SMED30019091

Overview
NameSMED30019091
Smed IDSMED30019091
Length (bp)5048
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30019091 (SMED30019091) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30019091 (SMED30019091) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30019091 (SMED30019091) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30019091 (SMED30019091) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019091

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30019091 SmedASXL_070883SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30019091 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.002786:11684..15798 +18368
Homology
BLAST of SMED30019091 vs. Ensembl Zebrafish
Match: CABZ01030006.1 (pep scaffold:GRCz11:KN150258.1:33006:36502:-1 gene:ENSDARG00000114113.1 transcript:ENSDART00000182402.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CABZ01030006.1)

HSP 1 Score: 60.077 bits (144), Expect = 6.535e-12
Identity = 39/104 (37.50%), Postives = 58/104 (55.77%), Query Frame = -3
Query: 4681 SQNIVTKIFVENIIFRYGVPKKLFTDQGTNFQSELFKSINELFGIW----KLNTSYHPQTDGLVERFNGTIINMIS-YVNRRQKD*DEFIKPCLFAYRNAVNVS 4977
            +Q I T I  + ++ R+GVP  + +D+G  F S LF    EL G W    KL T+YHPQT+ + ER N T+ +MI+ +V    K  D ++    FA  +A+  S
Sbjct:   80 AQTIAT-ILRQEMLTRWGVPDFILSDRGAQFVSSLF---TELCGKWNITPKLTTAYHPQTN-MTERVNRTLKSMIAGFVEDNHKTWDTYLPELRFALNSAIQES 178          

HSP 2 Score: 32.3426 bits (72), Expect = 6.535e-12
Identity = 10/27 (37.04%), Postives = 21/27 (77.78%), Query Frame = -2
Query: 4967 MDIIGPLPETINGNKCIIVFCDYLTEY 5047
            +DI+GP+P++   N+ ++VF DY +++
Sbjct:   43 VDIMGPMPKSGKQNEYLLVFVDYFSKW 69          
BLAST of SMED30019091 vs. Ensembl Xenopus
Match: mybl2 (MYB proto-oncogene like 2 [Source:Xenbase;Acc:XB-GENE-982419])

HSP 1 Score: 76.2554 bits (186), Expect = 2.260e-16
Identity = 40/91 (43.96%), Postives = 57/91 (62.64%), Query Frame = -3
Query: 4678 NIIFRYGVPKKLFTDQGTNFQSELFKSINELFGIWKLNTS-YHPQTDGLVERFNGTIINMI-SYVNRRQKD*DEFIKPCLFAYRNAVNVST 4944
            ++  R G+PK++ TDQGT F S + K +  LF + +L TS YHPQTDGLVERFN T+ +M+   V++  K+ D  +   +FA R     ST
Sbjct:  197 HVFSRVGIPKEILTDQGTPFMSRVMKELCRLFKVVQLRTSVYHPQTDGLVERFNKTLKSMLKKVVDKDGKNWDYLLPYLMFAIREVPQSST 287          

HSP 2 Score: 31.9574 bits (71), Expect = 2.260e-16
Identity = 11/29 (37.93%), Postives = 20/29 (68.97%), Query Frame = -2
Query: 4961 MDIIGPLPETINGNKCIIVFCDYLTEYSD 5047
            MD++GP+ ++  G++ I+V  DY T Y +
Sbjct:  151 MDLVGPIVKSARGHQHILVIMDYATRYPE 179          
BLAST of SMED30019091 vs. Ensembl Xenopus
Match: nmbr (neuromedin B receptor [Source:Xenbase;Acc:XB-GENE-6074611])

HSP 1 Score: 72.4034 bits (176), Expect = 3.157e-15
Identity = 33/64 (51.56%), Postives = 45/64 (70.31%), Query Frame = -3
Query: 4756 NIIFRYGVPKKLFTDQGTNFQSELFKSINELFGIWKLNTS-YHPQTDGLVERFNGTIINMISYV 4944
            ++  R G+PK++ TDQGT F S + K +  LF + +L TS YHPQTDGLVERFN T+ +M+  V
Sbjct:  264 HVFSRVGIPKEILTDQGTPFMSRVMKELCRLFKVVQLRTSVYHPQTDGLVERFNKTLKSMLKKV 327          

HSP 2 Score: 31.5722 bits (70), Expect = 3.157e-15
Identity = 11/29 (37.93%), Postives = 20/29 (68.97%), Query Frame = -2
Query: 4961 MDIIGPLPETINGNKCIIVFCDYLTEYSD 5047
            MD++GP+ ++  G++ I+V  DY T Y +
Sbjct:  218 MDLVGPIVKSARGHQHILVIMDYATRYPE 246          
BLAST of SMED30019091 vs. Ensembl Xenopus
Match: ENSXETT00000025355.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:1:22781891:22783779:1 gene:ENSXETG00000014447.1 transcript:ENSXETT00000025355.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.1662 bits (165), Expect = 2.130e-14
Identity = 29/76 (38.16%), Postives = 48/76 (63.16%), Query Frame = -3
Query: 4741 VTKIFVENIIFRYGVPKKLFTDQGTNFQSELFKSINELFGIWKLNTS-YHPQTDGLVERFNGTIINMISYVNRRQK 4965
            V K+ VE     YG+PK++ +DQG +F+S+L   +  + G+ K  T+ YHPQ D   ERFN T+++M+  + + +K
Sbjct:  232 VAKVLVERFFIHYGLPKRIHSDQGRDFESKLVHELMSMLGVLKSRTTPYHPQGDPQPERFNRTLLDMLGTLPKEKK 307          

HSP 2 Score: 33.113 bits (74), Expect = 2.130e-14
Identity = 23/83 (27.71%), Postives = 37/83 (44.58%), Query Frame = -1
Query: 4437 PFYLMYLRKNNMPIDLQF-----QTPVSQYMEIPDYKSTMQERLQSAWAKAGLLRKHNQEKYKKAYDKRAHSHGIKIGYLVYF 4670
            P++LM+ R+  +PID  F      TPV  +     Y   ++  LQ A+ +A         + K  YDK+   H ++ G  V  
Sbjct:  333 PYFLMFGREARLPIDTVFGVTADDTPVKSHSS---YVDRLKRDLQRAYKRAQEAVGKKNMQNKTLYDKKVKIHDLQPGDRVLL 412          
BLAST of SMED30019091 vs. Ensembl Xenopus
Match: ENSXETT00000006041.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:6:37317867:37322724:1 gene:ENSXETG00000003070.1 transcript:ENSXETT00000006041.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 66.6254 bits (161), Expect = 6.475e-14
Identity = 29/76 (38.16%), Postives = 48/76 (63.16%), Query Frame = -3
Query: 4741 VTKIFVENIIFRYGVPKKLFTDQGTNFQSELFKSINELFGIWKLNTS-YHPQTDGLVERFNGTIINMISYVNRRQK 4965
            V K+ VE     YG+PK++ +DQG +F+S+L   +  + G+ K  T+ YHPQ D   ERFN T+++M+  + + +K
Sbjct: 1019 VAKVLVERFFIHYGLPKRIHSDQGRDFESKLVHELMSMLGVLKSRTTPYHPQGDPQPERFNRTLLDMLGTLPKEKK 1094          

HSP 2 Score: 32.7278 bits (73), Expect = 6.475e-14
Identity = 22/78 (28.21%), Postives = 36/78 (46.15%), Query Frame = -1
Query: 4452 PFYLMYLRKNNMPIDLQF-----QTPVSQYMEIPDYKSTMQERLQSAWAKAGLLRKHNQEKYKKAYDKRAHSHGIKIG 4670
            P++LM+ R+  +PID  F      TPV  +     Y   ++  LQ A+ +A         + K  YDK+   H ++ G
Sbjct: 1120 PYFLMFGREARLPIDTVFGVTADDTPVKSHSS---YVDRLKRDLQRAYKRAQEAVGKKNMQNKTLYDKKVKIHDLQPG 1194          
BLAST of SMED30019091 vs. Ensembl Xenopus
Match: ENSXETT00000023851.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:KV461115.1:7997:9051:-1 gene:ENSXETG00000015824.1 transcript:ENSXETT00000023851.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 74.3294 bits (181), Expect = 3.917e-13
Identity = 38/91 (41.76%), Postives = 56/91 (61.54%), Query Frame = -3
Query: 4678 NIIFRYGVPKKLFTDQGTNFQSELFKSINELFGIWKLNTS-YHPQTDGLVERFNGTIINMI-SYVNRRQKD*DEFIKPCLFAYRNAVNVST 4944
             I  R G P ++ +DQG  F S+L + + +  G+  L +S YHPQT+GL ERFNGT+ NM+ ++V   + D ++F+   LFAYR     ST
Sbjct:  207 QIFSRVGFPSEILSDQGPQFMSQLLQCLWQRCGVTSLRSSPYHPQTNGLCERFNGTLKNMLRTFVEAGEGDWEKFLPCLLFAYREVPQEST 297          
BLAST of SMED30019091 vs. UniProt/SwissProt
Match: sp|P10394|POL4_DROME (Retrovirus-related Pol polyprotein from transposon 412 OS=Drosophila melanogaster OX=7227 GN=POL PE=4 SV=1)

HSP 1 Score: 43.5134 bits (101), Expect = 1.547e-10
Identity = 27/88 (30.68%), Postives = 48/88 (54.55%), Query Frame = -3
Query: 4720 SQNIVTKIFVENIIFRYGVPKKLFTDQGTNFQSELFKSINELFGIWKL-NTSYHPQTDGLVERFNGTIINMI-SYVNRRQKD*DEFIK 4977
            S   V K   E+ I +YG  K   TD GT +++ +   + +   I  + +T++H QT G+VER + T+   I SY++  + D D +++
Sbjct: 1006 SAKTVAKAIFESFILKYGPMKTFITDMGTEYKNSIITDLCKYLKIKNITSTAHHHQTVGVVERSHRTLNEYIRSYISTDKTDWDVWLQ 1093          

