 3
Query:   45 MAPMLGYWKLRGLAQPIRLLLEYTGEEYQEKLYELGNAPDFNRDEWLNEKFSLGLSFPNLPYLIEGDFKLTQSSAILRYIAEKHDMGS*INKFQFNFIY*LVGSSVEERAIVNMVADEIQDLRMSFVRLCYSPDFIKLKDDYISQ-LPSRL----KLFSDFLGSKQWLIGEKLSYPDFIFYDILDGIKMLSPNCLDDFENIKTYMIRFEKLDPIAKYLKSNKYIRKPL 713
            M     Y+  RG+ +PIR+LL  T +E     +       F+ ++W + K ++   F + P L  GD ++ QS  I+R++A  H                L G++ EE   ++M  + ++DL  ++  + Y  ++   +  +I   LP  L    KLF  +   + ++ G  +SY D++ ++ LD  K+LSP  LD    +K +  +F +   + +YLK    ++ P+
Sbjct:    1 MTLKFSYFGTRGIGEPIRMLL--TDQEVAFIDHR------FSWEQWADIKPTM--IFGSCPCLTMGDKEIVQSGTIIRHLARIHG---------------LNGTNEEETIFIDMFYEGVRDLHATYATMIYQ-NYENGRQPFIQDVLPEHLARLEKLFRTYENGENFVAGANISYVDYVLFEELDIQKILSPTALDRTPQLKKFHEQFGERKNLTEYLKKRAIMKTPV 202          
BLAST of Glutathione S-transferase vs. Ensembl Zebrafish
Match: gstm.2 (glutathione S-transferase mu tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-080218-30])

HSP 1 Score: 230.72 bits (587), Expect = 5.038e-75
Identity = 112/232 (48.28%), Postives = 157/232 (67.67%), Query Frame = 3
Query:   45 MAPMLGYWKLRGLAQPIRLLLEYTGEEYQEKLYELGNAPDFNRDEWLNEKFSLGLSFPNLPYLIEGDFKLTQSSAILRYIAEKHDMGS*INKFQFNFIY*LVGSSVEERAIVNMVADEIQDLRMSFVRLCYSPDFIKLKDDYISQLPSRLKLFSDFLGSKQWLIGEKLSYPDFIFYDILDGIKMLSPNCLDDFENIKTYMIRFEKLDPIAKYLKSNKYIRKPLYSKAASFGG 740
            MA  L YW +RGLAQPIRLLLEYTG +Y+EKLY  G AP+++R  WLN+K  L + FPNLPYL +GD K+ QS+AI+RYIA KH+               L G + EE+  V+++ ++  D R  FV+LCY  DF K K  Y  +LP  LK FSDFLG ++W  G+K+++ DFI Y++LD  +M  P CLDDF+N++ ++  FE L+ IA+Y+KSN++++ P+ SK A +G 
Sbjct:    1 MAMKLVYWDIRGLAQPIRLLLEYTGTKYEEKLYSCGEAPNYDRSCWLNDKSKLKMDFPNLPYLEDGDRKIVQSNAIMRYIARKHN---------------LCGETEEEQIRVDILENQAMDFRNGFVQLCYF-DFDKNKSSYCEKLPGTLKQFSDFLGDRKWFAGDKITFVDFIMYELLDQHRMFEPACLDDFKNLRCFLDHFENLEKIAEYMKSNRFMKTPVNSKMAKWGN 216          
BLAST of Glutathione S-transferase vs. Ensembl Zebrafish
Match: gstm.3 (glutathione S-transferase mu tandem duplicate 3 [Source:ZFIN;Acc:ZDB-GENE-050309-24])

HSP 1 Score: 229.95 bits (585), Expect = 9.359e-75
Identity = 110/231 (47.62%), Postives = 156/231 (67.53%), Query Frame = 3
Query:   45 MAPMLGYWKLRGLAQPIRLLLEYTGEEYQEKLYELGNAPDFNRDEWLNEKFSLGLSFPNLPYLIEGDFKLTQSSAILRYIAEKHDMGS*INKFQFNFIY*LVGSSVEERAIVNMVADEIQDLRMSFVRLCYSPDFIKLKDDYISQLPSRLKLFSDFLGSKQWLIGEKLSYPDFIFYDILDGIKMLSPNCLDDFENIKTYMIRFEKLDPIAKYLKSNKYIRKPLYSKAASFG 737
            MA  L YW +RG+AQP+RLLLE+TG +Y+EK Y  G APD+++  W NEK  LGL+FPNLPYL +GD K+ QS+AILRYIA K++               L G + EE+  V+++ ++  D R  F++LCY  DF K K  Y  +LP  LK FSDFLG ++W  G+K+++ DFI YD+LD  +ML P CLDD+ N+++++  FE L+ I  Y+KSNKY++ P+ +K A +G
Sbjct:    1 MAMKLAYWDIRGIAQPVRLLLEFTGTKYEEKFYSCGEAPDYDKSCWFNEKNKLGLAFPNLPYLEDGDTKVVQSNAILRYIARKNN---------------LCGETEEEQTRVDILENQAMDFRNGFIQLCYG-DFDKNKPCYCEKLPGSLKQFSDFLGDRKWFAGDKITFVDFIMYDLLDLHRMLHPECLDDYRNLRSFLDHFESLEKIVAYMKSNKYMKTPVNNKMAKWG 215          
BLAST of Glutathione S-transferase vs. Ensembl Zebrafish
Match: gstm.1 (glutathione S-transferase mu, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-030911-2])

HSP 1 Score: 228.409 bits (581), Expect = 4.013e-74
Identity = 109/232 (46.98%), Postives = 155/232 (66.81%), Query Frame = 3
Query:   45 MAPMLGYWKLRGLAQPIRLLLEYTGEEYQEKLYELGNAPDFNRDEWLNEKFSLGLSFPNLPYLIEGDFKLTQSSAILRYIAEKHDMGS*INKFQFNFIY*LVGSSVEERAIVNMVADEIQDLRMSFVRLCYSPDFIKLKDDYISQLPSRLKLFSDFLGSKQWLIGEKLSYPDFIFYDILDGIKMLSPNCLDDFENIKTYMIRFEKLDPIAKYLKSNKYIRKPLYSKAASFGG 740
            MA  L YW +RGLAQPIRLLLEYTG +Y+EK Y  G AP++++  W NEK  LG+ FPNLPYL +GD K+ QS+AI+RYIA KH+               L G + EE+  V+++ ++  D R  FV+LCY  DF K K  Y  +L   LK FSDFLG ++W  G+K+++ DFI Y++LD  +M  P CLDDF+N++ ++  FE L+ IA+Y+KSN++++ P+ +K A +G 
Sbjct:    1 MAMKLAYWDIRGLAQPIRLLLEYTGTKYEEKFYTCGEAPNYDKSCWFNEKSKLGMDFPNLPYLEDGDRKIVQSNAIMRYIARKHN---------------LCGETEEEQMRVDILENQAMDFRNGFVQLCY-LDFDKNKSSYCEKLSGTLKQFSDFLGDRKWFAGDKITFVDFIMYELLDQHRMFEPACLDDFKNLRCFLDHFESLEKIAEYMKSNRFMKTPVNNKMAKWGN 216          
BLAST of Glutathione S-transferase vs. Ensembl Zebrafish
Match: gstm.3 (glutathione S-transferase mu tandem duplicate 3 [Source:ZFIN;Acc:ZDB-GENE-050309-24])

HSP 1 Score: 134.42 bits (337), Expect = 7.800e-39
Identity = 65/136 (47.79%), Postives = 90/136 (66.18%), Query Frame = 3
Query:   45 MAPMLGYWKLRGLAQPIRLLLEYTGEEYQEKLYELGNAPDFNRDEWLNEKFSLGLSFPNLPYLIEGDFKLTQSSAILRYIAEKHDMGS*INKFQFNFIY*LVGSSVEERAIVNMVADEIQDLRMSFVRLCYSPDFI 452
            MA  L YW +RG+AQP+RLLLE+TG +Y+EK Y  G APD+++  W NEK  LGL+FPNLPYL +GD K+ QS+AILRYIA K++               L G + EE+  V+++ ++  D R  F++LCY  DF+
Sbjct:    1 MAMKLAYWDIRGIAQPVRLLLEFTGTKYEEKFYSCGEAPDYDKSCWFNEKNKLGLAFPNLPYLEDGDTKVVQSNAILRYIARKNN---------------LCGETEEEQTRVDILENQAMDFRNGFIQLCYG-DFV 120          
BLAST of Glutathione S-transferase vs. Ensembl Zebrafish
Match: gstp1 (glutathione S-transferase pi 1 [Source:ZFIN;Acc:ZDB-GENE-020806-4])

HSP 1 Score: 97.4413 bits (241), Expect = 1.110e-23
Identity = 57/226 (25.22%), Postives = 117/226 (51.77%), Query Frame = 3
Query:   45 MAP-MLGYWKLRGLAQPIRLLLEYTGEEYQEKLYELGNAPDFNRDEWLNEKFSLGLSFPNLPYLIEGDFKLTQSSAILRYIAEKHDMGS*INKFQFNFIY*LVGSSVEERAIVNMVADEIQDLRMSFVRLCYSPDFIKLKDDYISQLPSRLKLFSDFLGSKQ--WLIGEKLSYPDFIFYDILDGIKMLSPNCLDDFENIKTYMIRFEKLDPIAKYLKSNKYIRKPL 713
            MAP  L Y+ ++G    ++++L    ++ +E L           +EW+         F  LP   +GD  L QS+A+LR++  KH                  G +  E ++++++ D ++DLR+ +++L Y  ++   K+ +I  LP+ LK F + L   +  +L+G+++S+ D+  +D+L  +K+LSP+CLD F ++K+++ +      +   L+   + + P+
Sbjct:    1 MAPYTLTYFAVKGRCGALKIMLADKDQQLKENLVTF--------EEWMKGDLKATCVFGQLPKFEDGDLVLFQSNAMLRHLGRKHAA---------------YGKNDSEASLIDVMNDGVEDLRLKYIKLIYQ-EYETGKEAFIKDLPNHLKCFENVLAKNKTGFLVGDQISFADYNLFDLLLNLKVLSPSCLDSFPSLKSFVDKISARPKVKALLECENFKKLPI 202          
BLAST of Glutathione S-transferase vs. Ensembl Xenopus
Match: krt8.2 (keratin 8 [Source:Xenbase;Acc:XB-GENE-876686])

HSP 1 Score: 209.149 bits (531), Expect = 1.905e-66
Identity = 101/228 (44.30%), Postives = 151/228 (66.23%), Query Frame = 3
Query:   54 MLGYWKLRGLAQPIRLLLEYTGEEYQEKLYELGNAPDFNRDEWLNEKFSLGLSFPNLPYLIEGDFKLTQSSAILRYIAEKHDMGS*INKFQFNFIY*LVGSSVEERAIVNMVADEIQDLRMSFVRLCYSPDFIKLKDDYISQLPSRLKLFSDFLGSKQWLIGEKLSYPDFIFYDILDGIKMLSPNCLDDFENIKTYMIRFEKLDPIAKYLKSNKYIRKPLYSKAASFG 737
            +LGYW +RGLA  IRLLLEYTG +Y+EK Y  G+AP++++ +WL+EK  LGL FPNLPYL++GD KL+QS+AILRYIA KH                L G S +E+  V ++  +I   R + +    +P +  LK  Y+ +LP  LK FS FLG + W  G+K+++ DF+ YD+LD  ++L P CL +F+N++ ++ RFE L  I  Y+KS+++++ PL ++ AS+G
Sbjct:    2 ILGYWDIRGLAHSIRLLLEYTGTQYEEKKYITGDAPNYDKTQWLDEKEKLGLDFPNLPYLLDGDVKLSQSNAILRYIARKHG---------------LCGESEKEKMYVLLLHTQIDAFRSTIIIFAQAPRYETLKGPYLEKLPIALKRFSCFLGDRSWFAGDKITFVDFVVYDVLDQHQILEPTCLQNFKNLQDFLKRFEALPAIDAYMKSSRFMKMPLNNRMASWG 214          
BLAST of Glutathione S-transferase vs. Ensembl Xenopus
Match: nemp1 (nuclear envelope integral membrane protein 1 [Source:Xenbase;Acc:XB-GENE-974573])

