Voltage gated potassium channel

Overview
NameVoltage gated potassium channel
Smed IDSMED30019065
Length (bp)1554
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019065

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30019065h1SMcG0013142 SmedASXL_009365SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30019065h1SMcG0013142 dd_Smed_v4_23063_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30019065h1SMcG0013142 dd_Smed_v4_23063_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30019065h1SMcG0013142 dd_Smed_v4_23063_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30019065h1SMcG0013142 dd_Smed_v6_23063_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
photoreceptor neuronSMED30019065h1SMcG0013142 SMED30004462smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Voltage gated potassium channel vs. Ensembl Human
Match: KCNH5 (potassium voltage-gated channel subfamily H member 5 [Source:HGNC Symbol;Acc:HGNC:6254])

HSP 1 Score: 394.815 bits (1013), Expect = 8.796e-131
Identity = 233/468 (49.79%), Postives = 317/468 (67.74%), Query Frame = 1
Query:  103 MSGSRRGLVAPQNTLLDTIIRRCNSQHSSFILANAKIVDHPIIYVNEAFSKLTGFARNEVMQKSSQCTFLHGEETNKDLLDQWFSALNNYEQIQLELLVFKKNLSPLWIVLQIHPITNEKLEVXXXXXTFYDITAIKHPSDDEAEIKPGLSKFAKLAKSVARNRSIMIDLTQDFQENNKESSKVETSPINNIFMHSKNIPQYKHETPKTPPHIILHYSQFKVIWDWVILLLTYYTAVMVPFNAAFSNKSMDAVLFLIVDSIVDVIFFLDIVLNFHTTFVGSTGEVISDAFIIRINYLKGWFIIDLMSCLPYDVFNAFQPGSQEGISQXXXXXXXXXXXXXXXXXXXXDQYLEYMATXXXXXXXXXXXXAHWFACIWYTVGN----TDLRNNKQY-GWIPKMLQDC-----HQTVANWTTFDPNKEHKLLNYATSLYFTMSLLTSIGFGNVSANTELEKFACVIFMLFG 1476
            M G +RGLVAPQNT L+ I+RR  S  SSF+L NA+IVD P++Y N+ F KL+G+ R +VMQKSS C+F++GE T+K  +++     +NYE    E+L++KKN +P+W  +QI PI NE  +V+L L TF DIT  K P +D++    G +KFA+L +++  +RS++  LT     N  E     +     + + S  +PQYK E PKTPPHIILHY  FK  WDWVIL+LT+YTA+MVP+N +F  K  + + +L++DS+VDVIF +DIVLNFHTTFVG  GEVISD  +IR+NYLK WF+IDL+SCLPYD+ NAF+    EGIS L  +LKVVRLLRLGRV RKLD YLEY A +LVL++ VF L+AHW ACIWY++G+     ++ N  Q   W+ ++         + T A      P+K+     Y +SLYFTM+ LT+IGFGN++  T++EK   V  M+ G
Sbjct:    1 MPGGKRGLVAPQNTFLENIVRR--SSESSFLLGNAQIVDWPVVYSNDGFCKLSGYHRADVMQKSSTCSFMYGELTDKKTIEKVRQTFDNYESNCFEVLLYKKNRTPVWFYMQIAPIRNEHEKVVLFLCTFKDITLFKQPIEDDS--TKGWTKFARLTRALTNSRSVLQQLT---PMNKTEVVHKHSRLAEVLQLGSDILPQYKQEAPKTPPHIILHYCAFKTTWDWVILILTFYTAIMVPYNVSFKTKQ-NNIAWLVLDSVVDVIFLVDIVLNFHTTFVGPGGEVISDPKLIRMNYLKTWFVIDLLSCLPYDIINAFE-NVDEGISSLFSSLKVVRLLRLGRVARKLDHYLEYGAAVLVLLVCVFGLVAHWLACIWYSIGDYEVIDEVTNTIQIDSWLYQLALSIGTPYRYNTSAGIWEGGPSKDSL---YVSSLYFTMTSLTTIGFGNIAPTTDVEKMFSVAMMMVG 456          
BLAST of Voltage gated potassium channel vs. Ensembl Human
Match: KCNH1 (potassium voltage-gated channel subfamily H member 1 [Source:HGNC Symbol;Acc:HGNC:6250])

HSP 1 Score: 402.519 bits (1033), Expect = 2.677e-130
Identity = 230/468 (49.15%), Postives = 318/468 (67.95%), Query Frame = 1
Query:   97 ISMSGSRRGLVAPQNTLLDTIIRRCNSQHSSFILANAKIVDHPIIYVNEAFSKLTGFARNEVMQKSSQCTFLHGEETNKDLLDQWFSALNNYEQIQLELLVFKKNLSPLWIVLQIHPITNEKLEVXXXXXTFYDITAIKHPSDDEAEIKPGLSKFAKLAKSVARNRSIMIDLTQDFQENNKESSKVETSPINNIFMHSKNIPQYKHETPKTPPHIILHYSQFKVIWDWVILLLTYYTAVMVPFNAAFSNKSMDAVLFLIVDSIVDVIFFLDIVLNFHTTFVGSTGEVISDAFIIRINYLKGWFIIDLMSCLPYDVFNAFQPGSQEGISQXXXXXXXXXXXXXXXXXXXXDQYLEYMATXXXXXXXXXXXXAHWFACIWYTVG-----NTDLRNNKQYGWIPKMLQDC---HQTVANWTTFDPNKEHKLLNYATSLYFTMSLLTSIGFGNVSANTELEKFACVIFMLFG 1476
            ++M+G RRGLVAPQNT L+ I+RR N   ++F+L NA+IVD PI+Y N+ F KL+G+ R EVMQKSS C+F++GE T+KD +++      NYE    E+L++KKN +P+W  ++I PI NE+ +V+L L TF DITA K P +D++    G  KFA+L +++  +R ++  L    Q+          + +  + + S  +PQYK E PKTPPHIILHY  FK  WDW+IL+LT+YTA++VP+N +F  +  + V +L+VDSIVDVIF +DIVLNFHTTFVG  GEVISD  +IR+NYLK WF+IDL+SCLPYDV NAF+    EGIS L  +LKVVRLLRLGRV RKLD Y+EY A +LVL++ VF L AHW ACIWY++G     + D +  +   W+ ++  D    +Q   + +        K   Y +SLYFTM+ LTS+GFGN++ +T++EK   V  M+ G
Sbjct:    1 MTMAGGRRGLVAPQNTFLENIVRRSND--TNFVLGNAQIVDWPIVYSNDGFCKLSGYHRAEVMQKSSTCSFMYGELTDKDTIEKVRQTFENYEMNSFEILMYKKNRTPVWFFVKIAPIRNEQDKVVLFLCTFSDITAFKQPIEDDS--CKGWGKFARLTRALTSSRGVLQQLAPSVQKGENVHKHSRLAEV--LQLGSDILPQYKQEAPKTPPHIILHYCVFKTTWDWIILILTFYTAILVPYNVSFKTR-QNNVAWLVVDSIVDVIFLVDIVLNFHTTFVGPAGEVISDPKLIRMNYLKTWFVIDLLSCLPYDVINAFE-NVDEGISSLFSSLKVVRLLRLGRVARKLDHYIEYGAAVLVLLVCVFGLAAHWMACIWYSIGDYEIFDEDTKTIRNNSWLYQLAMDIGTPYQFNGSGSGKWEGGPSKNSVYISSLYFTMTSLTSVGFGNIAPSTDIEKIFAVAIMMIG 460          
BLAST of Voltage gated potassium channel vs. Ensembl Human
Match: KCNH1 (potassium voltage-gated channel subfamily H member 1 [Source:HGNC Symbol;Acc:HGNC:6250])

HSP 1 Score: 402.519 bits (1033), Expect = 9.611e-130
Identity = 233/471 (49.47%), Postives = 320/471 (67.94%), Query Frame = 1
Query:   97 ISMSGSRRGLVAPQNTLLDTIIRRCNSQHSSFILANAKIVDHPIIYVNEAFSKLTGFARNEVMQKSSQCTFLHGEETNKDLLDQWFSALNNYEQIQLELLVFKKNLSPLWIVLQIHPITNEKLEVXXXXXTFYDITAIKHPSDDEAEIKPGLSKFAKLAKSVARNRSIMIDLTQDFQEN---NKESSKVETSPINNIFMHSKNIPQYKHETPKTPPHIILHYSQFKVIWDWVILLLTYYTAVMVPFNAAFSNKSMDAVLFLIVDSIVDVIFFLDIVLNFHTTFVGSTGEVISDAFIIRINYLKGWFIIDLMSCLPYDVFNAFQPGSQEGISQXXXXXXXXXXXXXXXXXXXXDQYLEYMATXXXXXXXXXXXXAHWFACIWYTVG-----NTDLRNNKQYGWIPKMLQDC---HQTVANWTTFDPNKEHKLLNYATSLYFTMSLLTSIGFGNVSANTELEKFACVIFMLFG 1476
            ++M+G RRGLVAPQNT L+ I+RR N   ++F+L NA+IVD PI+Y N+ F KL+G+ R EVMQKSS C+F++GE T+KD +++      NYE    E+L++KKN +P+W  ++I PI NE+ +V+L L TF DITA K P +D++    G  KFA+L +++  +R ++  L    Q+    +K S   E      + + S  +PQYK E PKTPPHIILHY  FK  WDW+IL+LT+YTA++VP+N +F  +  + V +L+VDSIVDVIF +DIVLNFHTTFVG  GEVISD  +IR+NYLK WF+IDL+SCLPYDV NAF+    EGIS L  +LKVVRLLRLGRV RKLD Y+EY A +LVL++ VF L AHW ACIWY++G     + D +  +   W+ ++  D    +Q   + +        K   Y +SLYFTM+ LTS+GFGN++ +T++EK   V  M+ G
Sbjct:    1 MTMAGGRRGLVAPQNTFLENIVRRSND--TNFVLGNAQIVDWPIVYSNDGFCKLSGYHRAEVMQKSSTCSFMYGELTDKDTIEKVRQTFENYEMNSFEILMYKKNRTPVWFFVKIAPIRNEQDKVVLFLCTFSDITAFKQPIEDDS--CKGWGKFARLTRALTSSRGVLQQLAPSVQKGENVHKHSRLAEV-----LQLGSDILPQYKQEAPKTPPHIILHYCVFKTTWDWIILILTFYTAILVPYNVSFKTR-QNNVAWLVVDSIVDVIFLVDIVLNFHTTFVGPAGEVISDPKLIRMNYLKTWFVIDLLSCLPYDVINAFE-NVDEGISSLFSSLKVVRLLRLGRVARKLDHYIEYGAAVLVLLVCVFGLAAHWMACIWYSIGDYEIFDEDTKTIRNNSWLYQLAMDIGTPYQFNGSGSGKWEGGPSKNSVYISSLYFTMTSLTSVGFGNIAPSTDIEKIFAVAIMMIG 460          
BLAST of Voltage gated potassium channel vs. Ensembl Human
Match: KCNH1 (potassium voltage-gated channel subfamily H member 1 [Source:HGNC Symbol;Acc:HGNC:6250])

HSP 1 Score: 402.519 bits (1033), Expect = 9.611e-130
Identity = 233/471 (49.47%), Postives = 320/471 (67.94%), Query Frame = 1
Query:   97 ISMSGSRRGLVAPQNTLLDTIIRRCNSQHSSFILANAKIVDHPIIYVNEAFSKLTGFARNEVMQKSSQCTFLHGEETNKDLLDQWFSALNNYEQIQLELLVFKKNLSPLWIVLQIHPITNEKLEVXXXXXTFYDITAIKHPSDDEAEIKPGLSKFAKLAKSVARNRSIMIDLTQDFQEN---NKESSKVETSPINNIFMHSKNIPQYKHETPKTPPHIILHYSQFKVIWDWVILLLTYYTAVMVPFNAAFSNKSMDAVLFLIVDSIVDVIFFLDIVLNFHTTFVGSTGEVISDAFIIRINYLKGWFIIDLMSCLPYDVFNAFQPGSQEGISQXXXXXXXXXXXXXXXXXXXXDQYLEYMATXXXXXXXXXXXXAHWFACIWYTVG-----NTDLRNNKQYGWIPKMLQDC---HQTVANWTTFDPNKEHKLLNYATSLYFTMSLLTSIGFGNVSANTELEKFACVIFMLFG 1476
            ++M+G RRGLVAPQNT L+ I+RR N   ++F+L NA+IVD PI+Y N+ F KL+G+ R EVMQKSS C+F++GE T+KD +++      NYE    E+L++KKN +P+W  ++I PI NE+ +V+L L TF DITA K P +D++    G  KFA+L +++  +R ++  L    Q+    +K S   E      + + S  +PQYK E PKTPPHIILHY  FK  WDW+IL+LT+YTA++VP+N +F  +  + V +L+VDSIVDVIF +DIVLNFHTTFVG  GEVISD  +IR+NYLK WF+IDL+SCLPYDV NAF+    EGIS L  +LKVVRLLRLGRV RKLD Y+EY A +LVL++ VF L AHW ACIWY++G     + D +  +   W+ ++  D    +Q   + +        K   Y +SLYFTM+ LTS+GFGN++ +T++EK   V  M+ G
Sbjct:    1 MTMAGGRRGLVAPQNTFLENIVRRSND--TNFVLGNAQIVDWPIVYSNDGFCKLSGYHRAEVMQKSSTCSFMYGELTDKDTIEKVRQTFENYEMNSFEILMYKKNRTPVWFFVKIAPIRNEQDKVVLFLCTFSDITAFKQPIEDDS--CKGWGKFARLTRALTSSRGVLQQLAPSVQKGENVHKHSRLAEV-----LQLGSDILPQYKQEAPKTPPHIILHYCVFKTTWDWIILILTFYTAILVPYNVSFKTR-QNNVAWLVVDSIVDVIFLVDIVLNFHTTFVGPAGEVISDPKLIRMNYLKTWFVIDLLSCLPYDVINAFE-NVDEGISSLFSSLKVVRLLRLGRVARKLDHYIEYGAAVLVLLVCVFGLAAHWMACIWYSIGDYEIFDEDTKTIRNNSWLYQLAMDIGTPYQFNGSGSGKWEGGPSKNSVYISSLYFTMTSLTSVGFGNIAPSTDIEKIFAVAIMMIG 460          
BLAST of Voltage gated potassium channel vs. Ensembl Human
Match: KCNH1 (potassium voltage-gated channel subfamily H member 1 [Source:HGNC Symbol;Acc:HGNC:6250])

HSP 1 Score: 402.519 bits (1033), Expect = 9.611e-130
Identity = 233/471 (49.47%), Postives = 320/471 (67.94%), Query Frame = 1
Query:   97 ISMSGSRRGLVAPQNTLLDTIIRRCNSQHSSFILANAKIVDHPIIYVNEAFSKLTGFARNEVMQKSSQCTFLHGEETNKDLLDQWFSALNNYEQIQLELLVFKKNLSPLWIVLQIHPITNEKLEVXXXXXTFYDITAIKHPSDDEAEIKPGLSKFAKLAKSVARNRSIMIDLTQDFQEN---NKESSKVETSPINNIFMHSKNIPQYKHETPKTPPHIILHYSQFKVIWDWVILLLTYYTAVMVPFNAAFSNKSMDAVLFLIVDSIVDVIFFLDIVLNFHTTFVGSTGEVISDAFIIRINYLKGWFIIDLMSCLPYDVFNAFQPGSQEGISQXXXXXXXXXXXXXXXXXXXXDQYLEYMATXXXXXXXXXXXXAHWFACIWYTVG-----NTDLRNNKQYGWIPKMLQDC---HQTVANWTTFDPNKEHKLLNYATSLYFTMSLLTSIGFGNVSANTELEKFACVIFMLFG 1476
            ++M+G RRGLVAPQNT L+ I+RR N   ++F+L NA+IVD PI+Y N+ F KL+G+ R EVMQKSS C+F++GE T+KD +++      NYE    E+L++KKN +P+W  ++I PI NE+ +V+L L TF DITA K P +D++    G  KFA+L +++  +R ++  L    Q+    +K S   E      + + S  +PQYK E PKTPPHIILHY  FK  WDW+IL+LT+YTA++VP+N +F  +  + V +L+VDSIVDVIF +DIVLNFHTTFVG  GEVISD  +IR+NYLK WF+IDL+SCLPYDV NAF+    EGIS L  +LKVVRLLRLGRV RKLD Y+EY A +LVL++ VF L AHW ACIWY++G     + D +  +   W+ ++  D    +Q   + +        K   Y +SLYFTM+ LTS+GFGN++ +T++EK   V  M+ G
Sbjct:    1 MTMAGGRRGLVAPQNTFLENIVRRSND--TNFVLGNAQIVDWPIVYSNDGFCKLSGYHRAEVMQKSSTCSFMYGELTDKDTIEKVRQTFENYEMNSFEILMYKKNRTPVWFFVKIAPIRNEQDKVVLFLCTFSDITAFKQPIEDDS--CKGWGKFARLTRALTSSRGVLQQLAPSVQKGENVHKHSRLAEV-----LQLGSDILPQYKQEAPKTPPHIILHYCVFKTTWDWIILILTFYTAILVPYNVSFKTR-QNNVAWLVVDSIVDVIFLVDIVLNFHTTFVGPAGEVISDPKLIRMNYLKTWFVIDLLSCLPYDVINAFE-NVDEGISSLFSSLKVVRLLRLGRVARKLDHYIEYGAAVLVLLVCVFGLAAHWMACIWYSIGDYEIFDEDTKTIRNNSWLYQLAMDIGTPYQFNGSGSGKWEGGPSKNSVYISSLYFTMTSLTSVGFGNIAPSTDIEKIFAVAIMMIG 460          
BLAST of Voltage gated potassium channel vs. Ensembl Celegans
Match: egl-2 (pep chromosome:WBcel235:V:1288841:1299208:-1 gene:WBGene00001171.1 transcript:F16B3.1b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:egl-2)

HSP 1 Score: 362.073 bits (928), Expect = 7.080e-115
Identity = 219/482 (45.44%), Postives = 299/482 (62.03%), Query Frame = 1
Query:  103 MSGSRRGLVAPQNTLLDTIIRRCNSQHSSFILANAKIVDHPIIYVNEAFSKLTGFARNEVMQKSSQCTFLHGEETNKDLLDQWFSALNNYEQIQLELLVFKKNLSPLWIVLQIHPITNEKLEVXXXXXTFYDITAIKHPSDDEAEIKPGLSKFAKLAKSVARNRSIMIDLTQDFQENNKESSKVETSPINNIFMHSKNIPQYKHETPKTPPHIILHYSQFKVIWDWVILLLTYYTAVMVPFNAAFSNK---------------SMDAVLFLIVDSIVDVIFFLDIVLNFHTTFVGSTGEVISDAFIIRINYLKGWFIIDLMSCLPYDVFNAFQPGSQEGISQXXXXXXXXXXXXXXXXXXXXDQYLEYMATXXXXXXXXXXXXAHWFACIWYTVGNTDLRNNKQY-----GWIPKMLQDCHQ----TVANWTTF--DPNKEHKLLNYATSLYFTMSLLTSIGFGNVSANTELEKFACVIFML 1470
            M   +RGLVAPQNT L+ +IRRCN+  +SFILANA++VD+PI+Y N+ FSKL G+ R E+MQK     F+HGE      L +   AL N    Q E+ + KKN +P+W+++ + PI N K  V+L L  F DIT +K P DDE     GLS+  ++A+     +      T+D  ++   +S      I  + +    +PQY+ ETPKT PHIILHYS FK IWDW IL LT+YTA MVPFN AF N                 +D+V  +  DSIVDVIFF DI+LNFHTTFVG  GEV+ +  +IR NY K WF+IDL+SCLPYD+F  F+    E I  L  ALKVVRLLRLGRV RKLD YLEY A  L+L++  ++++AHW AC+W+ +G++++R          GW+ K+  D  Q     ++N TT    P++      Y +SLY+TMS ++++GFGN+++NT+ EK   V  M+
Sbjct:    1 MPVGKRGLVAPQNTFLENVIRRCNNADTSFILANAQVVDYPIVYCNDGFSKLVGYTRAEIMQKPCSLAFMHGEHGEVGSLQKMQEALENARTEQAEIGLCKKNKTPIWLLVHLAPIKNHKDAVVLYLCQFKDITPLKQPLDDENN--KGLSRILQIARIAKSKQQFNQIETKDLHKSPGNTSSNFNQVIKVMNLGGDMLPQYRQETPKTSPHIILHYSSFKTIWDWSILALTFYTAFMVPFNIAFKNSLRPFYLISSRENPGGGIDSVALM--DSIVDVIFFADILLNFHTTFVGPGGEVVIEPSVIRQNYFKSWFLIDLLSCLPYDIFYMFK-RDDERIGSLFSALKVVRLLRLGRVARKLDNYLEYGAATLLLLLCAYVIVAHWLACVWFWIGDSEVRLKMDNLALPDGWLWKLSNDLRQHYNIPLSNKTTLVGGPSRTSA---YISSLYYTMSCMSTVGFGNIASNTDNEKIFGVCMMI 474          
BLAST of Voltage gated potassium channel vs. Ensembl Celegans
Match: egl-2 (pep chromosome:WBcel235:V:1288841:1299208:-1 gene:WBGene00001171.1 transcript:F16B3.1a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:egl-2)

HSP 1 Score: 360.533 bits (924), Expect = 3.100e-114
Identity = 222/489 (45.40%), Postives = 303/489 (61.96%), Query Frame = 1
Query:  103 MSGSRRGLVAPQNTLLDTIIRRCNSQHSSFILANAKIVDHPIIYVNEAFSKLTGFARNEVMQKSSQCTFLHGEETNKDLLDQWFSALNNYEQIQLELLVFKKNLSPLWIVLQIHPITNEKLEVXXXXXTFYDITAIKHPSDDEAEIKPGLSKFAKLAKSVARNRSIMIDLTQDFQENNKESSKVETSPINN-------IFMHSKNIPQYKHETPKTPPHIILHYSQFKVIWDWVILLLTYYTAVMVPFNAAFSNK---------------SMDAVLFLIVDSIVDVIFFLDIVLNFHTTFVGSTGEVISDAFIIRINYLKGWFIIDLMSCLPYDVFNAFQPGSQEGISQXXXXXXXXXXXXXXXXXXXXDQYLEYMATXXXXXXXXXXXXAHWFACIWYTVGNTDLRNNKQY-----GWIPKMLQDCHQ----TVANWTTF--DPNKEHKLLNYATSLYFTMSLLTSIGFGNVSANTELEKFACVIFML 1470
            M   +RGLVAPQNT L+ +IRRCN+  +SFILANA++VD+PI+Y N+ FSKL G+ R E+MQK     F+HGE      L +   AL N    Q E+ + KKN +P+W+++ + PI N K  V+L L  F DIT +K P DDE     GLS+  ++A+ +A+++          Q N  E+  +  SP N        + +    +PQY+ ETPKT PHIILHYS FK IWDW IL LT+YTA MVPFN AF N                 +D+V  +  DSIVDVIFF DI+LNFHTTFVG  GEV+ +  +IR NY K WF+IDL+SCLPYD+F  F+    E I  L  ALKVVRLLRLGRV RKLD YLEY A  L+L++  ++++AHW AC+W+ +G++++R          GW+ K+  D  Q     ++N TT    P++      Y +SLY+TMS ++++GFGN+++NT+ EK   V  M+
Sbjct:    1 MPVGKRGLVAPQNTFLENVIRRCNNADTSFILANAQVVDYPIVYCNDGFSKLVGYTRAEIMQKPCSLAFMHGEHGEVGSLQKMQEALENARTEQAEIGLCKKNKTPIWLLVHLAPIKNHKDAVVLYLCQFKDITPLKQPLDDENN--KGLSRILQIAR-IAKSKQ---------QFNQIETKDLHKSPGNTSSNFNQVMNLGGDMLPQYRQETPKTSPHIILHYSSFKTIWDWSILALTFYTAFMVPFNIAFKNSLRPFYLISSRENPGGGIDSVALM--DSIVDVIFFADILLNFHTTFVGPGGEVVIEPSVIRQNYFKSWFLIDLLSCLPYDIFYMFK-RDDERIGSLFSALKVVRLLRLGRVARKLDNYLEYGAATLLLLLCAYVIVAHWLACVWFWIGDSEVRLKMDNLALPDGWLWKLSNDLRQHYNIPLSNKTTLVGGPSRTSA---YISSLYYTMSCMSTVGFGNIASNTDNEKIFGVCMMI 471          
BLAST of Voltage gated potassium channel vs. Ensembl Celegans
Match: egl-2 (pep chromosome:WBcel235:V:1289373:1299332:-1 gene:WBGene00001171.1 transcript:F16B3.1a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:egl-2)