HSP 2 Score: 36.5798 bits (83), Expect = 1.547e-10
Identity = 33/124 (26.61%), Postives = 56/124 (45.16%), Query Frame = -1
Query: 4347 LVYLRIEMRSM*VQMRPFYLMYLRKNNMPIDLQFQTPVSQYMEIPDYKSTMQERLQSAWAKAGLLRKHNQEKYKKAYDKRAHSHGIKIGYLVYFNRPEPLKGLSPKLHRPFK*PYKVCDTTETN 4718
             VY     +SM     P+ L++ R +N+P        +     I DY    + RL+ A+A+A  L + ++EK K+ YD +     +++G  V   R E    +  KL   +  PYK+    + N
Sbjct: 1095 FVYCFNTTQSMVHNYCPYELVFGRTSNLPKHFNKLHSIEPIYNIDDYAKESKYRLEVAYARARKLLEAHKEKNKENYDLKVKDIELEVGDKVLL-RNE----VGHKLDFKYTGPYKIESIGDNN 1213          

HSP 3 Score: 29.6462 bits (65), Expect = 1.547e-10
Identity = 14/28 (50.00%), Postives = 21/28 (75.00%), Query Frame = -2
Query: 4967 MDIIGPLPETINGNK-CIIVFCDYLTEY 5047
            +D IGPLP++ NGN+  + + CD LT+Y
Sbjct:  970 VDTIGPLPKSENGNEYAVTLICD-LTKY 996          
BLAST of SMED30019091 vs. UniProt/SwissProt
Match: sp|P31795|POL_MLVRK (Pol polyprotein (Fragment) OS=Radiation murine leukemia virus (strain Kaplan) OX=31689 GN=pol PE=3 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 3.185e-9
Identity = 32/73 (43.84%), Postives = 47/73 (64.38%), Query Frame = -3
Query: 4762 SQNIVTKIFVENIIFRYGVPKKLFTDQGTNFQSELFKSINELFGI-WKLNTSYHPQTDGLVERFNGTIINMIS 4977
            +  IVTK  +E I  R+G+P+ L TD G  F S++ +S+ +L GI WKL+ +Y PQ+ G VER N TI   ++
Sbjct:  335 TAKIVTKKLLEEIFPRFGMPQVLGTDNGPAFVSQVSQSVAKLLGIDWKLHCAYRPQSSGQVERMNRTIKETLT 407          
BLAST of SMED30019091 vs. UniProt/SwissProt
Match: sp|P11227|POL_MLVRD (Gag-Pol polyprotein OS=Radiation murine leukemia virus OX=11787 GN=pol PE=3 SV=2)

HSP 1 Score: 64.6994 bits (156), Expect = 9.683e-9
Identity = 32/68 (47.06%), Postives = 45/68 (66.18%), Query Frame = -3
Query: 4777 SQNIVTKIFVENIIFRYGVPKKLFTDQGTNFQSELFKSINELFGI-WKLNTSYHPQTDGLVERFNGTI 4977
            +  IVTK  +E I  R+G+P+ L TD G  F S++ +S+ +L GI WKL+ +Y PQ+ G VER N TI
Sbjct: 1488 TAKIVTKKLLEEIFPRFGMPQVLGTDNGPAFVSQVSQSVAKLLGIDWKLHCAYRPQSSGQVERMNRTI 1555          
BLAST of SMED30019091 vs. UniProt/SwissProt
Match: sp|Q2F7J3|POL_XMRV3 (Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP35) OX=356663 GN=gag-pol PE=1 SV=1)

HSP 1 Score: 64.3142 bits (155), Expect = 1.289e-8
Identity = 30/68 (44.12%), Postives = 46/68 (67.65%), Query Frame = -3
Query: 4777 SQNIVTKIFVENIIFRYGVPKKLFTDQGTNFQSELFKSINELFGI-WKLNTSYHPQTDGLVERFNGTI 4977
            +  +VTK  +E+I  R+G+P+ L +D G  F S++ +S+ +L GI WKL+ +Y PQ+ G VER N TI
Sbjct: 1487 TAKVVTKKLLEDIFPRFGMPQVLGSDNGPAFASQVSQSVADLLGIDWKLHCAYRPQSSGQVERMNRTI 1554          
BLAST of SMED30019091 vs. UniProt/SwissProt
Match: sp|A1Z651|POL_XMRV6 (Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP62) OX=373193 GN=gag-pol PE=1 SV=1)

HSP 1 Score: 62.7734 bits (151), Expect = 3.285e-8
Identity = 29/68 (42.65%), Postives = 46/68 (67.65%), Query Frame = -3
Query: 4777 SQNIVTKIFVENIIFRYGVPKKLFTDQGTNFQSELFKSINELFGI-WKLNTSYHPQTDGLVERFNGTI 4977
            +  +V+K  +E+I  R+G+P+ L +D G  F S++ +S+ +L GI WKL+ +Y PQ+ G VER N TI
Sbjct: 1487 TAKVVSKKLLEDIFPRFGMPQVLGSDNGPAFASQVSQSVADLLGIDWKLHCAYRPQSSGQVERMNRTI 1554          
BLAST of SMED30019091 vs. TrEMBL
Match: A0A355ABF2 (Uncharacterized protein OS=Flavobacteriaceae bacterium OX=1871037 GN=DDZ39_05755 PE=4 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 5.497e-49
Identity = 63/104 (60.58%), Postives = 76/104 (73.08%), Query Frame = -3
Query: 4660 VTKIFVENIIFRYGVPKKLFTDQGTNFQSELFKSINELFGIWKLNTS-YHPQTDGLVERFNGTIINMIS-YVNRRQKD*DEFIKPCLFAYRNAVNVSTDETFLF 4965
            + K+F+E+IIF+YG P KL TDQGTNF SE+   +NE F I K  TS YHPQ+DGLVERFN T+  M+S Y N RQ D DE+I PCLFAYRN V+ ST +T  F
Sbjct: 1954 IAKVFIEDIIFKYGAPSKLITDQGTNFLSEVMSEVNEFFKIDKHTTSAYHPQSDGLVERFNRTLEQMLSAYTNERQTDWDEYIAPCLFAYRNTVHESTKQTPFF 2057          

HSP 2 Score: 76.2554 bits (186), Expect = 5.497e-49
Identity = 40/108 (37.04%), Postives = 60/108 (55.56%), Query Frame = -1
Query: 4347 PFYLMYLRKNNMPIDLQFQTPVSQYMEIPDYKSTMQERLQSAWAKAGLLRKHNQEKYKKAYDKRAHSHGIKIGYLVYFNRPEPLKGLSPKLHRPFK*PYKVCDTTETN 4670
            PF+LM+LR+  +PIDL      + YM+  +Y   M+E+L+  W  A L     QE YK+ YD+   +    +G  V  + P   KGL+ KL++P+  PYKV + T  N
Sbjct: 2055 PFFLMFLREPKLPIDLTLVETKTCYMDEYNYVQDMKEKLKDVWTTAKLNMNFYQESYKEYYDRHISTPSFMVGDFVLLHTPLHEKGLTNKLYKPYDGPYKVIEVTPQN 2162          

HSP 3 Score: 44.669 bits (104), Expect = 5.497e-49
Identity = 18/29 (62.07%), Postives = 23/29 (79.31%), Query Frame = -2
Query: 4961 MDIIGPLPETINGNKCIIVFCDYLTEYSD 5047
            MDI+GPLPET  GNK I+VF DY T++ +
Sbjct: 1914 MDIMGPLPETTKGNKYILVFSDYFTKWPE 1942          
BLAST of SMED30019091 vs. TrEMBL
Match: A0A293LM44 (Integrase catalytic domain-containing protein (Fragment) OS=Ornithodoros erraticus OX=265619 PE=4 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 9.121e-32
Identity = 51/104 (49.04%), Postives = 74/104 (71.15%), Query Frame = -3
Query: 4660 VTKIFVENIIFRYGVPKKLFTDQGTNFQSELFKSINELFGIWKLNTS-YHPQTDGLVERFNGTIINMIS-YVNRRQKD*DEFIKPCLFAYRNAVNVSTDETFLF 4965
            V K FVE ++ R+GVP++L TDQGTNF S+L K + +L  I K+ T+ YHPQ++G VERFN T+ N++S YV   Q+D DE++   +FAY  AV+ S+DE+  +
Sbjct:  336 VAKHFVEGVVLRHGVPRQLLTDQGTNFLSKLMKDVCKLLNINKIQTTPYHPQSNGAVERFNQTLTNLLSHYVAHDQRDWDEWVPFAMFAYNTAVHDSSDESPFY 439          

HSP 2 Score: 44.2838 bits (103), Expect = 9.121e-32
Identity = 31/105 (29.52%), Postives = 49/105 (46.67%), Query Frame = -1
Query: 4356 PFYLMYLRKNNMPIDLQFQTPVSQYMEIPDYKSTMQERLQSAWAKAGLLRKHNQEKYKKAYDKRAHSHGIKIGYLVYFNRPEPLKGLSPKLHRPFK*PYKVCDTT 4670
            PFYL+Y R  ++P  +  +     Y  + DY+  +  R++ +   A    +   EK K  YDKR+     ++G  VY       KGL  KL   +  PY+V + T
Sbjct:  437 PFYLLYGRDPDLPSAVLEEPRRVVYSCMEDYREELTARMRISHDIASAALRAAAEKRKGHYDKRSRDASYRVGDRVYLEVKHTDKGLVKKLSPKWTGPYRVVEKT 541          