HSP 1 Score: 104.76 bits (260), Expect = 2.449e-26
Identity = 73/226 (32.30%), Postives = 111/226 (49.12%), Query Frame = 3
Query:   63 YWKLRGLAQPIRLLLEYTGEEYQEKLYELGNAPDFNRDEWLNEKFSL--GLSFPNLPYLIEGDFKLTQSSAILRYIAEKHDMGS*INKFQFNFIY*LVGSSVEERAIVNMVADEIQDLRMSFVRLCYSPDFIKLKDDYISQLPSRLKLFSDFLG----SKQWLIGEKLSYPDFIFYDILDGIKMLSPNCLDDFENIKTYMIRFEKLDPIAKYLKSNKYIRKPLYSK 722
            Y+ +RG A+ IRLLL   G +++E   ++         +W++ K        F  LP   +GDF L QS++ILRY+  KH                L GS   ERA+V+MV   ++DLR  + R  Y  ++   KD Y+  LP++L LF   L        +++G K+SY D+   D L     LSP CL ++  +  Y+ R      +AKYL S+   R+P+  K
Sbjct:    8 YFPVRGRAEAIRLLLADQGIDWEEDEVQIA--------DWVSGKDGRKKDAVFGQLPGFRDGDFVLYQSNSILRYLGNKHG---------------LDGSDAHERAVVDMVNSGVEDLRQKYGRFLYF-EYETGKDKYLETLPAQLDLFERILSKNANGSAFIVGNKISYADYNLLDTLHCHIDLSPTCLSNYPLLSAYVERLVSRPKLAKYLNSDVCKRRPITPK 209          
BLAST of Glutathione S-transferase vs. Ensembl Xenopus
Match: gnrhr (gonadotropin releasing hormone receptor [Source:Xenbase;Acc:XB-GENE-5753573])

HSP 1 Score: 103.605 bits (257), Expect = 1.372e-25
Identity = 79/239 (33.05%), Postives = 113/239 (47.28%), Query Frame = 3
Query:   21 PILLYLF---NMAPMLGYWKLRGLAQPIRLLLEYTGEEYQEKLYELGNAPDFNRDEWLNEKFSLGLSFPNLPYLIEGDFKLTQSSAILRYIAEKHDMGS*INKFQFNFIY*LVGSSVEERAIVNMVADEIQDLRMSFVRLCYSPDFIKLKDDYISQLPSRLKLFSDFL-----GSKQWLIGEKLSYPDFIFYDILDGIKMLSPNCLDDFENIKTYMIRFEKLDPIAKYLKSNKYIRKPL 713
            P LLY F        L Y+ +RG A+ IRLLL      ++E   +  +    N DE     F        LP    GDF L QS++ILRY+A KH                L G + EE A ++MV D ++DLR  + R  Y     K K  Y+  LP +L+ F   L     GSK +++G+K+SY D+   D+L     LSP CL  F  ++ Y+ R      ++ YL S+   R+P+
Sbjct:    7 PNLLYYFFPLVSGYTLTYYPVRGRAEAIRLLLADQDIPWEEDEVQWQDWCSGNHDERKKAVFG------RLPQFQNGDFVLCQSNSILRYLAHKHG---------------LTGDNDEESAHIDMVNDSVEDLRKKYGRFIYFTCQEKGKGKYLEGLPQQLEFFERVLSKNHNGSK-FVVGQKISYADYNLVDLLQCHLDLSPECLSAFPLLRAYLERLVSQPTLSDYLNSDARKRRPI 223          
BLAST of Glutathione S-transferase vs. Ensembl Xenopus
Match: gnrhr (gonadotropin releasing hormone receptor [Source:Xenbase;Acc:XB-GENE-5753573])

HSP 1 Score: 102.064 bits (253), Expect = 3.477e-25
Identity = 75/225 (33.33%), Postives = 111/225 (49.33%), Query Frame = 3
Query:   54 MLGYWKLRGLAQPIRLLLEYTGEEYQEKLYELGNAPDFNRDEWLNEKFSLGLSFPNLPYLIEGDFKLTQSSAILRYIAEKHDMGS*INKFQFNFIY*LVGSSVEERAIVNMVADEIQDLRMSFVRLCYSPDFIKLKDDYISQLPSRLKLFSDFL-----GSKQWLIGEKLSYPDFIFYDILDGIKMLSPNCLDDFENIKTYMIRFEKLDPIAKYLKSNKYIRKPL 713
             L Y+ +RG A+ IRLLL      ++E   +  +    N DE    K ++   F  LP    GDF L QS++ILRY+A KH                L G + EE A ++MV D ++DLR  + R  Y     K K  Y+  LP +L+ F   L     GSK +++G+K+SY D+   D+L     LSP CL  F  ++ Y+ R      ++ YL S+   R+P+
Sbjct:    5 TLTYFPVRGRAEAIRLLLADQDIPWEEDEVQWQDWCSGNHDE---RKKAV---FGRLPQFQNGDFVLCQSNSILRYLAHKHG---------------LTGDNDEESAHIDMVNDSVEDLRKKYGRFIYFTCQEKGKGKYLEGLPQQLEFFERVLSKNHNGSK-FVVGQKISYADYNLVDLLQCHLDLSPECLSAFPLLRAYLERLVSQPTLSDYLNSDARKRRPI 207          
BLAST of Glutathione S-transferase vs. Ensembl Xenopus
Match: gnrhr (gonadotropin releasing hormone receptor [Source:Xenbase;Acc:XB-GENE-5753573])

HSP 1 Score: 92.8189 bits (229), Expect = 8.649e-22
Identity = 74/228 (32.46%), Postives = 115/228 (50.44%), Query Frame = 3
Query:   54 MLGYWKLRGLAQPIRLLLEYTGEEYQEKLYELGNAPDFNRDEWLNEKFSLGLSFPNLPYLIEGDFKLTQSSAILRYIAEKHDMGS*INKFQFNFIY*LVGSSVEERAIVNMVADEIQDLRMSFVRLCYSPDFIKLKDDYISQLPSRLKLFSDFL-----GSKQWLIGEKLSYPDFIFYDILDGIKMLSPNCLDDFENIKTYMIRFEKLDPIAKYLKSNKYIRKPLYSK 722
             L Y+ +RG A+ IRLLL   G  +++   E    P +   +   +K ++   F  LP    GD+ L QS++ILRY+  KH                L GS+ EE   ++MV D ++DLR  +VRL ++ ++   KD Y+  LP +L+ F   L     GSK +++G+K+SY D+   D+L     LSP  L  F  +  Y+ R      + +YLKS    R+P+  K
Sbjct:    5 TLTYFPVRGRAEAIRLLLADQGVAFKD---EEAQIPLWFAGKDDRKKHAV---FGQLPQFKNGDYTLYQSNSILRYLGRKHG---------------LNGSNDEELGHIDMVNDGVEDLRQKYVRLIFT-EYDTGKDKYLEALPQQLEFFERILSKNHNGSK-FIVGQKISYADYNLLDLLHCHLDLSPKSLSAFPLLSAYVERLNSRPKLNEYLKSEARNRRPITPK 209          
BLAST of Glutathione S-transferase vs. Ensembl Mouse
Match: Gstm4 (glutathione S-transferase, mu 4 [Source:MGI Symbol;Acc:MGI:95862])

HSP 1 Score: 247.669 bits (631), Expect = 1.203e-81
Identity = 116/231 (50.22%), Postives = 160/231 (69.26%), Query Frame = 3
Query:   45 MAPMLGYWKLRGLAQPIRLLLEYTGEEYQEKLYELGNAPDFNRDEWLNEKFSLGLSFPNLPYLIEGDFKLTQSSAILRYIAEKHDMGS*INKFQFNFIY*LVGSSVEERAIVNMVADEIQDLRMSFVRLCYSPDFIKLKDDYISQLPSRLKLFSDFLGSKQWLIGEKLSYPDFIFYDILDGIKMLSPNCLDDFENIKTYMIRFEKLDPIAKYLKSNKYIRKPLYSKAASFG 737
            M   LGYW +RGLA  IRLLLEYTG  Y+EK Y +G+APD++R +WL+EKF LGL FPNLPYLI+G  K+TQS+AILRYIA KH+               L G + EE+  V+++ ++  D+     R+CYSPDF KLK +Y+ QLP  +KLFS FLG + W +GEK+++ DF+ YDILD   +  P CLD F N+K ++ RFE L  I+ Y+K+++++R PLY+K A++G
Sbjct:    1 MPMTLGYWDIRGLAHAIRLLLEYTGSSYEEKRYTMGDAPDYDRSQWLSEKFKLGLDFPNLPYLIDGSHKITQSNAILRYIARKHN---------------LCGETEEEKIRVDILENQAMDVSNQLARVCYSPDFEKLKVEYLEQLPGMVKLFSQFLGQRTWFVGEKITFVDFLAYDILDLHLIFEPTCLDAFPNLKDFVARFEVLKRISAYMKTSRFLRTPLYTKVATWG 216          
BLAST of Glutathione S-transferase vs. Ensembl Mouse
Match: Gstm1 (glutathione S-transferase, mu 1 [Source:MGI Symbol;Acc:MGI:95860])

HSP 1 Score: 242.276 bits (617), Expect = 1.756e-79
Identity = 112/232 (48.28%), Postives = 156/232 (67.24%), Query Frame = 3
Query:   45 MAPMLGYWKLRGLAQPIRLLLEYTGEEYQEKLYELGNAPDFNRDEWLNEKFSLGLSFPNLPYLIEGDFKLTQSSAILRYIAEKHDMGS*INKFQFNFIY*LVGSSVEERAIVNMVADEIQDLRMSFVRLCYSPDFIKLKDDYISQLPSRLKLFSDFLGSKQWLIGEKLSYPDFIFYDILDGIKMLSPNCLDDFENIKTYMIRFEKLDPIAKYLKSNKYIRKPLYSKAASFGG 740
            M  +LGYW +RGL  PIR+LLEYT   Y EK Y +G+APDF+R +WLNEKF LGL FPNLPYLI+G  K+TQS+AILRY+A KH                L G + EER   ++V +++ D RM  + LCY+PDF K K +++  +P ++KL+S+FLG + W  G+K++Y DF+ YDILD  +M  P CLD F N++ ++ RFE L  I+ Y+KS++YI  P++SK A +  
Sbjct:    1 MPMILGYWNVRGLTHPIRMLLEYTDSSYDEKRYTMGDAPDFDRSQWLNEKFKLGLDFPNLPYLIDGSHKITQSNAILRYLARKHH---------------LDGETEEERIRADIVENQVMDTRMQLIMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYDILDQYRMFEPKCLDAFPNLRDFLARFEGLKKISAYMKSSRYIATPIFSKMAHWSN 217          
BLAST of Glutathione S-transferase vs. Ensembl Mouse
Match: Gstm2 (glutathione S-transferase, mu 2 [Source:MGI Symbol;Acc:MGI:95861])