HSP 1 Score: 360.533 bits (924), Expect = 3.100e-114
Identity = 222/489 (45.40%), Postives = 303/489 (61.96%), Query Frame = 1
Query:  103 MSGSRRGLVAPQNTLLDTIIRRCNSQHSSFILANAKIVDHPIIYVNEAFSKLTGFARNEVMQKSSQCTFLHGEETNKDLLDQWFSALNNYEQIQLELLVFKKNLSPLWIVLQIHPITNEKLEVXXXXXTFYDITAIKHPSDDEAEIKPGLSKFAKLAKSVARNRSIMIDLTQDFQENNKESSKVETSPINN-------IFMHSKNIPQYKHETPKTPPHIILHYSQFKVIWDWVILLLTYYTAVMVPFNAAFSNK---------------SMDAVLFLIVDSIVDVIFFLDIVLNFHTTFVGSTGEVISDAFIIRINYLKGWFIIDLMSCLPYDVFNAFQPGSQEGISQXXXXXXXXXXXXXXXXXXXXDQYLEYMATXXXXXXXXXXXXAHWFACIWYTVGNTDLRNNKQY-----GWIPKMLQDCHQ----TVANWTTF--DPNKEHKLLNYATSLYFTMSLLTSIGFGNVSANTELEKFACVIFML 1470
            M   +RGLVAPQNT L+ +IRRCN+  +SFILANA++VD+PI+Y N+ FSKL G+ R E+MQK     F+HGE      L +   AL N    Q E+ + KKN +P+W+++ + PI N K  V+L L  F DIT +K P DDE     GLS+  ++A+ +A+++          Q N  E+  +  SP N        + +    +PQY+ ETPKT PHIILHYS FK IWDW IL LT+YTA MVPFN AF N                 +D+V  +  DSIVDVIFF DI+LNFHTTFVG  GEV+ +  +IR NY K WF+IDL+SCLPYD+F  F+    E I  L  ALKVVRLLRLGRV RKLD YLEY A  L+L++  ++++AHW AC+W+ +G++++R          GW+ K+  D  Q     ++N TT    P++      Y +SLY+TMS ++++GFGN+++NT+ EK   V  M+
Sbjct:    1 MPVGKRGLVAPQNTFLENVIRRCNNADTSFILANAQVVDYPIVYCNDGFSKLVGYTRAEIMQKPCSLAFMHGEHGEVGSLQKMQEALENARTEQAEIGLCKKNKTPIWLLVHLAPIKNHKDAVVLYLCQFKDITPLKQPLDDENN--KGLSRILQIAR-IAKSKQ---------QFNQIETKDLHKSPGNTSSNFNQVMNLGGDMLPQYRQETPKTSPHIILHYSSFKTIWDWSILALTFYTAFMVPFNIAFKNSLRPFYLISSRENPGGGIDSVALM--DSIVDVIFFADILLNFHTTFVGPGGEVVIEPSVIRQNYFKSWFLIDLLSCLPYDIFYMFK-RDDERIGSLFSALKVVRLLRLGRVARKLDNYLEYGAATLLLLLCAYVIVAHWLACVWFWIGDSEVRLKMDNLALPDGWLWKLSNDLRQHYNIPLSNKTTLVGGPSRTSA---YISSLYYTMSCMSTVGFGNIASNTDNEKIFGVCMMI 471          
BLAST of Voltage gated potassium channel vs. Ensembl Celegans
Match: unc-103 (Potassium voltage-gated channel unc-103 [Source:UniProtKB/Swiss-Prot;Acc:G5EFJ9])

HSP 1 Score: 176.407 bits (446), Expect = 6.367e-48
Identity = 121/275 (44.00%), Postives = 171/275 (62.18%), Query Frame = 1
Query:  697 IPQYKHETPKTPPHIILHYSQFKVIWDWVILLLTYYTAVMVPFNAAF--------SNKSMDAVLFLIVDSIVDVIFFLDIVLNFHTTFVGSTGE---VISDAFIIRINYLKGWFIIDLMSCLPYDVFNAFQPGSQEGISQXXXXXXXXXXXXXXXXXXXXDQYLEYMATXXXXXXXXXXXXAHWFACIWYTVGNTDLRNNKQYGWIPKMLQDCHQ--TVANWT--TFDPNKEHKLLNYATSLYFTMSLLTSIGFGNVSANTELEKFACVIFMLFG 1476
            +P+YK +  +     I+HYS FK +WDW+ILLL  YTAV  P+ AAF        + KS       IVD IVD++F +DI++NF TT+V    E   V+SD   I  +Y KGWFIID+++ +P+D+       + +  + L+G LK  RLLRL RV RKLD+Y EY A +L+L++  F L+AHW ACIWY +G+ +L ++K+Y W+ ++ +   Q  T  N T  T  P  + +   Y TSLYFT+S +TSIGFGNVSA T+ EK   +I M+ G
Sbjct:   58 LPEYKLQPTRIHHCTIVHYSPFKAVWDWIILLLVIYTAVFTPYVAAFLLRELQDTAKKSRFTEPLEIVDLIVDIMFIVDIIINFRTTYVNENDEACQVVSDPGKIATHYFKGWFIIDMVAAVPFDLL--LVSTNSDETTTLIGLLKTARLLRLVRVARKLDRYSEYGAAVLLLLMATFALIAHWLACIWYAIGSAEL-SHKEYTWLHQLSKQLAQPYTSTNGTIPTGGPTLKSR---YVTSLYFTLSTITSIGFGNVSATTDSEKIFTIIMMILG 326          
BLAST of Voltage gated potassium channel vs. Ensembl Celegans
Match: unc-103 (Potassium voltage-gated channel unc-103 [Source:UniProtKB/Swiss-Prot;Acc:G5EFJ9])

HSP 1 Score: 176.407 bits (446), Expect = 1.027e-47
Identity = 121/275 (44.00%), Postives = 171/275 (62.18%), Query Frame = 1
Query:  697 IPQYKHETPKTPPHIILHYSQFKVIWDWVILLLTYYTAVMVPFNAAF--------SNKSMDAVLFLIVDSIVDVIFFLDIVLNFHTTFVGSTGE---VISDAFIIRINYLKGWFIIDLMSCLPYDVFNAFQPGSQEGISQXXXXXXXXXXXXXXXXXXXXDQYLEYMATXXXXXXXXXXXXAHWFACIWYTVGNTDLRNNKQYGWIPKMLQDCHQ--TVANWT--TFDPNKEHKLLNYATSLYFTMSLLTSIGFGNVSANTELEKFACVIFMLFG 1476
            +P+YK +  +     I+HYS FK +WDW+ILLL  YTAV  P+ AAF        + KS       IVD IVD++F +DI++NF TT+V    E   V+SD   I  +Y KGWFIID+++ +P+D+       + +  + L+G LK  RLLRL RV RKLD+Y EY A +L+L++  F L+AHW ACIWY +G+ +L ++K+Y W+ ++ +   Q  T  N T  T  P  + +   Y TSLYFT+S +TSIGFGNVSA T+ EK   +I M+ G
Sbjct:   58 LPEYKLQPTRIHHCTIVHYSPFKAVWDWIILLLVIYTAVFTPYVAAFLLRELQDTAKKSRFTEPLEIVDLIVDIMFIVDIIINFRTTYVNENDEACQVVSDPGKIATHYFKGWFIIDMVAAVPFDLL--LVSTNSDETTTLIGLLKTARLLRLVRVARKLDRYSEYGAAVLLLLMATFALIAHWLACIWYAIGSAEL-SHKEYTWLHQLSKQLAQPYTSTNGTIPTGGPTLKSR---YVTSLYFTLSTITSIGFGNVSATTDSEKIFTIIMMILG 326          
BLAST of Voltage gated potassium channel vs. Ensembl Fly
Match: eag (gene:FBgn0000535 transcript:FBtr0310014)

HSP 1 Score: 442.195 bits (1136), Expect = 1.091e-150
Identity = 256/469 (54.58%), Postives = 330/469 (70.36%), Query Frame = 1
Query:  103 MSGSRRGLVAPQNTLLDTIIRRCNSQ-HSSFILANAKIVDHPIIYVNEAFSKLTGFARNEVMQKSSQ--CTFLHGEETNKDLLDQWFSALNNYEQIQLELLVFKKNLSPLWIVLQIHPITNEKLEVXXXXXTFYDITAIKHPSDDEAEIKPGLSKFAKLAKSVARNRSIMIDLTQDFQENNKESSKVETSPINNIFMHSKNIPQYKHETPKTPPHIILHYSQFKVIWDWVILLLTYYTAVMVPFNAAFSNKSMDAVLFLIVDSIVDVIFFLDIVLNFHTTFVGSTGEVISDAFIIRINYLKGWFIIDLMSCLPYDVFNAFQPGSQEGISQXXXXXXXXXXXXXXXXXXXXDQYLEYMATXXXXXXXXXXXXAHWFACIWYTVGNTDLRNNKQYGWIPKMLQDCHQTVANWTTFDPNKEHKLLN-------YATSLYFTMSLLTSIGFGNVSANTELEKFACVIFMLFGG 1479
            M G RRGLVAPQNT L+ IIRR NSQ  SSF+LANA+IVD PI+Y NE+F K++G+ R EVMQKS +  C F++GE T+K+ + +    L N +Q Q E+L++KKN +PLW++LQ+ PI NE+  V+L LLTF DITA+K P D E + K GLSKFAKLA+SV R+R     L    ++  K+S+      ++   M     PQY+ E PKTPPHI+LHY  FK IWDWVIL LT+YTA+MVP+N AF NK+ + V  L+VDSIVDVIFF+DIVLNFHTTFVG  GEV+SD  +IR+NYLK WFIIDL+SCLPYDVFNAF    ++GI  L  ALKVVRLLRLGRV+RKLD+YLEY A ML+L++  ++L+AHW ACIWY++G +D  N  QY W+ K+        +   + D   E  L+N       Y T+LYFTM+ +TS+GFGNV+A T+ EK   +  M+   
Sbjct:    1 MPGGRRGLVAPQNTFLENIIRRSNSQPDSSFLLANAQIVDFPIVYCNESFCKISGYNRAEVMQKSCRYVCGFMYGELTDKETVGRLEYTLENQQQDQFEILLYKKNKTPLWLLLQVAPIRNERDLVVLFLLTFRDITALKQPIDSE-DTKGGLSKFAKLARSVTRSRQFSAHLPT-LKDPTKQSNLAHMMSLSADIM-----PQYRQEAPKTPPHILLHYCAFKAIWDWVILCLTFYTAIMVPYNVAFKNKTSEDVSLLVVDSIVDVIFFIDIVLNFHTTFVGPGGEVVSDPKVIRMNYLKSWFIIDLLSCLPYDVFNAFD-RDEDGIGSLFSALKVVRLLRLGRVVRKLDRYLEYGAAMLILLLCFYMLVAHWLACIWYSIGRSDADNGIQYSWLWKLANVTQSPYSYIWSNDTGPE--LVNGPSRKSMYVTALYFTMTCMTSVGFGNVAAETDNEKVFTICMMIIAA 459          
BLAST of Voltage gated potassium channel vs. Ensembl Fly
Match: eag (gene:FBgn0000535 transcript:FBtr0303285)

HSP 1 Score: 437.573 bits (1124), Expect = 7.769e-149
Identity = 255/470 (54.26%), Postives = 329/470 (70.00%), Query Frame = 1
Query:  103 MSGSRRGLVAPQNTLLDTIIRRCNSQ-HSSFILANAKIVDHPIIYVNEAFSKLTGFARNEVMQKSSQ--CTFLHGEETNKDLLDQWFSALNNYEQIQLELLVFKKNLSPLWIVLQIHPITNEKLEVXXXXXTFYDITAIKHPSDDE-AEIKPGLSKFAKLAKSVARNRSIMIDLTQDFQENNKESSKVETSPINNIFMHSKNIPQYKHETPKTPPHIILHYSQFKVIWDWVILLLTYYTAVMVPFNAAFSNKSMDAVLFLIVDSIVDVIFFLDIVLNFHTTFVGSTGEVISDAFIIRINYLKGWFIIDLMSCLPYDVFNAFQPGSQEGISQXXXXXXXXXXXXXXXXXXXXDQYLEYMATXXXXXXXXXXXXAHWFACIWYTVGNTDLRNNKQYGWIPKMLQDCHQTVANWTTFDPNKEHKLLN-------YATSLYFTMSLLTSIGFGNVSANTELEKFACVIFMLFGG 1479
            M G RRGLVAPQNT L+ IIRR NSQ  SSF+LANA+IVD PI+Y NE+F K++G+ R EVMQKS +  C F++GE T+K+ + +    L N +Q Q E+L++KKN +PLW++LQ+ PI NE+  V+L LLTF DITA+K P D E  +   GLSKFAKLA+SV R+R     L    ++  K+S+      ++   M     PQY+ E PKTPPHI+LHY  FK IWDWVIL LT+YTA+MVP+N AF NK+ + V  L+VDSIVDVIFF+DIVLNFHTTFVG  GEV+SD  +IR+NYLK WFIIDL+SCLPYDVFNAF    ++GI  L  ALKVVRLLRLGRV+RKLD+YLEY A ML+L++  ++L+AHW ACIWY++G +D  N  QY W+ K+        +   + D   E  L+N       Y T+LYFTM+ +TS+GFGNV+A T+ EK   +  M+   
Sbjct:    1 MPGGRRGLVAPQNTFLENIIRRSNSQPDSSFLLANAQIVDFPIVYCNESFCKISGYNRAEVMQKSCRYVCGFMYGELTDKETVGRLEYTLENQQQDQFEILLYKKNKTPLWLLLQVAPIRNERDLVVLFLLTFRDITALKQPIDSEDTKGVLGLSKFAKLARSVTRSRQFSAHLPT-LKDPTKQSNLAHMMSLSADIM-----PQYRQEAPKTPPHILLHYCAFKAIWDWVILCLTFYTAIMVPYNVAFKNKTSEDVSLLVVDSIVDVIFFIDIVLNFHTTFVGPGGEVVSDPKVIRMNYLKSWFIIDLLSCLPYDVFNAFD-RDEDGIGSLFSALKVVRLLRLGRVVRKLDRYLEYGAAMLILLLCFYMLVAHWLACIWYSIGRSDADNGIQYSWLWKLANVTQSPYSYIWSNDTGPE--LVNGPSRKSMYVTALYFTMTCMTSVGFGNVAAETDNEKVFTICMMIIAA 461          
BLAST of Voltage gated potassium channel vs. Ensembl Fly
Match: eag (gene:FBgn0000535 transcript:FBtr0310015)

HSP 1 Score: 435.261 bits (1118), Expect = 7.819e-148
Identity = 255/477 (53.46%), Postives = 328/477 (68.76%), Query Frame = 1
Query:  103 MSGSRRGLVAPQNTLLDTIIRRCNSQ-HSSFILANAKIVDHPIIYVNEAFSKLTGFARNEVMQKSSQ--CTFLHGEETNKDLLDQWFSALNNYEQIQLELLVFKKNLSPLWIVLQIHPITNEKLEVXXXXXTFYDITAIKHPSDDEAEIKP--------GLSKFAKLAKSVARNRSIMIDLTQDFQENNKESSKVETSPINNIFMHSKNIPQYKHETPKTPPHIILHYSQFKVIWDWVILLLTYYTAVMVPFNAAFSNKSMDAVLFLIVDSIVDVIFFLDIVLNFHTTFVGSTGEVISDAFIIRINYLKGWFIIDLMSCLPYDVFNAFQPGSQEGISQXXXXXXXXXXXXXXXXXXXXDQYLEYMATXXXXXXXXXXXXAHWFACIWYTVGNTDLRNNKQYGWIPKMLQDCHQTVANWTTFDPNKEHKLLN-------YATSLYFTMSLLTSIGFGNVSANTELEKFACVIFMLFGG 1479
            M G RRGLVAPQNT L+ IIRR NSQ  SSF+LANA+IVD PI+Y NE+F K++G+ R EVMQKS +  C F++GE T+K+ + +    L N +Q Q E+L++KKN +PLW++LQ+ PI NE+  V+L LLTF DITA+K P D E             GLSKFAKLA+SV R+R     L    ++  K+S+      ++   M     PQY+ E PKTPPHI+LHY  FK IWDWVIL LT+YTA+MVP+N AF NK+ + V  L+VDSIVDVIFF+DIVLNFHTTFVG  GEV+SD  +IR+NYLK WFIIDL+SCLPYDVFNAF    ++GI  L  ALKVVRLLRLGRV+RKLD+YLEY A ML+L++  ++L+AHW ACIWY++G +D  N  QY W+ K+        +   + D   E  L+N       Y T+LYFTM+ +TS+GFGNV+A T+ EK   +  M+   
Sbjct:    1 MPGGRRGLVAPQNTFLENIIRRSNSQPDSSFLLANAQIVDFPIVYCNESFCKISGYNRAEVMQKSCRYVCGFMYGELTDKETVGRLEYTLENQQQDQFEILLYKKNKTPLWLLLQVAPIRNERDLVVLFLLTFRDITALKQPIDSEDTKGAVNLFLPVLGLSKFAKLARSVTRSRQFSAHLPT-LKDPTKQSNLAHMMSLSADIM-----PQYRQEAPKTPPHILLHYCAFKAIWDWVILCLTFYTAIMVPYNVAFKNKTSEDVSLLVVDSIVDVIFFIDIVLNFHTTFVGPGGEVVSDPKVIRMNYLKSWFIIDLLSCLPYDVFNAFD-RDEDGIGSLFSALKVVRLLRLGRVVRKLDRYLEYGAAMLILLLCFYMLVAHWLACIWYSIGRSDADNGIQYSWLWKLANVTQSPYSYIWSNDTGPE--LVNGPSRKSMYVTALYFTMTCMTSVGFGNVAAETDNEKVFTICMMIIAA 468          
BLAST of Voltage gated potassium channel vs. Ensembl Fly
Match: eag (gene:FBgn0000535 transcript:FBtr0310016)

HSP 1 Score: 439.884 bits (1130), Expect = 8.586e-142
Identity = 256/471 (54.35%), Postives = 330/471 (70.06%), Query Frame = 1
Query:  103 MSGSRRGLVAPQNTLLDTIIRRCNSQ-HSSFILANAKIVDHPIIYVNEAFSKLTGFARNEVMQKSSQ--CTFLHGEETNKDLLDQWFSALNNYEQIQLELLVFKKNLSPLWIVLQIHPITNEKLEVXXXXXTFYDITAIKHPSDDEAEIKP--GLSKFAKLAKSVARNRSIMIDLTQDFQENNKESSKVETSPINNIFMHSKNIPQYKHETPKTPPHIILHYSQFKVIWDWVILLLTYYTAVMVPFNAAFSNKSMDAVLFLIVDSIVDVIFFLDIVLNFHTTFVGSTGEVISDAFIIRINYLKGWFIIDLMSCLPYDVFNAFQPGSQEGISQXXXXXXXXXXXXXXXXXXXXDQYLEYMATXXXXXXXXXXXXAHWFACIWYTVGNTDLRNNKQYGWIPKMLQDCHQTVANWTTFDPNKEHKLLN-------YATSLYFTMSLLTSIGFGNVSANTELEKFACVIFMLFGG 1479
            M G RRGLVAPQNT L+ IIRR NSQ  SSF+LANA+IVD PI+Y NE+F K++G+ R EVMQKS +  C F++GE T+K+ + +    L N +Q Q E+L++KKN +PLW++LQ+ PI NE+  V+L LLTF DITA+K P D E + K   GLSKFAKLA+SV R+R     L    ++  K+S+      ++   M     PQY+ E PKTPPHI+LHY  FK IWDWVIL LT+YTA+MVP+N AF NK+ + V  L+VDSIVDVIFF+DIVLNFHTTFVG  GEV+SD  +IR+NYLK WFIIDL+SCLPYDVFNAF    ++GI  L  ALKVVRLLRLGRV+RKLD+YLEY A ML+L++  ++L+AHW ACIWY++G +D  N  QY W+ K+        +   + D   E  L+N       Y T+LYFTM+ +TS+GFGNV+A T+ EK   +  M+   
Sbjct:    1 MPGGRRGLVAPQNTFLENIIRRSNSQPDSSFLLANAQIVDFPIVYCNESFCKISGYNRAEVMQKSCRYVCGFMYGELTDKETVGRLEYTLENQQQDQFEILLYKKNKTPLWLLLQVAPIRNERDLVVLFLLTFRDITALKQPIDSE-DTKGVLGLSKFAKLARSVTRSRQFSAHLPT-LKDPTKQSNLAHMMSLSADIM-----PQYRQEAPKTPPHILLHYCAFKAIWDWVILCLTFYTAIMVPYNVAFKNKTSEDVSLLVVDSIVDVIFFIDIVLNFHTTFVGPGGEVVSDPKVIRMNYLKSWFIIDLLSCLPYDVFNAFD-RDEDGIGSLFSALKVVRLLRLGRVVRKLDRYLEYGAAMLILLLCFYMLVAHWLACIWYSIGRSDADNGIQYSWLWKLANVTQSPYSYIWSNDTGPE--LVNGPSRKSMYVTALYFTMTCMTSVGFGNVAAETDNEKVFTICMMIIAA 461          
BLAST of Voltage gated potassium channel vs. Ensembl Fly
Match: eag (gene:FBgn0000535 transcript:FBtr0303286)

HSP 1 Score: 434.106 bits (1115), Expect = 2.061e-139
Identity = 256/486 (52.67%), Postives = 330/486 (67.90%), Query Frame = 1
Query:  103 MSGSRRGLVAPQNTLLDTIIRRCNSQ-HSSFILANAKIVDHPIIYVNEAFSKLTGFARNEVMQKSSQCTFLHGEETNKDLLDQWFSALNNYEQIQLELLVFKKN-----------------LSPLWIVLQIHPITNEKLEVXXXXXTFYDITAIKHPSDDEAEIKP--GLSKFAKLAKSVARNRSIMIDLTQDFQENNKESSKVETSPINNIFMHSKNIPQYKHETPKTPPHIILHYSQFKVIWDWVILLLTYYTAVMVPFNAAFSNKSMDAVLFLIVDSIVDVIFFLDIVLNFHTTFVGSTGEVISDAFIIRINYLKGWFIIDLMSCLPYDVFNAFQPGSQEGISQXXXXXXXXXXXXXXXXXXXXDQYLEYMATXXXXXXXXXXXXAHWFACIWYTVGNTDLRNNKQYGWIPKMLQDCHQTVANWTTFDPNKEHKLLN-------YATSLYFTMSLLTSIGFGNVSANTELEKFACVIFMLFGG 1479
            M G RRGLVAPQNT L+ IIRR NSQ  SSF+LANA+IVD PI+Y NE+F K++G+ R EVMQKS +C F++GE T+K+ + +    L N +Q Q E+L++KKN                  +PLW++LQ+ PI NE+  V+L LLTF DITA+K P D E + K   GLSKFAKLA+SV R+R     L    ++  K+S+      ++   M     PQY+ E PKTPPHI+LHY  FK IWDWVIL LT+YTA+MVP+N AF NK+ + V  L+VDSIVDVIFF+DIVLNFHTTFVG  GEV+SD  +IR+NYLK WFIIDL+SCLPYDVFNAF    ++GI  L  ALKVVRLLRLGRV+RKLD+YLEY A ML+L++  ++L+AHW ACIWY++G +D  N  QY W+ K+        +   + D   E  L+N       Y T+LYFTM+ +TS+GFGNV+A T+ EK   +  M+   
Sbjct:    1 MPGGRRGLVAPQNTFLENIIRRSNSQPDSSFLLANAQIVDFPIVYCNESFCKISGYNRAEVMQKSCRCGFMYGELTDKETVGRLEYTLENQQQDQFEILLYKKNNLQCGCALSQFGKAQTQETPLWLLLQVAPIRNERDLVVLFLLTFRDITALKQPIDSE-DTKGVLGLSKFAKLARSVTRSRQFSAHLPT-LKDPTKQSNLAHMMSLSADIM-----PQYRQEAPKTPPHILLHYCAFKAIWDWVILCLTFYTAIMVPYNVAFKNKTSEDVSLLVVDSIVDVIFFIDIVLNFHTTFVGPGGEVVSDPKVIRMNYLKSWFIIDLLSCLPYDVFNAFD-RDEDGIGSLFSALKVVRLLRLGRVVRKLDRYLEYGAAMLILLLCFYMLVAHWLACIWYSIGRSDADNGIQYSWLWKLANVTQSPYSYIWSNDTGPE--LVNGPSRKSMYVTALYFTMTCMTSVGFGNVAAETDNEKVFTICMMIIAA 476          
BLAST of Voltage gated potassium channel vs. Ensembl Zebrafish
Match: kcnh1a (potassium voltage-gated channel, subfamily H (eag-related), member 1a [Source:ZFIN;Acc:ZDB-GENE-061226-1])

HSP 1 Score: 400.979 bits (1029), Expect = 1.724e-129
Identity = 243/469 (51.81%), Postives = 319/469 (68.02%), Query Frame = 1
Query:  103 MSGSRRGLVAPQNTLLDTIIRRCNSQHSSFILANAKIVDHPIIYVNEAFSKLTGFARNEVMQKSSQCTFLHGEETNKDLLDQWFSALNNYEQIQLELLVFKKNLSPLWIVLQIHPITNEKLEVXXXXXTFYDITAIKHPSDDEAEIKPGLSKFAKLAKSVARNRSIMIDL--TQDFQENNKESSKVETSPINNIFMHSKNIPQYKHETPKTPPHIILHYSQFKVIWDWVILLLTYYTAVMVPFNAAFSNKSMDAVLFLIVDSIVDVIFFLDIVLNFHTTFVGSTGEVISDAFIIRINYLKGWFIIDLMSCLPYDVFNAFQPGSQEGISQXXXXXXXXXXXXXXXXXXXXDQYLEYMATXXXXXXXXXXXXAHWFACIWYTVGNTDL----RNN-KQYGWIPKMLQDCHQTV----ANWTTFDPNKEHKLLNYATSLYFTMSLLTSIGFGNVSANTELEKFACVIFMLFG 1476
            M+G RRGLVAPQNT L+ I+RR N   ++F+L NA+IVD PI+Y N+ F KL+G+ R EVMQKSS C+F++GE T+KD  ++      NYE    E+L++KKN +P+W  ++I PI NE+ +V+L L TF DITA K P +D++    G  KFA+L +++  +R ++  L  T    EN  + S++       + + S  +PQYK ETPKTPPHIILHY  FK  WDWVIL+LT+YTA+MVP+N +F  K  + V +L+VDSIVDVIF +DIVLNFHTTFVG  GEVISD  +IR+NYLK WF+IDL+SCLPYDV NAF+    EGIS L  +LKVVRLLRLGRV RKLD Y+EY A +LVL++ VF L AHW ACIWY++G+ ++    RN  +   W+  ML +   T     A+ T        K   Y TSLYFTM+ LTSIGFGN++  T+ EK   V  M+ G
Sbjct:    1 MAGGRRGLVAPQNTFLENIVRRSND--TNFVLGNAQIVDWPIVYSNDGFCKLSGYHRAEVMQKSSTCSFMYGELTDKDTSEKVRLTFENYEMNSFEILMYKKNRTPVWFFVKIAPIRNEQEKVVLFLCTFSDITAFKQPIEDDSS--KGWGKFARLTRALTSSRGVLQQLQPTVHKGENVHKHSRLAEV----LQLGSDILPQYKQETPKTPPHIILHYCAFKTTWDWVILILTFYTAIMVPYNVSFKTK-QNNVTWLVVDSIVDVIFLVDIVLNFHTTFVGPAGEVISDPKLIRMNYLKTWFVIDLLSCLPYDVINAFE-NVDEGISSLFSSLKVVRLLRLGRVARKLDHYIEYGAAVLVLLVCVFGLAAHWLACIWYSIGDYEVIDEDRNTVRTDSWL-YMLAESIGTPYRFNASGTGRWEGGPTKDTVYITSLYFTMTSLTSIGFGNIAPTTDGEKIFAVAMMMIG 458          
BLAST of Voltage gated potassium channel vs. Ensembl Zebrafish
Match: kcnh5b (potassium voltage-gated channel, subfamily H (eag-related), member 5b [Source:ZFIN;Acc:ZDB-GENE-090319-1])