HSP 3 Score: 41.2022 bits (95), Expect = 9.121e-32
Identity = 16/29 (55.17%), Postives = 23/29 (79.31%), Query Frame = -2
Query: 4961 MDIIGPLPETINGNKCIIVFCDYLTEYSD 5047
            MDIIGPLP T  GN+ ++VF D+LT +++
Sbjct:  296 MDIIGPLPVTTAGNRYMLVFVDHLTRFAE 324          
BLAST of SMED30019091 vs. TrEMBL
Match: A0A147BAZ1 (Putative retrovirus-related pol polyprotein from transposon (Fragment) OS=Ixodes ricinus OX=34613 PE=4 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 2.668e-31
Identity = 50/101 (49.50%), Postives = 69/101 (68.32%), Query Frame = -3
Query: 4669 VTKIFVENIIFRYGVPKKLFTDQGTNFQSELFKSINELFGIWKLNTS-YHPQTDGLVERFNGTIINMISY-VNRRQKD*DEFIKPCLFAYRNAVNVSTDET 4965
            V + FVE I+ R+GVP++L TDQGTNF S L K    L G+ KL T+ YHP+++G VER N TI  ++S+ V R Q+D D ++   LF+Y  AV+ ST+ET
Sbjct:  854 VARAFVERIVLRHGVPQQLLTDQGTNFVSGLMKETCRLLGVKKLTTTAYHPESNGAVERLNKTIKGLLSHLVARDQRDWDLWMPYVLFSYNTAVHESTEET 954          

HSP 2 Score: 51.2174 bits (121), Expect = 2.668e-31
Identity = 31/101 (30.69%), Postives = 53/101 (52.48%), Query Frame = -1
Query: 4368 PFYLMYLRKNNMPIDLQFQTPVSQYMEIPDYKSTMQERLQSAWAKAGLLRKHNQEKYKKAYDKRAHSHGIKIGYLVYFNRPEPLKGLSPKLHRPFK*PYKV 4670
            PFYL + R   +P ++     V +Y  + DY++ +  R+++A    G   + +Q   K  YD++  S   + G  VY +   P KGLS KL + +K PY++
Sbjct:  955 PFYLCHGRDPGLPHEILDAPSVPKYACLEDYRAELTLRMRAAHEVTGEALRKSQACRKTQYDRKTKSPEFREGDRVYVDVRYPGKGLSQKLGQKWKGPYRI 1055          

HSP 3 Score: 40.0466 bits (92), Expect = 2.668e-31
Identity = 14/29 (48.28%), Postives = 23/29 (79.31%), Query Frame = -2
Query: 4961 MDIIGPLPETINGNKCIIVFCDYLTEYSD 5047
            +DI+GPLP T  GNK ++VF D+ T++++
Sbjct:  814 LDIVGPLPITTEGNKYVLVFVDHFTKFAE 842          
BLAST of SMED30019091 vs. TrEMBL
Match: W4YDL6 (Integrase catalytic domain-containing protein OS=Strongylocentrotus purpuratus OX=7668 PE=4 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 5.375e-31
Identity = 49/103 (47.57%), Postives = 72/103 (69.90%), Query Frame = -3
Query: 4669 VTKIFVENIIFRYGVPKKLFTDQGTNFQSELFKSINELFGIWKLNTS-YHPQTDGLVERFNGTIINMISYV---NRRQKD*DEFIKPCLFAYRNAVNVSTDET 4965
            V   FV   ++R+GVP+ L +DQG NF+S +FK +  + GI K  T+ Y+P++DGL+ERFNGT++NMIS +   ++RQ+D DE +   +FAYR+A   ST ET
Sbjct: 1030 VADKFVNEFVYRFGVPEVLHSDQGRNFESRVFKEMCGILGIHKTRTTPYNPKSDGLIERFNGTLLNMISMMIEPHKRQRDWDEKLAIAVFAYRSAPQDSTRET 1132          

HSP 2 Score: 48.521 bits (114), Expect = 5.375e-31
Identity = 32/102 (31.37%), Postives = 52/102 (50.98%), Query Frame = -1
Query: 4374 PFYLMYLRKNNMPIDLQ---FQTPVSQYMEIPDYKSTMQERLQSAWAKAGLLRKHNQEKYKKAYDKRAHSHGIKIGYLVYFNRPEPLKGLSPKLHRPFK*PY 4670
            P  LM  R+ ++PIDL     + P    +E  D+  T+++R++ A  +A      +  + KK YD +A    + +G  V+       KGLSPKL R ++ PY
Sbjct: 1133 PNMLMLGREVHLPIDLTTEALEDPEEHDIET-DHAYTLRQRMREAHERARKNCTESARRQKKDYDSKAGGSPLAVGDFVWLYNKAKTKGLSPKLQRRWEGPY 1233          

HSP 3 Score: 39.2762 bits (90), Expect = 5.375e-31
Identity = 15/29 (51.72%), Postives = 22/29 (75.86%), Query Frame = -2
Query: 4961 MDIIGPLPETINGNKCIIVFCDYLTEYSD 5047
            MD++GPLPET  GNK I+V  DY +++ +
Sbjct:  990 MDVVGPLPETERGNKYILVVGDYFSKWME 1018          
BLAST of SMED30019091 vs. TrEMBL
Match: W4YDL5 (Integrase catalytic domain-containing protein OS=Strongylocentrotus purpuratus OX=7668 PE=4 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 7.614e-31
Identity = 52/113 (46.02%), Postives = 75/113 (66.37%), Query Frame = -3
Query: 4669 FVIISQNIVT--KIFVENIIFRYGVPKKLFTDQGTNFQSELFKSINELFGIWKLNTS-YHPQTDGLVERFNGTIINMISYV---NRRQKD*DEFIKPCLFAYRNAVNVSTDET 4989
            + I  Q  VT    FV   + R+GVP+ L +DQG NF+S +FK +  + GI K  T+ Y+P++DGL+ERFNGT++NMIS +   ++RQ+D DE +   +FAYR+A   ST ET
Sbjct:  256 YPIPDQTAVTVADKFVNEFVCRFGVPEVLHSDQGRNFESRVFKEMCGILGIHKTRTTPYNPKSDGLIERFNGTLLNMISMMIEPHKRQRDWDEKLAIAVFAYRSAPQDSTRET 368          

HSP 2 Score: 50.0618 bits (118), Expect = 7.614e-31
Identity = 33/102 (32.35%), Postives = 52/102 (50.98%), Query Frame = -1
Query: 4374 PFYLMYLRKNNMPIDLQ---FQTPVSQYMEIPDYKSTMQERLQSAWAKAGLLRKHNQEKYKKAYDKRAHSHGIKIGYLVYFNRPEPLKGLSPKLHRPFK*PY 4670
            P  LM  R+ ++PIDL     + P    +E  DY  T+++R++ A  +A      +  + KK YD +A    + +G  V+       KGLSPKL R ++ PY
Sbjct:  369 PNMLMLGREVHLPIDLTTEALEDPEEHDIET-DYAYTLRQRMREAHERARKNCTESARRQKKDYDSKAGGSPLAVGDFVWLYNKAKTKGLSPKLQRRWEGPY 469          

HSP 3 Score: 40.4318 bits (93), Expect = 7.614e-31
Identity = 15/27 (55.56%), Postives = 21/27 (77.78%), Query Frame = -2
Query: 4967 MDIIGPLPETINGNKCIIVFCDYLTEY 5047
            MD++GPLPET  GNK I+V  DY +++
Sbjct:  226 MDVVGPLPETERGNKYILVVGDYFSKW 252          
BLAST of SMED30019091 vs. Ensembl Cavefish
Match: ENSAMXT00000058127.1 (pep primary_assembly:Astyanax_mexicanus-2.0:16:35454045:35455481:1 gene:ENSAMXG00000038477.1 transcript:ENSAMXT00000058127.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 89.7373 bits (221), Expect = 1.171e-26
Identity = 44/98 (44.90%), Postives = 64/98 (65.31%), Query Frame = -3
Query: 4678 VTKIFVENIIFRYGVPKKLFTDQGTNFQSELFKSINELFGIWKLNTS-YHPQTDGLVERFNGTIINMIS-YVNRRQKD*DEFIKPCLFAYRNAVNVST 4965
            V K+  E  I RYG P+ + TDQG NF+S LF  +  L  + K  TS Y PQ+DGL+ERFN T+++M+S +V+  Q+D D  +   + AYR++V+ ST
Sbjct:  118 VAKVLTEEWICRYGAPRSIHTDQGRNFESHLFSELCRLLNMHKSRTSPYRPQSDGLIERFNRTLLSMLSLFVDANQQDWDALLPFVMMAYRSSVHAST 215          

HSP 2 Score: 36.1946 bits (82), Expect = 1.171e-26
Identity = 13/29 (44.83%), Postives = 22/29 (75.86%), Query Frame = -2
Query: 4961 MDIIGPLPETINGNKCIIVFCDYLTEYSD 5047
            +DI+GPLPET   N+ I+V  DY +++++
Sbjct:   78 LDILGPLPETPQKNRYILVVGDYFSKWTE 106          