HSP 1 Score: 232.646 bits (592), Expect = 1.009e-75
Identity = 109/228 (47.81%), Postives = 155/228 (67.98%), Query Frame = 3
Query:   45 MAPMLGYWKLRGLAQPIRLLLEYTGEEYQEKLYELGNAPDFNRDEWLNEKFSLGLSFPNLPYLIEGDFKLTQSSAILRYIAEKHDMGS*INKFQFNFIY*LVGSSVEERAIVNMVADEIQDLRMSFVRLCYSPDFIKLKDDYISQLPSRLKLFSDFLGSKQWLIGEKLSYPDFIFYDILDGIKMLSPNCLDDFENIKTYMIRFEKLDPIAKYLKSNKYIRKPLYSKAA 728
            M   LGYW +RGLA  IRLLLEYT   Y++K Y +G+APD++R +WL+EKF LGL FPNLPYLI+G  K+TQS+AILRY+A KH+               L G + EER  V+++ ++  D R+    +CYSPDF K K +Y+  LP ++KL+S+FLG + W  G K++Y DF+ YD+LD  ++  P CLD F N+K +M RFE L  I+ Y+KS++++ KP+++K A
Sbjct:    1 MPMTLGYWDIRGLAHAIRLLLEYTDTSYEDKKYTMGDAPDYDRSQWLSEKFKLGLDFPNLPYLIDGSHKITQSNAILRYLARKHN---------------LCGETEEERIRVDILENQAMDTRIQLAMVCYSPDFEKKKPEYLEGLPEKMKLYSEFLGKQPWFAGNKVTYVDFLVYDVLDQHRIFEPKCLDAFPNLKDFMGRFEGLKKISDYMKSSRFLSKPIFAKMA 213          
BLAST of Glutathione S-transferase vs. Ensembl Mouse
Match: Gstm3 (glutathione S-transferase, mu 3 [Source:MGI Symbol;Acc:MGI:106026])

HSP 1 Score: 230.72 bits (587), Expect = 5.803e-75
Identity = 106/233 (45.49%), Postives = 157/233 (67.38%), Query Frame = 3
Query:   45 MAPMLGYWKLRGLAQPIRLLLEYTGEEYQEKLYELGNAPDFNRDEWLNEKFSLGLSFPNLPYLIEGDFKLTQSSAILRYIAEKHDMGS*INKFQFNFIY*LVGSSVEERAIVNMVADEIQDLRMSFVRLCYSPDFIKLKDDYISQLPSRLKLFSDFLGSKQWLIGEKLSYPDFIFYDILDGIKMLSPNCLDDFENIKTYMIRFEKLDPIAKYLKSNKYIRKPLYSKAASFGGD 743
            M   LGYW  RGL   IRLLLEYT   Y+EK Y +G+AP+F+R +WL+EKF+LGL FPNLPYLI+G  K+TQS+AILRY+  KH+               L G + EER  V+ + +++ D R+  + +C SPDF K K +++  +P ++KL+S+FLG + W  G+K++Y DF+ YDILD  +M  P CLD F N++ ++ RFE L  I+ Y+KS++++ +P+++K A +G D
Sbjct:    1 MPMTLGYWNTRGLTHSIRLLLEYTDSSYEEKRYVMGDAPNFDRSQWLSEKFNLGLDFPNLPYLIDGSHKVTQSNAILRYLGRKHN---------------LCGETEEERIRVDTLENQVMDTRIQLMIVCCSPDFEKQKPEFLKAIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYDILDQYRMFEPKCLDAFPNLRDFLARFEGLKKISAYMKSSRFLPRPVFTKIAQWGTD 218          
BLAST of Glutathione S-transferase vs. Ensembl Mouse
Match: Gstm7 (glutathione S-transferase, mu 7 [Source:MGI Symbol;Acc:MGI:1915562])

HSP 1 Score: 229.95 bits (585), Expect = 1.078e-74
Identity = 106/233 (45.49%), Postives = 158/233 (67.81%), Query Frame = 3
Query:   45 MAPMLGYWKLRGLAQPIRLLLEYTGEEYQEKLYELGNAPDFNRDEWLNEKFSLGLSFPNLPYLIEGDFKLTQSSAILRYIAEKHDMGS*INKFQFNFIY*LVGSSVEERAIVNMVADEIQDLRMSFVRLCYSPDFIKLKDDYISQLPSRLKLFSDFLGSKQWLIGEKLSYPDFIFYDILDGIKMLSPNCLDDFENIKTYMIRFEKLDPIAKYLKSNKYIRKPLYSKAASFGGD 743
            M   LGYW +RGLA  IRL LEYT   Y+EK Y +G+APD+++ +WLNEKF LGL FPNLPYLI+G  K+TQS+AILRY+  KH+               L G + EER  V+++ +++ D RM   RLCY+ DF KLK  Y+ QLP  ++L+S+FLG + W  G+K+++ DFI YD+L+  ++    CLD F N+K ++ RFE L  I+ Y+K+++++ +P+++K A++G +
Sbjct:    1 MPMTLGYWDIRGLAHAIRLFLEYTDSSYEEKRYTMGDAPDYDQSQWLNEKFKLGLDFPNLPYLIDGSHKITQSNAILRYLGRKHN---------------LCGETEEERIRVDILENQLMDNRMVLARLCYNADFEKLKPGYLEQLPGMMRLYSEFLGKRPWFAGDKITFVDFIAYDVLERNQVFEAKCLDAFPNLKDFIARFEGLKKISDYMKTSRFLPRPMFTKMATWGSN 218          
BLAST of Glutathione S-transferase vs. UniProt/SwissProt
Match: sp|P10649|GSTM1_MOUSE (Glutathione S-transferase Mu 1 OS=Mus musculus OX=10090 GN=Gstm1 PE=1 SV=2)

HSP 1 Score: 242.276 bits (617), Expect = 1.229e-78
Identity = 112/232 (48.28%), Postives = 156/232 (67.24%), Query Frame = 3
Query:   45 MAPMLGYWKLRGLAQPIRLLLEYTGEEYQEKLYELGNAPDFNRDEWLNEKFSLGLSFPNLPYLIEGDFKLTQSSAILRYIAEKHDMGS*INKFQFNFIY*LVGSSVEERAIVNMVADEIQDLRMSFVRLCYSPDFIKLKDDYISQLPSRLKLFSDFLGSKQWLIGEKLSYPDFIFYDILDGIKMLSPNCLDDFENIKTYMIRFEKLDPIAKYLKSNKYIRKPLYSKAASFGG 740
            M  +LGYW +RGL  PIR+LLEYT   Y EK Y +G+APDF+R +WLNEKF LGL FPNLPYLI+G  K+TQS+AILRY+A KH                L G + EER   ++V +++ D RM  + LCY+PDF K K +++  +P ++KL+S+FLG + W  G+K++Y DF+ YDILD  +M  P CLD F N++ ++ RFE L  I+ Y+KS++YI  P++SK A +  
Sbjct:    1 MPMILGYWNVRGLTHPIRMLLEYTDSSYDEKRYTMGDAPDFDRSQWLNEKFKLGLDFPNLPYLIDGSHKITQSNAILRYLARKHH---------------LDGETEEERIRADIVENQVMDTRMQLIMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYDILDQYRMFEPKCLDAFPNLRDFLARFEGLKKISAYMKSSRYIATPIFSKMAHWSN 217          
BLAST of Glutathione S-transferase vs. UniProt/SwissProt
Match: sp|Q9N0V4|GSTM1_BOVIN (Glutathione S-transferase Mu 1 OS=Bos taurus OX=9913 GN=GSTM1 PE=1 SV=3)

HSP 1 Score: 240.736 bits (613), Expect = 3.978e-78
Identity = 113/231 (48.92%), Postives = 161/231 (69.70%), Query Frame = 3
Query:   45 MAPMLGYWKLRGLAQPIRLLLEYTGEEYQEKLYELGNAPDFNRDEWLNEKFSLGLSFPNLPYLIEGDFKLTQSSAILRYIAEKHDMGS*INKFQFNFIY*LVGSSVEERAIVNMVADEIQDLRMSFVRLCYSPDFIKLKDDYISQLPSRLKLFSDFLGSKQWLIGEKLSYPDFIFYDILDGIKMLSPNCLDDFENIKTYMIRFEKLDPIAKYLKSNKYIRKPLYSKAASFG 737
            M  +LGYW +RGLA  IRLLLEYT   Y+E+ Y +G+APD++R +WLNEKF LGL FPNLPYLI+G  KLTQS+AILRYIA KH+               L G + EE   V+++ +++ D+R++  R+CYSPDF KLK  ++ ++P ++KLFS+FLG + W  G+KL+Y DF+ YD+LD  ++  P CLD F N+K ++ RFE L  I+ Y+KS++++  PL+ K A +G
Sbjct:    1 MPMILGYWDIRGLAHAIRLLLEYTDTNYEERQYSVGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGTHKLTQSNAILRYIARKHN---------------LCGETEEEMIRVDILENQVMDVRLAMARICYSPDFEKLKPGFLKEIPEKIKLFSEFLGKRPWFAGDKLTYVDFLVYDVLDMHRIFEPKCLDAFPNLKDFISRFEGLKKISAYMKSSRFLPGPLFMKLAVWG 216          
BLAST of Glutathione S-transferase vs. UniProt/SwissProt
Match: sp|Q03013|GSTM4_HUMAN (Glutathione S-transferase Mu 4 OS=Homo sapiens OX=9606 GN=GSTM4 PE=1 SV=3)

HSP 1 Score: 239.195 bits (609), Expect = 1.884e-77
Identity = 111/232 (47.84%), Postives = 161/232 (69.40%), Query Frame = 3
Query:   45 MAPMLGYWKLRGLAQPIRLLLEYTGEEYQEKLYELGNAPDFNRDEWLNEKFSLGLSFPNLPYLIEGDFKLTQSSAILRYIAEKHDMGS*INKFQFNFIY*LVGSSVEERAIVNMVADEIQDLRMSFVRLCYSPDFIKLKDDYISQLPSRLKLFSDFLGSKQWLIGEKLSYPDFIFYDILDGIKMLSPNCLDDFENIKTYMIRFEKLDPIAKYLKSNKYIRKPLYSKAASFGG 740
            M+  LGYW +RGLA  IRLLLEYT   Y+EK Y +G+APD++R +WLNEKF LGL FPNLPYLI+G  K+TQS+AIL YIA KH+               L G + EE+  V+++ ++  D+     R+CYSPDF KLK +Y+ +LP+ ++ FS FLG + W +G+K+++ DF+ YD+LD  ++  PNCLD F N+K ++ RFE L+ I+ Y+KS++++ KPLY++ A +G 
Sbjct:    1 MSMTLGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYIARKHN---------------LCGETEEEKIRVDILENQAMDVSNQLARVCYSPDFEKLKPEYLEELPTMMQHFSQFLGKRPWFVGDKITFVDFLAYDVLDLHRIFEPNCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPKPLYTRVAVWGN 217          
BLAST of Glutathione S-transferase vs. UniProt/SwissProt
Match: sp|P04905|GSTM1_RAT (Glutathione S-transferase Mu 1 OS=Rattus norvegicus OX=10116 GN=Gstm1 PE=1 SV=2)