HSP 1 Score: 392.119 bits (1006), Expect = 3.486e-129
Identity = 231/466 (49.57%), Postives = 317/466 (68.03%), Query Frame = 1
Query:  103 MSGSRRGLVAPQNTLLDTIIRRCNSQHSSFILANAKIVDHPIIYVNEAFSKLTGFARNEVMQKSSQCTFLHGEETNKDLLDQWFSALNNYEQIQLELLVFKKNLSPLWIVLQIHPITNEKLEVXXXXXTFYDITAIKHPSDDEAEIKPGLSKFAKLAKSVARNRSIMIDLTQDFQENNKESSKVETSPINNIFMHSKNIPQYKHETPKTPPHIILHYSQFKVIWDWVILLLTYYTAVMVPFNAAFSNKSMDAVLFLIVDSIVDVIFFLDIVLNFHTTFVGSTGEVISDAFIIRINYLKGWFIIDLMSCLPYDVFNAFQPGSQEGISQXXXXXXXXXXXXXXXXXXXXDQYLEYMATXXXXXXXXXXXXAHWFACIWYTVGNTDLRNN-----KQYGWIPKM---LQDCHQTVANWTTFDPNKEHKLLNYATSLYFTMSLLTSIGFGNVSANTELEKFACVIFMLFG 1476
            M G +RGLVAPQNT L+ I+RR  S  +SF+L NA+IVD P++Y N+ F KL+G+ R EVMQKSS C+F++GE T+K  +D+   A +NYE    E+L+++KN +P+W  +QI PI NE  +V+L L TF DIT  K P +DE+    G +KFA+L +++  ++S +  +T   + +         + +  + + S  +PQYK E PKTPPHIILHY  FK  WDWVIL+LT+YTA+MVP+N +F  K  + V +L++DS+VDVIF +DIVLNFHTTFVG  GEVISD  +IR+NYLK WF+IDL+SCLPYD+ NAF+    EGIS L  +LKVVRLLRLGRV RKLD YLEY A +LVL++ VF L+AHW ACIWY++G+ ++ +      K   W+ ++   +   ++  A+ T        K   Y TSLYFTM+ LT+IGFGN++  T+ EK   V  M+ G
Sbjct:    1 MPGGKRGLVAPQNTFLENIVRR--SSETSFLLGNAQIVDWPVVYSNDGFCKLSGYHRAEVMQKSSTCSFMYGELTDKKTIDKVRQAFDNYESNCFEVLLYRKNRTPVWFYMQIAPIRNENDKVVLFLCTFKDITVFKQPIEDES--TRGWTKFARLTRALTNSKSTIQQITPVSRTDVTSHKPSRLAEV--LQLGSDILPQYKQEAPKTPPHIILHYCTFKTTWDWVILILTFYTAIMVPYNVSFKTKQ-NNVTWLVLDSVVDVIFLVDIVLNFHTTFVGPGGEVISDPNLIRMNYLKTWFVIDLLSCLPYDIINAFE-NVDEGISSLFSSLKVVRLLRLGRVARKLDHYLEYGAAVLVLLVCVFGLVAHWLACIWYSIGDYEVIDEQTNTIKTDSWLFQLATSIGSPYRYNASGTGQWEGGPGKDSLYITSLYFTMTSLTTIGFGNIAPTTDGEKIFSVAMMMVG 458          
BLAST of Voltage gated potassium channel vs. Ensembl Zebrafish
Match: kcnh1b (potassium voltage-gated channel, subfamily H (eag-related), member 1b [Source:ZFIN;Acc:ZDB-GENE-121128-4])

HSP 1 Score: 396.741 bits (1018), Expect = 8.901e-128
Identity = 236/473 (49.89%), Postives = 313/473 (66.17%), Query Frame = 1
Query:  103 MSGSRRGLVAPQNTLLDTIIRRCNSQHSSFILANAKIVDHPIIYVNEAFSKLTGFARNEVMQKSSQCTFLHGEETNKDLLDQWFSALNNYEQIQLELLVFKKNLSPLWIVLQIHPITNEKLEVXXXXXTFYDITAIKHPSDDEAEIKPGLSKFAKLAKSVARNRSIMIDLTQDFQENN---KESSKVETSPINNIFMHSKNIPQYKHETPKTPPHIILHYSQFKVIWDWVILLLTYYTAVMVPFNAAFSNKSMDAVLFLIVDSIVDVIFFLDIVLNFHTTFVGSTGEVISDAFIIRINYLKGWFIIDLMSCLPYDVFNAFQPGSQEGISQXXXXXXXXXXXXXXXXXXXXDQYLEYMATXXXXXXXXXXXXAHWFACIWYTVGNTDLRNN-----KQYGWIPKMLQDCHQ-------TVANWTTFDPNKEHKLLNYATSLYFTMSLLTSIGFGNVSANTELEKFACVIFMLFG 1476
            M+G RRGLVAPQNT L+ I+RR N   ++F+L NA+IVD PI+Y N+ F KL+G+ R EVMQKSS C+F++GE ++K+  ++      NYE    ELL++KKN  P+W  ++I PI NE+ +V+L L TF DITA K P +D++    G  KFA+L +++  +R ++  L    Q      K S   E      + + S  +PQYK E PKTPPHIILHY  FK  WDWVIL+LT+YTA+MVP+N +F  K  + V +L+VDSIVDVIF +DIVLNFHTTFVG  GEVISD  +IR+NY+K WF+IDL+SCLPYDV NAF+    EGIS L  +LKVVRLLRLGRV RKLD Y+EY A +LVL++ VF L AHW ACIWY++G+ ++ +      +   W+  + +   Q           W    P+K+     Y TSLYFTM+ LTSIGFGN++  T+ EK   V  M+ G
Sbjct:    1 MAGGRRGLVAPQNTFLENIVRRSND--TNFVLGNAQIVDWPIVYSNDGFCKLSGYHRAEVMQKSSTCSFMYGELSDKETSEKLRQTFENYEMNSFELLMYKKNRMPVWFFVKIAPIRNEQDKVVLFLCTFSDITAFKQPIEDDS--SKGWGKFARLTRALTSSRGVLQQLAPTVQRGENVLKHSRLAEV-----LQLGSDILPQYKQEAPKTPPHIILHYCTFKTTWDWVILILTFYTAIMVPYNVSFKTK-QNNVTWLVVDSIVDVIFLVDIVLNFHTTFVGPAGEVISDPKLIRMNYVKTWFVIDLLSCLPYDVINAFE-NVDEGISSLFSSLKVVRLLRLGRVARKLDHYIEYGAAVLVLLVCVFGLAAHWLACIWYSIGDYEVIDQDANMVRTDSWLYLLGEAVGQPYHFNASGSGKWEG-GPSKDSV---YITSLYFTMTSLTSIGFGNIAPTTDGEKIFAVAMMMIG 458          
BLAST of Voltage gated potassium channel vs. Ensembl Zebrafish
Match: kcnh5b (potassium voltage-gated channel, subfamily H (eag-related), member 5b [Source:ZFIN;Acc:ZDB-GENE-090319-1])

HSP 1 Score: 392.504 bits (1007), Expect = 3.510e-126
Identity = 234/469 (49.89%), Postives = 319/469 (68.02%), Query Frame = 1
Query:  103 MSGSRRGLVAPQNTLLDTIIRRCNSQHSSFILANAKIVDHPIIYVNEAFSKLTGFARNEVMQKSSQCTFLHGEETNKDLLDQWFSALNNYEQIQLELLVFKKNLSPLWIVLQIHPITNEKLEVXXXXXTFYDITAIKHPSDDEAEIKPGLSKFAKLAKSVARNRSIMIDLTQDFQEN---NKESSKVETSPINNIFMHSKNIPQYKHETPKTPPHIILHYSQFKVIWDWVILLLTYYTAVMVPFNAAFSNKSMDAVLFLIVDSIVDVIFFLDIVLNFHTTFVGSTGEVISDAFIIRINYLKGWFIIDLMSCLPYDVFNAFQPGSQEGISQXXXXXXXXXXXXXXXXXXXXDQYLEYMATXXXXXXXXXXXXAHWFACIWYTVGNTDLRNN-----KQYGWIPKM---LQDCHQTVANWTTFDPNKEHKLLNYATSLYFTMSLLTSIGFGNVSANTELEKFACVIFMLFG 1476
            M G +RGLVAPQNT L+ I+RR  S  +SF+L NA+IVD P++Y N+ F KL+G+ R EVMQKSS C+F++GE T+K  +D+   A +NYE    E+L+++KN +P+W  +QI PI NE  +V+L L TF DIT  K P +DE+    G +KFA+L +++  ++S +  +T   + +   +K S   E      + + S  +PQYK E PKTPPHIILHY  FK  WDWVIL+LT+YTA+MVP+N +F  K  + V +L++DS+VDVIF +DIVLNFHTTFVG  GEVISD  +IR+NYLK WF+IDL+SCLPYD+ NAF+    EGIS L  +LKVVRLLRLGRV RKLD YLEY A +LVL++ VF L+AHW ACIWY++G+ ++ +      K   W+ ++   +   ++  A+ T        K   Y TSLYFTM+ LT+IGFGN++  T+ EK   V  M+ G
Sbjct:    1 MPGGKRGLVAPQNTFLENIVRR--SSETSFLLGNAQIVDWPVVYSNDGFCKLSGYHRAEVMQKSSTCSFMYGELTDKKTIDKVRQAFDNYESNCFEVLLYRKNRTPVWFYMQIAPIRNENDKVVLFLCTFKDITVFKQPIEDES--TRGWTKFARLTRALTNSKSTIQQITPVSRTDVTSHKPSRLAEV-----LQLGSDILPQYKQEAPKTPPHIILHYCTFKTTWDWVILILTFYTAIMVPYNVSFKTK-QNNVTWLVLDSVVDVIFLVDIVLNFHTTFVGPGGEVISDPNLIRMNYLKTWFVIDLLSCLPYDIINAFE-NVDEGISSLFSSLKVVRLLRLGRVARKLDHYLEYGAAVLVLLVCVFGLVAHWLACIWYSIGDYEVIDEQTNTIKTDSWLFQLATSIGSPYRYNASGTGQWEGGPGKDSLYITSLYFTMTSLTTIGFGNIAPTTDGEKIFSVAMMMVG 458          
BLAST of Voltage gated potassium channel vs. Ensembl Zebrafish
Match: kcnh5b (potassium voltage-gated channel, subfamily H (eag-related), member 5b [Source:ZFIN;Acc:ZDB-GENE-090319-1])

HSP 1 Score: 392.504 bits (1007), Expect = 5.770e-126
Identity = 234/469 (49.89%), Postives = 319/469 (68.02%), Query Frame = 1
Query:  103 MSGSRRGLVAPQNTLLDTIIRRCNSQHSSFILANAKIVDHPIIYVNEAFSKLTGFARNEVMQKSSQCTFLHGEETNKDLLDQWFSALNNYEQIQLELLVFKKNLSPLWIVLQIHPITNEKLEVXXXXXTFYDITAIKHPSDDEAEIKPGLSKFAKLAKSVARNRSIMIDLTQDFQEN---NKESSKVETSPINNIFMHSKNIPQYKHETPKTPPHIILHYSQFKVIWDWVILLLTYYTAVMVPFNAAFSNKSMDAVLFLIVDSIVDVIFFLDIVLNFHTTFVGSTGEVISDAFIIRINYLKGWFIIDLMSCLPYDVFNAFQPGSQEGISQXXXXXXXXXXXXXXXXXXXXDQYLEYMATXXXXXXXXXXXXAHWFACIWYTVGNTDLRNN-----KQYGWIPKM---LQDCHQTVANWTTFDPNKEHKLLNYATSLYFTMSLLTSIGFGNVSANTELEKFACVIFMLFG 1476
            M G +RGLVAPQNT L+ I+RR  S  +SF+L NA+IVD P++Y N+ F KL+G+ R EVMQKSS C+F++GE T+K  +D+   A +NYE    E+L+++KN +P+W  +QI PI NE  +V+L L TF DIT  K P +DE+    G +KFA+L +++  ++S +  +T   + +   +K S   E      + + S  +PQYK E PKTPPHIILHY  FK  WDWVIL+LT+YTA+MVP+N +F  K  + V +L++DS+VDVIF +DIVLNFHTTFVG  GEVISD  +IR+NYLK WF+IDL+SCLPYD+ NAF+    EGIS L  +LKVVRLLRLGRV RKLD YLEY A +LVL++ VF L+AHW ACIWY++G+ ++ +      K   W+ ++   +   ++  A+ T        K   Y TSLYFTM+ LT+IGFGN++  T+ EK   V  M+ G
Sbjct:    1 MPGGKRGLVAPQNTFLENIVRR--SSETSFLLGNAQIVDWPVVYSNDGFCKLSGYHRAEVMQKSSTCSFMYGELTDKKTIDKVRQAFDNYESNCFEVLLYRKNRTPVWFYMQIAPIRNENDKVVLFLCTFKDITVFKQPIEDES--TRGWTKFARLTRALTNSKSTIQQITPVSRTDVTSHKPSRLAEV-----LQLGSDILPQYKQEAPKTPPHIILHYCTFKTTWDWVILILTFYTAIMVPYNVSFKTK-QNNVTWLVLDSVVDVIFLVDIVLNFHTTFVGPGGEVISDPNLIRMNYLKTWFVIDLLSCLPYDIINAFE-NVDEGISSLFSSLKVVRLLRLGRVARKLDHYLEYGAAVLVLLVCVFGLVAHWLACIWYSIGDYEVIDEQTNTIKTDSWLFQLATSIGSPYRYNASGTGQWEGGPGKDSLYITSLYFTMTSLTTIGFGNIAPTTDGEKIFSVAMMMVG 458          
BLAST of Voltage gated potassium channel vs. Ensembl Xenopus
Match: tmem50b (transmembrane protein 50B [Source:Xenbase;Acc:XB-GENE-970258])

HSP 1 Score: 389.423 bits (999), Expect = 1.546e-124
Identity = 228/466 (48.93%), Postives = 316/466 (67.81%), Query Frame = 1
Query:  103 MSGSRRGLVAPQNTLLDTIIRRCNSQHSSFILANAKIVDHPIIYVNEAFSKLTGFARNEVMQKSSQCTFLHGEETNKDLLDQWFSALNNYEQIQLELLVFKKNLSPLWIVLQIHPITNEKLEVXXXXXTFYDITAIKHPSDDEAEIKPGLSKFAKLAKSVARNRSIMIDLTQDFQENNKESSKVETSPINNIFMHSKNIPQYKHETPKTPPHIILHYSQFKVIWDWVILLLTYYTAVMVPFNAAFSNKSMDAVLFLIVDSIVDVIFFLDIVLNFHTTFVGSTGEVISDAFIIRINYLKGWFIIDLMSCLPYDVFNAFQPGSQEGISQXXXXXXXXXXXXXXXXXXXXDQYLEYMATXXXXXXXXXXXXAHWFACIWYTVGNTDLRNN-----KQYGWIPKM---LQDCHQTVANWTTFDPNKEHKLLNYATSLYFTMSLLTSIGFGNVSANTELEKFACVIFMLFG 1476
            M G +RGLVAPQNT L+ I+RR N   SSF+L NA+IVD P++Y N+ F KL+G+ R ++MQKSS C+F++GE T+K  +++      NYE    E+L++KK+ +P+W  +QI PI NE  +V+L L TF DIT  K P +DE+    G +KFA+L +++  +RS++  LT     N  E     +     + + S  +PQYK E PKTPPHIILHY  FK  WDWVIL+LT+YTA+MVP+N +F  K  + + +L++DS+VDVIF +DIVLNFHTTFVG  GEVISD  +IR+NYLK WF+IDL+SCLPYD+ NAF+    EG+S L  +LKVVRLLRLGRV RKLD YLEY A +LVL++ VF L+AHW ACIWY++G+ ++ +      K+  W+ ++   +   ++  A+ +        K   Y +SLYFTM+ LT+IGFGN++  T+ EK   V  M+ G
Sbjct:    4 MPGGKRGLVAPQNTFLENIVRRSN--ESSFLLGNAQIVDWPVVYSNDGFCKLSGYHRADIMQKSSTCSFMYGELTDKKTIEKVRQTFENYESNCFEVLLYKKSRTPVWFYMQIAPIRNEHEKVVLFLCTFKDITLFKQPIEDES--TRGWTKFARLTRALTNSRSVLQQLT---PMNKAEVVHKHSRLAEVLQLGSDILPQYKQEAPKTPPHIILHYCAFKTTWDWVILILTFYTAIMVPYNVSFKTK-QNNIAWLVLDSVVDVIFLVDIVLNFHTTFVGPGGEVISDPKLIRMNYLKTWFVIDLLSCLPYDIINAFE-NVDEGMSSLFSSLKVVRLLRLGRVARKLDHYLEYGAAVLVLLVCVFGLVAHWLACIWYSIGDYEVIDEVTNTIKKDSWLYQLGLSIGTPYRYNASGSGQWEGGPSKDSLYVSSLYFTMTSLTTIGFGNIAPTTDGEKIFSVAMMMVG 460          
BLAST of Voltage gated potassium channel vs. Ensembl Xenopus
Match: ENSXETT00000000694.1 (potassium voltage-gated channel subfamily H member 1 [Source:NCBI gene;Acc:100496157])

HSP 1 Score: 387.882 bits (995), Expect = 4.434e-124
Identity = 231/485 (47.63%), Postives = 316/485 (65.15%), Query Frame = 1
Query:   97 ISMSGSRRGLVAPQNTLLDTIIRRCNSQHSSFILANAKIVDHPIIYVNEAFSKLTGFARNEVMQKSSQCTFLHGEETNKDLLDQWFSALNNYEQIQLELLVFKKNLSPLWIVLQIHPITNEKLEVXXXXXTFYDITAIKHPSDDEAEIKPGLSKFAKLAKSVARNRSIMIDLTQDFQEN---NKESSKVETSPINNIFMHSKNIPQYKHETPKTPPHIILHYSQFKVIWDWVILLLTYYTAVMVPFNAAFSNKSMDAVLFLIVDSIVDVIFFLDIVLNFHTTFVGSTGEVISDAFIIRINYLKGWFIIDLMSCLPYDVFNAFQP------------GSQEGISQXXXXXXXXXXXXXXXXXXXXDQYLEYMATXXXXXXXXXXXXAHWFACIWYTVGNTDLRNN---KQYGWIPKMLQDCH-------QTVANWTTFDPNKEHKLLNYATSLYFTMSLLTSIGFGNVSANTELEKFACVIFMLFG 1476
            ++++G RRGLVAPQNT L+ I+RR N   ++F+L NA+IVD PI+Y N+ F KL+G+ R EVMQKSS C+F++GE T+K+ +D+      NYE    E+L++KKN +P+W  ++I PI NE+ +V+L L TF DITA K P +D++    G  K A+L +++  +R ++  L     +    +K S   E      + + S+ +PQYK E PKTPPHIILHY  FK  WDWVIL+LT+YTA++VP+N +F  K  + V +L+VDSIVDVIF +DIVLNFHTTFVG  GEVISD  +IR+NYLK WF+IDL+SCLPYDV NAF+                 GIS L  +LKVVRLLRLGRV RKLD Y+EY A +LVL++ VF L AHW ACIWY++G  ++ N+   +   W+ ++                 W    P+K+     Y +SLYFTM+ LTS+GFGN++  T+ EK   V  M+ G
Sbjct:    1 MTVAGGRRGLVAPQNTFLENIVRRSND--TNFVLGNAQIVDWPIVYSNDGFCKLSGYHRAEVMQKSSTCSFMYGELTDKETIDKVRQTFENYEMNSFEILMYKKNRTPVWFFVKIAPIRNEQDKVVLFLCTFSDITAFKQPIEDDS--TKGWGKLARLTRALTSSRGVLQQLAPTVHKGENVHKHSRLAEV-----LQLGSEILPQYKQEAPKTPPHIILHYCVFKTTWDWVILILTFYTAILVPYNVSFKTK-QNNVAWLVVDSIVDVIFLVDIVLNFHTTFVGPAGEVISDPKLIRMNYLKTWFVIDLLSCLPYDVINAFENVDEVGDFFSFSISKSRGISSLFSSLKVVRLLRLGRVARKLDHYIEYGAAVLVLLVCVFGLAAHWLACIWYSIGAYEVINDGTIRTESWLFQLGTSIGSPYRFNLSGSGKWEG-GPSKDSV---YISSLYFTMTSLTSVGFGNIAPTTDGEKIFAVAMMMIG 471          
BLAST of Voltage gated potassium channel vs. Ensembl Xenopus
Match: tmem50b (transmembrane protein 50B [Source:Xenbase;Acc:XB-GENE-970258])

HSP 1 Score: 385.956 bits (990), Expect = 1.059e-123
Identity = 226/466 (48.50%), Postives = 315/466 (67.60%), Query Frame = 1
Query:  103 MSGSRRGLVAPQNTLLDTIIRRCNSQHSSFILANAKIVDHPIIYVNEAFSKLTGFARNEVMQKSSQCTFLHGEETNKDLLDQWFSALNNYEQIQLELLVFKKNLSPLWIVLQIHPITNEKLEVXXXXXTFYDITAIKHPSDDEAEIKPGLSKFAKLAKSVARNRSIMIDLTQDFQENNKESSKVETSPINNIFMHSKNIPQYKHETPKTPPHIILHYSQFKVIWDWVILLLTYYTAVMVPFNAAFSNKSMDAVLFLIVDSIVDVIFFLDIVLNFHTTFVGSTGEVISDAFIIRINYLKGWFIIDLMSCLPYDVFNAFQPGSQEGISQXXXXXXXXXXXXXXXXXXXXDQYLEYMATXXXXXXXXXXXXAHWFACIWYTVGNTDLRNN-----KQYGWIPKM---LQDCHQTVANWTTFDPNKEHKLLNYATSLYFTMSLLTSIGFGNVSANTELEKFACVIFMLFG 1476
            M G +RGLVAPQNT L+ I+RR N    +F+L NA+IVD P++Y N+ F KL+G+ R ++MQKSS C+F++GE T+K  +++      NYE    E+L++KK+ +P+W  +QI PI NE  +V+L L TF DIT  K P +DE+    G +KFA+L +++  +RS++  LT     N  E     +     + + S  +PQYK E PKTPPHIILHY  FK  WDWVIL+LT+YTA+MVP+N +F  K  + + +L++DS+VDVIF +DIVLNFHTTFVG  GEVISD  +IR+NYLK WF+IDL+SCLPYD+ NAF+    EG+S L  +LKVVRLLRLGRV RKLD YLEY A +LVL++ VF L+AHW ACIWY++G+ ++ +      K+  W+ ++   +   ++  A+ +        K   Y +SLYFTM+ LT+IGFGN++  T+ EK   V  M+ G
Sbjct:    1 MPGGKRGLVAPQNTFLENIVRRSNG---NFLLGNAQIVDWPVVYSNDGFCKLSGYHRADIMQKSSTCSFMYGELTDKKTIEKVRQTFENYESNCFEVLLYKKSRTPVWFYMQIAPIRNEHEKVVLFLCTFKDITLFKQPIEDES--TRGWTKFARLTRALTNSRSVLQQLT---PMNKAEVVHKHSRLAEVLQLGSDILPQYKQEAPKTPPHIILHYCAFKTTWDWVILILTFYTAIMVPYNVSFKTK-QNNIAWLVLDSVVDVIFLVDIVLNFHTTFVGPGGEVISDPKLIRMNYLKTWFVIDLLSCLPYDIINAFE-NVDEGMSSLFSSLKVVRLLRLGRVARKLDHYLEYGAAVLVLLVCVFGLVAHWLACIWYSIGDYEVIDEVTNTIKKDSWLYQLGLSIGTPYRYNASGSGQWEGGPSKDSLYVSSLYFTMTSLTTIGFGNIAPTTDGEKIFSVAMMMVG 456          
BLAST of Voltage gated potassium channel vs. Ensembl Xenopus
Match: tmem50b (transmembrane protein 50B [Source:Xenbase;Acc:XB-GENE-970258])

HSP 1 Score: 385.571 bits (989), Expect = 1.601e-123
Identity = 226/466 (48.50%), Postives = 315/466 (67.60%), Query Frame = 1
Query:  103 MSGSRRGLVAPQNTLLDTIIRRCNSQHSSFILANAKIVDHPIIYVNEAFSKLTGFARNEVMQKSSQCTFLHGEETNKDLLDQWFSALNNYEQIQLELLVFKKNLSPLWIVLQIHPITNEKLEVXXXXXTFYDITAIKHPSDDEAEIKPGLSKFAKLAKSVARNRSIMIDLTQDFQENNKESSKVETSPINNIFMHSKNIPQYKHETPKTPPHIILHYSQFKVIWDWVILLLTYYTAVMVPFNAAFSNKSMDAVLFLIVDSIVDVIFFLDIVLNFHTTFVGSTGEVISDAFIIRINYLKGWFIIDLMSCLPYDVFNAFQPGSQEGISQXXXXXXXXXXXXXXXXXXXXDQYLEYMATXXXXXXXXXXXXAHWFACIWYTVGNTDLRNN-----KQYGWIPKM---LQDCHQTVANWTTFDPNKEHKLLNYATSLYFTMSLLTSIGFGNVSANTELEKFACVIFMLFG 1476
            M G +RGLVAPQNT L+ I+RR N    +F+L NA+IVD P++Y N+ F KL+G+ R ++MQKSS C+F++GE T+K  +++      NYE    E+L++KK+ +P+W  +QI PI NE  +V+L L TF DIT  K P +DE+    G +KFA+L +++  +RS++  LT     N  E     +     + + S  +PQYK E PKTPPHIILHY  FK  WDWVIL+LT+YTA+MVP+N +F  K  + + +L++DS+VDVIF +DIVLNFHTTFVG  GEVISD  +IR+NYLK WF+IDL+SCLPYD+ NAF+    EG+S L  +LKVVRLLRLGRV RKLD YLEY A +LVL++ VF L+AHW ACIWY++G+ ++ +      K+  W+ ++   +   ++  A+ +        K   Y +SLYFTM+ LT+IGFGN++  T+ EK   V  M+ G
Sbjct:    4 MPGGKRGLVAPQNTFLENIVRRSNG---NFLLGNAQIVDWPVVYSNDGFCKLSGYHRADIMQKSSTCSFMYGELTDKKTIEKVRQTFENYESNCFEVLLYKKSRTPVWFYMQIAPIRNEHEKVVLFLCTFKDITLFKQPIEDES--TRGWTKFARLTRALTNSRSVLQQLT---PMNKAEVVHKHSRLAEVLQLGSDILPQYKQEAPKTPPHIILHYCAFKTTWDWVILILTFYTAIMVPYNVSFKTKQ-NNIAWLVLDSVVDVIFLVDIVLNFHTTFVGPGGEVISDPKLIRMNYLKTWFVIDLLSCLPYDIINAFE-NVDEGMSSLFSSLKVVRLLRLGRVARKLDHYLEYGAAVLVLLVCVFGLVAHWLACIWYSIGDYEVIDEVTNTIKKDSWLYQLGLSIGTPYRYNASGSGQWEGGPSKDSLYVSSLYFTMTSLTTIGFGNIAPTTDGEKIFSVAMMMVG 459          
BLAST of Voltage gated potassium channel vs. Ensembl Xenopus
Match: tmem50b (transmembrane protein 50B [Source:Xenbase;Acc:XB-GENE-970258])