HSP 3 Score: 36.1946 bits (82), Expect = 1.171e-26
Identity = 24/106 (22.64%), Postives = 51/106 (48.11%), Query Frame = -1
Query: 4362 PFYLMYLRKNNMPIDLQFQTPVSQYMEIPDYKSTMQERLQSAWAKAGLLRKHN---QEKYKKAYDKRAHSHGIKIGYLVYFNRPEPLKGLSPKLHRPFK*PYKVCD 4670
            P+ +++  +  +P+D+   T V +  +  +   +  E + S   +A  ++KH     E  K+ +D + +      G LV+       +G+ PKL R ++ PY+V +
Sbjct:  219 PYRVLFGHEIVLPVDVLLNTGVQEKFQTTNEYVSRMEGILSTVCEA--VKKHQIRASEGQKQNFDVKVNFQYYSEGELVWVKNEARKRGVCPKLQRRYRGPYRVLE 322          
BLAST of SMED30019091 vs. Ensembl Cavefish
Match: ENSAMXT00000031920.1 (pep primary_assembly:Astyanax_mexicanus-2.0:12:11094903:11101818:1 gene:ENSAMXG00000039354.1 transcript:ENSAMXT00000031920.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 89.7373 bits (221), Expect = 1.201e-26
Identity = 44/98 (44.90%), Postives = 64/98 (65.31%), Query Frame = -3
Query: 4678 VTKIFVENIIFRYGVPKKLFTDQGTNFQSELFKSINELFGIWKLNTS-YHPQTDGLVERFNGTIINMIS-YVNRRQKD*DEFIKPCLFAYRNAVNVST 4965
            V K+  E  I RYG P+ + TDQG NF+S LF  +  L  + K  TS Y PQ+DGL+ERFN T+++M+S +V+  Q+D D  +   + AYR++V+ ST
Sbjct:   82 VAKVLTEEWICRYGAPRSIHTDQGRNFESHLFSELCRLLNMHKSRTSPYRPQSDGLIERFNRTLLSMLSLFVDANQQDWDALLPFVMMAYRSSVHAST 179          

HSP 2 Score: 36.1946 bits (82), Expect = 1.201e-26
Identity = 23/104 (22.12%), Postives = 48/104 (46.15%), Query Frame = -1
Query: 4362 PFYLMYLRKNNMPIDLQFQTPVSQ-YMEIPDYKSTMQERLQSAWAKAGLLRKHNQEKYKKAYDKRAHSHGIKIGYLVYFNRPEPLKGLSPKLHRPFK*PYKVCD 4670
            P+ +++  +  +P+D+   T V + +    +Y S M+  L +        +    E  K+ +D + +      G LV+       +G+ PKL R ++ PY+V +
Sbjct:  183 PYRVLFGHEIVLPVDVLLNTGVQEKFQTTNEYVSRMEGILSTVCEAVKKHQIRASEGQKQNFDVKVNFQYYSEGELVWVKNEARKRGVCPKLQRRYRGPYRVLE 286          

HSP 3 Score: 35.8094 bits (81), Expect = 1.201e-26
Identity = 13/29 (44.83%), Postives = 22/29 (75.86%), Query Frame = -2
Query: 4961 MDIIGPLPETINGNKCIIVFCDYLTEYSD 5047
            +DI+GPLPET   N+ I+V  DY +++++
Sbjct:   42 LDILGPLPETPQKNRYILVVGDYFSKWTE 70          
BLAST of SMED30019091 vs. Ensembl Cavefish
Match: ENSAMXT00000037741.1 (pep primary_assembly:Astyanax_mexicanus-2.0:6:27788674:27792885:-1 gene:ENSAMXG00000029895.1 transcript:ENSAMXT00000037741.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 91.2781 bits (225), Expect = 6.853e-23
Identity = 46/100 (46.00%), Postives = 63/100 (63.00%), Query Frame = -3
Query: 4678 NIVTKIFVENIIFRYGVPKKLFTDQGTNFQSELFKSINELFGIWKLNTS-YHPQTDGLVERFNGTIINMIS-YVNRRQKD*DEFIKPCLFAYRNAVNVST 4971
            + V +  VE  I R+G P+ + TDQG NF S LF++I EL  I K  T+ YHP +DGLVER N TI  M+S +V+  Q + DE +   + AYR++V  ST
Sbjct:  200 DTVARTVVEQFILRWGTPRSIHTDQGKNFDSALFRAICELLDIHKTRTTPYHPSSDGLVERLNRTITTMLSMFVDANQGNWDELLPYVMMAYRSSVQTST 299          

HSP 2 Score: 38.1206 bits (87), Expect = 6.853e-23
Identity = 16/27 (59.26%), Postives = 20/27 (74.07%), Query Frame = -2
Query: 4967 MDIIGPLPETINGNKCIIVFCDYLTEY 5047
            +DI+GPLP T  GNK IIV  DY T++
Sbjct:  162 IDIVGPLPVTSQGNKYIIVIADYFTKW 188          
BLAST of SMED30019091 vs. Ensembl Cavefish
Match: ENSAMXT00000033239.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02002121.1:47256:48953:1 gene:ENSAMXG00000036506.1 transcript:ENSAMXT00000033239.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 81.6481 bits (200), Expect = 1.655e-22
Identity = 42/108 (38.89%), Postives = 65/108 (60.19%), Query Frame = -3
Query: 4678 FVIISQNIVT--KIFVENIIFRYGVPKKLFTDQGTNFQSELFKSINELFGIWKLNTS-YHPQTDGLVERFNGTIINMISYVNRR-QKD*DEFIKPCLFAYRNAVNVST 4989
            + +  Q  VT   + V     R+GVP++L +DQG NF+SE+   +  + GI K  T+  HPQ+DGLVERFN T+   ++ V+ + Q+D D+ +   L A R+AV  +T
Sbjct:  266 YAVPDQGAVTTADVLVREFFCRFGVPEELHSDQGRNFESEVMAEVCRILGIHKTRTTPLHPQSDGLVERFNRTLAAQLAMVSSKGQRDWDKHLPVVLLACRSAVQETT 373          

HSP 2 Score: 46.2098 bits (108), Expect = 1.655e-22
Identity = 31/104 (29.81%), Postives = 46/104 (44.23%), Query Frame = -1
Query: 4368 PFYLMYLRKNNMPIDLQFQTPVSQYMEIPDYKSTMQERLQSAWAKAGLLRKHNQ---EKYKKAYDKRAHSHGIKIGYLVYFNRPEPLKGLSPKLHRPFK*PYKV 4670
            P  LM+ R+   P+ L F  P        D  + + + L S     GL R +     +K K+AYD R     ++ G  V+   P+  KGL PKL   +  P +V
Sbjct:  377 PALLMFGRELRTPVTLAFGAPPDGGEVAKDTPTFVSDLLSSLDLAHGLARSNQSAAGQKQKRAYDTRCFGDPLEAGARVWLYNPQRKKGLCPKLQSAWVGPCRV 480          
BLAST of SMED30019091 vs. Ensembl Cavefish
Match: ENSAMXT00000033562.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000701.1:49379:53741:-1 gene:ENSAMXG00000037931.1 transcript:ENSAMXT00000033562.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 81.2629 bits (199), Expect = 1.939e-22
Identity = 42/108 (38.89%), Postives = 65/108 (60.19%), Query Frame = -3
Query: 4678 FVIISQNIVT--KIFVENIIFRYGVPKKLFTDQGTNFQSELFKSINELFGIWKLNTS-YHPQTDGLVERFNGTIINMISYV-NRRQKD*DEFIKPCLFAYRNAVNVST 4989
            + +  Q  VT   + V     R+GVP++L +DQG NF+SE+   +  + GI K  T+  HPQ+DGLVERFN T+   ++ V ++ Q+D D+ +   L A R+AV  +T
Sbjct:  202 YAVPDQGAVTTADVLVREFFCRFGVPEELHSDQGRNFESEVMAEVCRILGIHKTRTTPLHPQSDGLVERFNRTLAAQLAMVASKGQRDWDKHLPVVLLACRSAVQETT 309          

HSP 2 Score: 46.2098 bits (108), Expect = 1.939e-22
Identity = 34/105 (32.38%), Postives = 46/105 (43.81%), Query Frame = -1
Query: 4368 PFYLMYLRKNNMPIDLQFQTPVSQYMEIPDYKSTMQERLQSAWAKAGLLRKHNQ----EKYKKAYDKRAHSHGIKIGYLVYFNRPEPLKGLSPKLHRPFK*PYKV 4670
            P  LM+ R+   P+ L F  P        D   T   RL S+   A  L + NQ    +K K+AYD R     + +G  V+   P+  KGL PKL   +  P  V
Sbjct:  313 PAMLMFGRELRTPVALAFGAPPDGGEHATD-APTFVSRLMSSLDLAHGLARSNQSAAGQKQKRAYDTRCFGEPLSVGARVWLYNPQRKKGLCPKLQSAWVGPCVV 416          
BLAST of SMED30019091 vs. Ensembl Medaka
Match: ENSORLT00000045127.1 (pep primary_assembly:ASM223467v1:10:587855:593081:1 gene:ENSORLG00000029202.1 transcript:ENSORLT00000045127.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 87.4261 bits (215), Expect = 8.029e-28
Identity = 41/99 (41.41%), Postives = 65/99 (65.66%), Query Frame = -3
Query: 4675 VTKIFVENIIFRYGVPKKLFTDQGTNFQSELFKSINELFGIWKLNTS-YHPQTDGLVERFNGTIINMIS-YVNRRQKD*DEFIKPCLFAYRNAVNVSTD 4965
            + K+  E  + R+G P+ + +DQG NF+S LFK +  L  I K  TS YHPQ+DGLVERFN T++++++ +V   Q + D+ +   + AYR++V+ ST 
Sbjct:   83 IAKVLTEEWVCRFGAPRSIHSDQGRNFESTLFKELCSLLSIHKSRTSPYHPQSDGLVERFNRTLLSLLALFVEDNQLNWDKLLPYVMLAYRSSVHASTS 181          