HSP 1 Score: 238.039 bits (606), Expect = 4.801e-77
Identity = 110/232 (47.41%), Postives = 156/232 (67.24%), Query Frame = 3
Query:   45 MAPMLGYWKLRGLAQPIRLLLEYTGEEYQEKLYELGNAPDFNRDEWLNEKFSLGLSFPNLPYLIEGDFKLTQSSAILRYIAEKHDMGS*INKFQFNFIY*LVGSSVEERAIVNMVADEIQDLRMSFVRLCYSPDFIKLKDDYISQLPSRLKLFSDFLGSKQWLIGEKLSYPDFIFYDILDGIKMLSPNCLDDFENIKTYMIRFEKLDPIAKYLKSNKYIRKPLYSKAASFGG 740
            M  +LGYW +RGL  PIRLLLEYT   Y+EK Y +G+APD++R +WLNEKF LGL FPNLPYLI+G  K+TQS+AI+RY+A KH                L G + EER   ++V +++ D RM  + LCY+PDF K K +++  +P ++KL+S+FLG + W  G+K++Y DF+ YDILD   +  P CLD F N+K ++ RFE L  I+ Y+KS++Y+  P++SK A +  
Sbjct:    1 MPMILGYWNVRGLTHPIRLLLEYTDSSYEEKRYAMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGSRKITQSNAIMRYLARKHH---------------LCGETEEERIRADIVENQVMDNRMQLIMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYDILDQYHIFEPKCLDAFPNLKDFLARFEGLKKISAYMKSSRYLSTPIFSKLAQWSN 217          
BLAST of Glutathione S-transferase vs. UniProt/SwissProt
Match: sp|P16413|GSTMU_CAVPO (Glutathione S-transferase B OS=Cavia porcellus OX=10141 GN=GSTM1 PE=1 SV=1)

HSP 1 Score: 238.039 bits (606), Expect = 5.528e-77
Identity = 114/227 (50.22%), Postives = 158/227 (69.60%), Query Frame = 3
Query:   51 PM-LGYWKLRGLAQPIRLLLEYTGEEYQEKLYELGNAPDFNRDEWLNEKFSLGLSFPNLPYLIEGDFKLTQSSAILRYIAEKHDMGS*INKFQFNFIY*LVGSSVEERAIVNMVADEIQDLRMSFVRLCYSPDFIKLKDDYISQLPSRLKLFSDFLGSKQWLIGEKLSYPDFIFYDILDGIKMLSPNCLDDFENIKTYMIRFEKLDPIAKYLKSNKYIRKPLYSKAA 728
            PM LGYW +RGL  PIRL+LEYT   Y+EK Y +G+APD++R +WLNEKF LGL FPNLPYLI+G  KLTQS+AILRYIA KH+               L G + EE   ++++ +++ D+RM  + LCYSPDF + K +++  +P ++KLFS FLG   W  G KL+Y DF+ YD+LD  +ML P CL+ F N+K ++ RFE L+ I+ Y+KS++++ KPL+SK A
Sbjct:    1 PMTLGYWNIRGLTHPIRLILEYTNSGYEEKRYNMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGTHKLTQSNAILRYIARKHN---------------LCGVTEEETIRMDILENQVMDIRMQLIMLCYSPDFEQKKAEFLEGIPDKMKLFSQFLGKLPWFAGNKLTYVDFLAYDVLDQYRMLEPKCLEAFPNLKDFISRFEGLEKISSYMKSSRFLPKPLFSKFA 212          
BLAST of Glutathione S-transferase vs. TrEMBL
Match: G9BRW2 (Glutathione S-transferase OS=Dugesia japonica OX=6161 GN=GST PE=2 SV=1)

HSP 1 Score: 335.109 bits (858), Expect = 1.103e-112
Identity = 162/234 (69.23%), Postives = 191/234 (81.62%), Query Frame = 3
Query:   45 MAPMLGYWKLRGLAQPIRLLLEYTGEEYQEKLYELGNAPDFNRDEWLNEKFSLGLSFPNLPYLIEGDFKLTQSSAILRYIAEKHDMGS*INKFQFNFIY*LVGSSVEERAIVNMVADEIQDLRMSFVRLCYSPDFIKLKDDYISQLPSRLKLFSDFLGSKQWLIGEKLSYPDFIFYDILDGIKMLSPNCLDDFENIKTYMIRFEKLDPIAKYLKSNKYIRKPLYSKAASFGGDT 746
            MAP+LGYWK+RGLAQ IRLLLEYTGEEY EK YELGN  DFNRD+WLNEKFSLGLSFPNLPYLI+GD KLTQSSAILRY+AEKH+M               VG + EERA   M+A+E+QDLRM F RLCY+PDF  LK +Y+SQLPSRLKLFSDF+G+K WL+GEKL+YPDF FYD+LD +K+LSP CLD+F+N+K Y+  FEKL+PIAKY+KS+KYI+KPL +K   FGGD 
Sbjct:    1 MAPLLGYWKIRGLAQSIRLLLEYTGEEYNEKYYELGN--DFNRDDWLNEKFSLGLSFPNLPYLIDGDLKLTQSSAILRYLAEKHNM---------------VGETSEERARTMMLAEEVQDLRMGFARLCYNPDFANLKHEYLSQLPSRLKLFSDFIGTKHWLMGEKLTYPDFHFYDMLDSLKILSPTCLDEFDNLKNYLENFEKLEPIAKYMKSDKYIQKPLNNKVVKFGGDC 217          
BLAST of Glutathione S-transferase vs. TrEMBL
Match: K9IYW7 (Glutathione S-transferase OS=Desmodus rotundus OX=9430 PE=2 SV=1)

HSP 1 Score: 259.225 bits (661), Expect = 6.046e-83
Identity = 122/232 (52.59%), Postives = 167/232 (71.98%), Query Frame = 3
Query:   45 MAPMLGYWKLRGLAQPIRLLLEYTGEEYQEKLYELGNAPDFNRDEWLNEKFSLGLSFPNLPYLIEGDFKLTQSSAILRYIAEKHDMGS*INKFQFNFIY*LVGSSVEERAIVNMVADEIQDLRMSFVRLCYSPDFIKLKDDYISQLPSRLKLFSDFLGSKQWLIGEKLSYPDFIFYDILDGIKMLSPNCLDDFENIKTYMIRFEKLDPIAKYLKSNKYIRKPLYSKAASFGG 740
            MA  LGYW +RGLA  IRLLLEYT   YQEK Y LG+APDF++ +WL+EKF LGL FPNLPYLI+G  K+TQS+AILRYIA KH+               L G + EE+  ++++ +EI D+RM  +R+CYSPDF KLK +++  LP +LK FS FLG + W +G+KL+Y DF+ YDILD ++M  P CLD+F N+K +++RFE L  I+ Y+KS++++R P+YSKA+ +G 
Sbjct:    1 MAMTLGYWDVRGLAHSIRLLLEYTDSNYQEKKYTLGDAPDFDKSQWLSEKFKLGLDFPNLPYLIDGAHKVTQSNAILRYIARKHN---------------LCGETEEEKIRMDILENEIMDIRMYNIRICYSPDFEKLKPEFLKVLPEKLKQFSQFLGKRSWFVGDKLTYVDFLAYDILDVLRMFQPTCLDEFANLKDFLVRFEGLKKISAYMKSSRFLRTPVYSKASMWGN 217          
BLAST of Glutathione S-transferase vs. TrEMBL
Match: A0A151N8K8 (Glutathione S-transferase Mu 3 OS=Alligator mississippiensis OX=8496 GN=GSTM3 PE=4 SV=1)

HSP 1 Score: 258.07 bits (658), Expect = 2.287e-82
Identity = 119/231 (51.52%), Postives = 164/231 (71.00%), Query Frame = 3
Query:   45 MAPMLGYWKLRGLAQPIRLLLEYTGEEYQEKLYELGNAPDFNRDEWLNEKFSLGLSFPNLPYLIEGDFKLTQSSAILRYIAEKHDMGS*INKFQFNFIY*LVGSSVEERAIVNMVADEIQDLRMSFVRLCYSPDFIKLKDDYISQLPSRLKLFSDFLGSKQWLIGEKLSYPDFIFYDILDGIKMLSPNCLDDFENIKTYMIRFEKLDPIAKYLKSNKYIRKPLYSKAASFG 737
            MA +LGYW +RGLA  IRLLLEYTG  Y++KLY  G APD+++ +W+NEK  LGL FPNLPYLI+G  KLTQS+AILRYIA KHDM                G + EE+  ++M+ +++ D RMS V +CY+PDF KLK  Y+ QLP +LKLFS FLG ++W  GEK+++ DF+ YD+LD  +M  P CLD F+N+K ++ RFE LD IA Y++S+++++ P+ +K A +G
Sbjct:    1 MAAVLGYWDIRGLAHAIRLLLEYTGTTYEDKLYSCGEAPDYDKSQWINEKEKLGLDFPNLPYLIDGKTKLTQSNAILRYIARKHDM---------------CGETEEEKVRLDMLENQVMDFRMSLVMVCYNPDFEKLKPGYLEQLPGKLKLFSQFLGDRKWFAGEKITFVDFLMYDVLDQNRMFEPKCLDQFKNLKDFLDRFEALDKIAAYMRSDRFMKTPINNKMAKWG 216          
BLAST of Glutathione S-transferase vs. TrEMBL
Match: I3N180 (Uncharacterized protein OS=Ictidomys tridecemlineatus OX=43179 GN=LOC101959659 PE=3 SV=2)

HSP 1 Score: 251.906 bits (642), Expect = 5.585e-80
Identity = 118/232 (50.86%), Postives = 162/232 (69.83%), Query Frame = 3
Query:   45 MAPMLGYWKLRGLAQPIRLLLEYTGEEYQEKLYELGNAPDFNRDEWLNEKFSLGLSFPNLPYLIEGDFKLTQSSAILRYIAEKHDMGS*INKFQFNFIY*LVGSSVEERAIVNMVADEIQDLRMSFVRLCYSPDFIKLKDDYISQLPSRLKLFSDFLGSKQWLIGEKLSYPDFIFYDILDGIKMLSPNCLDDFENIKTYMIRFEKLDPIAKYLKSNKYIRKPLYSKAASFGG 740
            M   LGYW +RGLA PIRLLLEYT   Y+EK Y +G+APD++R +WLNEKF LGL FPNLPYLI+G  K+TQS+AILRY+A KH+               L G + EE+  V+++ +++ D+RM F+ LCY+PDF K K +Y+  LP ++KLFS FLG + W  G+K++Y DFI YD+LD  ++  P CL+ F N+K +M RFE L  I+ Y+KSN+++  PLYSK A++G 
Sbjct:    1 MPMTLGYWNIRGLAHPIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGPHKITQSNAILRYLARKHN---------------LCGETEEEKIRVDILENQVVDVRMHFIMLCYNPDFEKKKPEYLETLPEKIKLFSQFLGKRPWFAGDKITYVDFITYDVLDQHRVFEPKCLEAFPNLKDFMSRFEGLKKISAYMKSNRFLPTPLYSKMATWGN 217          
BLAST of Glutathione S-transferase vs. TrEMBL
Match: A0A151N9I2 (Glutathione S-transferase Mu 1 OS=Alligator mississippiensis OX=8496 GN=Y1Q_0014943 PE=3 SV=1)