HSP 1 Score: 385.956 bits (990), Expect = 2.240e-123
Identity = 226/466 (48.50%), Postives = 315/466 (67.60%), Query Frame = 1
Query:  103 MSGSRRGLVAPQNTLLDTIIRRCNSQHSSFILANAKIVDHPIIYVNEAFSKLTGFARNEVMQKSSQCTFLHGEETNKDLLDQWFSALNNYEQIQLELLVFKKNLSPLWIVLQIHPITNEKLEVXXXXXTFYDITAIKHPSDDEAEIKPGLSKFAKLAKSVARNRSIMIDLTQDFQENNKESSKVETSPINNIFMHSKNIPQYKHETPKTPPHIILHYSQFKVIWDWVILLLTYYTAVMVPFNAAFSNKSMDAVLFLIVDSIVDVIFFLDIVLNFHTTFVGSTGEVISDAFIIRINYLKGWFIIDLMSCLPYDVFNAFQPGSQEGISQXXXXXXXXXXXXXXXXXXXXDQYLEYMATXXXXXXXXXXXXAHWFACIWYTVGNTDLRNN-----KQYGWIPKM---LQDCHQTVANWTTFDPNKEHKLLNYATSLYFTMSLLTSIGFGNVSANTELEKFACVIFMLFG 1476
            M G +RGLVAPQNT L+ I+RR N    +F+L NA+IVD P++Y N+ F KL+G+ R ++MQKSS C+F++GE T+K  +++      NYE    E+L++KK+ +P+W  +QI PI NE  +V+L L TF DIT  K P +DE+    G +KFA+L +++  +RS++  LT     N  E     +     + + S  +PQYK E PKTPPHIILHY  FK  WDWVIL+LT+YTA+MVP+N +F  K  + + +L++DS+VDVIF +DIVLNFHTTFVG  GEVISD  +IR+NYLK WF+IDL+SCLPYD+ NAF+    EG+S L  +LKVVRLLRLGRV RKLD YLEY A +LVL++ VF L+AHW ACIWY++G+ ++ +      K+  W+ ++   +   ++  A+ +        K   Y +SLYFTM+ LT+IGFGN++  T+ EK   V  M+ G
Sbjct:    4 MPGGKRGLVAPQNTFLENIVRRSNG---NFLLGNAQIVDWPVVYSNDGFCKLSGYHRADIMQKSSTCSFMYGELTDKKTIEKVRQTFENYESNCFEVLLYKKSRTPVWFYMQIAPIRNEHEKVVLFLCTFKDITLFKQPIEDES--TRGWTKFARLTRALTNSRSVLQQLT---PMNKAEVVHKHSRLAEVLQLGSDILPQYKQEAPKTPPHIILHYCAFKTTWDWVILILTFYTAIMVPYNVSFKTK-QNNIAWLVLDSVVDVIFLVDIVLNFHTTFVGPGGEVISDPKLIRMNYLKTWFVIDLLSCLPYDIINAFE-NVDEGMSSLFSSLKVVRLLRLGRVARKLDHYLEYGAAVLVLLVCVFGLVAHWLACIWYSIGDYEVIDEVTNTIKKDSWLYQLGLSIGTPYRYNASGSGQWEGGPSKDSLYVSSLYFTMTSLTTIGFGNIAPTTDGEKIFSVAMMMVG 459          
BLAST of Voltage gated potassium channel vs. Ensembl Mouse
Match: Kcnh1 (potassium voltage-gated channel, subfamily H (eag-related), member 1 [Source:MGI Symbol;Acc:MGI:1341721])

HSP 1 Score: 401.749 bits (1031), Expect = 9.877e-130
Identity = 230/468 (49.15%), Postives = 318/468 (67.95%), Query Frame = 1
Query:   97 ISMSGSRRGLVAPQNTLLDTIIRRCNSQHSSFILANAKIVDHPIIYVNEAFSKLTGFARNEVMQKSSQCTFLHGEETNKDLLDQWFSALNNYEQIQLELLVFKKNLSPLWIVLQIHPITNEKLEVXXXXXTFYDITAIKHPSDDEAEIKPGLSKFAKLAKSVARNRSIMIDLTQDFQENNKESSKVETSPINNIFMHSKNIPQYKHETPKTPPHIILHYSQFKVIWDWVILLLTYYTAVMVPFNAAFSNKSMDAVLFLIVDSIVDVIFFLDIVLNFHTTFVGSTGEVISDAFIIRINYLKGWFIIDLMSCLPYDVFNAFQPGSQEGISQXXXXXXXXXXXXXXXXXXXXDQYLEYMATXXXXXXXXXXXXAHWFACIWYTVG-----NTDLRNNKQYGWIPKMLQDC---HQTVANWTTFDPNKEHKLLNYATSLYFTMSLLTSIGFGNVSANTELEKFACVIFMLFG 1476
            ++M+G RRGLVAPQNT L+ I+RR N   ++F+L NA+IVD PI+Y N+ F KL+G+ R EVMQKSS C+F++GE T+KD +++      NYE    E+L++KKN +P+W  ++I PI NE+ +V+L L TF DITA K P +D++    G  KFA+L +++  +R ++  L    Q+          + +  + + S  +PQYK E PKTPPHIILHY  FK  WDW+IL+LT+YTA++VP+N +F  +  + V +L+VDSIVDVIF +DIVLNFHTTFVG  GEVISD  +IR+NYLK WF+IDL+SCLPYDV NAF+    EGIS L  +LKVVRLLRLGRV RKLD Y+EY A +LVL++ VF L AHW ACIWY++G     + D +  +   W+ ++  D    +Q   + +        K   Y +SLYFTM+ LTS+GFGN++ +T++EK   V  M+ G
Sbjct:    1 MTMAGGRRGLVAPQNTFLENIVRRSND--TNFVLGNAQIVDWPIVYSNDGFCKLSGYHRAEVMQKSSACSFMYGELTDKDTVEKVRQTFENYEMNSFEILMYKKNRTPVWFFVKIAPIRNEQDKVVLFLCTFSDITAFKQPIEDDS--CKGWGKFARLTRALTSSRGVLQQLAPSVQKGENVHKHSRLAEV--LQLGSDILPQYKQEAPKTPPHIILHYCVFKTTWDWIILILTFYTAILVPYNVSFKTR-QNNVAWLVVDSIVDVIFLVDIVLNFHTTFVGPAGEVISDPKLIRMNYLKTWFVIDLLSCLPYDVINAFE-NVDEGISSLFSSLKVVRLLRLGRVARKLDHYIEYGAAVLVLLVCVFGLAAHWMACIWYSIGDYEIFDEDTKTIRNNSWLYQLALDIGTPYQFNGSGSGKWEGGPSKNSVYISSLYFTMTSLTSVGFGNIAPSTDIEKIFAVAIMMIG 460          
BLAST of Voltage gated potassium channel vs. Ensembl Mouse
Match: Kcnh5 (potassium voltage-gated channel, subfamily H (eag-related), member 5 [Source:MGI Symbol;Acc:MGI:3584508])

HSP 1 Score: 395.586 bits (1015), Expect = 4.483e-127
Identity = 233/468 (49.79%), Postives = 318/468 (67.95%), Query Frame = 1
Query:  103 MSGSRRGLVAPQNTLLDTIIRRCNSQHSSFILANAKIVDHPIIYVNEAFSKLTGFARNEVMQKSSQCTFLHGEETNKDLLDQWFSALNNYEQIQLELLVFKKNLSPLWIVLQIHPITNEKLEVXXXXXTFYDITAIKHPSDDEAEIKPGLSKFAKLAKSVARNRSIMIDLTQDFQENNKESSKVETSPINNIFMHSKNIPQYKHETPKTPPHIILHYSQFKVIWDWVILLLTYYTAVMVPFNAAFSNKSMDAVLFLIVDSIVDVIFFLDIVLNFHTTFVGSTGEVISDAFIIRINYLKGWFIIDLMSCLPYDVFNAFQPGSQEGISQXXXXXXXXXXXXXXXXXXXXDQYLEYMATXXXXXXXXXXXXAHWFACIWYTVGN----TDLRNNKQY-GWIPKMLQDC-----HQTVANWTTFDPNKEHKLLNYATSLYFTMSLLTSIGFGNVSANTELEKFACVIFMLFG 1476
            M G +RGLVAPQNT L+ I+RR  S  SSF+L NA+IVD P++Y N+ F KL+G+ R +VMQKSS C+F++GE T+K  +++     +NYE    E+L++KKN +P+W  +QI PI NE  +V+L L TF DIT  K P +D++    G +KFA+L +++  +RS++  LT     N  E+    +     + + S  +PQYK E PKTPPHIILHY  FK  WDWVIL+LT+YTA+MVP+N +F  K  + + +L++DS+VDVIF +DIVLNFHTTFVG  GEVISD  +IR+NYLK WF+IDL+SCLPYD+ NAF+    EGIS L  +LKVVRLLRLGRV RKLD YLEY A +LVL++ VF L+AHW ACIWY++G+     ++ N  Q   W+ ++         + T A      P+K+     Y +SLYFTM+ LT+IGFGN++  T++EK   V  M+ G
Sbjct:    1 MPGGKRGLVAPQNTFLENIVRR--SSESSFLLGNAQIVDWPVVYSNDGFCKLSGYHRADVMQKSSTCSFMYGELTDKKTIEKVRQTFDNYESNCFEVLLYKKNRTPVWFYMQIAPIRNEHEKVVLFLCTFKDITLFKQPIEDDS--TKGWTKFARLTRALTNSRSVLQQLT---PMNKTETVHKHSRLAEVLQLGSDILPQYKQEAPKTPPHIILHYCAFKTTWDWVILILTFYTAIMVPYNVSFKTK-QNNIAWLVLDSVVDVIFLVDIVLNFHTTFVGPGGEVISDPKLIRMNYLKTWFVIDLLSCLPYDIINAFE-NVDEGISSLFSSLKVVRLLRLGRVARKLDHYLEYGAAVLVLLVCVFGLVAHWLACIWYSIGDYEVIDEVTNTIQIDSWLYQLALSIGTPYRYNTSAGIWEGGPSKDSL---YVSSLYFTMTSLTTIGFGNIAPTTDVEKMFSVAMMMVG 456          
BLAST of Voltage gated potassium channel vs. Ensembl Mouse
Match: Kcnh1 (potassium voltage-gated channel, subfamily H (eag-related), member 1 [Source:MGI Symbol;Acc:MGI:1341721])

HSP 1 Score: 392.889 bits (1008), Expect = 4.852e-126
Identity = 234/496 (47.18%), Postives = 323/496 (65.12%), Query Frame = 1
Query:   97 ISMSGSRRGLVAPQNTLLDTIIRRCNSQHSSFILANAKIVDHPIIYVNEAFSKLTGFARNEVMQKSSQCTFLHGEETNKDLLDQWFSALNNYEQIQLELLVFKKNLSPLWIVLQIHPITNEKLEVXXXXXTFYDITAIKHPSDDEAEIKPGLSKFAKLAKSVARNRSIMIDLTQDFQ--ENNKESSKVETSPINNIFMHSKNIPQYKHETPKTPPHIILHYSQFKVIWDWVILLLTYYTAVMVPFNAAFSNKSMDAVLFLIVDSIVDVIFFLDIVLNFHTTFVGSTGEVISDAFIIRINYLKGWFIIDLMSCLPYDVFNAFQ-----------PG---------------SQEGISQXXXXXXXXXXXXXXXXXXXXDQYLEYMATXXXXXXXXXXXXAHWFACIWYTVGN-----TDLRNNKQYGWIPKMLQDC---HQTVANWTTFDPNKEHKLLNYATSLYFTMSLLTSIGFGNVSANTELEKFACVIFMLFG 1476
            ++M+G RRGLVAPQNT L+ I+RR N   ++F+L NA+IVD PI+Y N+ F KL+G+ R EVMQKSS C+F++GE T+KD +++      NYE    E+L++KKN +P+W  ++I PI NE+ +V+L L TF DITA K P +D++    G  KFA+L +++  +R ++  L    Q  EN  + S++       + + S  +PQYK E PKTPPHIILHY  FK  WDW+IL+LT+YTA++VP+N +F  +  + V +L+VDSIVDVIF +DIVLNFHTTFVG  GEVISD  +IR+NYLK WF+IDL+SCLPYDV NAF+           PG                 +GIS L  +LKVVRLLRLGRV RKLD Y+EY A +LVL++ VF L AHW ACIWY++G+      D +  +   W+ ++  D    +Q   + +        K   Y +SLYFTM+ LTS+GFGN++ +T++EK   V  M+ G
Sbjct:    1 MTMAGGRRGLVAPQNTFLENIVRRSND--TNFVLGNAQIVDWPIVYSNDGFCKLSGYHRAEVMQKSSACSFMYGELTDKDTVEKVRQTFENYEMNSFEILMYKKNRTPVWFFVKIAPIRNEQDKVVLFLCTFSDITAFKQPIEDDS--CKGWGKFARLTRALTSSRGVLQQLAPSVQKGENVHKHSRLAEV----LQLGSDILPQYKQEAPKTPPHIILHYCVFKTTWDWIILILTFYTAILVPYNVSFKTR-QNNVAWLVVDSIVDVIFLVDIVLNFHTTFVGPAGEVISDPKLIRMNYLKTWFVIDLLSCLPYDVINAFENVDEVSAFMGDPGKIGFADQIPPPLEGRESQGISSLFSSLKVVRLLRLGRVARKLDHYIEYGAAVLVLLVCVFGLAAHWMACIWYSIGDYEIFDEDTKTIRNNSWLYQLALDIGTPYQFNGSGSGKWEGGPSKNSVYISSLYFTMTSLTSVGFGNIAPSTDIEKIFAVAIMMIG 487          
BLAST of Voltage gated potassium channel vs. Ensembl Mouse
Match: Kcnh8 (potassium voltage-gated channel, subfamily H (eag-related), member 8 [Source:MGI Symbol;Acc:MGI:2445160])

HSP 1 Score: 287.73 bits (735), Expect = 7.059e-86
Identity = 195/473 (41.23%), Postives = 281/473 (59.41%), Query Frame = 1
Query:  118 RGLVAPQNTLLDTIIRRCNSQHSSFILANAKIVDH-PIIYVNEAFSKLTGFARNEVMQKSSQCTFLHGEETNKDLLDQWFSALNNYEQIQLELLVFKKNLSPLWIVLQIHPITNEKLEVXXXXXTFYDI--TAIKHPSDDEAEIK-PGLSKFAKLAKSV-ARNRSIMIDLTQDFQENNKESSKVETSPINNIFMHSKNIPQYKHETPKTPPHIILHYSQFKVIWDWVILLLTYYTAVMVPFNAAF-SNKSMDAVLFLIVDSI-VDVIFFLDIVLNFHTTFVGSTGEVISDAFIIRINYLKGWFIIDLMSCLPYDVFNAFQPGSQEGISQXXXXXXXXXXXXXXXXXXXXDQYLEYMATXXXXXXXXXXXXAHWFACIWYTVGNTDLRNNK----QYGWIPKMLQDCHQT-VANWTTFDPNKEHKLLNYATSLYFTMSLLTSIGFGNVSANTELEKFACVIFMLFGGW*GFLIF 1500
            +GL+APQNT LDTI  R +  HS+FILANA++    PI+Y ++ F +L GFAR EVMQKS  C FL G ETN+ L+ Q   +L    + + E++ +KKN +P W +L I PI NEK +V+L L +F DI  T +K  S+D+ E +  G S+      S   R+R+++  ++   Q   K   K+     NN+F+     P+YK    K    I+LH+S FK  WDW+ILL T+Y AV VP+N  F  N+ +       V  I V+++F +DI+LNF TT+V  +G+VI +A  I I+Y+  WFIIDL++ LP+D+  AF       +  L+  LK VRLLRL R+L+KLD+Y ++   +L L++ +F LLAHW ACIWY +G  +  +N     + GW+ ++ +        N T   P+       Y  +LYFT+S LTS+GFGNVSANT+ EK   +  ML G     L+F
Sbjct:    5 KGLLAPQNTFLDTIATRFDGTHSNFILANAQVAKGFPIVYCSDGFCELAGFARTEVMQKSCSCKFLFGVETNEQLMLQIEKSLEEKVEFKGEIMFYKKNGAPFWCLLDIVPIKNEKGDVVLFLASFKDITDTKVKITSEDKKEDRTKGRSRAGSHFDSARRRSRAVLYHISGHLQRREKNKLKIN----NNVFVDKPAFPEYKVSDAKKSKFILLHFSTFKAGWDWLILLATFYVAVTVPYNVCFIGNEDLSTTRSTTVSDIAVEILFIIDIILNFRTTYVSKSGQVIFEARSICIHYVTTWFIIDLIAALPFDLLYAF----NVTVVSLVHLLKTVRLLRLLRLLQKLDRYSQHSTIVLTLLMSMFALLAHWMACIWYVIGKMEREDNSLLKWEVGWLHELGKRLESPYYGNNTLGGPSIRSA---YIAALYFTLSSLTSVGFGNVSANTDAEKIFSICTMLIGALMHALVF 466          
BLAST of Voltage gated potassium channel vs. Ensembl Mouse
Match: Kcnh4 (potassium voltage-gated channel, subfamily H (eag-related), member 4 [Source:MGI Symbol;Acc:MGI:2156184])

HSP 1 Score: 265.774 bits (678), Expect = 3.230e-78
Identity = 177/470 (37.66%), Postives = 272/470 (57.87%), Query Frame = 1
Query:  118 RGLVAPQNTLLDTIIRRCNSQHSSFILANAK-IVDHPIIYVNEAFSKLTGFARNEVMQKSSQCTFLHGEETNKDLLDQWFSALNNYEQIQLELLVFKKNLSPLWIVLQIHPITNEKLEVXXXXXTFYDITAIKHP--------SDDEAEIKPGLSKFAKLAKSVAR-NRSIMIDLTQDFQENNKESSKVETSPINNIFMHSKNIPQYKHETPKTPPHIILHYSQFKVIWDWVILLLTYYTAVMVPFNAAFS---NKSMDAVLFLIVDSIVDVIFFLDIVLNFHTTFVGSTGEVISDAFIIRINYLKGWFIIDLMSCLPYDVFNAFQPGSQEGISQXXXXXXXXXXXXXXXXXXXXDQYLEYMATXXXXXXXXXXXXAHWFACIWYTVGNTDLRNNKQY----GWIPKMLQDCHQTVANWTTFDPNKEHKLLNYATSLYFTMSLLTSIGFGNVSANTELEKFACVIFMLFG 1476
            +GL+APQNT LDTI  R +  HS+F+LANA+     PI+Y ++ F +LTG+ R EVMQK+  C FL+G ET++  L +   AL  +++ + E+  ++K+ S  W +L + PI NE  EV+L L +F DI+    P         D+  E   G    +   +S  R NR+++  LT  F    + S K  +    N+F    ++P+YK  +      ++LHYS  K +WD +ILL T+Y AV VP+N  F+   +  + +   L+ D  V+++F LDI+LNF TT+V  +G+VIS    I ++YL  WF +DL++ LP+D+   F       ++ L+  LK VRLLRL R+L+KL++Y +  A +L L++ VF LLAHW AC+WY +G  ++  N       GW+ ++ +   +   N +   P++      Y  +LYFT+S LTS+GFGNV ANT+ EK   +  ML G
Sbjct:    5 KGLLAPQNTFLDTIATRFDGTHSNFLLANAQGPRGFPIVYCSDGFCELTGYGRTEVMQKTCSCRFLYGPETSEPALQRLQKALEGHQEHRTEICFYRKDGSAFWCLLDMMPIKNEMGEVVLFLFSFKDISQSGGPGLGSPGIHGDNNHENSLGRRGTSSRLRSTKRQNRTVLHRLTGHFGRRGQSSVKANS----NLFEPKPSVPEYKVASVGGSRCLLLHYSIPKAVWDGLILLATFYVAVTVPYNVCFAGDDDTPITSRHTLVSDIAVEMLFILDIILNFRTTYVSQSGQVISAPRSIGLHYLATWFFVDLIAALPFDLLYVF----NITVTSLVHLLKTVRLLRLLRLLQKLERYSQCSAVVLTLLMSVFALLAHWMACVWYVIGRREMEANDPLLWDIGWLHELGKRLEEPYVNGSAGGPSRRSA---YIAALYFTLSSLTSVGFGNVCANTDAEKIFSICTMLIG 463          
BLAST of Voltage gated potassium channel vs. UniProt/SwissProt
Match: sp|Q02280|KCNAE_DROME (Potassium voltage-gated channel protein eag OS=Drosophila melanogaster OX=7227 GN=eag PE=1 SV=2)

HSP 1 Score: 427.943 bits (1099), Expect = 7.130e-137
Identity = 256/488 (52.46%), Postives = 330/488 (67.62%), Query Frame = 1
Query:  103 MSGSRRGLVAPQNTLLDTIIRRCNSQ-HSSFILANAKIVDHPIIYVNEAFSKLTGFARNEVMQKSSQ--CTFLHGEETNKDLLDQWFSALNNYEQIQLELLVFKKN-----------------LSPLWIVLQIHPITNEKLEVXXXXXTFYDITAIKHPSDDEAEIKP--GLSKFAKLAKSVARNRSIMIDLTQDFQENNKESSKVETSPINNIFMHSKNIPQYKHETPKTPPHIILHYSQFKVIWDWVILLLTYYTAVMVPFNAAFSNKSMDAVLFLIVDSIVDVIFFLDIVLNFHTTFVGSTGEVISDAFIIRINYLKGWFIIDLMSCLPYDVFNAFQPGSQEGISQXXXXXXXXXXXXXXXXXXXXDQYLEYMATXXXXXXXXXXXXAHWFACIWYTVGNTDLRNNKQYGWIPKMLQDCHQTVANWTTFDPNKEHKLLN-------YATSLYFTMSLLTSIGFGNVSANTELEKFACVIFMLFGG 1479
            M G RRGLVAPQNT L+ IIRR NSQ  SSF+LANA+IVD PI+Y NE+F K++G+ R EVMQKS +  C F++GE T+K+ + +    L N +Q Q E+L++KKN                  +PLW++LQ+ PI NE+  V+L LLTF DITA+K P D E + K   GLSKFAKLA+SV R+R     L    ++  K+S+      ++   M     PQY+ E PKTPPHI+LHY  FK IWDWVIL LT+YTA+MVP+N AF NK+ + V  L+VDSIVDVIFF+DIVLNFHTTFVG  GEV+SD  +IR+NYLK WFIIDL+SCLPYDVFNAF    ++GI  L  ALKVVRLLRLGRV+RKLD+YLEY A ML+L++  ++L+AHW ACIWY++G +D  N  QY W+ K+        +   + D   E  L+N       Y T+LYFTM+ +TS+GFGNV+A T+ EK   +  M+   
Sbjct:    1 MPGGRRGLVAPQNTFLENIIRRSNSQPDSSFLLANAQIVDFPIVYCNESFCKISGYNRAEVMQKSCRYVCGFMYGELTDKETVGRLEYTLENQQQDQFEILLYKKNNLQCGCALSQFGKAQTQETPLWLLLQVAPIRNERDLVVLFLLTFRDITALKQPIDSE-DTKGVLGLSKFAKLARSVTRSRQFSAHLPT-LKDPTKQSNLAHMMSLSADIM-----PQYRQEAPKTPPHILLHYCAFKAIWDWVILCLTFYTAIMVPYNVAFKNKTSEDVSLLVVDSIVDVIFFIDIVLNFHTTFVGPGGEVVSDPKVIRMNYLKSWFIIDLLSCLPYDVFNAFD-RDEDGIGSLFSALKVVRLLRLGRVVRKLDRYLEYGAAMLILLLCFYMLVAHWLACIWYSIGRSDADNGIQYSWLWKLANVTQSPYSYIWSNDTGPE--LVNGPSRKSMYVTALYFTMTCMTSVGFGNVAAETDNEKVFTICMMIIAA 478          
BLAST of Voltage gated potassium channel vs. UniProt/SwissProt
Match: sp|Q63472|KCNH1_RAT (Potassium voltage-gated channel subfamily H member 1 OS=Rattus norvegicus OX=10116 GN=Kcnh1 PE=1 SV=1)