HSP 2 Score: 40.0466 bits (92), Expect = 8.029e-28
Identity = 27/102 (26.47%), Postives = 47/102 (46.08%), Query Frame = -1
Query: 4368 PFYLMYLRKNNMPIDLQFQTPVSQYMEIPD-YKSTMQERLQSAWAKAGLLRKHNQEKYKKAYDKRAHSHGIKIGYLVYFNRPEPLKGLSPKLHRPFK*PYKV 4670
            P+ +++ R+  +P+D+       +     D Y S +QE L S        +     + K +YD RA+      G LV+ +     +G+  KL R FK P++V
Sbjct:  184 PYRVLFGREIVLPVDIMLNIDKHETFSSADEYVSRLQETLSSVVDAVKRHQTRASGRQKDSYDFRANFQYYSEGELVWVHNKARKRGVCAKLQRRFKGPFRV 285          

HSP 3 Score: 38.5058 bits (88), Expect = 8.029e-28
Identity = 14/29 (48.28%), Postives = 23/29 (79.31%), Query Frame = -2
Query: 4961 MDIIGPLPETINGNKCIIVFCDYLTEYSD 5047
            ++I+GPLPET N NK I+V  DY +++++
Sbjct:   43 LEILGPLPETPNKNKYILVISDYFSKWTE 71          
BLAST of SMED30019091 vs. Ensembl Medaka
Match: ENSORLT00000029278.1 (pep primary_assembly:ASM223467v1:19:15721323:15727883:-1 gene:ENSORLG00000027831.1 transcript:ENSORLT00000029278.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 81.2629 bits (199), Expect = 3.748e-25
Identity = 41/87 (47.13%), Postives = 56/87 (64.37%), Query Frame = -3
Query: 4678 RYGVPKKLFTDQGTNFQSELFKSINELFGIWKLNTS-YHPQTDGLVERFNGTIINMI-SYVNRRQKD*DEFIKPCLFAYRNAVNVST 4932
            R G+PK++ TD GTNF S+L K +  L G+  + T+ YHPQTDGLVERFN T+  M+  +V+    D D+++   LFAYR     ST
Sbjct:  775 RVGIPKEILTDCGTNFLSKLLKQVYSLLGVKGIKTTPYHPQTDGLVERFNQTLKTMLRKFVSETGTDWDQWLPYLLFAYREVPQAST 861          

HSP 2 Score: 39.2762 bits (90), Expect = 3.748e-25
Identity = 15/29 (51.72%), Postives = 22/29 (75.86%), Query Frame = -2
Query: 4961 MDIIGPLPETINGNKCIIVFCDYLTEYSD 5047
            MDI+GPL ++ +G+K I+V CDY T Y +
Sbjct:  725 MDIVGPLEKSSSGHKYILVICDYATRYPE 753          

HSP 3 Score: 36.1946 bits (82), Expect = 3.748e-25
Identity = 27/98 (27.55%), Postives = 43/98 (43.88%), Query Frame = -1
Query: 4386 PFYLMYLRKNNMPIDLQ---FQTPVSQYMEIPDYKSTMQERLQSAWAKAGLLRKHNQEKYKKAYDKRAHSHGIKIGYLVYFNRPEPLKGLSPKLHRPF 4670
            PF L+Y R+   P+DL    ++ PV+    +  Y   M+ERL+     A    +  Q + K  YDK+A     ++G  V    P     L  +   P+
Sbjct:  865 PFELLYGRQVRGPLDLLKDYWEKPVTDKDNVVSYVLKMRERLERMSTLAQEHMRSAQAQQKTWYDKKAKDRIFQVGQQVLLLLPTSDNKLLARWQGPY 962          
BLAST of SMED30019091 vs. Ensembl Medaka
Match: ENSORLT00000029443.1 (pep primary_assembly:ASM223467v1:7:33775978:33780156:-1 gene:ENSORLG00000022369.1 transcript:ENSORLT00000029443.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 80.4925 bits (197), Expect = 1.147e-21
Identity = 42/87 (48.28%), Postives = 54/87 (62.07%), Query Frame = -3
Query: 4678 RYGVPKKLFTDQGTNFQSELFKSINELFGIWKL-NTSYHPQTDGLVERFNGTIINMI-SYVNRRQKD*DEFIKPCLFAYRNAVNVST 4932
            R G+P ++ TD+GTNF S L   + +L GI  L  T+YHPQTDGL ERFN TI  M+  +VN    D D+++   LFAYR     ST
Sbjct:  748 RVGLPLEILTDRGTNFLSTLLSQVYQLLGIKSLRTTAYHPQTDGLTERFNQTIKQMLRKFVNESGTDWDKWLPYLLFAYREVPQAST 834          

HSP 2 Score: 35.039 bits (79), Expect = 1.147e-21
Identity = 13/29 (44.83%), Postives = 21/29 (72.41%), Query Frame = -2
Query: 4961 MDIIGPLPETINGNKCIIVFCDYLTEYSD 5047
            MDI+GPL  + +GN+ ++V  DY T+Y +
Sbjct:  698 MDIVGPLERSKSGNRYMLVITDYATKYPE 726          

HSP 3 Score: 29.261 bits (64), Expect = 1.147e-21
Identity = 27/110 (24.55%), Postives = 43/110 (39.09%), Query Frame = -1
Query: 4356 PFYLMYLRKNNMPIDL-----QFQTPVSQYMEIPDYKSTMQERLQSAWAKAGLLRKHNQEKYKKAYDKRAHSHGIKIGYLVYFNRPEPLKGLSPKLHRPFK*PYKVCDTT 4670
            PF L+Y  +   P+ L     +   P S+ + +  +   M+ERL+     A       Q++ K  YD+ A       G  V    P     L  K   PF+   ++  TT
Sbjct:  838 PFELLYGHEVRGPLSLLKDMWEGDRPHSETVNVVSFVVQMRERLEKMSELAQAHMAEAQKQQKVWYDRSARQRSFSPGQKVLVLLPSSDSKLLAKWQGPFEVLQRIGQTT 947          
BLAST of SMED30019091 vs. Ensembl Medaka
Match: ENSORLT00000035135.1 (uncharacterized LOC111946338 [Source:NCBI gene;Acc:111946338])

HSP 1 Score: 80.4925 bits (197), Expect = 1.272e-21
Identity = 42/87 (48.28%), Postives = 54/87 (62.07%), Query Frame = -3
Query: 4678 RYGVPKKLFTDQGTNFQSELFKSINELFGIWKL-NTSYHPQTDGLVERFNGTIINMI-SYVNRRQKD*DEFIKPCLFAYRNAVNVST 4932
            R G+P ++ TD+GTNF S L   + +L GI  L  T+YHPQTDGL ERFN TI  M+  +VN    D D+++   LFAYR     ST
Sbjct:  748 RVGLPLEILTDRGTNFLSTLLSQVYQLLGIKSLRTTAYHPQTDGLTERFNQTIKQMLRKFVNESGTDWDKWLPYLLFAYREVPQAST 834          

HSP 2 Score: 35.039 bits (79), Expect = 1.272e-21
Identity = 13/29 (44.83%), Postives = 21/29 (72.41%), Query Frame = -2
Query: 4961 MDIIGPLPETINGNKCIIVFCDYLTEYSD 5047
            MDI+GPL  + +GN+ ++V  DY T+Y +
Sbjct:  698 MDIVGPLERSKSGNRYMLVITDYATKYPE 726          

HSP 3 Score: 29.261 bits (64), Expect = 1.272e-21
Identity = 30/114 (26.32%), Postives = 52/114 (45.61%), Query Frame = -1
Query: 4356 PFYLMYLRKNNMPIDL-----QFQTPVSQYMEIPDYKSTMQERLQ--SAWAKAGLLRKHNQEK--YKKAYDKRAHSHGIKIGYLVYFNRPEPLKGLSPKLHRPFK*PYKVCDTT 4670
            PF L+Y  +   P+ L     +   P S+ + +  +   M+ERL+  S  A+A +     Q+K  Y ++  +R+ S G K+  L+    P     L  K   PF+   ++  TT
Sbjct:  838 PFELLYGHEVRGPLSLLKDMWEGDRPHSETVNVVSFVVQMRERLEKMSELAQAHMAEAQKQQKVWYDRSARQRSFSPGQKVLVLL----PSSDSKLLTKWQGPFEVLQRIGQTT 947          
BLAST of SMED30019091 vs. Ensembl Medaka
Match: ENSORLT00000043981.1 (uncharacterized LOC111947659 [Source:NCBI gene;Acc:111947659])

HSP 1 Score: 80.4925 bits (197), Expect = 1.391e-21
Identity = 42/87 (48.28%), Postives = 54/87 (62.07%), Query Frame = -3
Query: 4678 RYGVPKKLFTDQGTNFQSELFKSINELFGIWKL-NTSYHPQTDGLVERFNGTIINMI-SYVNRRQKD*DEFIKPCLFAYRNAVNVST 4932
            R G+P ++ TD+GTNF S L   + +L GI  L  T+YHPQTDGL ERFN TI  M+  +VN    D D+++   LFAYR     ST
Sbjct:  748 RVGLPLEILTDRGTNFLSTLLSQVYQLLGIKSLRTTAYHPQTDGLTERFNQTIKQMLRKFVNESGTDWDKWLPYLLFAYREVPQAST 834          

HSP 2 Score: 35.039 bits (79), Expect = 1.391e-21
Identity = 13/29 (44.83%), Postives = 21/29 (72.41%), Query Frame = -2
Query: 4961 MDIIGPLPETINGNKCIIVFCDYLTEYSD 5047
            MDI+GPL  + +GN+ ++V  DY T+Y +
Sbjct:  698 MDIVGPLERSKSGNRYMLVITDYATKYPE 726          