HSP 1 Score: 250.751 bits (639), Expect = 1.380e-79
Identity = 116/230 (50.43%), Postives = 159/230 (69.13%), Query Frame = 3
Query:   45 MAPMLGYWKLRGLAQPIRLLLEYTGEEYQEKLYELGNAPDFNRDEWLNEKFSLGLSFPNLPYLIEGDFKLTQSSAILRYIAEKHDMGS*INKFQFNFIY*LVGSSVEERAIVNMVADEIQDLRMSFVRLCYSPDFIKLKDDYISQLPSRLKLFSDFLGSKQWLIGEKLSYPDFIFYDILDGIKMLSPNCLDDFENIKTYMIRFEKLDPIAKYLKSNKYIRKPLYSKAASF 734
            M  +LGYW +RGLA  IR+LLEYTG  Y++K Y  G APD++  +W NEK +LGL FPNLPYLI+G  KLTQS+AILRYIA KH+M                G + EE   V+MV +++ D+RM F ++CYSPDF KLK +Y+ QLP +LKLFS FLG ++W  GEKL+Y DF+ YD+LD  +M  P CLD  +N+K+++ RFE L+ IA Y+ S +Y++ P++ + A +
Sbjct:    1 MGVILGYWDIRGLAHSIRMLLEYTGTPYEDKQYTCGEAPDYDTSQWTNEKQNLGLDFPNLPYLIDGKTKLTQSNAILRYIARKHNM---------------CGKTEEEMIRVDMVENQVMDIRMGFAKICYSPDFEKLKPEYLEQLPGKLKLFSQFLGDRKWFAGEKLTYVDFLMYDVLDQHRMFEPKCLDQLKNLKSFLDRFEALEKIAAYMHSGRYMKTPIFWRIAQW 215          
BLAST of Glutathione S-transferase vs. Ensembl Cavefish
Match: ENSAMXT00000030565.1 (glutathione S-transferase Mu 3 [Source:NCBI gene;Acc:103025109])

HSP 1 Score: 210.305 bits (534), Expect = 3.789e-67
Identity = 101/227 (44.49%), Postives = 151/227 (66.52%), Query Frame = 3
Query:   57 LGYWKLRGLAQPIRLLLEYTGEEYQEKLYELGNAPDFNRDEWLNEKFSLGLSFPNLPYLIEGDFKLTQSSAILRYIAEKHDMGS*INKFQFNFIY*LVGSSVEERAIVNMVADEIQDLRMSFVRLCYSPDFIKLKDDYISQLPSRLKLFSDFLGSKQWLIGEKLSYPDFIFYDILDGIKMLSPNCLDDFENIKTYMIRFEKLDPIAKYLKSNKYIRKPLYSKAASFG 737
            L YW +RGLAQPIRLLLEYTG +Y++K Y  G APD+++  W NEK  L + FPNLPYL +GD K++QS+AI+RYI  KH+               L G + +E+  V+++ ++  D R  FV LCY  ++ + K  Y+  LP  LK FSDFLG ++W  G+K+++ DFI Y++LD  +M  P CLD+F+N++  + RFE L+ IA Y+KS+++++ P+ +K A +G
Sbjct:    3 LHYWDIRGLAQPIRLLLEYTGVKYEDKFYSCGEAPDYDKSCWFNEKPKLKMDFPNLPYLEDGDRKISQSNAIMRYIGRKHN---------------LCGETEDEKVRVDILENQAMDFRNGFVMLCYL-NYQEKKAGYLEALPGVLKQFSDFLGDRKWFAGDKITFVDFIMYELLDQHRMFEPKCLDNFKNLQDLLDRFEALEKIAAYMKSSRFMKTPVNNKMAKWG 213          
BLAST of Glutathione S-transferase vs. Ensembl Cavefish
Match: ENSAMXT00000048694.1 (glutathione S-transferase Mu 3 [Source:NCBI gene;Acc:103025109])

HSP 1 Score: 210.305 bits (534), Expect = 3.789e-67
Identity = 101/227 (44.49%), Postives = 151/227 (66.52%), Query Frame = 3
Query:   57 LGYWKLRGLAQPIRLLLEYTGEEYQEKLYELGNAPDFNRDEWLNEKFSLGLSFPNLPYLIEGDFKLTQSSAILRYIAEKHDMGS*INKFQFNFIY*LVGSSVEERAIVNMVADEIQDLRMSFVRLCYSPDFIKLKDDYISQLPSRLKLFSDFLGSKQWLIGEKLSYPDFIFYDILDGIKMLSPNCLDDFENIKTYMIRFEKLDPIAKYLKSNKYIRKPLYSKAASFG 737
            L YW +RGLAQPIRLLLEYTG +Y++K Y  G APD+++  W NEK  L + FPNLPYL +GD K++QS+AI+RYI  KH+               L G + +E+  V+++ ++  D R  FV LCY  ++ + K  Y+  LP  LK FSDFLG ++W  G+K+++ DFI Y++LD  +M  P CLD+F+N++  + RFE L+ IA Y+KS+++++ P+ +K A +G
Sbjct:    3 LHYWDIRGLAQPIRLLLEYTGVKYEDKFYSCGEAPDYDKSCWFNEKPKLKMDFPNLPYLEDGDRKISQSNAIMRYIGRKHN---------------LCGETEDEKVRVDILENQAMDFRNGFVMLCYL-NYQEKKAGYLEALPGVLKQFSDFLGDRKWFAGDKITFVDFIMYELLDQHRMFEPKCLDNFKNLQDLLDRFEALEKIAAYMKSSRFMKTPVNNKMAKWG 213          
BLAST of Glutathione S-transferase vs. Ensembl Cavefish
Match: GSTM3 (glutathione S-transferase Mu 3-like [Source:NCBI gene;Acc:103025412])

HSP 1 Score: 202.216 bits (513), Expect = 7.808e-64
Identity = 97/232 (41.81%), Postives = 146/232 (62.93%), Query Frame = 3
Query:   45 MAPMLGYWKLRGLAQPIRLLLEYTGEEYQEKLYELGNAPDFNRDEWLNEKFSLGLSFPNLPYLIEGDFKLTQSSAILRYIAEKHDMGS*INKFQFNFIY*LVGSSVEERAIVNMVADEIQDLRMSFVRLCYSPDFIKLKDDYISQLPSRLKLFSDFLGSKQWLIGEKLSYPDFIFYDILDGIKMLSPNCLDDFENIKTYMIRFEKLDPIAKYLKSNKYIRKPLYSKAASFGG 740
            M   L YW +RG AQ IRLLLEYTG +Y+ K Y  G APD++R  W N+K  L + F NLPYL +GD K+ QS+AI+RYIA K++               L G + +E+  V+++ ++  D R  F+RLCY       K  Y+  LP  LK FSDFLG ++W  G+K+++ DF  Y++LD  +M  P CLD+F+N++ ++ RFE L+ I+ Y+KS+++++ P+ +K A +G 
Sbjct:    9 MTMKLYYWDIRGAAQHIRLLLEYTGAKYENKFYSCGEAPDYDRSSWFNDKAKLKMDFTNLPYLEDGDRKIPQSNAIMRYIARKYN---------------LCGETEDEKVRVDILENQAMDFRNGFIRLCYMA--YDNKSAYLEALPGVLKQFSDFLGGRKWFAGDKITFVDFTMYELLDQHRMFEPKCLDNFKNLRDFLDRFEALEKISAYMKSSRFMKTPVNNKMAKWGN 223          
BLAST of Glutathione S-transferase vs. Ensembl Cavefish
Match: ENSAMXT00000048867.1 (glutathione S-transferase Mu 3 [Source:NCBI gene;Acc:103025109])

HSP 1 Score: 198.364 bits (503), Expect = 1.038e-61
Identity = 96/219 (43.84%), Postives = 145/219 (66.21%), Query Frame = 3
Query:   81 LAQPIRLLLEYTGEEYQEKLYELGNAPDFNRDEWLNEKFSLGLSFPNLPYLIEGDFKLTQSSAILRYIAEKHDMGS*INKFQFNFIY*LVGSSVEERAIVNMVADEIQDLRMSFVRLCYSPDFIKLKDDYISQLPSRLKLFSDFLGSKQWLIGEKLSYPDFIFYDILDGIKMLSPNCLDDFENIKTYMIRFEKLDPIAKYLKSNKYIRKPLYSKAASFG 737
            LAQPIRLLLEYTG +Y++K Y  G APD+++  W NEK  L + FPNLPYL +GD K++QS+AI+RYI  KH+               L G + +E+  V+++ ++  D R  FV LCY  ++ + K  Y+  LP  LK FSDFLG ++W  G+K+++ DFI Y++LD  +M  P CLD+F+N++  + RFE L+ IA Y+KS+++++ P+ +K A +G
Sbjct:   65 LAQPIRLLLEYTGVKYEDKFYSCGEAPDYDKSCWFNEKPKLKMDFPNLPYLEDGDRKISQSNAIMRYIGRKHN---------------LCGETEDEKVRVDILENQAMDFRNGFVMLCYL-NYQEKKAGYLEALPGVLKQFSDFLGDRKWFAGDKITFVDFIMYELLDQHRMFEPKCLDNFKNLQDLLDRFEALEKIAAYMKSSRFMKTPVNNKMAKWG 267          
BLAST of Glutathione S-transferase vs. Ensembl Cavefish
Match: GSTP1 (glutathione S-transferase pi 1 [Source:NCBI gene;Acc:103038276])

HSP 1 Score: 86.6557 bits (213), Expect = 8.459e-20
Identity = 58/226 (25.66%), Postives = 104/226 (46.02%), Query Frame = 3
Query:   45 MAP-MLGYWKLRGLAQPIRLLLEYTGEEYQEKLYELGNAPDFNRDEWLNEKFSLGLSFPNLPYLIEGDFKLTQSSAILRYIAEKHDMGS*INKFQFNFIY*LVGSSVEERAIVNMVADEIQDLRMSFVRLCYSPDFIKLKDDYISQLPSRLKLFSDFLGSKQ--WLIGEKLSYPDFIFYDILDGIKMLSPNCLDDFENIKTYMIRFEKLDPIAKYLKSNKYIRKPL 713
            MAP  + Y+ +RG     R++L   G+E++E +           ++W+         F  LP   +G   L QS+  LR++  KH                  G +  E A ++M  D ++DLR  ++++ Y  ++   KD YI  LP+ L  F   L   +  +L+G+ +S+ D+  +++L    +LSP CLD    +K+++        I  +L S  Y + P+
Sbjct:    1 MAPYTITYFAVRGRCGATRIMLADQGQEWKEIVVSF--------EDWMKGDLKKTCVFGQLPKFEDGGLTLFQSNTFLRHLGRKHGA---------------YGKNDCEAAQIDMFNDGVEDLRTKYLKMIYQ-EYETGKDAYIKDLPNHLCKFEAVLAKNKSGFLVGDSISFADYSLFEVLLNHLVLSPTCLDSLPALKSFVDTLSARPKIKAFLDSEDYKKLPI 202          
BLAST of Glutathione S-transferase vs. Ensembl Nematostella
Match: EDO42590 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S183])