HSP 1 Score: 401.364 bits (1030), Expect = 9.703e-129
Identity = 233/470 (49.57%), Postives = 321/470 (68.30%), Query Frame = 1
Query:   97 ISMSGSRRGLVAPQNTLLDTIIRRCNSQHSSFILANAKIVDHPIIYVNEAFSKLTGFARNEVMQKSSQCTFLHGEETNKDLLDQWFSALNNYEQIQLELLVFKKNLSPLWIVLQIHPITNEKLEVXXXXXTFYDITAIKHPSDDEAEIKPGLSKFAKLAKSVARNRSIMIDLTQDFQ--ENNKESSKVETSPINNIFMHSKNIPQYKHETPKTPPHIILHYSQFKVIWDWVILLLTYYTAVMVPFNAAFSNKSMDAVLFLIVDSIVDVIFFLDIVLNFHTTFVGSTGEVISDAFIIRINYLKGWFIIDLMSCLPYDVFNAFQPGSQEGISQXXXXXXXXXXXXXXXXXXXXDQYLEYMATXXXXXXXXXXXXAHWFACIWYTVG-----NTDLRNNKQYGWIPKMLQDC---HQTVANWTTFDPNKEHKLLNYATSLYFTMSLLTSIGFGNVSANTELEKFACVIFMLFG 1476
            ++M+G RRGLVAPQNT L+ I+RR N   ++F+L NA+IVD PI+Y N+ F KL+G+ R EVMQKSS C+F++GE T+KD +++      NYE    E+L++KKN +P+W  ++I PI NE+ +V+L L TF DITA K P +D++    G  KFA+L +++  +R ++  L    Q  EN  + S++       + + S  +PQYK E PKTPPHIILHY  FK  WDW+IL+LT+YTA++VP+N +F  +  + V +L+VDSIVDVIF +DIVLNFHTTFVG  GEVISD  +IR+NYLK WF+IDL+SCLPYDV NAF+    EGIS L  +LKVVRLLRLGRV RKLD Y+EY A +LVL++ VF L AHW ACIWY++G     + D +  +   W+ ++  D    +Q   + +        K   Y +SLYFTM+ LTS+GFGN++ +T++EK   V  M+ G
Sbjct:    1 MTMAGGRRGLVAPQNTFLENIVRRSND--TNFVLGNAQIVDWPIVYSNDGFCKLSGYHRAEVMQKSSACSFMYGELTDKDTVEKVRQTFENYEMNSFEILMYKKNRTPVWFFVKIAPIRNEQDKVVLFLCTFSDITAFKQPIEDDS--CKGWGKFARLTRALTSSRGVLQQLAPSVQKGENVHKHSRLAEV----LQLGSDILPQYKQEAPKTPPHIILHYCVFKTTWDWIILILTFYTAILVPYNVSFKTR-QNNVAWLVVDSIVDVIFLVDIVLNFHTTFVGPAGEVISDPKLIRMNYLKTWFVIDLLSCLPYDVINAFE-NVDEGISSLFSSLKVVRLLRLGRVARKLDHYIEYGAAVLVLLVCVFGLAAHWMACIWYSIGDYEIFDEDTKTIRNNSWLYQLALDIGTPYQFNGSGSGKWEGGPSKNSVYISSLYFTMTSLTSVGFGNIAPSTDIEKIFAVAIMMIG 460          
BLAST of Voltage gated potassium channel vs. UniProt/SwissProt
Match: sp|Q920E3|KCNH5_MOUSE (Potassium voltage-gated channel subfamily H member 5 OS=Mus musculus OX=10090 GN=Kcnh5 PE=1 SV=3)

HSP 1 Score: 395.586 bits (1015), Expect = 3.136e-126
Identity = 233/468 (49.79%), Postives = 318/468 (67.95%), Query Frame = 1
Query:  103 MSGSRRGLVAPQNTLLDTIIRRCNSQHSSFILANAKIVDHPIIYVNEAFSKLTGFARNEVMQKSSQCTFLHGEETNKDLLDQWFSALNNYEQIQLELLVFKKNLSPLWIVLQIHPITNEKLEVXXXXXTFYDITAIKHPSDDEAEIKPGLSKFAKLAKSVARNRSIMIDLTQDFQENNKESSKVETSPINNIFMHSKNIPQYKHETPKTPPHIILHYSQFKVIWDWVILLLTYYTAVMVPFNAAFSNKSMDAVLFLIVDSIVDVIFFLDIVLNFHTTFVGSTGEVISDAFIIRINYLKGWFIIDLMSCLPYDVFNAFQPGSQEGISQXXXXXXXXXXXXXXXXXXXXDQYLEYMATXXXXXXXXXXXXAHWFACIWYTVGN----TDLRNNKQY-GWIPKMLQDC-----HQTVANWTTFDPNKEHKLLNYATSLYFTMSLLTSIGFGNVSANTELEKFACVIFMLFG 1476
            M G +RGLVAPQNT L+ I+RR  S  SSF+L NA+IVD P++Y N+ F KL+G+ R +VMQKSS C+F++GE T+K  +++     +NYE    E+L++KKN +P+W  +QI PI NE  +V+L L TF DIT  K P +D++    G +KFA+L +++  +RS++  LT     N  E+    +     + + S  +PQYK E PKTPPHIILHY  FK  WDWVIL+LT+YTA+MVP+N +F  K  + + +L++DS+VDVIF +DIVLNFHTTFVG  GEVISD  +IR+NYLK WF+IDL+SCLPYD+ NAF+    EGIS L  +LKVVRLLRLGRV RKLD YLEY A +LVL++ VF L+AHW ACIWY++G+     ++ N  Q   W+ ++         + T A      P+K+     Y +SLYFTM+ LT+IGFGN++  T++EK   V  M+ G
Sbjct:    1 MPGGKRGLVAPQNTFLENIVRR--SSESSFLLGNAQIVDWPVVYSNDGFCKLSGYHRADVMQKSSTCSFMYGELTDKKTIEKVRQTFDNYESNCFEVLLYKKNRTPVWFYMQIAPIRNEHEKVVLFLCTFKDITLFKQPIEDDS--TKGWTKFARLTRALTNSRSVLQQLT---PMNKTETVHKHSRLAEVLQLGSDILPQYKQEAPKTPPHIILHYCAFKTTWDWVILILTFYTAIMVPYNVSFKTK-QNNIAWLVLDSVVDVIFLVDIVLNFHTTFVGPGGEVISDPKLIRMNYLKTWFVIDLLSCLPYDIINAFE-NVDEGISSLFSSLKVVRLLRLGRVARKLDHYLEYGAAVLVLLVCVFGLVAHWLACIWYSIGDYEVIDEVTNTIQIDSWLYQLALSIGTPYRYNTSAGIWEGGPSKDSL---YVSSLYFTMTSLTTIGFGNIAPTTDVEKMFSVAMMMVG 456          
BLAST of Voltage gated potassium channel vs. UniProt/SwissProt
Match: sp|Q9EPI9|KCNH5_RAT (Potassium voltage-gated channel subfamily H member 5 OS=Rattus norvegicus OX=10116 GN=Kcnh5 PE=2 SV=1)

HSP 1 Score: 395.201 bits (1014), Expect = 4.263e-126
Identity = 233/468 (49.79%), Postives = 318/468 (67.95%), Query Frame = 1
Query:  103 MSGSRRGLVAPQNTLLDTIIRRCNSQHSSFILANAKIVDHPIIYVNEAFSKLTGFARNEVMQKSSQCTFLHGEETNKDLLDQWFSALNNYEQIQLELLVFKKNLSPLWIVLQIHPITNEKLEVXXXXXTFYDITAIKHPSDDEAEIKPGLSKFAKLAKSVARNRSIMIDLTQDFQENNKESSKVETSPINNIFMHSKNIPQYKHETPKTPPHIILHYSQFKVIWDWVILLLTYYTAVMVPFNAAFSNKSMDAVLFLIVDSIVDVIFFLDIVLNFHTTFVGSTGEVISDAFIIRINYLKGWFIIDLMSCLPYDVFNAFQPGSQEGISQXXXXXXXXXXXXXXXXXXXXDQYLEYMATXXXXXXXXXXXXAHWFACIWYTVGN----TDLRNNKQY-GWIPKMLQDC-----HQTVANWTTFDPNKEHKLLNYATSLYFTMSLLTSIGFGNVSANTELEKFACVIFMLFG 1476
            M G +RGLVAPQNT L+ I+RR  S  SSF+L NA+IVD P++Y N+ F KL+G+ R +VMQKSS C+F++GE T+K  +++     +NYE    E+L++KKN +P+W  +QI PI NE  +V+L L TF DIT  K P +D++    G +KFA+L +++  +RS++  LT     N  E+    +     + + S  +PQYK E PKTPPHIILHY  FK  WDWVIL+LT+YTA+MVP+N +F  K  + + +L++DS+VDVIF +DIVLNFHTTFVG  GEVISD  +IR+NYLK WF+IDL+SCLPYD+ NAF+    EGIS L  +LKVVRLLRLGRV RKLD YLEY A +LVL++ VF L+AHW ACIWY++G+     ++ N  Q   W+ ++         + T A      P+K+     Y +SLYFTM+ LT+IGFGN++  T++EK   V  M+ G
Sbjct:    1 MPGGKRGLVAPQNTFLENIVRR--SSESSFLLGNAQIVDWPVVYSNDGFCKLSGYHRADVMQKSSTCSFMYGELTDKKTIEKVRQTFDNYESNCFEVLLYKKNRTPVWFYMQIAPIRNEHEKVVLFLCTFKDITLFKQPIEDDS--TKGWTKFARLTRALTNSRSVLQQLT---PMNKTETVHKHSRLAEVLQLGSDILPQYKQEAPKTPPHIILHYCAFKTTWDWVILILTFYTAIMVPYNVSFKTK-QNNIAWLVLDSVVDVIFLVDIVLNFHTTFVGPGGEVISDPKLIRMNYLKTWFVIDLLSCLPYDIINAFE-NVDEGISSLFSSLKVVRLLRLGRVARKLDHYLEYGAAVLVLLVCVFGLVAHWLACIWYSIGDYEVIDEVTNTIQIDSWLYQLALSIGTPYRYNTSAGIWEGGPSKDSL---YVSSLYFTMTSLTTIGFGNIAPTTDVEKMFSVAMMMVG 456          
BLAST of Voltage gated potassium channel vs. UniProt/SwissProt
Match: sp|Q8NCM2|KCNH5_HUMAN (Potassium voltage-gated channel subfamily H member 5 OS=Homo sapiens OX=9606 GN=KCNH5 PE=1 SV=3)

HSP 1 Score: 394.045 bits (1011), Expect = 1.141e-125
Identity = 233/468 (49.79%), Postives = 317/468 (67.74%), Query Frame = 1
Query:  103 MSGSRRGLVAPQNTLLDTIIRRCNSQHSSFILANAKIVDHPIIYVNEAFSKLTGFARNEVMQKSSQCTFLHGEETNKDLLDQWFSALNNYEQIQLELLVFKKNLSPLWIVLQIHPITNEKLEVXXXXXTFYDITAIKHPSDDEAEIKPGLSKFAKLAKSVARNRSIMIDLTQDFQENNKESSKVETSPINNIFMHSKNIPQYKHETPKTPPHIILHYSQFKVIWDWVILLLTYYTAVMVPFNAAFSNKSMDAVLFLIVDSIVDVIFFLDIVLNFHTTFVGSTGEVISDAFIIRINYLKGWFIIDLMSCLPYDVFNAFQPGSQEGISQXXXXXXXXXXXXXXXXXXXXDQYLEYMATXXXXXXXXXXXXAHWFACIWYTVGN----TDLRNNKQY-GWIPKMLQDC-----HQTVANWTTFDPNKEHKLLNYATSLYFTMSLLTSIGFGNVSANTELEKFACVIFMLFG 1476
            M G +RGLVAPQNT L+ I+RR  S  SSF+L NA+IVD P++Y N+ F KL+G+ R +VMQKSS C+F++GE T+K  +++     +NYE    E+L++KKN +P+W  +QI PI NE  +V+L L TF DIT  K P +D++    G +KFA+L +++  +RS++  LT     N  E     +     + + S  +PQYK E PKTPPHIILHY  FK  WDWVIL+LT+YTA+MVP+N +F  K  + + +L++DS+VDVIF +DIVLNFHTTFVG  GEVISD  +IR+NYLK WF+IDL+SCLPYD+ NAF+    EGIS L  +LKVVRLLRLGRV RKLD YLEY A +LVL++ VF L+AHW ACIWY++G+     ++ N  Q   W+ ++         + T A      P+K+     Y +SLYFTM+ LT+IGFGN++  T++EK   V  M+ G
Sbjct:    1 MPGGKRGLVAPQNTFLENIVRR--SSESSFLLGNAQIVDWPVVYSNDGFCKLSGYHRADVMQKSSTCSFMYGELTDKKTIEKVRQTFDNYESNCFEVLLYKKNRTPVWFYMQIAPIRNEHEKVVLFLCTFKDITLFKQPIEDDS--TKGWTKFARLTRALTNSRSVLQQLT---PMNKTEVVHKHSRLAEVLQLGSDILPQYKQEAPKTPPHIILHYCAFKTTWDWVILILTFYTAIMVPYNVSFKTKQ-NNIAWLVLDSVVDVIFLVDIVLNFHTTFVGPGGEVISDPKLIRMNYLKTWFVIDLLSCLPYDIINAFE-NVDEGISSLFSSLKVVRLLRLGRVARKLDHYLEYGAAVLVLLVCVFGLVAHWLACIWYSIGDYEVIDEVTNTIQIDSWLYQLALSIGTPYRYNTSAGIWEGGPSKDSL---YVSSLYFTMTSLTTIGFGNIAPTTDVEKMFSVAMMMVG 456          
BLAST of Voltage gated potassium channel vs. TrEMBL
Match: A0A1I8JDJ1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 498.819 bits (1283), Expect = 9.215e-166
Identity = 276/472 (58.47%), Postives = 347/472 (73.52%), Query Frame = 1
Query:  103 MSGSRRGLVAPQNTLLDTIIRRCNSQHSSFILANAKIVDHPIIYVNEAFSKLTGFARNEVMQKSSQCTFLHGEETNKDLLDQWFSALNNYEQIQLELLVFKKNLSPLWIVLQIHPITNEKLEVXXXXXTFYDITAIKHPSDDE----AEIKPGLSKFAKLAKSVARNRSIMIDLTQDFQENNKESSKVETSPINNIFMHSKNIPQYKHETPKTPPHIILHYSQFKVIWDWVILLLTYYTAVMVPFNAAFSNKSMDAVLFLIVDSIVDVIFFLDIVLNFHTTFVGSTGEVISDAFIIRINYLKGWFIIDLMSCLPYDVFNAFQPGS-------QEGISQXXXXXXXXXXXXXXXXXXXXDQYLEYMATXXXXXXXXXXXXAHWFACIWYTVGNTDLRNNKQYGWIPKMLQDCHQTVANWT--TFDPNKEHKLLNYATSLYFTMSLLTSIGFGNVSANTELEKFACVIFMLFGG 1479
            MSGSRRGLVAPQNT L+ IIRRCN QHSSF+LANA+IVD+PI+Y N+ FSKL+GF+R E MQ+S  C F++ ++T+ + + +   +L + E  Q E+L+ KKN +PLW+++ I PI NEK  V+L L+TF DITA+K P ++E    A+   GLSKFA+LA+SV RNRS+M+ +         + S+++    + + +H+  +PQYK E PKTPPHIILHYS FK IWDW+IL+LT YTAVMVPFN AF  K+MD V F++ DSIVDVIFF+DIVLNFHTTFVG  GEVISD  IIR+NYLKGWF+IDL+SCLPYDVFNAFQP S       Q GIS L  ALKVVRLLR+GRV RK+DQYLEY A +L+LMIF F+LLAHW AC+WYT+G  DL     YGWIP++  D  +   NWT  T+      K + Y TSLYFT+SLLTS+GFGN++  TE EK   V+FML G 
Sbjct:    1 MSGSRRGLVAPQNTFLENIIRRCNGQHSSFLLANARIVDYPIVYCNDGFSKLSGFSRAEAMQRSCTCNFMYSDQTDPESIQRINKSLESCEPDQQEILLLKKNKTPLWLLMYIAPIKNEKDVVILYLITFRDITALKQPYEEEEAKAAQTAVGLSKFARLARSVTRNRSVMVPMANVPPGGRMDDSRLDQLG-SALSLHADVLPQYKQEAPKTPPHIILHYSAFKTIWDWIILILTGYTAVMVPFNVAFKFKTMDDVSFIVTDSIVDVIFFIDIVLNFHTTFVGPNGEVISDPSIIRVNYLKGWFVIDLLSCLPYDVFNAFQPESTDTITIHQGGISSLFSALKVVRLLRIGRVARKVDQYLEYGAALLILMIFGFVLLAHWMACVWYTIGLRDLDLEIWYGWIPRLANDSLEP-KNWTKNTYQSLLPDKSMAYLTSLYFTLSLLTSVGFGNIAPYTEGEKAVVVVFMLLGA 470          
BLAST of Voltage gated potassium channel vs. TrEMBL
Match: A0A267DWF6 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig011633g1 PE=4 SV=1)

HSP 1 Score: 501.13 bits (1289), Expect = 3.989e-164
Identity = 275/466 (59.01%), Postives = 347/466 (74.46%), Query Frame = 1
Query:  103 MSGSRRGLVAPQNTLLDTIIRRCNSQHSSFILANAKIVDHPIIYVNEAFSKLTGFARNEVMQKSSQCTFLHGEETNKDLLDQWFSALNNYEQIQLELLVFKKNLSPLWIVLQIHPITNEKLEVXXXXXTFYDITAIKHPSDDE----AEIKPGLSKFAKLAKSVARNRSIMIDLTQDFQENNKESSKVETSPINNIFMHSKNIPQYKHETPKTPPHIILHYSQFKVIWDWVILLLTYYTAVMVPFNAAFSNKSMDAVLFLIVDSIVDVIFFLDIVLNFHTTFVGSTGEVISDAFIIRINYLKGWFIIDLMSCLPYDVFNAFQPGSQE-GISQXXXXXXXXXXXXXXXXXXXXDQYLEYMATXXXXXXXXXXXXAHWFACIWYTVGNTDLRNNKQYGWIPKMLQDCHQTVANWT--TFDPNKEHKLLNYATSLYFTMSLLTSIGFGNVSANTELEKFACVIFMLFGG 1479
            MSGSRRGLVAPQNT L+ IIRRCN QHSSF+LANA+IVD+PI+Y N+ FSKL+GF+R E MQ+S  C F++ ++T+ + + +   +L + E  Q E+L+ KKN +PLW+++ I PI NEK  V+L L+TF DITA+K P ++E    A+   GLSKFA+LA+SV RNRS+M+ +         + S+++    + + +H+  +PQYK E PKTPPHIILHYS FK IWDW+IL+LT YTAVMVPFN AF  K+MD V F++ DSIVDVIFF+DIVLNFHTTFVG  GEVISD  IIR+NYLKGWF+IDL+SCLPYDVFNAFQP S + GIS L  ALKVVRLLR+GRV RK+DQYLEY A +L+LMIF F+LLAHW AC+WYT+G  DL     YGWIP++  D  +   NWT  T+      K + Y TSLYFT+SLLTS+GFGN++  TE EK   V+FML G 
Sbjct:    1 MSGSRRGLVAPQNTFLENIIRRCNGQHSSFLLANARIVDYPIVYCNDGFSKLSGFSRAEAMQRSCTCNFMYSDQTDPESIQRINKSLESCEPDQQEILLLKKNKTPLWLLMYIAPIKNEKDVVILYLITFRDITALKQPYEEEEAKAAQTAVGLSKFARLARSVTRNRSVMVPMANVPPGGRMDDSRLDQLG-SALSLHADVLPQYKQEAPKTPPHIILHYSAFKTIWDWIILILTGYTAVMVPFNVAFKFKTMDDVSFIVTDSIVDVIFFIDIVLNFHTTFVGPNGEVISDPSIIRVNYLKGWFVIDLLSCLPYDVFNAFQPESTDGGISSLFSALKVVRLLRIGRVARKVDQYLEYGAALLILMIFGFVLLAHWMACVWYTIGLRDLDLEIWYGWIPRLANDSLEP-KNWTKNTYQSLLPDKSMAYLTSLYFTLSLLTSVGFGNIAPYTEGEKAVVVVFMLLGA 464          
BLAST of Voltage gated potassium channel vs. TrEMBL
Match: A0A4S2M2L1 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_003158 PE=4 SV=1)

HSP 1 Score: 505.368 bits (1300), Expect = 7.829e-162
Identity = 291/526 (55.32%), Postives = 358/526 (68.06%), Query Frame = 1
Query:  103 MSGSRRGLVAPQNTLLDTIIRRCNSQHSSFILANAKIVDHPIIYVNEAFSKLTGFARNEVMQKSSQCTFLHGEETNKDLLDQWFSALNNYEQIQLELLVFKKNLSPLWIVLQIHPITNEKLEVXXXXXTFYDITAIKHPSDDEAEIKPGLSKFAKLAKSVARNRSIMIDLTQDFQENNKESSKVETSPI--------------------NNIFMHSKN-----------------------------IPQYKHETPKTPPHIILHYSQFKVIWDWVILLLTYYTAVMVPFNAAFSNKSMDAVLFLIVDSIVDVIFFLDIVLNFHTTFVGSTGEVISDAFIIRINYLKGWFIIDLMSCLPYDVFNAFQP-GSQEGISQXXXXXXXXXXXXXXXXXXXXDQYLEYMATXXXXXXXXXXXXAHWFACIWYTVGNTDLRNNKQYGWIPKMLQDCHQT---VANWTTFD---PNKEHKLLNYATSLYFTMSLLTSIGFGNVSANTELEKFACVIFMLFGGW*GFLIFYYKV 1512
            +SGSRRGLVAPQNT LD IIRRCN Q  SFILANA+IVD+PI+Y NE FSKL G++R ++MQKS  C + +GE+T +++ D+   AL+     Q+E+L +KKN SPLW+++ I P+ NE+ +V+L LL F DIT +K P +DE   K GLSKFA+LA+SV RNRS +  L+      +  S  V+++ +                     +   HS N                             +P YK E PKTPPHIILHY  FK  WDW+IL+LT YTAVMVPFNAAF +K+MD V FL+VDSIVDVIFF+DIVLNFHTTFVG  GEVISDA IIRINYLKGWF++DL+SCLPYDVFNAFQP  +Q  IS L GALKVVRLLR+GRV RKLDQYLEYMA  L+LMI  F+LLAHW AC+WY+VG+TDL+N  QYGWIP++L D  QT    ANWTT +   P    + + Y TSLYFT+SL+TSIGFGNVSA T  EK   V+FML G + G+   +  V
Sbjct:    4 ISGSRRGLVAPQNTFLDKIIRRCNGQFCSFILANARIVDYPIVYCNEGFSKLIGYSRVDIMQKSGNCAYFYGEQTTQEMRDRLLKALDTQTPDQIEMLFYKKNHSPLWLLVCISPVRNEQEDVVLFLLAFRDITMLKTPFEDEESAK-GLSKFARLARSVTRNRSTLQQLSAPHAAPSNASELVQSNRLLVPNSTTLSGSRSPLSSSTSGHTLCHSFNASMSSFRLHESTRSDPEKGVMNASSWLDLVPPYKQEAPKTPPHIILHYVAFKTTWDWIILVLTGYTAVMVPFNAAFKSKTMDDVSFLVVDSIVDVIFFIDIVLNFHTTFVGPNGEVISDATIIRINYLKGWFLVDLLSCLPYDVFNAFQPEATQSTISSLFGALKVVRLLRIGRVTRKLDQYLEYMAASLLLMIAGFVLLAHWLACVWYSVGSTDLKNGIQYGWIPRLLNDIGQTKSQPANWTTGNIPIP----RTMTYVTSLYFTLSLITSIGFGNVSATTFGEKLVSVVFMLIGAF-GYATIFGNV 523          
BLAST of Voltage gated potassium channel vs. TrEMBL
Match: R7V2W7 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_198709 PE=4 SV=1)

HSP 1 Score: 475.707 bits (1223), Expect = 4.373e-155
Identity = 264/467 (56.53%), Postives = 348/467 (74.52%), Query Frame = 1
Query:  112 SRRGLVAPQNTLLDTIIRRCNSQHSSFILANAKIVDHPIIYVNEAFSKLTGFARNEVMQKSSQCTFLHGEETNKDLLDQWFSALNNYEQIQLELLVFKKNLSPLWIVLQIHPITNEKLEVXXXXXTFYDITAIKHPSDDE-AEIKPG---LSKFAKLAKSVARNRSIMIDLTQDFQENNKESSKVETSPINNIF-MHSKNIPQYKHETPKTPPHIILHYSQFKVIWDWVILLLTYYTAVMVPFNAAFSNKSMDAVLFLIVDSIVDVIFFLDIVLNFHTTFVGSTGEVISDAFIIRINYLKGWFIIDLMSCLPYDVFNAFQPGSQEGISQXXXXXXXXXXXXXXXXXXXXDQYLEYMATXXXXXXXXXXXXAHWFACIWYTVGNTDLRNNKQYGWIPKMLQDCHQT-VANWTT------FDPNKEHKLLNYATSLYFTMSLLTSIGFGNVSANTELEKFACVIFMLFG 1476
            SRRGLVAPQNT L+ IIRR N QHSSF+LANA+IVD+PI+Y N+ F KL G+ R EVMQKSS C+F++GE T+ D + +   AL   EQ Q+E+L++KKN +PLW++L + PI NEK  V+L LLTF DITA+K P DDE  ++  G   LSKFA+LA+SV RNRS+++  +        E+SK   S I N+  ++++ +P Y+ E PKTPPHIILHYS FK  WDW+IL+LT+YTAVMVP+NAAF NK+M+ V  L+VDSIVDV+FF+DI+LNFHTTFVG +GEV+SD  +IR+NYLK WF+IDL+SCLPYDVFNAFQ    E IS L  ALKVVRLLRLGRV RKLD Y+EY A +L+L+IF+F+L+AHWFAC+W+T+GN++ R  + +GW+ K+ ++     VAN +T        PN     + Y TSLY+T+S +TS+GFGNV++ TE+EK   +  M+ G
Sbjct:    3 SRRGLVAPQNTFLENIIRRSNGQHSSFLLANARIVDYPIVYCNDGFCKLAGYNRAEVMQKSSTCSFMYGELTDGDTVGKLEDALEKQEQEQVEILLYKKNKTPLWLLLHVAPIRNEKEAVILFLLTFKDITALKQPIDDENGKVNSGAVGLSKFARLARSVTRNRSVLLQFSPSMPNTKMENSK--PSQIANMMNLNAEILPSYRQEAPKTPPHIILHYSAFKASWDWIILVLTFYTAVMVPYNAAFENKTMEDVPLLVVDSIVDVVFFIDIILNFHTTFVGPSGEVVSDPKVIRMNYLKSWFVIDLLSCLPYDVFNAFQ-HVDENISSLFSALKVVRLLRLGRVARKLDHYIEYGAAVLILLIFMFVLIAHWFACVWFTIGNSEARAGRYFGWLQKLAREIGSPYVANNSTGRVIYEGGPNNG---MAYVTSLYYTLSCMTSVGFGNVNSVTEMEKVFTICMMIIG 463          
BLAST of Voltage gated potassium channel vs. TrEMBL
Match: A0A1S3JY71 (potassium voltage-gated channel subfamily H member 1 OS=Lingula unguis OX=7574 GN=LOC106176953 PE=4 SV=1)