HSP 3 Score: 29.261 bits (64), Expect = 1.391e-21
Identity = 27/110 (24.55%), Postives = 43/110 (39.09%), Query Frame = -1
Query: 4356 PFYLMYLRKNNMPIDL-----QFQTPVSQYMEIPDYKSTMQERLQSAWAKAGLLRKHNQEKYKKAYDKRAHSHGIKIGYLVYFNRPEPLKGLSPKLHRPFK*PYKVCDTT 4670
            PF L+Y  +   P+ L     +   P S+ + +  +   M+ERL+     A       Q++ K  YD+ A       G  V    P     L  K   PF+   ++  TT
Sbjct:  838 PFELLYGHEVRGPLSLLKDMWEGDRPHSETVNVVSFVVQMRERLEKMSELAQAHMAEAQKQQKVWYDRSARQRSFSPGQKVLVLLPSSDSKLLTKWQGPFEVLQRIGQTT 947          
BLAST of SMED30019091 vs. Planmine SMEST
Match: SMESG000073500.1 (SMESG000073500.1)

HSP 1 Score: 220.32 bits (560), Expect = 6.972e-102
Identity = 131/321 (40.81%), Postives = 189/321 (58.88%), Query Frame = -1
Query: 3765 LMYLRKNNMPIDLQFQTPVSQYMEIPDYKSTMQERLQSAWAKAGLLRKHNQEKYKKAYDKRAHSHGIKIGYLVYFNRPEPLKGLSPKLHRPFK*PYKVCDTTETN----------------YSGIR*SMQTSSR***ITVPVTAKAKGS*R*NNCQTKIHKKPTPVSYINKXXXXXXXXXLISCANGQIIDLPYAVNKIPLMENRDIYSTITNIVWVSHGEITDQIEINNLLDPFSSFVELNYEKNVYVAPKLRLNFKYPWLIRQ------NRSEGQSHIYIEVRTKEFRDPIEIEQVLNRRNIYWKKVKFVRVRILFYIY 4661
            L YLR+NN+PIDL++Q  V+QYME+ DYKS MQERLQS W +AGL  K+NQE YK  YDKRAH H IK+G LVY N+PEP KGLS KL +PFK PY VCDTTETN                ++     +Q+      +   + +K        N   +I K PT ++Y+NK LF+   +  + C+N   +   YA  +I   EN   YST+T IVW+   + +++ EI+NL+  F     L Y +N+ +A  L +NFKYP LI+Q      +  +  S I +  RT++ ++ +E+E V+N  NI+W+  +  +V+++F  Y
Sbjct: 1083 LFYLRRNNIPIDLKYQPSVTQYMEVSDYKSVMQERLQSVWKQAGLKIKYNQESYKDQYDKRAHEHLIKLGDLVYLNKPEPTKGLSTKLQKPFKGPYTVCDTTETNLKLRPIRNKKAETIVLHANRCKKIQSDGE---VEYSLRSKPDKINDGPNIIQQITKNPTRLNYMNKVLFVALKISNLFCSNEAEVMPRYAKTEIEGFENIHTYSTLTQIVWLDLCKESEESEIDNLVSYFEPPKTLGYHQNILIARYLTMNFKYPSLIKQYEPRKNSVRKLHSLIRLNARTQKLKNHVEVEPVINGINIFWQPYETQQVKVIFQSY 1400          

HSP 2 Score: 147.517 bits (371), Expect = 6.972e-102
Identity = 76/104 (73.08%), Postives = 84/104 (80.77%), Query Frame = -3
Query: 4660 VTKIFVENIIFRYGVPKKLFTDQGTNFQSELFKSINELFGIWKLNTS-YHPQTDGLVERFNGTIINMI-SYVNRRQKD*DEFIKPCLFAYRNAVNVSTDETFLF 4965
            V +IF ENIIFRYG PKKL TDQ TNF+S+LFKSI ELF I KL+ S YHPQT GLVERFNG +I+MI SYVNR QKD D FIKPCLFAYRN+VN ST ET  +
Sbjct:  982 VARIFGENIIFRYGSPKKLLTDQRTNFESDLFKSITELFRILKLSKSPYHPQTGGLVERFNGNLISMISSYVNRNQKDWDLFIKPCLFAYRNSVNESTGETLFY 1085          

HSP 3 Score: 46.595 bits (109), Expect = 6.972e-102
Identity = 19/29 (65.52%), Postives = 24/29 (82.76%), Query Frame = -2
Query: 4961 MDIIGPLPETINGNKCIIVFCDYLTEYSD 5047
            MDI+GPLPE IN NK I+V CDYLT++ +
Sbjct:  942 MDIVGPLPEKINWNKYIVVSCDYLTKWPE 970          
BLAST of SMED30019091 vs. Planmine SMEST
Match: SMESG000080287.1 (SMESG000080287.1)

HSP 1 Score: 172.94 bits (437), Expect = 1.676e-77
Identity = 77/109 (70.64%), Postives = 89/109 (81.65%), Query Frame = -1
Query: 4347 RPFYLMYLRKNNMPIDLQFQTPVSQYMEIPDYKSTMQERLQSAWAKAGLLRKHNQEKYKKAYDKRAHSHGIKIGYLVYFNRPEPLKGLSPKLHRPFK*PYKVCDTTETN 4673
            + FYLMYLR+NNMPI+L++Q PV+QYME+PDYK+ MQERLQS W +AGL  K+NQE YK  YDKR H HGIK+G LVY N+PEP KGLS KL RPF  PY VCDTTETN
Sbjct:  929 KSFYLMYLRRNNMPINLEYQPPVTQYMEVPDYKAVMQERLQSVWKQAGLKIKYNQESYKDQYDKREHEHGIKVGDLVYLNKPEPTKGLSTKLQRPFNGPYTVCDTTETN 1037          

HSP 2 Score: 130.568 bits (327), Expect = 1.676e-77
Identity = 66/90 (73.33%), Postives = 76/90 (84.44%), Query Frame = -3
Query: 4672 FRYGVPKKLFTDQGTNFQSELFKSINELFGIWKLNTS-YHPQTDGLVERFNGTIINMI-SYVNRRQKD*DEFIKPCLFAYRNAVNVSTDE 4935
            ++YG PKKL TDQGTNFQS+L KSI ELFGI KL+TS YH QT+GLVERFNGT+I+MI SYVNR QKD + FIKPCLFAYRN++  ST E
Sbjct:  839 WKYGSPKKLLTDQGTNFQSDLVKSITELFGILKLSTSPYHLQTEGLVERFNGTLISMISSYVNRNQKDWELFIKPCLFAYRNSIKESTGE 928          

HSP 3 Score: 29.261 bits (64), Expect = 1.676e-77
Identity = 13/31 (41.94%), Postives = 18/31 (58.06%), Query Frame = -2
Query: 4271 TRQKRIIVVYANRCKLVPDSDESQYPLRPKQ 4363
             ++   IVV+ANRCK +      +Y LR KQ
Sbjct: 1045 NKKAETIVVHANRCKKIQSEGGGKYSLRSKQ 1075          
BLAST of SMED30019091 vs. Planmine SMEST
Match: SMESG000012102.1 (SMESG000012102.1)

HSP 1 Score: 149.058 bits (375), Expect = 6.291e-68
Identity = 68/98 (69.39%), Postives = 79/98 (80.61%), Query Frame = -1
Query: 4374 FYLMYLRKNNMPIDLQFQTPVSQYMEIPDYKSTMQERLQSAWAKAGLLRKHNQEKYKKAYDKRAHSHGIKIGYLVYFNRPEPLKGLSPKLHRPFK*PY 4667
            FYLMYLR+NNMPIDL++Q PV+QYME+ DYK+ +QERLQS W +AGL  K+NQE YK  YDKRAH HGIK+G LVY N+P   KGLS KL RPFK PY
Sbjct:  246 FYLMYLRRNNMPIDLEYQPPVTQYMEVSDYKAVVQERLQSVWKQAGLKIKYNQESYKDQYDKRAHEHGIKVGDLVYLNKPRLTKGLSKKLQRPFKGPY 343          

HSP 2 Score: 130.568 bits (327), Expect = 6.291e-68
Identity = 76/129 (58.91%), Postives = 88/129 (68.22%), Query Frame = -3
Query: 4660 DHYLKQ*MET--NVL*YFVIISQNIVTKIFVENIIFRYGVPKKLFTDQGTNFQSELFKSINELFGIWKLNTS-YHPQTDGLVERFNGTIINMI-SYVNRRQKD*DEFIKPCLFAYRNAVNVSTDETFLF 5034
            DHY K    T   +   F+ + Q     I +  I       KKL TDQGTNFQS+LFKSI ELFGI KL+TS Y+PQTDGLVERFN T+I+MI SYVNR QK+ D FIKPCLFAYRN+VN ST ET  +
Sbjct:  119 DHYKKATYNTMKKIWGTFMFLQQACAGLIGIYVIAVTVKGSKKLLTDQGTNFQSDLFKSITELFGILKLSTSQYYPQTDGLVERFNDTLISMISSYVNRNQKNWDLFIKPCLFAYRNSVNESTGETLFY 247          
BLAST of SMED30019091 vs. Planmine SMEST
Match: SMESG000031866.1 (SMESG000031866.1)

HSP 1 Score: 162.925 bits (411), Expect = 1.209e-65
Identity = 75/108 (69.44%), Postives = 87/108 (80.56%), Query Frame = -1
Query: 4347 PFYLMYLRKNNMPIDLQFQTPVSQYMEIPDYKSTMQERLQSAWAKAGLLRKHNQEKYKKAYDKRAHSHGIKIGYLVYFNRPEPLKGLSPKLHRPFK*PYKVCDTTETN 4670
            PFY+MYL++NNMPIDLQFQ+P+SQYM++ DYK  MQERLQSA  KA L  KH QE YK+ YDKRAH+H IK+G  VY N+PEP KGL  KL RPFK PY VCD+TETN
Sbjct:   92 PFYIMYLQRNNMPIDLQFQSPISQYMDVTDYKVIMQERLQSARIKAVLKIKHYQEAYKECYDKRAHAHDIKVGDFVYINKPEPTKGLLVKLQRPFKEPYLVCDSTETN 199          