HSP 1 Score: 204.142 bits (518), Expect = 3.797e-65
Identity = 106/235 (45.11%), Postives = 150/235 (63.83%), Query Frame = 3
Query:   45 MAPMLGYWKLRGLAQPIRLLLEYTGEEYQEKLYELGNAPDFNRDEWLNEKFSLGLSFPNLPYLIEGD---FKLTQSSAILRYIAEKHDMGS*INKFQFNFIY*LVGSSVEERAIVNMVADEIQDLRMSFVRLCYS-PDFIKLKDDYISQLPSRLKLFSDFLGSKQWLIGEKLSYPDFIFYDILDGIKMLSPNCLDDFENIKTYMIRFEKLDPIAKYLKSNKYIRKPLYSKAASFG 737
            M  + GYW +RGLAQPIRLLL+Y GEE+++K Y+       +R  W NEKFSLGL FPNLPY I+GD    K+TQS+AILRYI  K+DM                G + EE+ IV+++ +++ D R  FVRLCY+   F + K  YI    S +K F+DFLG K +L G+ L++ DF+ Y++LD  ++  P+ LD   N+K ++ RFEKL  IA Y+ SN++I++P+ S  A+F 
Sbjct:    1 MPSVFGYWAIRGLAQPIRLLLKYNGEEFEDKRYD-----GHDRTSWTNEKFSLGLDFPNLPYYIDGDKKHIKITQSNAILRYIGRKYDM---------------CGKTEEEKVIVDILENQLMDFRNGFVRLCYNNAAFEENKPAYIQSAQSSIKAFADFLGQKSYLAGDNLTFVDFVLYELLDQHRIFEPSLLDAHPNLKAFLDRFEKLPAIAAYMSSNEFIKRPINSPIAAFA 215          
BLAST of Glutathione S-transferase vs. Ensembl Nematostella
Match: EDO47273 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMI2])

HSP 1 Score: 187.963 bits (476), Expect = 7.872e-59
Identity = 93/229 (40.61%), Postives = 148/229 (64.63%), Query Frame = 3
Query:   48 APMLGYWKLRGLAQPIRLLLEYTGEEYQEKLYELGNAPDFNRDEWLNEKFSLGLSFPNLPYLIEGDFKLTQSSAILRYIAEKHDMGS*INKFQFNFIY*LVGSSVEERAIVNMVADEIQDLRMSFVRLCYSPDFIKLKDDYISQLPSRLKLFSDFLGSKQWLIGEKLSYPDFIFYDILDGIKMLSPNCLDDFENIKTYMIRFEKLDPIAKYLKSNKYIRKPLYSKAASF 734
             P+LGYW +RGL QPIRLLL+YT E++++K Y L +     ++EW  EK++LGL FPNLPY I+GD  +TQS+AILRYIA +H+M                G + +E  IV+M+ +++ ++   F R C+ P   K K  Y+  + + +K F+DFLG K +L GE+L++ DF+ Y+++D  ++  P+ L   EN+K ++ R E+L  +A+Y+KS ++I +P+ +  ASF
Sbjct:    4 VPILGYWPIRGLGQPIRLLLKYTNEDFEDKRYALASGG--KQNEWFIEKYNLGLDFPNLPYFIDGDIMITQSNAILRYIARRHNM---------------CGKTKKEMVIVDMLENQVMNI---FYR-CFKPTIFKNKAVYLKDIKAVIKRFADFLGEKTYLAGEELTFVDFVMYELMDHHRLFEPSLLQPHENLKMFLNRIEQLPAVAEYMKSEEFIHRPINAPFASF 211          
BLAST of Glutathione S-transferase vs. Ensembl Nematostella
Match: EDO42589 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S182])

HSP 1 Score: 177.948 bits (450), Expect = 9.146e-55
Identity = 91/232 (39.22%), Postives = 143/232 (61.64%), Query Frame = 3
Query:   45 MAPMLGYWKLRGLAQPIRLLLEYTGEEYQEKLYELGNAPDFNRDEWLNEKFSLGLSFPNLPYLIEGDFKLTQSSAILRYIAEKHDMGS*INKFQFNFIY*LVGSSVEERAIVNMVADEIQDLRMSFVRLCY-SPDFIKLKDDYISQLPSRLKLFSDFLGSKQWLIGEKLSYPDFIFYDILDGIKMLSPNCLDDFENIKTYMIRFEKLDPIAKYLKSNKYIRKPLYSKAASFG 737
            MAP+ GYWKLRGLA+ +R LL YT  EY+ K Y  G+APDFN+D WL+EK ++GL  PN+PY ++GD KLTQ+SAI+R+IA +HD               L G + EE+ + +M+  EI+D    F +  Y + +F +    Y+  + + +K F++FLG+  +  G+ L++ DF  ++ LD ++ L P  LD  +N+K +M R ++L  + +Y+ S  Y   P+ +K A +G
Sbjct:    1 MAPIFGYWKLRGLAEGVRYLLAYTNTEYERKDYVTGDAPDFNKDGWLSEKENIGLLLPNVPYNMDGDIKLTQTSAIMRHIARQHD---------------LCGKTEEEKCLCDMIDYEIKDFFPGFFKATYFTNNFEEDIKVYLKGIRTLVKRFANFLGTNPYFAGQNLTFADFNVWEALDQLRTLDPTILDGHDNLKGFMKRIQELPGVREYMASEFYHSLPISNKMAKWG 217          
BLAST of Glutathione S-transferase vs. Ensembl Nematostella
Match: EDO38608 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCI4])

HSP 1 Score: 59.6918 bits (143), Expect = 1.185e-10
Identity = 51/184 (27.72%), Postives = 85/184 (46.20%), Query Frame = 3
Query:   57 LGYWKLRGLAQPIRLLLEYTGEEYQEKLYELGNAPDFNRDEWLNEKFSLGLSFPNLPYLIEGD-FKLTQSSAILRYIAEKHDMGS*INKFQFNFIY*LVGSSVEERAIVNMVADEIQDLRMSFVRLCYSPD----FIKLKDDY-ISQLPSRLKLFSDFL--GSKQWLIGEKLSYPDFIFYDILD 584
            L Y+  RG A+P RL     G EY++K +E        R+EWL  K  L   F  +P L+  D  KL QS AIL Y+A +                 L  ++  + A+ +M+     DL    ++     D     +KL+++   + +P+ L+  S FL      +L+ +KL+Y D + +++ D
Sbjct:    6 LHYFNARGRAEPARLAFAAAGIEYEDKRFE-------GREEWLRVKPELDPPFGQVPLLVIDDKIKLAQSMAILAYVAREGG---------------LAPTNSLDIAMCDMIVGVEGDLNSKGMKWFMEKDEKKKVLKLREELDTTHIPAFLEAMSKFLEKNGTGFLVTDKLTYADILVFNVCD 167          
BLAST of Glutathione S-transferase vs. Ensembl Nematostella
Match: EDO33767 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SR87])

HSP 1 Score: 50.447 bits (119), Expect = 1.851e-7
Identity = 55/192 (28.65%), Postives = 80/192 (41.67%), Query Frame = 3
Query:   45 MAPM--LGYWKLRGLAQPIRLLLEYTGEEYQEKLYELGNAPDFNRDEWLNEKFSLGLSFPNLPYL-IEGDFKLTQSSAILRYIAEKHDMGS*INKFQFNFIY*LVGSSVEERAIVNMVADEIQDLRMSFVRLCYSPDF----IKLKDDYISQLPSRL----KLFSDFLGSKQWLIGEKLSYPDFIFYDILDG 587
            MAP   + Y+  R  A+ IR+LL      + +   E    PD     W   K S    F  LP L I    KL QS AI R++A++H                L  S    +A  +M  D  +D+        +  D      K K+ +   LP RL    KLF +  G K +L+G+K++Y D  F+   +G
Sbjct:    1 MAPTYRVVYFDARARAECIRVLLHLADVPFTD---ERVAPPD-----WAAMKTSGRCPFGELPLLEISDGRKLAQSHAIFRFLAKEHG---------------LAPSDSYSQARCDMFLDNTKDMIEKVGTAFWEKDEKLKEQKSKEFHEETLPKRLEFINKLFQENKGGKGYLVGDKITYADIDFFCFFNG 169          
BLAST of Glutathione S-transferase vs. Ensembl Medaka
Match: GSTM4 (glutathione S-transferase Mu 5 [Source:NCBI gene;Acc:101157858])

HSP 1 Score: 225.713 bits (574), Expect = 4.533e-73
Identity = 105/231 (45.45%), Postives = 158/231 (68.40%), Query Frame = 3
Query:   45 MAPMLGYWKLRGLAQPIRLLLEYTGEEYQEKLYELGNAPDFNRDEWLNEKFSLGLSFPNLPYLIEGDFKLTQSSAILRYIAEKHDMGS*INKFQFNFIY*LVGSSVEERAIVNMVADEIQDLRMSFVRLCYSPDFIKLKDDYISQLPSRLKLFSDFLGSKQWLIGEKLSYPDFIFYDILDGIKMLSPNCLDDFENIKTYMIRFEKLDPIAKYLKSNKYIRKPLYSKAASFG 737
            M+  LGYW +RGLA P RLLLEYTG +Y+EK Y  G AP++++  W + KF LGL FPNLPYL++GD K+ QS+AI RY+A K+                L G + EE+  ++++ + + D RMSF+R+CY+ D+  LK +Y+  LP  LK FSDFLG+++W  G++L++ DFI YD+LD  ++  P CLD F+N+K ++ RFE L+ I+ ++KS +YIR P++++ A +G
Sbjct:    1 MSMTLGYWDIRGLAHPTRLLLEYTGAKYEEKTYVCGEAPNYDKSGWFSVKFKLGLDFPNLPYLVDGDKKIVQSNAIQRYLARKNK---------------LCGETEEEKIRLDILENVVMDFRMSFIRMCYT-DYENLKPEYLKTLPDVLKQFSDFLGNRKWFAGDRLTFGDFIMYDVLDQQRIFLPTCLDAFKNLKDFLDRFESLERISAFMKSGRYIRTPIHNRMAKWG 215          
BLAST of Glutathione S-transferase vs. Ensembl Medaka
Match: gstm.1 (glutathione S-transferase Mu 3 [Source:NCBI gene;Acc:101157367])

HSP 1 Score: 225.328 bits (573), Expect = 4.320e-72
Identity = 105/231 (45.45%), Postives = 156/231 (67.53%), Query Frame = 3
Query:   45 MAPMLGYWKLRGLAQPIRLLLEYTGEEYQEKLYELGNAPDFNRDEWLNEKFSLGLSFPNLPYLIEGDFKLTQSSAILRYIAEKHDMGS*INKFQFNFIY*LVGSSVEERAIVNMVADEIQDLRMSFVRLCYSPDFIKLKDDYISQLPSRLKLFSDFLGSKQWLIGEKLSYPDFIFYDILDGIKMLSPNCLDDFENIKTYMIRFEKLDPIAKYLKSNKYIRKPLYSKAASFG 737
            MA  L YW +RGLAQPIRLLLEYTG  Y++K Y  G AP++++  W + K  LG+ FPNLPYL++GD K+ QS+AI+RYIA KH+               L G + +E+  V+++ ++  D R  FVR+CY+ D  K+K  Y+  LP  LK FSDFLG + W  GEK+++ DF+ Y++LD  +M  P+CLDDF+N+K ++ RFE L+ I+ Y+KS+++++ P+ +K A +G
Sbjct:   66 MAMTLAYWDIRGLAQPIRLLLEYTGTSYEDKFYVCGEAPNYDKSCWFDIKEKLGMDFPNLPYLLDGDRKIVQSNAIMRYIARKHN---------------LCGETEDEKVRVDIIENQAMDFRNGFVRMCYT-DLDKMKPGYLKSLPEVLKQFSDFLGDRDWFAGEKITFVDFLMYELLDQHRMFHPSCLDDFKNLKDFLDRFEALEKISAYMKSDRFMKTPVNNKMAKWG 280          
BLAST of Glutathione S-transferase vs. Ensembl Medaka
Match: GSTM4 (glutathione S-transferase Mu 5 [Source:NCBI gene;Acc:101157858])