HSP 1 Score: 462.611 bits (1189), Expect = 1.892e-148
Identity = 257/473 (54.33%), Postives = 339/473 (71.67%), Query Frame = 1
Query:  103 MSGSRRGLVAPQNTLLDTIIRRCNSQHSSFILANAKIVDHPIIYVNEAFSKLTGFARNEVMQKSSQCTFLHGEETNKDLLDQWFSALNNYEQIQLELLVFKKNL-------SPLWIVLQIHPITNEKLEVXXXXXTFYDITAIKHP-SDDEAEIKPGLSKFAKLAKSVARNRSIMIDLTQDFQENNKESSKVETSPINNIFMHSKN-----IPQYKHETPKTPPHIILHYSQFKVIWDWVILLLTYYTAVMVPFNAAFSNKSMDAVLFLIVDSIVDVIFFLDIVLNFHTTFVGSTGEVISDAFIIRINYLKGWFIIDLMSCLPYDVFNAFQPGSQEGISQXXXXXXXXXXXXXXXXXXXXDQYLEYMATXXXXXXXXXXXXAHWFACIWYTVGNTDLRNNKQYGWIPKMLQDCHQTV--ANWTTFDPNKEHKLLNYATSLYFTMSLLTSIGFGNVSANTELEKFACVIFMLFG 1476
            M G++RGLVAPQNT L+ IIRR N QHSSF+LANA+IVD+PI+Y NE F KL+G+ R EVMQKS  C F+HGE T+ D + Q  +AL  +EQIQ+E+L++KKN        +PLW++  + PI NEK +V+L LLTF DITA+K P  +D+ +   GLSKFA+LA+SV RN+S+++  +   Q     S   + +       H  N     +PQY+ E PKTPPHIILHY  FK  WDW+IL+LT+YTAVMVP+N AF +K+MD V  L+VDSIVDV+FF+DI+LNFHTTFVG  GE++SD  IIR+NYLK WF+IDL+SCLPYDVFNAFQ    E IS +  ALKVVRLLRLGRV+RKLD YLEY A +LV+++F F+L+AHWFAC+WY++G T++++   +GW+  +     Q     N T        K ++Y T+LYFT+S +TS+GFGNV+ANT LEK   ++ M+ G
Sbjct:    1 MHGTKRGLVAPQNTFLENIIRRSNGQHSSFLLANAQIVDYPIVYCNEGFCKLSGYTRAEVMQKSCNCAFMHGERTDPDTVTQIQTALEEWEQIQVEILLYKKNRGHALLSGTPLWLMEHVAPIKNEKDQVVLFLLTFKDITALKRPICEDDGK---GLSKFARLARSVTRNKSVVLQYSNQLQAPATTSKIPQDNNRPFSLAHIMNFNADILPQYRQEAPKTPPHIILHYCAFKATWDWIILILTFYTAVMVPYNVAFRSKTMDGVGLLVVDSIVDVVFFVDIILNFHTTFVGPGGEIVSDPKIIRMNYLKSWFVIDLLSCLPYDVFNAFQ-HVDESISSIFSALKVVRLLRLGRVVRKLDHYLEYGAAVLVILVFCFVLVAHWFACLWYSIGMTEVQSGLAFGWLQLLANRTQQPFYQTNSTGEFEGGPSKDMSYVTALYFTLSCMTSVGFGNVAANTMLEKGFTILMMIAG 469          
BLAST of Voltage gated potassium channel vs. Ensembl Cavefish
Match: kcnh5b (potassium voltage-gated channel subfamily H member 5 [Source:NCBI gene;Acc:103041965])

HSP 1 Score: 393.275 bits (1009), Expect = 3.775e-126
Identity = 234/471 (49.68%), Postives = 317/471 (67.30%), Query Frame = 1
Query:  103 MSGSRRGLVAPQNTLLDTIIRRCNSQHSSFILANAKIVDHPIIYVNEAFSKLTGFARNEVMQKSSQCTFLHGEETNKDLLDQWFSALNNYEQIQLELLVFKKNLSPLWIVLQIHPITNEKLEVXXXXXTFYDITAIKHPSDDEAEIKPGLSKFAKLAKSVARNRSIMIDLTQDFQENNKESSKVETSPINNIFMHSKNI-PQYKHETPKTPPHIILHYSQFKVIWDWVILLLTYYTAVMVPFNAAFSNKSMDAVLFLIVDSIVDVIFFLDIVLNFHTTFVGSTGEVISDAFIIRINYLKGWFIIDLMSCLPYDVFNAFQPGSQEGISQXXXXXXXXXXXXXXXXXXXXDQYLEYMATXXXXXXXXXXXXAHWFACIWYTVGNTDLRNN-----KQYGWIPKMLQDCH-------QTVANWTTFDPNKEHKLLNYATSLYFTMSLLTSIGFGNVSANTELEKFACVIFMLFG 1476
            M G +RGLVAPQNT L+ I+RR  S  +SF+L NA+IV+ P++Y N+ F KL+G+ R EVMQKSS C+F++GE T+K  +++     +NYE    E+L+++KN +P+W  +QI PI NE  +V+L L TF DIT  K P +DE+  + G +KFA+L +++  ++S +  LT     N  + +  + S +  +F    +I PQYK E PKTPPHIILHY  FK  WDWVIL+LT+YTA+MVP+N +F  K  + V +L++DS+VDVIF +DIVLNFHTTFVG  GEVISD  +IR+NYLK WF+IDL+SCLPYD+ NAF+    EGIS L  +LKVVRLLRLGRV RKLD YLEY A +LVL++ VF L+AHW ACIWY++G+ ++ +      K   W+ ++                 W    P K H L  Y TSLYFTM+ LT+IGFGN++  T+ EK   V  M+ G
Sbjct:    1 MPGGKRGLVAPQNTFLENIVRR--SSETSFLLGNAQIVEWPVVYSNDGFCKLSGYHRAEVMQKSSTCSFMYGELTDKKTIEKVRQTFDNYESNCFEILLYRKNRTPVWFYMQIAPIRNENDKVVLFLCTFKDITVFKQPIEDES-TRVGWTKFARLTRALTTSKSTIQQLT---PMNKTDVTSHKHSRLAEVFQLGSDILPQYKQEAPKTPPHIILHYCTFKTTWDWVILILTFYTAIMVPYNVSFKTK-QNNVTWLVLDSVVDVIFLVDIVLNFHTTFVGPGGEVISDPKLIRMNYLKTWFVIDLLSCLPYDIINAFE-NVDEGISSLFSSLKVVRLLRLGRVARKLDHYLEYGAAVLVLLVCVFGLVAHWLACIWYSIGDYEVIDELTNTIKTDSWLYQLATSIGSPYRYNASGSGQWEG-GPGK-HSL--YITSLYFTMTSLTTIGFGNIAPTTDGEKIFSVAMMMVG 459          
BLAST of Voltage gated potassium channel vs. Ensembl Cavefish
Match: kcnh5b (potassium voltage-gated channel subfamily H member 5 [Source:NCBI gene;Acc:103041965])

HSP 1 Score: 393.275 bits (1009), Expect = 5.873e-126
Identity = 234/471 (49.68%), Postives = 317/471 (67.30%), Query Frame = 1
Query:  103 MSGSRRGLVAPQNTLLDTIIRRCNSQHSSFILANAKIVDHPIIYVNEAFSKLTGFARNEVMQKSSQCTFLHGEETNKDLLDQWFSALNNYEQIQLELLVFKKNLSPLWIVLQIHPITNEKLEVXXXXXTFYDITAIKHPSDDEAEIKPGLSKFAKLAKSVARNRSIMIDLTQDFQENNKESSKVETSPINNIFMHSKNI-PQYKHETPKTPPHIILHYSQFKVIWDWVILLLTYYTAVMVPFNAAFSNKSMDAVLFLIVDSIVDVIFFLDIVLNFHTTFVGSTGEVISDAFIIRINYLKGWFIIDLMSCLPYDVFNAFQPGSQEGISQXXXXXXXXXXXXXXXXXXXXDQYLEYMATXXXXXXXXXXXXAHWFACIWYTVGNTDLRNN-----KQYGWIPKMLQDCH-------QTVANWTTFDPNKEHKLLNYATSLYFTMSLLTSIGFGNVSANTELEKFACVIFMLFG 1476
            M G +RGLVAPQNT L+ I+RR  S  +SF+L NA+IV+ P++Y N+ F KL+G+ R EVMQKSS C+F++GE T+K  +++     +NYE    E+L+++KN +P+W  +QI PI NE  +V+L L TF DIT  K P +DE+  + G +KFA+L +++  ++S +  LT     N  + +  + S +  +F    +I PQYK E PKTPPHIILHY  FK  WDWVIL+LT+YTA+MVP+N +F  K  + V +L++DS+VDVIF +DIVLNFHTTFVG  GEVISD  +IR+NYLK WF+IDL+SCLPYD+ NAF+    EGIS L  +LKVVRLLRLGRV RKLD YLEY A +LVL++ VF L+AHW ACIWY++G+ ++ +      K   W+ ++                 W    P K H L  Y TSLYFTM+ LT+IGFGN++  T+ EK   V  M+ G
Sbjct:    1 MPGGKRGLVAPQNTFLENIVRR--SSETSFLLGNAQIVEWPVVYSNDGFCKLSGYHRAEVMQKSSTCSFMYGELTDKKTIEKVRQTFDNYESNCFEILLYRKNRTPVWFYMQIAPIRNENDKVVLFLCTFKDITVFKQPIEDES-TRVGWTKFARLTRALTTSKSTIQQLT---PMNKTDVTSHKHSRLAEVFQLGSDILPQYKQEAPKTPPHIILHYCTFKTTWDWVILILTFYTAIMVPYNVSFKTK-QNNVTWLVLDSVVDVIFLVDIVLNFHTTFVGPGGEVISDPKLIRMNYLKTWFVIDLLSCLPYDIINAFE-NVDEGISSLFSSLKVVRLLRLGRVARKLDHYLEYGAAVLVLLVCVFGLVAHWLACIWYSIGDYEVIDELTNTIKTDSWLYQLATSIGSPYRYNASGSGQWEG-GPGK-HSL--YITSLYFTMTSLTTIGFGNIAPTTDGEKIFSVAMMMVG 459          
BLAST of Voltage gated potassium channel vs. Ensembl Cavefish
Match: kcnh5a (potassium voltage-gated channel subfamily H member 5 [Source:NCBI gene;Acc:103032183])

HSP 1 Score: 389.808 bits (1000), Expect = 2.204e-125
Identity = 229/466 (49.14%), Postives = 314/466 (67.38%), Query Frame = 1
Query:  103 MSGSRRGLVAPQNTLLDTIIRRCNSQHSSFILANAKIVDHPIIYVNEAFSKLTGFARNEVMQKSSQCTFLHGEETNKDLLDQWFSALNNYEQIQLELLVFKKNLSPLWIVLQIHPITNEKLEVXXXXXTFYDITAIKHPSDDEAEIKPGLSKFAKLAKSVARNRSIMIDLTQDFQENNKESSKVETSPINNIFMHSKNIPQYKHETPKTPPHIILHYSQFKVIWDWVILLLTYYTAVMVPFNAAFSNKSMDAVLFLIVDSIVDVIFFLDIVLNFHTTFVGSTGEVISDAFIIRINYLKGWFIIDLMSCLPYDVFNAFQPGSQEGISQXXXXXXXXXXXXXXXXXXXXDQYLEYMATXXXXXXXXXXXXAHWFACIWYTVGNTDLRNN-----KQYGWIPKM---LQDCHQTVANWTTFDPNKEHKLLNYATSLYFTMSLLTSIGFGNVSANTELEKFACVIFMLFG 1476
            M G +RGLVAPQNT L+ I+RR  S  +SF+L NA+IV+ PI+Y N+ F KL+G+ R EVMQKSS C+F++GE T++  +D+     +NYE    E+L++KKN +P+W+ +Q+ PI NE  +V+L L TF DIT  K P +DE     G +KFA+L +++  +R  +  L      N  E S   +     + + S  +PQYK E PKTPPHIILHY  FK  WDWVIL+LT+YTA+MVP+N +F  K  + + +L+VDS+VDVIF +DIVLNFHTTFVG  GEVISD  +IR+NYLK WF+IDL+SCLPYD+ NAF+    EG+S L  +LKVVRLLRLGRV RKLD YLEY A +LVL++ VF L+AHW ACIWY++G+ ++ +      K   W+ ++   +   ++  A+ +        K   Y +SLYFTM+ LT+IGFGN++  T+ EK   V  M+ G
Sbjct:    1 MHGGKRGLVAPQNTFLENIVRR--SSETSFLLGNAQIVEWPIVYSNDGFCKLSGYHRAEVMQKSSTCSFMYGELTDRKTIDKVRQTFDNYESNCFEVLLYKKNRTPVWLYMQVAPIRNENDKVVLFLCTFKDITVFKQPIEDET--TKGWTKFARLTRALTTSRGTVQQLA---PMNKTEVSHKPSRLAEALQLGSDILPQYKQEAPKTPPHIILHYCTFKTTWDWVILILTFYTAIMVPYNVSFKTKQ-NNLAWLVVDSVVDVIFLVDIVLNFHTTFVGPGGEVISDPKLIRMNYLKTWFVIDLLSCLPYDIINAFE-NVDEGLSSLFSSLKVVRLLRLGRVARKLDHYLEYGAAVLVLLVCVFGLVAHWLACIWYSIGDYEVIDEVTNTIKTDSWLYQLAVSIGTPYRYNASGSGQWEGGPSKDTLYISSLYFTMTSLTTIGFGNIAPTTDGEKIFSVAMMMVG 457          
BLAST of Voltage gated potassium channel vs. Ensembl Cavefish
Match: kcnh1b (potassium voltage-gated channel, subfamily H (eag-related), member 1b [Source:ZFIN;Acc:ZDB-GENE-121128-4])

HSP 1 Score: 377.096 bits (967), Expect = 2.015e-120
Identity = 224/457 (49.02%), Postives = 303/457 (66.30%), Query Frame = 1
Query:  130 APQNTLLDTIIRRCNSQHSSFILANAKIVDHPIIYVNEAFSKLTGFARNEVMQKSSQCTFLHGEETNKDLLDQWFSALNNYEQIQLELLVFKKNLSPLWIVLQIHPITNEKLEVXXXXXTFYDITAIKHPSDDEAEIKPGLSKFAKLAKSVARNRSIMIDLTQDFQENNKESSKVETSPINNIFMHSKNIPQYKHETPKTPPHIILHYSQFKVIWDWVILLLTYYTAVMVPFNAAFSNKSMDAVLFLIVDSIVDVIFFLDIVLNFHTTFVGSTGEVISDAFIIRINYLKGWFIIDLMSCLPYDVFNAFQPGSQEGISQXXXXXXXXXXXXXXXXXXXXDQYLEYMATXXXXXXXXXXXXAHWFACIWYTVGNTD--------LRNNKQYGWIPKMLQDCHQTVANWTTFDPNKEHKLLNYATSLYFTMSLLTSIGFGNVSANTELEKFACVIFMLFG 1476
            A  NT L+ I+RR N   ++F+L NA+IVD PI+Y N+ F KL+G+ R EVMQKSS C+F++GE T+K++ ++      NYE    E+L++KKN  P+W  ++I PI NE+ +V+L L TF DITA K P +DE+    G  KFA+L +++  +R ++  L     +          + +  + + S  +PQYK ETPKTPPHIILHY  FK  WDWVIL+LT+YTA+MVP+N +F  K  + V +L+VDSIVDVIF +DIVLNFHTTFVG  GEVISD  +IR+NY+K WF+IDL+SCLPYDV NAF+    EGIS L  +LKVVRLLRLGRV RKLD Y+EY A +LVL++ VF L AHW ACIWY++G+ +        +R +     + + +   ++  A+ T        K   Y TSLYFTM+ LTSIGFGN++  T+ EK   V  M+ G
Sbjct:    1 AGMNTFLENIVRRSND--TNFVLGNAQIVDWPIVYSNDGFCKLSGYHRAEVMQKSSTCSFMYGELTDKEMGEKVRQTFENYEMNSFEILMYKKNRMPVWFFVKIAPIRNEQDKVVLFLCTFNDITAFKQPIEDESS--KGWGKFARLTRALTSSRGVLQQLAPTVHKGENVHKHSRLAEV--LQLGSDILPQYKQETPKTPPHIILHYCTFKTTWDWVILILTFYTAIMVPYNVSFKTKQ-NNVTWLVVDSIVDVIFLVDIVLNFHTTFVGPAGEVISDPKLIRMNYVKTWFVIDLLSCLPYDVINAFE-NVDEGISSLFSSLKVVRLLRLGRVARKLDHYIEYGAAVLVLLVCVFGLAAHWLACIWYSIGDYEVIDEGSNRVRTDSWLYLLGEAVGTPYRFNASGTGRWEGGPSKDSVYITSLYFTMTSLTSIGFGNIAPTTDGEKIFAVAMMMIG 449          
BLAST of Voltage gated potassium channel vs. Ensembl Cavefish
Match: kcnh5a (potassium voltage-gated channel subfamily H member 5 [Source:NCBI gene;Acc:103032183])

HSP 1 Score: 376.711 bits (966), Expect = 6.231e-119
Identity = 230/496 (46.37%), Postives = 315/496 (63.51%), Query Frame = 1
Query:  103 MSGSRRGLVAPQNTLLDTIIRRCNSQHSSFILANAKIVDHPIIYVNEAFSKLTGFARNEVMQKSSQCTFLHGEETNKDLLDQWFSALNNYEQIQLELLVFKKNLSPLWIVLQIHPITNEKLEVXXXXXTFYDITAIKHPSDDEAEIKPGLSKFAKLAKSVARNRSIMIDLTQDFQENNKESSKVETSPINNIFMHSKNIPQYKHETPKTPPHIILHYSQFKVIWDWVILLLTYYTAVMVPFNAAFSNKSMDAVLFLIVDSIVDVIFFLDIVLNFHTTFVGSTGEVISDAFIIRINYLKGWFIIDLMSCLPYDVFNAFQ----------------PGSQE--------------GISQXXXXXXXXXXXXXXXXXXXXDQYLEYMATXXXXXXXXXXXXAHWFACIWYTVGNTDLRNN-----KQYGWIPKM---LQDCHQTVANWTTFDPNKEHKLLNYATSLYFTMSLLTSIGFGNVSANTELEKFACVIFMLFG 1476
            M G +RGLVAPQNT L+ I+RR  S  +SF+L NA+IV+ PI+Y N+ F KL+G+ R EVMQKSS C+F++GE T++  +D+     +NYE    E+L++KKN +P+W+ +Q+ PI NE  +V+L L TF DIT  K P +DE     G +KFA+L +++  +R  +  L      N  E S   +     + + S  +PQYK E PKTPPHIILHY  FK  WDWVIL+LT+YTA+MVP+N +F  K  + + +L+VDS+VDVIF +DIVLNFHTTFVG  GEVISD  +IR+NYLK WF+IDL+SCLPYD+ NAF+                P S                G+S L  +LKVVRLLRLGRV RKLD YLEY A +LVL++ VF L+AHW ACIWY++G+ ++ +      K   W+ ++   +   ++  A+ +        K   Y +SLYFTM+ LT+IGFGN++  T+ EK   V  M+ G
Sbjct:    1 MHGGKRGLVAPQNTFLENIVRR--SSETSFLLGNAQIVEWPIVYSNDGFCKLSGYHRAEVMQKSSTCSFMYGELTDRKTIDKVRQTFDNYESNCFEVLLYKKNRTPVWLYMQVAPIRNENDKVVLFLCTFKDITVFKQPIEDET--TKGWTKFARLTRALTTSRGTVQQLA---PMNKTEVSHKPSRLAEALQLGSDILPQYKQEAPKTPPHIILHYCTFKTTWDWVILILTFYTAIMVPYNVSFKTK-QNNLAWLVVDSVVDVIFLVDIVLNFHTTFVGPGGEVISDPKLIRMNYLKTWFVIDLLSCLPYDIINAFENVDEDPISDSTAVGHLPASGSSPRNATRAEDSVLPGLSSLFSSLKVVRLLRLGRVARKLDHYLEYGAAVLVLLVCVFGLVAHWLACIWYSIGDYEVIDEVTNTIKTDSWLYQLAVSIGTPYRYNASGSGQWEGGPSKDTLYISSLYFTMTSLTTIGFGNIAPTTDGEKIFSVAMMMVG 488          
BLAST of Voltage gated potassium channel vs. Ensembl Sea Lamprey
Match: kcnh1b (potassium voltage-gated channel, subfamily H (eag-related), member 1b [Source:ZFIN;Acc:ZDB-GENE-121128-4])

HSP 1 Score: 363.229 bits (931), Expect = 1.732e-115
Identity = 220/475 (46.32%), Postives = 308/475 (64.84%), Query Frame = 1
Query:  172 NSQHSSFILANAKIVDHPIIYVNEAFSKLTGFARNEVMQKSSQCTFLHGEETNKDLLDQWFSALNNYEQIQLELLVFKKNLSPLWIVLQIHPITNEKLEVXXXXXTFYDITAIKHPSDDEAEIKPGLSKFAKLAKSVARNRSIMIDLTQDFQEN---NKESSKVETSPINNIFMHSKNIPQYKHETPKTPPHIILHYSQFKVIWDWVILLLTYYTAVMVPFNAAFSNKSMDAVLFLIVDSIVDVIFFLDIVLNFHTTFVGSTGEVISDAFIIRINYLKGWFIIDLMSCLPYDVFNAFQP--------------GSQ--------------EGISQXXXXXXXXXXXXXXXXXXXXDQYLEYMATXXXXXXXXXXXXAHWFACIWYTVGNTDLRNN-----KQYGWIPKMLQDC----HQTVANWTTFDPNKEHKLLNYATSLYFTMSLLTSIGFGNVSANTELEKFACVIFMLFG 1476
            +S  ++F+L NA+I+D PI+Y N+ F KL+G+ R EVMQKSS C+F++G+ T+K+ +++      NYE    E+L++KKN +PLW  +QI PI NE  +V+L L TF DITA K P +D++    G +KFA+L +++  +RS++  LT +  +    +K S   E      + + S  +PQYK ETPKTPPHIILHY  FK  WDW+IL+LT+YTA+MVP+N +F  K  + V +L+VDS+VDVIF +DIVLNFHTTFVG  GEVISD  +IR+NYLK WF+IDL+SCLPYD+ NAF+               GS+              +GIS L  +LKVVRLLRLGRV RKLD Y+EY A +LVL++ VF L AHW ACIWY++G+ ++ +      +++ W+ ++ +      H     W    P+K+     Y +SLYFTM+ LTSIGFGN++  T+ EK   V  M+ G
Sbjct:    4 HSADTNFLLGNAQILDWPIVYSNDGFCKLSGYHRAEVMQKSSTCSFMYGDLTDKETMEKVKQTFENYESCSFEILMYKKNRTPLWFYMQIAPIRNEHEKVVLFLCTFRDITAFKQPIEDDS--TKGWTKFARLTRALTNSRSVLQQLTPNVHKGENVHKHSRLAEV-----LQLGSDILPQYKQETPKTPPHIILHYCAFKTTWDWIILILTFYTAIMVPYNVSFKTKQ-NNVAWLVVDSVVDVIFLVDIVLNFHTTFVGPAGEVISDPKLIRMNYLKTWFVIDLLSCLPYDIINAFENVDEVVRAAQIRGPFGSRSPSRLLDAWPRVAPQGISSLFSSLKVVRLLRLGRVARKLDHYIEYGAAVLVLLVCVFGLAAHWLACIWYSIGDYEVIDEATNLIRKHSWLYQLGETIGTPYHFNGTQWEG-GPSKDAV---YISSLYFTMTSLTSIGFGNIAPTTDGEKIFAVAMMMIG 466          
BLAST of Voltage gated potassium channel vs. Ensembl Sea Lamprey
Match: kcnh5b (potassium voltage-gated channel, subfamily H (eag-related), member 5b [Source:ZFIN;Acc:ZDB-GENE-090319-1])

HSP 1 Score: 276.559 bits (706), Expect = 5.878e-89
Identity = 170/385 (44.16%), Postives = 242/385 (62.86%), Query Frame = 1
Query:  415 SPLWIVLQIHPITNEKLEVXXXXXTFYDITAIKHPSDDEAEIKPGLSKFAKLAKSVARNRSIMIDLTQDFQENNKESSK-VETSPINNIFMHSKNIPQYKHETPKTPPHIILHYSQFKVIWDWVILLLTYYTAVMVPFNAAFSNKSMDAVLFLIVDSIVDVIFFLDIVLNFHTTFVGSTGEVISDAFIIRINYLKGWFIIDLMSCLPYDVFNAFQ------------------------PGSQEGISQXXXXXXXXXXXXXXXXXXXXDQYLEYMATXXXXXXXXXXXXAHWFACIWYTVGNTDLRNNKQYGWIPKMLQDCHQ------TVANWTTFDPNKEHKLLNYATSLYFTMSLLTSIGFGNVSANTELEKFACVIFMLFG 1476
            +P+W+ +Q+ P+ NE  EV+L L  F DIT  K P +D++    G ++FA+L +++A +RS++  L+          +K + T+ +  + ++++ +P YK E PKTP +IILHY  FK  WDW+IL+LT+YTA+MVP+N +F  +  + V +L+VDS+VD IF +DIVLNFHTT+VGS GEVISD  +IR  YLK WF+IDL+SCLPYD+ NAF+                         G  +GIS L  ALKVVRLLRLGRV RKLD Y+EY A +LVL++ VF L+AHW ACIW+++G  D    ++YGW+ ++     Q               P++      Y ++LYFTMS LTS+GFGN++ NT+ EK   V  M+ G
Sbjct:    1 TPVWLHMQVSPVRNELNEVVLFLSIFRDITIFKQPIEDDSR---GWARFARLTRALATSRSVLHQLSTSGARGEAAGAKGLRTAEV--VQLNTEVLPAYKQEAPKTPRNIILHYCAFKTTWDWLILILTFYTAIMVPYNVSFRTRQSN-VAWLVVDSVVDAIFLVDIVLNFHTTYVGSAGEVISDPALIRTKYLKTWFLIDLLSCLPYDIINAFENADEYSSATNGFLTPACAQIPPHKGGEAQGISSLFSALKVVRLLRLGRVARKLDHYIEYGAAVLVLLVCVFGLVAHWLACIWFSIG--DAEAAREYGWLHQLAHSVGQPYRYSGDGGGRWEGGPSRRTL---YVSALYFTMSSLTSVGFGNIAPNTDAEKMFAVAMMMIG 374          
BLAST of Voltage gated potassium channel vs. Ensembl Sea Lamprey
Match: kcnh5b (potassium voltage-gated channel, subfamily H (eag-related), member 5b [Source:ZFIN;Acc:ZDB-GENE-090319-1])