HSP 2 Score: 108.612 bits (270), Expect = 1.209e-65
Identity = 59/85 (69.41%), Postives = 64/85 (75.29%), Query Frame = -3
Query: 4669 KKLFTDQGTNFQSELFKSINELFGIWKLNTS-YHPQTDGLVERFNGTIINMIS-YVNRRQKD*DEFIKPCLFAYRNAVNVSTDET 4917
            KKL TDQ TNFQS LFK + ELF I K +TS YH QTDGLVE FN T+INM+S YVNR+    D FIKPCLFAY NAVN ST ET
Sbjct:    7 KKLLTDQETNFQSGLFKLVTELFSILKHSTSPYHTQTDGLVEIFNCTLINMMSSYVNRKHDHCDLFIKPCLFAYHNAVNESTGET 91          

HSP 3 Score: 21.557 bits (44), Expect = 1.209e-65
Identity = 11/25 (44.00%), Postives = 14/25 (56.00%), Query Frame = -2
Query: 4244 LVPDSDESQYPLRPKQKEAKDKIIV 4318
            LV DS E+   LRP+  +    IIV
Sbjct:  191 LVCDSTETNLKLRPQYNKKAGTIIV 215          
BLAST of SMED30019091 vs. Planmine SMEST
Match: SMESG000056661.1 (SMESG000056661.1)

HSP 1 Score: 194.897 bits (494), Expect = 5.416e-57
Identity = 124/314 (39.49%), Postives = 177/314 (56.37%), Query Frame = -1
Query: 3765 PFYLMYLRKNNMPIDLQFQTPVSQYMEIPDYKSTMQERLQSAWAKAGLLRKHNQEKYKKAYDKRAHSHGI-----KIG-YLVYFNRPEPLKGLSPKLHRPFK*PYKVCDTTETNYSGIR*SMQTSSR***ITVPVTAKAKGS*R*NNCQTKIHKKPTPVSYINKXXXXXXXXXLISCANGQIIDLP-YAVNKIPLMENRDIYSTITNIVWVSHGEITDQIEINNLLDPFSSFVELNYEKNVYVAPKLRLNFKYPWLIRQ-----NRSEGQSHIYIEVRTKEFRDPIEIEQVLNRRNIYWKKVKFVRVRILFYIY 4670
            PFYLMYLR+NN P+DL+FQ P+SQYM+I DYK  MQERLQS W +AGL  +H QE YK+ YDKRAH+H I     K G  +V+ NR +                 KV    +T Y                   + +K K   R    + K+ K P+ + YINK+LF+ +++++    +      P Y + KIPL E  DIY+T T +VW+     T++IEI+NLL+ F   V+L++ KN YV  +L +N++YPWLI+Q     N ++  + I IE+ TK   + + IE VLN  NIYW+     +V+I+F  Y
Sbjct: 2144 PFYLMYLRRNNKPVDLKFQAPISQYMDISDYKVIMQERLQSVWTQAGLKIRHRQEAYKECYDKRAHAHNIEKNNKKAGKIIVHANRCK-----------------KVPVAEDTKYQ------------------LRSKDKNVERHPALKQKVAKNPSSLGYINKTLFVATLMIINVLGSNATSSFPNYVIKKIPLKEKVDIYATCTQMVWIYRCAPTEEIEISNLLNYFEPPVKLDFNKNTYVNRQLTINYEYPWLIKQVQPKINSTKIINLINIEIWTKTLNNYVSIEPVLNGINIYWETRNSQQVKIIFQNY 2422          