HSP 1 Score: 210.305 bits (534), Expect = 1.131e-66
Identity = 100/231 (43.29%), Postives = 154/231 (66.67%), Query Frame = 3
Query:   45 MAPMLGYWKLRGLAQPIRLLLEYTGEEYQEKLYELGNAPDFNRDEWLNEKFSLGLSFPNLPYLIEGDFKLTQSSAILRYIAEKHDMGS*INKFQFNFIY*LVGSSVEERAIVNMVADEIQDLRMSFVRLCYSPDFIKLKDDYISQLPSRLKLFSDFLGSKQWLIGEKLSYPDFIFYDILDGIKMLSPNCLDDFENIKTYMIRFEKLDPIAKYLKSNKYIRKPLYSKAASFG 737
            +  +L Y +   LA P RLLLEYTG +Y+EK Y  G AP++++  W + KF LGL FPNLPYL++GD K+ QS+AI RY+A K+                L G + EE+  ++++ + + D RMSF+R+CY+ D+  LK +Y+  LP  LK FSDFLG+++W  G++L++ DFI YD+LD  ++  P CLD F+N+K ++ RFE L+ I+ ++KS +YIR P++++ A +G
Sbjct:   36 VTKLLSYSEPVQLAHPTRLLLEYTGAKYEEKTYVCGEAPNYDKSGWFSVKFKLGLDFPNLPYLVDGDKKIVQSNAIQRYLARKNK---------------LCGETEEEKIRLDILENVVMDFRMSFIRMCYT-DYENLKPEYLKTLPDVLKQFSDFLGNRKWFAGDRLTFGDFIMYDVLDQQRIFLPTCLDAFKNLKDFLDRFESLERISAFMKSGRYIRTPIHNRMAKWG 250          
BLAST of Glutathione S-transferase vs. Ensembl Medaka
Match: ENSORLT00000012133.2 (glutathione S-transferase alpha 4 [Source:NCBI gene;Acc:101174370])

HSP 1 Score: 69.3218 bits (168), Expect = 1.783e-13
Identity = 62/220 (28.18%), Postives = 100/220 (45.45%), Query Frame = 3
Query:   54 MLGYWKLRGLAQPIRLLLEYTGEEYQEKLYELGNAPDFNRDEWLNEKFSLGLSFPNLPYLIEGDFKLTQSSAILRYIAEKHDMGS*INKFQFNFIY*LVGSSVEERAIVNMVADEIQDLRMSFVRLCYSPDFIKLKDDYISQLPSR-LKLFSDFLGSKQWLIGEKLSYPDFIFYDILDGIKMLSPNCLDDFENIKTYMIRFEKLDPIAKYLKSNKYIRKP 710
            +L Y+  RG  + IR LL     E+ E           +RD++        L F  +P +     KL Q+ AIL YIAEK++               L G  ++ERA+VNM A+ + DL    + L +  D     D+  S+   R L +F   L    +L+G KLSY D +  +    ++      L DF ++K++  R  K+  ++++L+     RKP
Sbjct:    6 VLHYFNGRGKMESIRWLLTVVEAEFDEMYLT-------SRDQYEKLLNDGSLMFQQVPLVEIDGMKLVQTKAILHYIAEKYN---------------LHGKDIKERAMVNMYAEGLIDLMEMMMMLPFVADPKPKLDNIQSKAKERYLPVFEKALSGPVYLVGGKLSYADVLLLECTLMLEEKFTGILGDFPSVKSFQGRMIKIPAVSRFLQPGSK-RKP 202          
BLAST of Glutathione S-transferase vs. Planmine SMEST
Match: SMESG000014182.1 (SMESG000014182.1)

HSP 1 Score: 434.491 bits (1116), Expect = 1.622e-155
Identity = 218/235 (92.77%), Postives = 219/235 (93.19%), Query Frame = 3
Query:   45 MAPMLGYWKLRGLAQPIRLLLEYTGEEYQEKLYELGNAPDFNRDEWLNEKFSLGLSFPNLPYLIEGDFKLTQSSAILRYIAEKHDMGS*INKFQFNFIY*LVGSSVEERAIVNMVADEIQDLRMSFVRLCYSPDFIKLKDDYISQLPSRLKLFSDFLGSKQWLIGEKLSYPDFIFYDILDGIKMLSPNCLDDFENIKTYMIRFEKLDPIAKYLKSNKYIRKPLYSKAASFGGDTD 749
            MAPMLGYWKLRGLAQPIRLLLEYTGEEYQEKLYELGNAPDFNRDEWLNEKFSLGLSFPNLPYLIEGDFKLTQSSAILRYIAEKHDM               VGSSVEERAIVNMVADEIQDLRMSF RLCYSPDFIKLKDDYISQLPSRLKLFSDFLGSKQWLIGEKLSYPDFIFYDILDGIKMLSPNCL+DFENIKTYMIRFEKLDPIAKYLKSNKYIRKPLYSKAASFGGDTD
Sbjct:    1 MAPMLGYWKLRGLAQPIRLLLEYTGEEYQEKLYELGNAPDFNRDEWLNEKFSLGLSFPNLPYLIEGDFKLTQSSAILRYIAEKHDM---------------VGSSVEERAIVNMVADEIQDLRMSFARLCYSPDFIKLKDDYISQLPSRLKLFSDFLGSKQWLIGEKLSYPDFIFYDILDGIKMLSPNCLNDFENIKTYMIRFEKLDPIAKYLKSNKYIRKPLYSKAASFGGDTD 220          
BLAST of Glutathione S-transferase vs. Planmine SMEST
Match: SMESG000014182.1 (SMESG000014182.1)

HSP 1 Score: 427.943 bits (1099), Expect = 5.770e-153
Identity = 215/232 (92.67%), Postives = 216/232 (93.10%), Query Frame = 3
Query:   54 MLGYWKLRGLAQPIRLLLEYTGEEYQEKLYELGNAPDFNRDEWLNEKFSLGLSFPNLPYLIEGDFKLTQSSAILRYIAEKHDMGS*INKFQFNFIY*LVGSSVEERAIVNMVADEIQDLRMSFVRLCYSPDFIKLKDDYISQLPSRLKLFSDFLGSKQWLIGEKLSYPDFIFYDILDGIKMLSPNCLDDFENIKTYMIRFEKLDPIAKYLKSNKYIRKPLYSKAASFGGDTD 749
            MLGYWKLRGLAQPIRLLLEYTGEEYQEKLYELGNAPDFNRDEWLNEKFSLGLSFPNLPYLIEGDFKLTQSSAILRYIAEKHDM               VGSSVEERAIVNMVADEIQDLRMSF RLCYSPDFIKLKDDYISQLPSRLKLFSDFLGSKQWLIGEKLSYPDFIFYDILDGIKMLSPNCL+DFENIKTYMIRFEKLDPIAKYLKSNKYIRKPLYSKAASFGGDTD
Sbjct:    1 MLGYWKLRGLAQPIRLLLEYTGEEYQEKLYELGNAPDFNRDEWLNEKFSLGLSFPNLPYLIEGDFKLTQSSAILRYIAEKHDM---------------VGSSVEERAIVNMVADEIQDLRMSFARLCYSPDFIKLKDDYISQLPSRLKLFSDFLGSKQWLIGEKLSYPDFIFYDILDGIKMLSPNCLNDFENIKTYMIRFEKLDPIAKYLKSNKYIRKPLYSKAASFGGDTD 217          
BLAST of Glutathione S-transferase vs. Planmine SMEST
Match: SMESG000015099.1 (SMESG000015099.1)

HSP 1 Score: 413.305 bits (1061), Expect = 3.632e-147
Identity = 208/235 (88.51%), Postives = 212/235 (90.21%), Query Frame = 3
Query:   45 MAPMLGYWKLRGLAQPIRLLLEYTGEEYQEKLYELGNAPDFNRDEWLNEKFSLGLSFPNLPYLIEGDFKLTQSSAILRYIAEKHDMGS*INKFQFNFIY*LVGSSVEERAIVNMVADEIQDLRMSFVRLCYSPDFIKLKDDYISQLPSRLKLFSDFLGSKQWLIGEKLSYPDFIFYDILDGIKMLSPNCLDDFENIKTYMIRFEKLDPIAKYLKSNKYIRKPLYSKAASFGGDTD 749
            MAPMLGYWK+RGLAQPIRLLLEYTGEEYQEKLYELGNAPDFNRDEWLNEKFSLGLSFPNLPYLIEGD KLTQSSAILRYIAEKHDM               VGSSVEERAIVNMVADEIQDLRMSFVRLCYSPDFIKLKDDYISQLPSRLKLFSDFLGSKQWL GEKLSYPDF FYDILDGIKMLSPNCLDDFENIKTY+ +FEKLDPIAKYLKSNKYI KPL +K A FGGDTD
Sbjct:    1 MAPMLGYWKIRGLAQPIRLLLEYTGEEYQEKLYELGNAPDFNRDEWLNEKFSLGLSFPNLPYLIEGDLKLTQSSAILRYIAEKHDM---------------VGSSVEERAIVNMVADEIQDLRMSFVRLCYSPDFIKLKDDYISQLPSRLKLFSDFLGSKQWLNGEKLSYPDFNFYDILDGIKMLSPNCLDDFENIKTYINKFEKLDPIAKYLKSNKYIHKPLNNKVAKFGGDTD 220          
BLAST of Glutathione S-transferase vs. Planmine SMEST
Match: SMESG000015099.1 (SMESG000015099.1)

HSP 1 Score: 406.757 bits (1044), Expect = 1.221e-144
Identity = 205/232 (88.36%), Postives = 209/232 (90.09%), Query Frame = 3
Query:   54 MLGYWKLRGLAQPIRLLLEYTGEEYQEKLYELGNAPDFNRDEWLNEKFSLGLSFPNLPYLIEGDFKLTQSSAILRYIAEKHDMGS*INKFQFNFIY*LVGSSVEERAIVNMVADEIQDLRMSFVRLCYSPDFIKLKDDYISQLPSRLKLFSDFLGSKQWLIGEKLSYPDFIFYDILDGIKMLSPNCLDDFENIKTYMIRFEKLDPIAKYLKSNKYIRKPLYSKAASFGGDTD 749
            MLGYWK+RGLAQPIRLLLEYTGEEYQEKLYELGNAPDFNRDEWLNEKFSLGLSFPNLPYLIEGD KLTQSSAILRYIAEKHDM               VGSSVEERAIVNMVADEIQDLRMSFVRLCYSPDFIKLKDDYISQLPSRLKLFSDFLGSKQWL GEKLSYPDF FYDILDGIKMLSPNCLDDFENIKTY+ +FEKLDPIAKYLKSNKYI KPL +K A FGGDTD
Sbjct:    1 MLGYWKIRGLAQPIRLLLEYTGEEYQEKLYELGNAPDFNRDEWLNEKFSLGLSFPNLPYLIEGDLKLTQSSAILRYIAEKHDM---------------VGSSVEERAIVNMVADEIQDLRMSFVRLCYSPDFIKLKDDYISQLPSRLKLFSDFLGSKQWLNGEKLSYPDFNFYDILDGIKMLSPNCLDDFENIKTYINKFEKLDPIAKYLKSNKYIHKPLNNKVAKFGGDTD 217          
BLAST of Glutathione S-transferase vs. Planmine SMEST
Match: SMESG000014182.1 (SMESG000014182.1)