HSP 1 Score: 275.404 bits (703), Expect = 2.536e-88
Identity = 170/390 (43.59%), Postives = 242/390 (62.05%), Query Frame = 1
Query:  415 SPLWIVLQIHPITNEKLEVXXXXXTFYDITAIKHPSDDEAEIKPGLSKFAKLAKSVARNRSIMIDLTQDFQENNKESSK-VETSPINNIFMHSKNIPQYKHETPKTPPHIILHYSQFKVIWDWVILLLTYYTAVMVPFNAAFSNKSMDAVLFLIVDSIVDVIFFLDIVLNFHTTFVGSTGEVISDAFIIRINYLKGWFIIDLMSCLPYDVFNAFQPGSQ-----------------------------EGISQXXXXXXXXXXXXXXXXXXXXDQYLEYMATXXXXXXXXXXXXAHWFACIWYTVGNTDLRNNKQYGWIPKMLQDCHQ------TVANWTTFDPNKEHKLLNYATSLYFTMSLLTSIGFGNVSANTELEKFACVIFMLFG 1476
            +P+W+ +Q+ P+ NE  EV+L L  F DIT  K P +D++    G ++FA+L +++A +RS++  L+          +K + T+ +  + ++++ +P YK E PKTP +IILHY  FK  WDW+IL+LT+YTA+MVP+N +F  +  + V +L+VDS+VD IF +DIVLNFHTT+VGS GEVISD  +IR  YLK WF+IDL+SCLPYD+ NAF+   +                             EGIS L  ALKVVRLLRLGRV RKLD Y+EY A +LVL++ VF L+AHW ACIW+++G  D    ++YGW+ ++     Q               P++      Y ++LYFTMS LTS+GFGN++ NT+ EK   V  M+ G
Sbjct:    1 TPVWLHMQVSPVRNELNEVVLFLSIFRDITIFKQPIEDDSR---GWARFARLTRALATSRSVLHQLSTSGARGEAAGAKGLRTAEV--VQLNTEVLPAYKQEAPKTPRNIILHYCAFKTTWDWLILILTFYTAIMVPYNVSFRTRQSN-VAWLVVDSVVDAIFLVDIVLNFHTTYVGSAGEVISDPALIRTKYLKTWFLIDLLSCLPYDIINAFENADEDTTAASTHHHLLSQSSSVGQAAARSLHVAEGISSLFSALKVVRLLRLGRVARKLDHYIEYGAAVLVLLVCVFGLVAHWLACIWFSIG--DAEAAREYGWLHQLAHSVGQPYRYSGDGGGRWEGGPSRRTL---YVSALYFTMSSLTSVGFGNIAPNTDAEKMFAVAMMMIG 379          
BLAST of Voltage gated potassium channel vs. Ensembl Sea Lamprey
Match: kcnh8 (potassium voltage-gated channel, subfamily H (eag-related), member 8 [Source:ZFIN;Acc:ZDB-GENE-060503-204])

HSP 1 Score: 190.66 bits (483), Expect = 2.566e-55
Identity = 139/369 (37.67%), Postives = 211/369 (57.18%), Query Frame = 1
Query:  415 SPLWIVLQIHPITNEKLEVXXXXXTFYDITAIKH-PSDD---EAEIKPGLSK--FAKLAKSVARNRSIMIDLTQDFQENNKESSKVETSPINNIFMHSKN-IPQYKHETPKTPPHIILHYSQFKVIWDWVILLLTYYTAVMVPFNAAFSN---KSMDAVLFLIVDSIVDVIFFLDIVLNFHTTFVGSTGEVISDAFIIRINYLKGWFIIDLMSCLPYDVFNAFQPGSQEGISQXXXXXXXXXXXXXXXXXXXXDQYLEYMATXXXXXXXXXXXXAHWFACIWYTVGNTDLRNNK----QYGWIPKMLQDCHQTVANWTTFDPNKEHKLLNYATSLYFTMSLLTSIGFGNVSANTELEKFACVIFMLFGG 1479
            SP W +L I PI NEK EV+L L +F DI+  K  P+ D   EAE +P       +    S  R+R+++  L+   Q  +    K++    NN+F   K  +P+YK    +    I+LHY  FK  WDW+ILL T+Y AV VP+N  F N   +   +   ++ D   +++F +DIVLNF TT+V  +G+V+ +   I ++Y+  WF IDL++ LP+D+  AF+      ++  +  LK VRLLRL R+L+KLD+Y +Y A +L +++ +F LLAHW ACIWY +G  ++++      Q GW+ ++ +       ++             Y TSLYFT+S +TS+GFGNVSANT+ EK   +  ML G 
Sbjct:    2 SPFWCLLDIVPIRNEKREVVLFLASFKDISDTKRGPTQDGVKEAEERPRQKGQTGSGFNTSRRRSRAVLYHLSGHLQRQDNSKLKLK----NNVFGPEKAALPEYKVAAAQRSRLILLHYGTFKAGWDWLILLATFYVAVTVPYNVCFLNSDEQCTSSRSTMVSDITSEILFIIDIVLNFRTTYVSGSGQVVYNGRSICLHYVTTWFPIDLIAALPFDLLCAFKI----AVTSFVHLLKTVRLLRLLRLLQKLDRYSQYSAVVLAMLMCMFALLAHWMACIWYIIGFEEMKSTDLVTHQIGWLQELQR--RLVAPHYPNITQGMPPIRSAYITSLYFTLSSITSVGFGNVSANTDGEKIFSICAMLIGA 360          
BLAST of Voltage gated potassium channel vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005922.1 (pep scaffold:Pmarinus_7.0:GL476456:333240:381928:-1 gene:ENSPMAG00000005344.1 transcript:ENSPMAT00000005922.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 172.555 bits (436), Expect = 8.032e-47
Identity = 121/313 (38.66%), Postives = 180/313 (57.51%), Query Frame = 1
Query:  586 RNRSIMIDLTQDFQENNKESSKVETSPINNIFMHSKNIPQYKHETPKTPPHIILHYSQFKVIWDWVILLLTYYTAVMVPFNAAFSNKS---MDAVLFLIVDSIVDVIFFLDIVLNFHTTFVGSTGEVISDAFIIRINYLKGWFIIDLMSCLPYDVFNAFQPGSQEGISQXXXXXXXXXXXXXXXXXXXXDQYLEYMATXXXXXXXXXXXXAHWFACIWYTVGNTDLRNNKQYGWIPKMLQDCHQTV-----ANWTTFDPNKEHKLLNYATSLYFTMSLLTSIGFGNVSANTELEKFACVIFMLFGGW*GFLIF 1500
            R+R+++  L+   Q+ +K   K+     NN+F    ++P+YK    +    I+LHY  FK  WD +ILL T+Y AV VP+N  FS       D     +VD  V+++F +DI+LNF TT+V  +G+V+ D   I ++Y+  WF IDL++ LP+D+  AF       ++ L+  LK VRLLRL R+L+ LD+Y +Y   +L L++F+F LLAHW ACIWY +G  ++  N ++ W    L +  + +      N T   P+       Y  SLYF +S LTS+GFGNVSANT+ EK   V  ML G     ++F
Sbjct:    3 RSRAVLYHLSGHLQKQDKNKLKIN----NNVFGEKPSLPEYKVAAIQKSRFILLHYGTFKAGWDLLILLATFYVAVTVPYNVCFSETVENISDPRSTAVVDISVEILFIIDILLNFRTTYVSKSGQVVYDGRSICVHYVTTWFFIDLIAALPFDLLYAFNV----SVTTLVHLLKTVRLLRLLRLLQNLDRYSQYSTVVLTLLMFMFGLLAHWMACIWYKIGRAEIEINDRHSWDIGWLHELGKKLETPFHTNNTGGGPSTRSA---YIASLYFALSSLTSVGFGNVSANTDAEKIFSVCAMLIGALMHAVVF 304          
BLAST of Voltage gated potassium channel vs. Ensembl Nematostella
Match: EDO36780 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHR1])

HSP 1 Score: 338.576 bits (867), Expect = 6.551e-109
Identity = 208/465 (44.73%), Postives = 293/465 (63.01%), Query Frame = 1
Query:  103 MSGSRRGLVAPQNTLLDTIIRRCNSQHSSFILANAKIVDHPIIYVNEAFSKLTGFARNEVMQKSSQCTFLHGEETNKDLLDQWFSALNNYEQIQLELLVFKKNLSPLWIVLQIHPITNEKLEVXXXXXTFYDITAIKHPSDDEAEIKPGLSKFAKLAKSVARNRSIMIDLTQDFQENNKESSKVETSPINNIF-MHSKNIPQYKHETPKTPPHIILHYSQFKVIWDWVILLLTYYTAVMVPFNAAFSNKSMDAVLFLIVDSIVDVIFFLDIVLNFHTTFVGSTGEVISDAFIIRINYLKGWFIIDLMSCLPYDVFNAFQPGS--QEGISQXXXXXXXXXXXXXXXXXXXXDQYLEYMATXXXXXXXXXXXXAHWFACIWYTVGNTDLRNNKQYGWIPKMLQDC---HQTVANWTTFDPNKEHKLL--NYATSLYFTMSLLTSIGFGNVSANTELEK-FACVIFML 1470
            M   RRGLV PQNT L+ I+RR N  H +FIL NA+I+ +PI+Y ++ F KLTGF+R+EVM+KSS CTFLHGE T+ + + +   AL N + +QLE++++KK+   +W++L I PI NEK EV+L L+T  DIT  K P         G   +A+L KS+ R++++++   Q      K +S+     I ++  ++   IPQYK E P+TPP +ILHY+ FK  WDWVIL+LT YT V VPF   F+  S       I+D IVD +F  DIVLNFHTT+VG  GE+I D  +IR+NYLK WF++DL+S LPY V   F P S  ++ I+ LL  L+V RLLRLGRV RK+D+YLEY A+   L++  F L+AHW AC++Y +  T       + W+  +       ++   N T +D       +   Y ++LY+T++ LT+IGFGN+S NT  EK F CV  +L
Sbjct:    1 MPAGRRGLVVPQNTFLENIVRRSNGLHPNFILGNAQILGNPIVYASDGFCKLTGFSRSEVMKKSSDCTFLHGEHTSNESMKEIHDALINKQALQLEIIIYKKDGLAMWVLLHIGPIVNEKGEVVLFLMTIKDITEYKDPIPGTG----GAKGWARLNKSLTRHKTVLVAFKQ------KSASQKNAQQITHLMSLNDDIIPQYKQEIPETPPRVILHYNTFKTSWDWVILILTLYTTVSVPFMVCFAYNSEP---LNILDMIVDWLFIADIVLNFHTTYVGKDGEIIDDPRLIRLNYLKTWFVLDLVSSLPYGVL-YFIPKSEMEQTIANLLSFLRVFRLLRLGRVARKIDKYLEYGASTFFLLMLSFCLVAHWMACMFYVIA-TKYDKYDVHCWLYILADQIGMQYKKNGNSTEYDYTNTGPTIAARYVSALYYTLTSLTTIGFGNISPNTTAEKLFGCVTMLL 450          
BLAST of Voltage gated potassium channel vs. Ensembl Nematostella
Match: EDO45888 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRU8])

HSP 1 Score: 274.633 bits (701), Expect = 2.042e-84
Identity = 174/465 (37.42%), Postives = 277/465 (59.57%), Query Frame = 1
Query:  115 RRGLVAPQNTLLDTIIRRCNSQHSSFILANAKIVD-HPIIYVNEAFSKLTGFARNEVMQKSSQCTFLHGEETNKDLLDQWFSALNNYEQIQLELLVFKKNLSPLWIVLQIHPITNEKLEVXXXXXTFYDITAIK------HPSDDEAEIKPGLSKFAKLAKSVAR--NRSIMIDLTQDFQENNKESSKVETSPINNIFMHSKNIPQYKHETPKTPPHIILHYSQFKVIWDWVILLLTYYTAVMVPFNAAFSNKSMDAVLFLIVDSIVDVIFFLDIVLNFHTTFVGSTGEVISDAFIIRINYLKGWFIIDLMSCLPYDVFNAFQPGSQEGISQXXXXXXXXXXXXXXXXXXXXDQYLEYMATXXXXXXXXXXXXAHWFACIWYTVGNTDLRNNKQYGWIPKMLQDCHQTVANWTTFDPN-KEHKLLNYATSLYFTMSLLTSIGFGNVSANTELEKFACVIFMLFGG 1479
            RRG  APQNT L+TI ++ +  +S+F+L +A+  + +PI+Y ++ F +LTGF R E+M+++  C FL+G ETN++ +    +AL   ++++ E++ ++KN S  + +L I PI NEK  V+L L++  D+T  K      H  D+ A  + G  +  KL +S +R  +R +++ L++ +Q++N  +      P       S+ +P YK ET K    + LHYS  K +WDW +L+LT+Y A+MVP+N AFS     A   +IVD ++++ F LDIV++F TTFV   G ++ +   I I+YLKGWFI+D ++ LP++    F   S   + Q    LK  RLLRL RV+RKL +Y EY   +L L++  F ++AHW ACIWY +G  ++ +N    W+ +  +        +  F P+    +   Y T+LYF ++ +T++GFGNVSANT  EK   V+ ML G 
Sbjct:    4 RRGRFAPQNTFLETIAQKFDHGNSNFVLGSAQEKNNYPIVYCSDGFCELTGFTRTELMRRTCACNFLYGLETNQEDVRNIQNALKTQKELKKEVIFYRKNGSHFFCLLDIVPIKNEKGTVVLFLVSHKDVTKRKQSGEATHDRDENASGRTGPGE-RKLTRSRSRKFSRDVLLHLSRQYQQSNSATKPQSRRPTKR----SRRLPLYKRETTKKSKLLFLHYSNVKSLWDWWVLILTFYIAIMVPYNVAFSRHG-KARDLIIVDMVIELFFILDIVVHFRTTFVNKAGRIVYEQKAIAIHYLKGWFILDFLAALPFEAL-YFINKSWGFLVQ---LLKCGRLLRLFRVVRKLHRYTEYSTVLLTLLMLAFAMVAHWLACIWYVIGLEEVSHNSTISWLYQFGETIQMP---FIAFSPDTGPDEGSAYVTALYFILTSMTTVGFGNVSANTRAEKAFAVVVMLIGA 455          
BLAST of Voltage gated potassium channel vs. Ensembl Nematostella
Match: EDO30140 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1M9])

HSP 1 Score: 248.054 bits (632), Expect = 1.323e-73
Identity = 173/482 (35.89%), Postives = 266/482 (55.19%), Query Frame = 1
Query:  115 RRGLVAPQNTLLDTIIRRCN-SQHSSFILANAKIVDHPIIYVNEAFSKLTGFARNEVMQKSSQCTFLHGEETNKDLLDQWFSALNNYEQIQLELLVFKKNLSPLWIVLQIHPITNEKLEVXXXXXTFYDITAIKHPSD--DEAEIKPGLSKFAKLAKSVARNRSIMIDLTQDFQENNKESSKVETSPINNIFMHSKNIPQYKHETPKTPPHIILHYSQFKVIWDWVILLLTYYTAVMVPFNAAF---SNKSMDAV--------------------LFLIVDSIVDVIFFLDIVLNFHTTFVGSTGEVISDAFIIRINYLKGWFIIDLMSCLPYDVFNAFQPGSQEGISQXXXXXXXXXXXXXXXXXXXXDQYLEYMATXXXXXXXXXXXXAHWFACIWYTVGNTDL-RNNKQYGWIPKMLQDCHQTV-ANWTTFDPNKEHKLLNYATSLYFTMSLLTSIGFGNVSANTELEKFACVIFMLFG 1476
            +RGLVAPQNT + TII++ + S   +F+L NA+    PIIY NE F +LTG++R E++Q++  C FL G+ TN+       +AL    +  +E+L ++K+ SP    + + P+ +E   V + ++   D+T   +  D  + + +   +      +  VAR     I+     + N +   + +++ +  + + +  +P+YK + P   P  ILHYS FK  WDW+IL L  YTA++ P+ A+F    +K  D +                      +I+D +VDV+F +DI +NF TTFV S  EV+S    I ++Y K WF+IDLM+ +P+++      G+ +  + L+G LK  RLLRL RV RKLD Y EY   +L L++  F LLAHW ACIWY +GN +  R N  +GW+  + +  H+          P+ E K   Y T+LYFT+S LTS+GFGNVS NT  EK   +  ML G
Sbjct:    4 KRGLVAPQNTFIQTIIKKFDGSPDRNFVLGNAQADGLPIIYCNEGFCELTGYSRAELVQRNCSCDFLCGQGTNEVAKQDVKNALKGTVERHIEILYYRKDGSPFLCSVLVAPVKDEAGRVSMYIVNHEDVTWSPNRDDVINHSSVTRVVCNINFYSAFVARK----IEYRGLAKRNRRNEQRKKSALV--MSLGADVLPEYKLQAPNIHPWTILHYSVFKAFWDWLILFLVIYTAIVTPYMASFILTRDKMRDELNKDPETRRDYGSGAREVYSDPLVILDYLVDVMFIVDIFINFRTTFVDSNDEVVSHPCRIAVHYFKTWFVIDLMAAIPFELL--IMVGNTDETTTLIGLLKTARLLRLVRVARKLDHYSEYGMAVLCLLMCSFALLAHWLACIWYAIGNLERQRTNSTHGWLDVLAEQIHRPFDEKEVDSGPDIESK---YITALYFTLSSLTSVGFGNVSPNTNAEKIFSICVMLIG 474          
BLAST of Voltage gated potassium channel vs. Ensembl Nematostella
Match: EDO47123 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RND7])

HSP 1 Score: 163.31 bits (412), Expect = 3.458e-45
Identity = 111/258 (43.02%), Postives = 160/258 (62.02%), Query Frame = 1
Query:  730 PPHIILHYSQFKVIWDWVILLLTYYTAVMVPFNAAFSNKSMDAVLFL-------IVDSIVDVIFFLDIVLNFHTTFVG-STGEVISDAFIIRINYLKGWFIIDLMSCLPYDVFNAFQPGSQEGISQXXXXXXXXXXXXXXXXXXXXDQYLEYMATXXXXXXXXXXXXAHWFACIWYTVGNTDLRNNKQYGWIPKMLQDCHQTVANWTTFDPNKEHKLLNYATSLYFTMSLLTSIGFGNVSANTELEKFACVIFMLFGG 1479
            P +IILH S+FK +WDW +LLL  YT++ +P+ AAF       +  L       IV+ IVD++F +DI++NF +T+    T E++S+   I  NYLK WF+ID ++ +P+++F   + G +  IS L G LK  RLLRL RV RKLD+Y EY   +++L+  +F L+AHW ACIWY +G  ++RN  ++GWI  + +   Q V N +  + +       Y TSLYFT++ LTSIGFGNV+ NT  EK   V  ML G 
Sbjct:    3 PRYIILHNSKFKAVWDWFVLLLVIYTSIEIPYTAAFGQSQKSPLQQLKAGSAIGIVNLIVDLMFVVDILINFRSTYTRQGTDELVSNPRKIACNYLKSWFVIDFLAAIPFELF--VEAGGKGAIS-LAGLLKTARLLRLVRVSRKLDRYSEYGLAVVILLTCLFTLVAHWLACIWYFIGRGEIRN--KHGWITLLGEQTGQPV-NTSAPENSGPSMKSRYVTSLYFTLTSLTSIGFGNVAPNTNAEKLFAVAMMLVGA 254          
BLAST of Voltage gated potassium channel vs. Ensembl Nematostella
Match: EDO41718 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3F8])

HSP 1 Score: 151.754 bits (382), Expect = 2.461e-40
Identity = 111/282 (39.36%), Postives = 164/282 (58.16%), Query Frame = 1
Query:  703 QYKHETPKTPP----HIILHYSQFKVIWDWVILLLTYYTAVMVPFNAAF------SNKSM------------DAVLFLIVDSIVDVIFFLDIVLNFHTTFVGSTGEVISDAFIIRINYLKGWFIIDLMSCLPYDVFNAFQPGSQEGISQXXXXXXXXXXXXXXXXXXXXDQYLEYMATXXXXXXXXXXXXAHWFACIWYTVGNTDLRNNKQYGWIPKMLQDCHQTVANWTTFDP-NKEHKLLNYATSLYFTMSLLTSIGFGNVSANTELEKFACVIFMLFGG 1479
            +YK    + PP     IILHY  FK+ WDW+I++L  YTAV VPF +AF       NK +            DA   L+VD+ +DVIF LDIVLNF TT+V     +I++   I I+YL+ +FI+D ++ +P+++            + L   LK  RLLRL R  RKLD+  EYM ++L LM+  F+L+AHW ACIWY +G ++ + +KQ  W+  +  + ++   ++   DP +  +    Y TSLY+ M+L T++GFGNVSANT+ E+   +  ML G 
Sbjct:   10 RYKRYKLQIPPQMRNRIILHYGLFKITWDWLIMVLVLYTAVEVPFVSAFIMSQADLNKRLKRKYDCSIILYPDAYPLLLVDTCIDVIFMLDIVLNFRTTYVKEGEVLITNPCKIGIHYLRSYFIVDFVAAIPWELLLDLNADEN---TTLFSLLKTARLLRLFRAARKLDRNYEYMTSLLFLMLMFFMLVAHWMACIWYMIGFSE-QKHKQTSWLSILATESNK---HFHPTDPWSGPYLPSRYLTSLYYVMTLCTTVGFGNVSANTDGERIFTICGMLLGA 284          
BLAST of Voltage gated potassium channel vs. Ensembl Medaka
Match: kcnh1a (potassium voltage-gated channel subfamily H member 1-like [Source:NCBI gene;Acc:101155792])

HSP 1 Score: 400.979 bits (1029), Expect = 1.695e-129
Identity = 239/471 (50.74%), Postives = 319/471 (67.73%), Query Frame = 1
Query:  103 MSGSRRGLVAPQNTLLDTIIRRCNSQHSSFILANAKIVDHPIIYVNEAFSKLTGFARNEVMQKSSQCTFLHGEETNKDLLDQWFSALNNYEQIQLELLVFKKNLSPLWIVLQIHPITNEKLEVXXXXXTFYDITAIKHPSDDEAEIKPGLSKFAKLAKSVARNRSIMIDLTQDFQEN-NKESSKVETSPINNIFMHSKNI-PQYKHETPKTPPHIILHYSQFKVIWDWVILLLTYYTAVMVPFNAAFSNKSMDAVLFLIVDSIVDVIFFLDIVLNFHTTFVGSTGEVISDAFIIRINYLKGWFIIDLMSCLPYDVFNAFQPGSQEGISQXXXXXXXXXXXXXXXXXXXXDQYLEYMATXXXXXXXXXXXXAHWFACIWYTVGNTDLRNN-----KQYGWIPKMLQDCHQTVANWTTFD------PNKEHKLLNYATSLYFTMSLLTSIGFGNVSANTELEKFACVIFMLFG 1476
            M+G RRGLVAPQNT L+ I+RR N   ++F+L NA+IVD PI+Y N+ F KL+G+ R EVMQKSS C+F++GE T+KD  ++      NYE    E+L++KKN +P+W  ++I PI NE+ +V+L L TF DITA K P +D++    G  KFA+L +++  +R ++    Q  Q   +K  + ++ S +  +     +I PQYK ETPKTPPHIILHY  FK  WDWVIL+LT+YTA+MVP+N +F  K  + V +L+VDSIVDVIF +DIVLNFHTTFVG  GEVISD  +IR+NYLK WF+IDL+SCLPYDV NAF+    EGIS L  +LKVVRLLRLGRV RKLD Y+EY A +LVL++ VF L AHW ACIWY++G+ ++ +      +   W+  + +   +     TT        PNK+     Y TSLYFTM+ LTSIGFGN++  T+ EK   V  M+ G
Sbjct:    1 MAGGRRGLVAPQNTFLENIVRRSND--TNFVLGNAQIVDWPIVYSNDGFCKLSGYHRAEVMQKSSTCSFMYGELTDKDTTEKVRLTFENYEMNSFEILMYKKNRTPVWFFVKIAPIRNEQEKVVLFLCTFSDITAFKQPIEDDSS--KGWGKFARLTRALTSSRGVL----QQLQPTVHKGENVLKHSRLAEVLQLGSDILPQYKQETPKTPPHIILHYCLFKTTWDWVILILTFYTAIMVPYNVSFKTKQ-NNVTWLVVDSIVDVIFLVDIVLNFHTTFVGPAGEVISDPKLIRMNYLKTWFVIDLLSCLPYDVINAFE-NVDEGISSLFSSLKVVRLLRLGRVARKLDHYIEYGAAVLVLLVCVFGLAAHWLACIWYSIGDYEVIDEETNLVRTDSWLYILAETVGRPYRFNTTGSGKWEGGPNKDSV---YITSLYFTMTSLTSIGFGNIAPTTDGEKIFAVAMMMIG 458          
BLAST of Voltage gated potassium channel vs. Ensembl Medaka
Match: ENSORLT00000001433.2 (potassium voltage-gated channel subfamily H member 1 [Source:NCBI gene;Acc:101170816])