HSP 2 Score: 48.521 bits (114), Expect = 5.416e-57
Identity = 22/28 (78.57%), Postives = 24/28 (85.71%), Query Frame = -3
Query: 4669 RRQKD*DEFIKPCLFAYRNAVNVSTDET 4752
            ++QKD D FIKPCLFAYRNAVN ST ET
Sbjct: 2116 KKQKDWDLFIKPCLFAYRNAVNESTGET 2143          
The following BLAST results are available for this feature:
BLAST of SMED30019091 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30019091 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30019091 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30019091 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CABZ01030006.16.535e-1237.50pep scaffold:GRCz11:KN150258.1:33006:36502:-1 gene... [more]
back to top
BLAST of SMED30019091 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mybl22.260e-1643.96MYB proto-oncogene like 2 [Source:Xenbase;Acc:XB-G... [more]
nmbr3.157e-1551.56neuromedin B receptor [Source:Xenbase;Acc:XB-GENE-... [more]
ENSXETT00000025355.12.130e-1438.16pep primary_assembly:Xenopus_tropicalis_v9.1:1:227... [more]
ENSXETT00000006041.16.475e-1438.16pep primary_assembly:Xenopus_tropicalis_v9.1:6:373... [more]
ENSXETT00000023851.13.917e-1341.76pep primary_assembly:Xenopus_tropicalis_v9.1:KV461... [more]
back to top
BLAST of SMED30019091 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30019091 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P10394|POL4_DROME1.547e-1030.68Retrovirus-related Pol polyprotein from transposon... [more]
sp|P31795|POL_MLVRK3.185e-943.84Pol polyprotein (Fragment) OS=Radiation murine leu... [more]
sp|P11227|POL_MLVRD9.683e-947.06Gag-Pol polyprotein OS=Radiation murine leukemia v... [more]
sp|Q2F7J3|POL_XMRV31.289e-844.12Gag-Pol polyprotein OS=Xenotropic MuLV-related vir... [more]
sp|A1Z651|POL_XMRV63.285e-842.65Gag-Pol polyprotein OS=Xenotropic MuLV-related vir... [more]
back to top
BLAST of SMED30019091 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A355ABF25.497e-4960.58Uncharacterized protein OS=Flavobacteriaceae bacte... [more]
A0A293LM449.121e-3249.04Integrase catalytic domain-containing protein (Fra... [more]
A0A147BAZ12.668e-3149.50Putative retrovirus-related pol polyprotein from t... [more]
W4YDL65.375e-3147.57Integrase catalytic domain-containing protein OS=S... [more]
W4YDL57.614e-3146.02Integrase catalytic domain-containing protein OS=S... [more]
back to top
BLAST of SMED30019091 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000058127.11.171e-2644.90pep primary_assembly:Astyanax_mexicanus-2.0:16:354... [more]
ENSAMXT00000031920.11.201e-2644.90pep primary_assembly:Astyanax_mexicanus-2.0:12:110... [more]
ENSAMXT00000037741.16.853e-2346.00pep primary_assembly:Astyanax_mexicanus-2.0:6:2778... [more]
ENSAMXT00000033239.11.655e-2238.89pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000033562.11.939e-2238.89pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of SMED30019091 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30019091 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30019091 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30019091 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000045127.18.029e-2841.41pep primary_assembly:ASM223467v1:10:587855:593081:... [more]
ENSORLT00000029278.13.748e-2547.13pep primary_assembly:ASM223467v1:19:15721323:15727... [more]
ENSORLT00000029443.11.147e-2148.28pep primary_assembly:ASM223467v1:7:33775978:337801... [more]
ENSORLT00000035135.11.272e-2148.28uncharacterized LOC111946338 [Source:NCBI gene;Acc... [more]
ENSORLT00000043981.11.391e-2148.28uncharacterized LOC111947659 [Source:NCBI gene;Acc... [more]
back to top
BLAST of SMED30019091 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000073500.16.972e-10240.81SMESG000073500.1[more]
SMESG000080287.11.676e-7770.64SMESG000080287.1[more]
SMESG000012102.16.291e-6869.39SMESG000012102.1[more]
SMESG000031866.11.209e-6569.44SMESG000031866.1[more]
SMESG000056661.15.416e-5739.49SMESG000056661.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019091 ID=SMED30019091|Name=SMED30019091|organism=Schmidtea mediterranea sexual|type=transcript|length=5048bp
TTCAGTTATAAACTATTATATATATGTAACAAAATATTTTCTTTTAAAAA
TTTCAATAAAATTGATTTTTAAAAGATATTCCTTTAAATATTAAAATTCT
TCTTCGATCTCTGTCGATATTAGAGTGACTTTGATTGATTATCCTTCAAG
AGCAGCACAGTGCTCGAATATTATGAAATTGTAAAATAACCCTTCCAACA
AATAATTGGTGGCCATAATTCGTGACATCAAGCTTGGTAACCTTCGGTTG
AAAATGAAAAGAAATGATAGAAGAGACCAAATATCAGACTTTAAAATAGA
GAGTTCTGACTTTGGTTATGACTTGGTATCTGCTAACCCTATCGACTCCT
ACTGATCTTAAAGTAATCCTTTGACCTGTCAAACGGGTGCCCAGAGATCC
ATTTAAATTTTTTTGTTTAAGCTCTCAGAAACTATGACTTGTTTGCCGGT
ATTACAAAAAGTAACATCCGTACATAAAGAGCGCATTCTTTATCAAATTA
TTAGGAAGCCAAATATCGCAAATTCCGTTCTGTGTCCATTTGTATCAGTA
GAATAGTTAGGTCAACTTTGCTATTTTCACTACAAACCAGTTCTAATTTT
GTTATTCCATACAAAAAAACTTTTTGGAACTTCATATTGAGTTTGGTCGT
GAATGATTTGAATGAAGATAATGATGTCAGCAACAAATTAGGAAAATTTT
ATAAATATTTATTCCCCCCCCCCCTCTCTCTCTAATTGGAAATATTTCCC
GTTGAATAAAAGTCTAAAGGTTGTGTCATTTGTCACTTACTGAAGACAAC
AATGACCTCATTTGATCCTTAAGTGAAAATTCATCAAACTGTCAAAGGTC
AAAATAATTGAGTTTCAAATCGAAATGCTTTTTTTTGAGAATTTTTTTAT
CTTCAATAATTTTCTCTTATCTTTCGTATCGTATTTGTCCTCCAATTCAA
TGCGTACTTTGATTACGTAAGTAGTGGCACCCTCCTTCAGTTAAGCAATA
TTCTTGCAGGAGGTTTCTGAATAAAGAAGTTAGAGAAAAGGTTTAGTATT
CCGGGTTTCCTTGCAAGACTTTGTCTGATACTTCTTACGTCCTTCGAGGA
TTTTTGCATCCCCTTGAAAATAGTAACGGAAATTCCGAAAAATCTCCTCT
AAATTCCAACACCATTATCATTCAATTACGTTAATTAATTAAAATGAATT
AATTACCTAACTGATGTCGTTCTCCACAAGATAAGAAGCCTGTCGGTTGC
GTGTCCCTACTTTGATTACGTTACAAGCACGCGAATATTCCCACAATTCC
ACAACCCGTTGCTTGCGTAGTTAGATTAATGAAACGTTTACCTTTTTAAT
GGGAAAGGTCTGGGAGCAATAAAATGTCTCGAGCTAAACTAACAATTTTA
CTTAACAAGATCCTAATTTCTTTATATGGGGGTGGGGAGGTTGAAATGAT
ATTGTAGGGGGCACCGGAAAATCAGTCAAGCAATGACATAAATACAATAA
GCAATTTTTATGTAATTTTGACTTATTTATCCCAATAATACACTTTTTTG
GCTACAAGGAAACTTTTACAAGAATTCCAAGCTTTATTATTAACCGCCTT
TATTCTCATAAGGTGAGGCACGGAGAAAGGAAAGCTTCATAAATTAGCCC
CCCCCTATACTGGGCCTTTCATTGAAAGGCCAGGTGATATTAAATGCTTC
ATTCCATTGTTCTTTCTTGACTGTTATTATTTGTTTAAGATACAATAAGG
TTCCCCCCCCGATAATTTTGTTAGCGGGATATTATGGGGGTCCTACAAAA
TTTGTGAGATAATTGTTACTAGCTTTAAAATATTTTTGGGGTTTAGTAAT
ATATACAGTTGTGAGTAGTATTAATTTTGTATCACATTCTTTCATTAAGG
GGTAAGAGAATTTCGCCCCCCCCCACCGGTTAGTAATCCATTTACAATAT
CATTTATCAATCTGTATTTGTATCATAATACATTGAAATTGGTTACGTAA
TCTTTATCTTTTGCACAATTTTTAATCCTCAATTTTTTCACACAAATCCA
AATTATTTACCTAAGAGTAAAATGTAAACACGAAGAGACAAACAAATTTC
ACACGTAAAATTTAGCCTATTTTCGGTTGCAAAATTTTGGAGATTTTTTC
GAAAAATTAGGAAAAATCGCGGAAAAATTTATTGATTAATCCAAAAATAT
TCCAAAAATATTCCGAAAATAATTTTGAATTTTACTTTTATCCCGAGATG
CCTTTTATCTCTGTTTCAATTTTATACTATTGATCAATATAAAACCAAAT
ATTGATCGAAAGAAATGGGGAATAAAGATAAATGGCAAGGAAAATAAATA
ATTTTACTGATCGCAAAAAATAGGAATTTTTAATTAAGCCTAATTTAATT
TGTCTAAAATTTGGAGGGGGGGGGGGGGAGATTACAATAATATCTTTACT
AACATAATAAAAAAATTTATTTGACTCTAAATTCGATCCCGGCCCAACAA
TGAGCATCAAAAAAATCTTTAATTATTTTTCCAACAAAAAAAAAAGAATG
GAATCCCTGAAAATCCATCGAAATAGTTGAAAGGGGGGTCTTCAATAATA
GCTTTACTAATATAATAAAAAAATTATTTTACTCTAAATTGGATCCTGAC
CCAACAATGAGCATCAAAAAAAAGTCTTTTTAATTATTTTACCAATGGAC
AACAGAAAACAAATCCTTAAACACGTGTCGAATAAATTAAAAGAGAAAAA
AAAACATTTGTTTTGTTAAGGAAATGGAAATTTAAATACGAATTGTAAAT
TTCAAAAAACAAAAAACACCCGGAAATTTCAAATTTGAATAATAGATTGA
ATTGGGGAAAACAAATCAAAGAATTCCCCAGTAAACAACGCGCAATATTT
TCAATGAAATCAATTACAGAGGTTTCCATTATCGATAAATCTATCACGAA
AATTTCCCTTTTTTTTAATTTTTTCAAATTTCAACTAGAATCACCGAGAG
ATTTTTCGATTTTTTTTTGTTGTTGTTGTTGTTATTTGTTAGTGGATAAA
ATTAATAAATTTGTGATAGATCAATATCGTTTATTTCCTTGTTTGATTTA
TTGATTGCAATCAGTTTTTTTTATTTTTTGGTTTTTATTTTTCTAACATT
GAAAATTGTTGTTGTCGTAATAAGTGATGAATATATCAAACAATCAATTT
TTTTTAAACTCATCGGACTGTTGCACATTTCCAAAAAAAGCACGTACGCA
CACGAGCAGTTCTGAGTCATGGCTGACGAATATCATTGGTCCTCGCTAAG
CCAACTGGATAATAGAGAATGTGTGTATGCTTGCATTCATACATTCTGTG
GGTGTGCATAATGCGCTATCTACCCACTCAATAGGTGTGTGTGTGTGTTT
TTTTGTAAAAATCGATATCTCTGGGATTCGTTGGTACACAATGCAGCTTA
GCATAATTTTTTTTTGTTTAACGGGAATTTTTATTTTCAAAAAAAAATAC
TTTCAATAATTTTATTGATTTTCTTATAATTTTAAAAATTATATTTATCA
AATTTCTATAAGATATTTTTTATAGCAGATTGAATCGATTTTTTGGTGTT
CTATGGATTTATTACGAATTTAATTGTAACGATAATAACAATTATGCGTC
ACTCAAATTTTAAATAAATATCGCTTGATTGACATTAAATACTACTTTAA
AAAATATATTTTATATTCATCTTGGCATGCACACAAAATAGAATGTGGTT
TTTAAAATAAATAAATATATATAAAATAAAATTCGTACTCTAACAAATTT
CACCTTTTTCCAATATATGTTTCTTCTATTCAATACTTGTTCTATCTCAA
TTGGATCTCGAAATTCTTTTGTTCGTACTTCTATATAAATATGACTTTGT
CCTTCTGACCTGTTTTGTCTTATCAACCACGGATATTTAAAGTTCAATCT
TAGTTTCGGTGCAACATATACGTTTTTCTCGTAATTTAGTTCTACAAATG
AACTGAATGGATCTAGTAGATTATTGATTTCGATTTGATCTGTTATCTCA
CCATGAGAGACCCAAACAATATTTGTAATAGTGGAATAGATATCTCGGTT
TTCCATTAGTGGTATTTTATTTACTGCATAAGGTAAATCAATTATTTGCC
CATTTGCACATGATATAAGCATCAACATACTAAATAGGAATAATGATTTA
TTAATGTAGCTGACTGGAGTTGGTTTTTTGTGAATTTTTGTCTGACAATT
ATTTTATCTTTAGCTTCCTTTTGCTTTGGCCGTAACGGGTACTGTGATTC
ATCACTATCTGGAACTAGTTTGCATCGATTAGCGTATACCACTATAATTC
GTTTCTGTCGTGTCACACACTTTGTATGGTCATTTAAATGGCCTGTGCAA
CTTTGGTGACAAACCTTTGAGCGGTTCTGGTCTATTGAAATAAACTAAAT
ATCCAATCTTTATTCCATGGCTATGTGCCCTTTTGTCATAGGCTTTTTTA
TATTTTTCTTGATTGTGTTTTCTCAGTAGCCCTGCTTTGGCCCATGCTGA
CTGTAACCTTTCTTGCATTGTTGATTTATAGTCTGGTATTTCCATATACT
GAGACACTGGTGTTTGGAATTGTAAATCGATCGGCATGTTGTTCTTCCTA
AGATACATTAAATAGAAAGGTCTCATCTGTACTTACATTGACCGCATTTC
GATACGCAAATAAACAAGGCTTTATGAACTCGTCTCAATCCTTTTGTCTC
CGATTTACATAAGAAATCATATTTATTATAGTTCCATTGAATCTTTCGAC
TAATCCATCGGTTTGTGGATGATAAGAAGTATTCAGCTTCCAAATTCCAA
ATAACTCGTTTATTGATTTGAACAGTTCACTCTGAAAATTTGTTCCTTGA
TCTGTAAACAACTTTTTAGGAACACCATATCTGAAGATAATATTTTCAAC
AAATATTTTAGTCACTATATTCTGTGAGATAATCACAAAATACTATAATA
CATTTGTTTCCATTTATTGTTTCAGGTAATGGTCCAATAATATCCATT
back to top

protein sequence of SMED30019091-orf-1

>SMED30019091-orf-1 ID=SMED30019091-orf-1|Name=SMED30019091-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=154bp
MLMLISCANGQIIDLPYAVNKIPLMENRDIYSTITNIVWVSHGEITDQIE
INNLLDPFSSFVELNYEKNVYVAPKLRLNFKYPWLIRQNRSEGQSHIYIE
VRTKEFRDPIEIEQVLNRRNIYWKKVKFVRVRILFYIYLFILKTTFYFVC
MPR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR001584Integrase_cat-core
IPR012337RNaseH-like_sf
Vocabulary: biological process
TermDefinition
GO:0015074DNA integration
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableTMHMMTMhelixcoord: 32..54
NoneNo IPR availableTMHMMTMhelixcoord: 5..27