HSP 1 Score: 390.578 bits (1002), Expect = 2.356e-138
Identity = 202/235 (85.96%), Postives = 203/235 (86.38%), Query Frame = 3
Query:   45 MAPMLGYWKLRGLAQPIRLLLEYTGEEYQEKLYELGNAPDFNRDEWLNEKFSLGLSFPNLPYLIEGDFKLTQSSAILRYIAEKHDMGS*INKFQFNFIY*LVGSSVEERAIVNMVADEIQDLRMSFVRLCYSPDFIKLKDDYISQLPSRLKLFSDFLGSKQWLIGEKLSYPDFIFYDILDGIKMLSPNCLDDFENIKTYMIRFEKLDPIAKYLKSNKYIRKPLYSKAASFGGDTD 749
            MAPMLGYWKLRGLAQPIRLLLEYTGEEYQEKLYELGN                GLSFPNLPYLIEGDFKLTQSSAILRYIAEKHDM               VGSSVEERAIVNMVADEIQDLRMSF RLCYSPDFIKLKDDYISQLPSRLKLFSDFLGSKQWLIGEKLSYPDFIFYDILDGIKMLSPNCL+DFENIKTYMIRFEKLDPIAKYLKSNKYIRKPLYSKAASFGGDTD
Sbjct:    1 MAPMLGYWKLRGLAQPIRLLLEYTGEEYQEKLYELGN----------------GLSFPNLPYLIEGDFKLTQSSAILRYIAEKHDM---------------VGSSVEERAIVNMVADEIQDLRMSFARLCYSPDFIKLKDDYISQLPSRLKLFSDFLGSKQWLIGEKLSYPDFIFYDILDGIKMLSPNCLNDFENIKTYMIRFEKLDPIAKYLKSNKYIRKPLYSKAASFGGDTD 204          
The following BLAST results are available for this feature:
BLAST of Glutathione S-transferase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GSTM43.924e-7847.84glutathione S-transferase mu 4 [Source:HGNC Symbol... [more]
GSTM53.529e-7749.57glutathione S-transferase mu 5 [Source:HGNC Symbol... [more]
GSTM45.393e-7746.98glutathione S-transferase mu 4 [Source:HGNC Symbol... [more]
GSTM23.005e-7647.84glutathione S-transferase mu 2 [Source:HGNC Symbol... [more]
GSTM19.220e-7547.19glutathione S-transferase mu 1 [Source:HGNC Symbol... [more]
back to top
BLAST of Glutathione S-transferase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gst-235.221e-1931.19Glutathione S-Transferase [Source:UniProtKB/TrEMB... [more]
gst-14.246e-1827.63Glutathione S-transferase P [Source:UniProtKB/Swi... [more]
gst-14.246e-1827.63Glutathione S-transferase P [Source:UniProtKB/Swi... [more]
gst-101.936e-1626.15Glutathione S-transferase P 10 [Source:UniProtKB/... [more]
gst-256.033e-1625.44Glutathione S-Transferase [Source:UniProtKB/TrEMB... [more]
back to top
BLAST of Glutathione S-transferase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glutathione S-transferase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gstm.25.038e-7548.28glutathione S-transferase mu tandem duplicate 2 [S... [more]
gstm.39.359e-7547.62glutathione S-transferase mu tandem duplicate 3 [S... [more]
gstm.14.013e-7446.98glutathione S-transferase mu, tandem duplicate 1 [... [more]
gstm.37.800e-3947.79glutathione S-transferase mu tandem duplicate 3 [S... [more]
gstp11.110e-2325.22glutathione S-transferase pi 1 [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of Glutathione S-transferase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
krt8.21.905e-6644.30keratin 8 [Source:Xenbase;Acc:XB-GENE-876686][more]
nemp12.449e-2632.30nuclear envelope integral membrane protein 1 [Sour... [more]
gnrhr1.372e-2533.05gonadotropin releasing hormone receptor [Source:Xe... [more]
gnrhr3.477e-2533.33gonadotropin releasing hormone receptor [Source:Xe... [more]
gnrhr8.649e-2232.46gonadotropin releasing hormone receptor [Source:Xe... [more]
back to top
BLAST of Glutathione S-transferase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gstm41.203e-8150.22glutathione S-transferase, mu 4 [Source:MGI Symbol... [more]
Gstm11.756e-7948.28glutathione S-transferase, mu 1 [Source:MGI Symbol... [more]
Gstm21.009e-7547.81glutathione S-transferase, mu 2 [Source:MGI Symbol... [more]
Gstm35.803e-7545.49glutathione S-transferase, mu 3 [Source:MGI Symbol... [more]
Gstm71.078e-7445.49glutathione S-transferase, mu 7 [Source:MGI Symbol... [more]
back to top
BLAST of Glutathione S-transferase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P10649|GSTM1_MOUSE1.229e-7848.28Glutathione S-transferase Mu 1 OS=Mus musculus OX=... [more]
sp|Q9N0V4|GSTM1_BOVIN3.978e-7848.92Glutathione S-transferase Mu 1 OS=Bos taurus OX=99... [more]
sp|Q03013|GSTM4_HUMAN1.884e-7747.84Glutathione S-transferase Mu 4 OS=Homo sapiens OX=... [more]
sp|P04905|GSTM1_RAT4.801e-7747.41Glutathione S-transferase Mu 1 OS=Rattus norvegicu... [more]
sp|P16413|GSTMU_CAVPO5.528e-7750.22Glutathione S-transferase B OS=Cavia porcellus OX=... [more]
back to top
BLAST of Glutathione S-transferase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G9BRW21.103e-11269.23Glutathione S-transferase OS=Dugesia japonica OX=6... [more]
K9IYW76.046e-8352.59Glutathione S-transferase OS=Desmodus rotundus OX=... [more]
A0A151N8K82.287e-8251.52Glutathione S-transferase Mu 3 OS=Alligator missis... [more]
I3N1805.585e-8050.86Uncharacterized protein OS=Ictidomys tridecemlinea... [more]
A0A151N9I21.380e-7950.43Glutathione S-transferase Mu 1 OS=Alligator missis... [more]
back to top
BLAST of Glutathione S-transferase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000030565.13.789e-6744.49glutathione S-transferase Mu 3 [Source:NCBI gene;A... [more]
ENSAMXT00000048694.13.789e-6744.49glutathione S-transferase Mu 3 [Source:NCBI gene;A... [more]
GSTM37.808e-6441.81glutathione S-transferase Mu 3-like [Source:NCBI g... [more]
ENSAMXT00000048867.11.038e-6143.84glutathione S-transferase Mu 3 [Source:NCBI gene;A... [more]
GSTP18.459e-2025.66glutathione S-transferase pi 1 [Source:NCBI gene;A... [more]
back to top
BLAST of Glutathione S-transferase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glutathione S-transferase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glutathione S-transferase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO425903.797e-6545.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO472737.872e-5940.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO425899.146e-5539.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO386081.185e-1027.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO337671.851e-728.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Glutathione S-transferase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
GSTM44.533e-7345.45glutathione S-transferase Mu 5 [Source:NCBI gene;A... [more]
gstm.14.320e-7245.45glutathione S-transferase Mu 3 [Source:NCBI gene;A... [more]
GSTM41.131e-6643.29glutathione S-transferase Mu 5 [Source:NCBI gene;A... [more]
ENSORLT00000012133.21.783e-1328.18glutathione S-transferase alpha 4 [Source:NCBI gen... [more]
back to top
BLAST of Glutathione S-transferase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000014182.11.622e-15592.77SMESG000014182.1[more]
SMESG000014182.15.770e-15392.67SMESG000014182.1[more]
SMESG000015099.13.632e-14788.51SMESG000015099.1[more]
SMESG000015099.11.221e-14488.36SMESG000015099.1[more]
SMESG000014182.12.356e-13885.96SMESG000014182.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019092 ID=SMED30019092|Name=Glutathione S-transferase|organism=Schmidtea mediterranea sexual|type=transcript|length=968bp
CCTTAAAATCAATCAACTTTCCAATATTATTGTATTTGTTTAACATGGCT
CCTATGTTAGGTTACTGGAAGCTTCGAGGACTAGCTCAACCTATTAGACT
TTTACTGGAATATACAGGAGAAGAATACCAAGAAAAGTTATACGAATTGG
GGAACGCGCCGGATTTCAATAGAGATGAATGGTTAAATGAAAAATTTAGT
TTAGGATTAAGTTTTCCAAATCTGCCATATTTAATTGAAGGAGATTTTAA
ATTAACTCAATCTTCTGCTATTTTGCGTTACATAGCAGAAAAGCATGACA
TGGGTAGTTAAATCAACAAATTTCAGTTTAATTTCATTTATTAACTAGTT
GGATCTTCTGTTGAAGAAAGAGCTATCGTAAATATGGTCGCAGATGAAAT
CCAGGATCTTCGAATGAGTTTTGTAAGATTGTGTTATAGCCCGGATTTTA
TCAAATTAAAAGATGATTATATATCGCAATTACCAAGTCGTTTGAAACTA
TTTTCCGACTTTTTAGGAAGTAAACAATGGCTGATTGGTGAAAAGTTAAG
TTATCCCGATTTCATTTTCTATGACATACTAGACGGCATAAAAATGCTTT
CACCAAATTGTTTAGATGATTTCGAAAATATTAAAACATACATGATTAGA
TTTGAGAAATTGGATCCGATTGCGAAGTATTTGAAATCAAATAAATATAT
ACGCAAACCGCTTTATAGTAAAGCAGCGAGTTTTGGAGGTGATACTGATT
AAATGTTATCGGTAAAATGTGAATCAAACTTGCATTGAATTTTTGTTACT
AAATAAGTGGGAAATGAAATATTTATCCTTCTAGTGTATTAAAGTTGGAT
ATTTATAATGGATAGGTTCTTTTAGAATTTTTTAATTCAATGAACTTTCA
AGTTGTTAGTTCATTATATTACATGTTAATTATGGCACATTTTTGGAATT
AAATAATGAATTAGTTTG
back to top

protein sequence of SMED30019092-orf-1

>SMED30019092-orf-1 ID=SMED30019092-orf-1|Name=SMED30019092-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=123bp
MVADEIQDLRMSFVRLCYSPDFIKLKDDYISQLPSRLKLFSDFLGSKQWL
IGEKLSYPDFIFYDILDGIKMLSPNCLDDFENIKTYMIRFEKLDPIAKYL
KSNKYIRKPLYSKAASFGGDTD*
back to top

protein sequence of SMED30019092-orf-2

>SMED30019092-orf-2 ID=SMED30019092-orf-2|Name=SMED30019092-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=103bp
LKSINFPILLYLFNMAPMLGYWKLRGLAQPIRLLLEYTGEEYQEKLYELG
NAPDFNRDEWLNEKFSLGLSFPNLPYLIEGDFKLTQSSAILRYIAEKHDM
GS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036282Glutathione-S-Trfase_C_sf
IPR004046GST_C
IPR010987Glutathione-S-Trfase_C-like
IPR012336Thioredoxin-like_fold
IPR004045Glutathione_S-Trfase_N
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0004364glutathione transferase activity
GO:0016740transferase activity
Vocabulary: biological process
TermDefinition
GO:0008152metabolic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.20.1050.130coord: 1..122
e-value: 3.6E-36
score: 126.7
NoneNo IPR availablePANTHERPTHR11571GLUTATHIONE S-TRANSFERASEcoord: 3..117
NoneNo IPR availablePANTHERPTHR11571:SF137GLUTATHIONE S-TRANSFERASE MU 1coord: 3..117
IPR004046Glutathione S-transferase, C-terminalPFAMPF14497GST_C_3coord: 7..102
e-value: 2.0E-15
score: 56.7
IPR010987Glutathione S-transferase, C-terminal-likePROSITEPS50405GST_CTERcoord: 1..110
score: 19.264
IPR036282Glutathione S-transferase, C-terminal domain superfamilySUPERFAMILYSSF47616GST C-terminal domain-likecoord: 1..119