HSP 1 Score: 400.208 bits (1027), Expect = 3.350e-129
Identity = 236/468 (50.43%), Postives = 316/468 (67.52%), Query Frame = 1
Query:  103 MSGSRRGLVAPQNTLLDTIIRRCNSQHSSFILANAKIVDHPIIYVNEAFSKLTGFARNEVMQKSSQCTFLHGEETNKDLLDQWFSALNNYEQIQLELLVFKKNLSPLWIVLQIHPITNEKLEVXXXXXTFYDITAIKHPSDDEAEIKPGLSKFAKLAKSVARNRSIMIDLTQDFQENNKESSKVETSPINNIFMHSKNIPQYKHETPKTPPHIILHYSQFKVIWDWVILLLTYYTAVMVPFNAAFSNKSMDAVLFLIVDSIVDVIFFLDIVLNFHTTFVGSTGEVISDAFIIRINYLKGWFIIDLMSCLPYDVFNAFQPGSQEGISQXXXXXXXXXXXXXXXXXXXXDQYLEYMATXXXXXXXXXXXXAHWFACIWYTVGNTDLRNN-----KQYGWIPKMLQDCHQ-----TVANWTTFDPNKEHKLLNYATSLYFTMSLLTSIGFGNVSANTELEKFACVIFMLFG 1476
            M+G RRGLVAPQNT L+ I+RR N   ++F+L NA+IVD PI+Y N+ F KL+G+ R EVMQKSS C+F++GE T+K+  ++      NYE    E+L++KKN  P+W  ++I PI NE+ +V+L L TF DITA K P +DE+    G  KFA+L +++  +R ++  L     +   ES    +     + + S  +PQYK ETPKTPPHIILHY  FK  WDWVIL+LT+YTA+MVP+N +F  K  + V +L+VDSIVDVIF +DIVLNFHTTFVG  GEVISD  +IR+NY+K WF+IDL+SCLPYDV NAF+    EGIS L  +LKVVRLLRLGRV RKLD Y+EY A +LVL++ VF L AHW ACIWY++G+ ++ +      +   W+  + +   +     +   W    P+K+     Y TSLYFTM+ LTSIGFGN++ NT+ EK   V  M+ G
Sbjct:    4 MAGGRRGLVAPQNTFLENIVRRSND--TNFVLGNAQIVDWPIVYSNDGFCKLSGYHRAEVMQKSSTCSFMYGELTDKETTEKVRLTFENYEMNSFEVLMYKKNRMPVWFFVKIAPIRNEQDKVVLFLCTFSDITAFKQPIEDESS--KGWGKFARLTRALTSSRGVLQQLAPAVHKG--ESIHKHSRLAEVLQLGSDILPQYKQETPKTPPHIILHYCLFKTTWDWVILILTFYTAIMVPYNVSFKTKQ-NNVTWLVVDSIVDVIFLVDIVLNFHTTFVGPAGEVISDPKLIRMNYVKTWFVIDLLSCLPYDVINAFE-NVDEGISSLFSSLKVVRLLRLGRVARKLDHYIEYGAAVLVLLVCVFGLAAHWLACIWYSIGDYEVIDEETNSVRMDSWLYLLGETVGRPYRLNSSGRWEG-GPSKDSV---YITSLYFTMTSLTSIGFGNIAPNTDGEKIFAVAMMMIG 459          
BLAST of Voltage gated potassium channel vs. Ensembl Medaka
Match: ENSORLT00000036780.1 (potassium voltage-gated channel subfamily H member 1 [Source:NCBI gene;Acc:101170816])

HSP 1 Score: 399.823 bits (1026), Expect = 3.632e-129
Identity = 236/468 (50.43%), Postives = 316/468 (67.52%), Query Frame = 1
Query:  103 MSGSRRGLVAPQNTLLDTIIRRCNSQHSSFILANAKIVDHPIIYVNEAFSKLTGFARNEVMQKSSQCTFLHGEETNKDLLDQWFSALNNYEQIQLELLVFKKNLSPLWIVLQIHPITNEKLEVXXXXXTFYDITAIKHPSDDEAEIKPGLSKFAKLAKSVARNRSIMIDLTQDFQENNKESSKVETSPINNIFMHSKNIPQYKHETPKTPPHIILHYSQFKVIWDWVILLLTYYTAVMVPFNAAFSNKSMDAVLFLIVDSIVDVIFFLDIVLNFHTTFVGSTGEVISDAFIIRINYLKGWFIIDLMSCLPYDVFNAFQPGSQEGISQXXXXXXXXXXXXXXXXXXXXDQYLEYMATXXXXXXXXXXXXAHWFACIWYTVGNTDLRNN-----KQYGWIPKMLQDCHQ-----TVANWTTFDPNKEHKLLNYATSLYFTMSLLTSIGFGNVSANTELEKFACVIFMLFG 1476
            M+G RRGLVAPQNT L+ I+RR N   ++F+L NA+IVD PI+Y N+ F KL+G+ R EVMQKSS C+F++GE T+K+  ++      NYE    E+L++KKN  P+W  ++I PI NE+ +V+L L TF DITA K P +DE+    G  KFA+L +++  +R ++  L     +   ES    +     + + S  +PQYK ETPKTPPHIILHY  FK  WDWVIL+LT+YTA+MVP+N +F  K  + V +L+VDSIVDVIF +DIVLNFHTTFVG  GEVISD  +IR+NY+K WF+IDL+SCLPYDV NAF+    EGIS L  +LKVVRLLRLGRV RKLD Y+EY A +LVL++ VF L AHW ACIWY++G+ ++ +      +   W+  + +   +     +   W    P+K+     Y TSLYFTM+ LTSIGFGN++ NT+ EK   V  M+ G
Sbjct:    1 MAGGRRGLVAPQNTFLENIVRRSND--TNFVLGNAQIVDWPIVYSNDGFCKLSGYHRAEVMQKSSTCSFMYGELTDKETTEKVRLTFENYEMNSFEVLMYKKNRMPVWFFVKIAPIRNEQDKVVLFLCTFSDITAFKQPIEDESS--KGWGKFARLTRALTSSRGVLQQLAPAVHKG--ESIHKHSRLAEVLQLGSDILPQYKQETPKTPPHIILHYCLFKTTWDWVILILTFYTAIMVPYNVSFKTKQ-NNVTWLVVDSIVDVIFLVDIVLNFHTTFVGPAGEVISDPKLIRMNYVKTWFVIDLLSCLPYDVINAFE-NVDEGISSLFSSLKVVRLLRLGRVARKLDHYIEYGAAVLVLLVCVFGLAAHWLACIWYSIGDYEVIDEETNSVRMDSWLYLLGETVGRPYRLNSSGRWEG-GPSKDSV---YITSLYFTMTSLTSIGFGNIAPNTDGEKIFAVAMMMIG 456          
BLAST of Voltage gated potassium channel vs. Ensembl Medaka
Match: kcnh1a (potassium voltage-gated channel subfamily H member 1-like [Source:NCBI gene;Acc:101155792])

HSP 1 Score: 395.586 bits (1015), Expect = 2.777e-127
Identity = 238/479 (49.69%), Postives = 320/479 (66.81%), Query Frame = 1
Query:  103 MSGSRRGLVAPQNTLLDTIIRRCNSQHSSFILANAKIVDHPIIYVNEAFSKLTGFARNEVMQKSSQCTFLHGEETNKDLLDQWFSALNNYEQIQLELLVFKKNLSPLWIVLQIHPITNEKLEVXXXXXTFYDITAIKHPSDDEAEIKPGLSKFAKLAKSVARNRSIMIDLTQDFQEN-NKESSKVETSPINNIFMHSKNI-PQYKHETPKTPPHIILHYSQFKVIWDWVILLLTYYTAVMVPFNAAFSNKSMDAVLFLIVDSIVDVIFFLDIVLNFHTTFVGSTGEVISDAFIIRINYLKGWFIIDLMSCLPYDVFNAFQPGSQ--------EGISQXXXXXXXXXXXXXXXXXXXXDQYLEYMATXXXXXXXXXXXXAHWFACIWYTVGNTDLRNN-----KQYGWIPKMLQDCHQTVANWTTFD------PNKEHKLLNYATSLYFTMSLLTSIGFGNVSANTELEKFACVIFMLFG 1476
            M+G RRGLVAPQNT L+ I+RR N   ++F+L NA+IVD PI+Y N+ F KL+G+ R EVMQKSS C+F++GE T+KD  ++      NYE    E+L++KKN +P+W  ++I PI NE+ +V+L L TF DITA K P +D++    G  KFA+L +++  +R ++    Q  Q   +K  + ++ S +  +     +I PQYK ETPKTPPHIILHY  FK  WDWVIL+LT+YTA+MVP+N +F  K  + V +L+VDSIVDVIF +DIVLNFHTTFVG  GEVISD  +IR+NYLK WF+IDL+SCLPYDV NAF+   +        +GIS L  +LKVVRLLRLGRV RKLD Y+EY A +LVL++ VF L AHW ACIWY++G+ ++ +      +   W+  + +   +     TT        PNK+     Y TSLYFTM+ LTSIGFGN++  T+ EK   V  M+ G
Sbjct:    1 MAGGRRGLVAPQNTFLENIVRRSND--TNFVLGNAQIVDWPIVYSNDGFCKLSGYHRAEVMQKSSTCSFMYGELTDKDTTEKVRLTFENYEMNSFEILMYKKNRTPVWFFVKIAPIRNEQEKVVLFLCTFSDITAFKQPIEDDSS--KGWGKFARLTRALTSSRGVL----QQLQPTVHKGENVLKHSRLAEVLQLGSDILPQYKQETPKTPPHIILHYCLFKTTWDWVILILTFYTAIMVPYNVSFKTKQ-NNVTWLVVDSIVDVIFLVDIVLNFHTTFVGPAGEVISDPKLIRMNYLKTWFVIDLLSCLPYDVINAFENVDENWNHHAVTQGISSLFSSLKVVRLLRLGRVARKLDHYIEYGAAVLVLLVCVFGLAAHWLACIWYSIGDYEVIDEETNLVRTDSWLYILAETVGRPYRFNTTGSGKWEGGPNKDSV---YITSLYFTMTSLTSIGFGNIAPTTDGEKIFAVAMMMIG 467          
BLAST of Voltage gated potassium channel vs. Ensembl Medaka
Match: kcnh5b (potassium voltage-gated channel subfamily H member 5 [Source:NCBI gene;Acc:101172862])

HSP 1 Score: 392.119 bits (1006), Expect = 1.721e-125
Identity = 232/471 (49.26%), Postives = 313/471 (66.45%), Query Frame = 1
Query:  103 MSGSRRGLVAPQNTLLDTIIRRCNSQHSSFILANAKIVDHPIIYVNEAFSKLTGFARNEVMQKSSQCTFLHGEETNKDLLDQWFSALNNYEQIQLELLVFKKNLSPLWIVLQIHPITNEKLEVXXXXXTFYDITAIKHPSDDEAEIKPGLSKFAKLAKSVARNRSIMIDLTQDFQENNKESSKVETSPINNIF-MHSKNIPQYKHETPKTPPHIILHYSQFKVIWDWVILLLTYYTAVMVPFNAAFSNKSMDAVLFLIVDSIVDVIFFLDIVLNFHTTFVGSTGEVISDAFIIRINYLKGWFIIDLMSCLPYDVFNAFQPGSQEGISQXXXXXXXXXXXXXXXXXXXXDQYLEYMATXXXXXXXXXXXXAHWFACIWYTVGNTDLRNN-----KQYGWIPKMLQDCH-------QTVANWTTFDPNKEHKLLNYATSLYFTMSLLTSIGFGNVSANTELEKFACVIFMLFG 1476
            M G +RGLVAPQNT L+ I+RR  S  +SF+L NA+IV+ P++Y N+ F KL+GF R EVMQKSS C+F++GE T+K  +D+     +NYE    E+L+++KN SP+W  +Q+ PI NE  +V+L L TF DIT  K P +DE+    G +KFA+L +++  NR+ +    Q      K     + S +  +  ++S  +PQYK E PKTPPHIILHY  FK  WDWVIL+LT+YTA+MVP+N +F  K  + + +L++DS+VDVIF +DIVLNFHTTFVG  GEVISD  +IR+NYLK WF+IDL+SCLPYD+ NAF+    EGIS L  +LKVVRLLRLGRV RKLD YLEY A +LVL++ VF L+AHW ACIWY++G+ ++ +      K   W+ ++                 W    P K+     Y TSLYFTM+ LT+IGFGN++  T+ EK   V  M+ G
Sbjct:    1 MPGGKRGLVAPQNTFLENIVRR--SSETSFLLGNAQIVEWPVVYSNDGFCKLSGFHRAEVMQKSSTCSFMYGELTDKKTIDKVRQTFDNYESNCFEVLLYRKNRSPVWFYMQVAPIRNENDKVVLFLCTFKDITLFKQPIEDES--TKGWTKFARLTRALTTNRNTL----QQLAPMGKHEVSHKPSRLAEVLQLNSDILPQYKQEAPKTPPHIILHYCTFKTTWDWVILILTFYTAIMVPYNVSFKTKQ-NNIAWLVLDSVVDVIFLVDIVLNFHTTFVGPCGEVISDPKLIRMNYLKTWFVIDLLSCLPYDIINAFE-NVDEGISSLFSSLKVVRLLRLGRVARKLDHYLEYGAAVLVLLVCVFGLVAHWLACIWYSIGDYEVIDEVTNTIKMDSWLYQLAISIGSPYRYNVSGSGRWEG-GPGKDSL---YITSLYFTMTSLTTIGFGNIAPTTDGEKIFSVAMMMVG 457          
BLAST of Voltage gated potassium channel vs. Planmine SMEST
Match: SMESG000017777.1 (SMESG000017777.1)

HSP 1 Score: 871.307 bits (2250), Expect = 0.000e+0
Identity = 458/459 (99.78%), Postives = 458/459 (99.78%), Query Frame = 1
Query:  103 MSGSRRGLVAPQNTLLDTIIRRCNSQHSSFILANAKIVDHPIIYVNEAFSKLTGFARNEVMQKSSQCTFLHGEETNKDLLDQWFSALNNYEQIQLELLVFKKNLSPLWIVLQIHPITNEKLEVXXXXXTFYDITAIKHPSDDEAEIKPGLSKFAKLAKSVARNRSIMIDLTQDFQENNKESSKVETSPINNIFMHSKNIPQYKHETPKTPPHIILHYSQFKVIWDWVILLLTYYTAVMVPFNAAFSNKSMDAVLFLIVDSIVDVIFFLDIVLNFHTTFVGSTGEVISDAFIIRINYLKGWFIIDLMSCLPYDVFNAFQPGSQEGISQXXXXXXXXXXXXXXXXXXXXDQYLEYMATXXXXXXXXXXXXAHWFACIWYTVGNTDLRNNKQYGWIPKMLQDCHQTVANWTTFDPNKEHKLLNYATSLYFTMSLLTSIGFGNVSANTELEKFACVIFMLFGG 1479
            MSGSRRGLVAPQNTLLDTIIRRCNSQHSSFILANAKIVDHPIIYVNEAFSKLTGFARNEVMQKSSQCTFLHGEETNKDLLDQWFSALNNYEQIQLELLVFKKNLSPLWIVLQIHPITNEKLEVLLLLLTFYDITAIKHPSDDEAEIKPGLSKFAKLAKSVARNRSIMIDLTQDFQENNKESSKVETSPINNIFMHSKNIPQYKHETPKTPPHIILHYSQFKVIWDWVILLLTYYTAVMVPFNAAFSNKSMDAVLFLIVDSIVDVIFFLDIVLNFHTTFVGSTGEVISDAFIIRINYLKGWFIIDLMSCLPYDVFNAFQPGSQEGISQLLGALKVVRLLRLGRVLRKLDQYLEYMATMLVLMIFVFLLLAHWFACIWYTVGNTDLRNNKQYGWIPKMLQDCHQTVANWTTFDPNKEHKLLNYATSLYFTMSLLTSIGFGNVSANTELEKFACVIFMLFG 
Sbjct:    1 MSGSRRGLVAPQNTLLDTIIRRCNSQHSSFILANAKIVDHPIIYVNEAFSKLTGFARNEVMQKSSQCTFLHGEETNKDLLDQWFSALNNYEQIQLELLVFKKNLSPLWIVLQIHPITNEKLEVLLLLLTFYDITAIKHPSDDEAEIKPGLSKFAKLAKSVARNRSIMIDLTQDFQENNKESSKVETSPINNIFMHSKNIPQYKHETPKTPPHIILHYSQFKVIWDWVILLLTYYTAVMVPFNAAFSNKSMDAVLFLIVDSIVDVIFFLDIVLNFHTTFVGSTGEVISDAFIIRINYLKGWFIIDLMSCLPYDVFNAFQPGSQEGISQLLGALKVVRLLRLGRVLRKLDQYLEYMATMLVLMIFVFLLLAHWFACIWYTVGNTDLRNNKQYGWIPKMLQDCHQTVANWTTFDPNKEHKLLNYATSLYFTMSLLTSIGFGNVSANTELEKFACVIFMLFGA 459          
BLAST of Voltage gated potassium channel vs. Planmine SMEST
Match: SMESG000035416.1 (SMESG000035416.1)

HSP 1 Score: 470.315 bits (1209), Expect = 1.007e-154
Identity = 265/495 (53.54%), Postives = 351/495 (70.91%), Query Frame = 1
Query:   97 ISMSGSRRGLVAPQNTLLDTIIRRCNSQHSSFILANAKIVDHPIIYVNEAFSKLTGFARNEVMQKSSQCTFLHGEETNKDLLDQWFSALNNYEQIQLELLVFKKNLSPLWIVLQIHPITNEKLEVXXXXXTFYDITAIKHPSDDEAEIKPGLSKFAKLAKSVARNRSIMIDLT--------------------QDFQENNKESSKVETSPINNIFMHSKNIPQYKHETPKTPPHIILHYSQFKVIWDWVILLLTYYTAVMVPFNAAFSNKSMDAVLFLIVDSIVDVIFFLDIVLNFHTTFVGSTGEVISDAFIIRINYLKGWFIIDLMSCLPYDVFNAFQP-GSQEGISQXXXXXXXXXXXXXXXXXXXXDQYLEYMATXXXXXXXXXXXXAHWFACIWYTVGNTDLRNNKQYGWIPKMLQDC--HQTVANWTTFDPNKEHKLLNYATSLYFTMSLLTSIGFGNVSANTELEKFACVIFMLFGGW*GFLIFYYKV 1512
            +SM G+RRGLVAPQNT LD IIRRCNSQHS+F LAN+ I ++PIIY +E F K++G+++ EV+ + + C F+HG+ T  ++ D++ +A       Q+E+L +KKN + LW++ Q+ PI NEK E+ L L+TF +ITA+K  ++DE   K   SKFA+LA++V +NRS++  ++                     D+ + + ES   +T       M S+ +P Y+ E PKTPPHIILHY  FK +WDW+IL+LT YTAVMVP+NAAF +++MD ++FL+VDSIVDV+FF+DIV NFHTTFVG  GEVISD  +IRINYLKGWF+IDL+SCLPYDVFNAFQP  +Q  IS L  ALKVVRLLR+GRV RKLDQYLEYMA  L+LMIF F+LLAHW ACIW+++G+ DL+N   YGWIP++  D   ++   N T    N   K L Y TSLY+T+SL+TSIGFGNVSANT  EK   V+FML G + G+   + K+
Sbjct:    4 LSMYGNRRGLVAPQNTFLDKIIRRCNSQHSNFFLANSNIYNYPIIYSSEGFCKMSGYSKTEVIHQQATCNFMHGDGTTNEMKDRFKAAFEMLHYEQIEVLFYKKNKNELWLMFQVSPIRNEKDEINLFLVTFKNITALKTSTNDEDSSKDS-SKFARLARTVTKNRSLLQHMSTSSTSLSKVGIGVAVDAKSVSDYIKYDVESCGTQTKE-----MISEKLPFYRQEAPKTPPHIILHYLNFKAVWDWIILILTGYTAVMVPYNAAFKSRNMDDIVFLVVDSIVDVVFFIDIVFNFHTTFVGPNGEVISDPNVIRINYLKGWFVIDLLSCLPYDVFNAFQPETTQSAISSLFSALKVVRLLRIGRVTRKLDQYLEYMAVSLILMIFGFVLLAHWLACIWFSIGHADLQNKVFYGWIPRLSNDTMHYRNWKNITNIQDNLPPKSLVYITSLYYTLSLITSIGFGNVSANTFGEKLVSVVFMLIGAF-GYATIFGKI 491          
BLAST of Voltage gated potassium channel vs. Planmine SMEST
Match: SMESG000035416.1 (SMESG000035416.1)

HSP 1 Score: 468.003 bits (1203), Expect = 8.309e-154
Identity = 264/493 (53.55%), Postives = 349/493 (70.79%), Query Frame = 1
Query:  103 MSGSRRGLVAPQNTLLDTIIRRCNSQHSSFILANAKIVDHPIIYVNEAFSKLTGFARNEVMQKSSQCTFLHGEETNKDLLDQWFSALNNYEQIQLELLVFKKNLSPLWIVLQIHPITNEKLEVXXXXXTFYDITAIKHPSDDEAEIKPGLSKFAKLAKSVARNRSIMIDLT--------------------QDFQENNKESSKVETSPINNIFMHSKNIPQYKHETPKTPPHIILHYSQFKVIWDWVILLLTYYTAVMVPFNAAFSNKSMDAVLFLIVDSIVDVIFFLDIVLNFHTTFVGSTGEVISDAFIIRINYLKGWFIIDLMSCLPYDVFNAFQP-GSQEGISQXXXXXXXXXXXXXXXXXXXXDQYLEYMATXXXXXXXXXXXXAHWFACIWYTVGNTDLRNNKQYGWIPKMLQDC--HQTVANWTTFDPNKEHKLLNYATSLYFTMSLLTSIGFGNVSANTELEKFACVIFMLFGGW*GFLIFYYKV 1512
            M G+RRGLVAPQNT LD IIRRCNSQHS+F LAN+ I ++PIIY +E F K++G+++ EV+ + + C F+HG+ T  ++ D++ +A       Q+E+L +KKN + LW++ Q+ PI NEK E+ L L+TF +ITA+K  ++DE   K   SKFA+LA++V +NRS++  ++                     D+ + + ES   +T       M S+ +P Y+ E PKTPPHIILHY  FK +WDW+IL+LT YTAVMVP+NAAF +++MD ++FL+VDSIVDV+FF+DIV NFHTTFVG  GEVISD  +IRINYLKGWF+IDL+SCLPYDVFNAFQP  +Q  IS L  ALKVVRLLR+GRV RKLDQYLEYMA  L+LMIF F+LLAHW ACIW+++G+ DL+N   YGWIP++  D   ++   N T    N   K L Y TSLY+T+SL+TSIGFGNVSANT  EK   V+FML G + G+   + K+
Sbjct:    1 MYGNRRGLVAPQNTFLDKIIRRCNSQHSNFFLANSNIYNYPIIYSSEGFCKMSGYSKTEVIHQQATCNFMHGDGTTNEMKDRFKAAFEMLHYEQIEVLFYKKNKNELWLMFQVSPIRNEKDEINLFLVTFKNITALKTSTNDEDSSKDS-SKFARLARTVTKNRSLLQHMSTSSTSLSKVGIGVAVDAKSVSDYIKYDVESCGTQTKE-----MISEKLPFYRQEAPKTPPHIILHYLNFKAVWDWIILILTGYTAVMVPYNAAFKSRNMDDIVFLVVDSIVDVVFFIDIVFNFHTTFVGPNGEVISDPNVIRINYLKGWFVIDLLSCLPYDVFNAFQPETTQSAISSLFSALKVVRLLRIGRVTRKLDQYLEYMAVSLILMIFGFVLLAHWLACIWFSIGHADLQNKVFYGWIPRLSNDTMHYRNWKNITNIQDNLPPKSLVYITSLYYTLSLITSIGFGNVSANTFGEKLVSVVFMLIGAF-GYATIFGKI 486          
BLAST of Voltage gated potassium channel vs. Planmine SMEST
Match: SMESG000035416.1 (SMESG000035416.1)

HSP 1 Score: 467.618 bits (1202), Expect = 8.898e-154
Identity = 264/493 (53.55%), Postives = 349/493 (70.79%), Query Frame = 1
Query:  103 MSGSRRGLVAPQNTLLDTIIRRCNSQHSSFILANAKIVDHPIIYVNEAFSKLTGFARNEVMQKSSQCTFLHGEETNKDLLDQWFSALNNYEQIQLELLVFKKNLSPLWIVLQIHPITNEKLEVXXXXXTFYDITAIKHPSDDEAEIKPGLSKFAKLAKSVARNRSIMIDLT--------------------QDFQENNKESSKVETSPINNIFMHSKNIPQYKHETPKTPPHIILHYSQFKVIWDWVILLLTYYTAVMVPFNAAFSNKSMDAVLFLIVDSIVDVIFFLDIVLNFHTTFVGSTGEVISDAFIIRINYLKGWFIIDLMSCLPYDVFNAFQP-GSQEGISQXXXXXXXXXXXXXXXXXXXXDQYLEYMATXXXXXXXXXXXXAHWFACIWYTVGNTDLRNNKQYGWIPKMLQDC--HQTVANWTTFDPNKEHKLLNYATSLYFTMSLLTSIGFGNVSANTELEKFACVIFMLFGGW*GFLIFYYKV 1512
            M G+RRGLVAPQNT LD IIRRCNSQHS+F LAN+ I ++PIIY +E F K++G+++ EV+ + + C F+HG+ T  ++ D++ +A       Q+E+L +KKN + LW++ Q+ PI NEK E+ L L+TF +ITA+K  ++DE   K   SKFA+LA++V +NRS++  ++                     D+ + + ES   +T       M S+ +P Y+ E PKTPPHIILHY  FK +WDW+IL+LT YTAVMVP+NAAF +++MD ++FL+VDSIVDV+FF+DIV NFHTTFVG  GEVISD  +IRINYLKGWF+IDL+SCLPYDVFNAFQP  +Q  IS L  ALKVVRLLR+GRV RKLDQYLEYMA  L+LMIF F+LLAHW ACIW+++G+ DL+N   YGWIP++  D   ++   N T    N   K L Y TSLY+T+SL+TSIGFGNVSANT  EK   V+FML G + G+   + K+
Sbjct:    1 MYGNRRGLVAPQNTFLDKIIRRCNSQHSNFFLANSNIYNYPIIYSSEGFCKMSGYSKTEVIHQQATCNFMHGDGTTNEMKDRFKAAFEMLHYEQIEVLFYKKNKNELWLMFQVSPIRNEKDEINLFLVTFKNITALKTSTNDEDSSKDS-SKFARLARTVTKNRSLLQHMSTSSTSLSKVGIGVAVDAKSVSDYIKYDVESCGTQTKE-----MISEKLPFYRQEAPKTPPHIILHYLNFKAVWDWIILILTGYTAVMVPYNAAFKSRNMDDIVFLVVDSIVDVVFFIDIVFNFHTTFVGPNGEVISDPNVIRINYLKGWFVIDLLSCLPYDVFNAFQPETTQSAISSLFSALKVVRLLRIGRVTRKLDQYLEYMAVSLILMIFGFVLLAHWLACIWFSIGHADLQNKVFYGWIPRLSNDTMHYRNWKNITNIQDNLPPKSLVYITSLYYTLSLITSIGFGNVSANTFGEKLVSVVFMLIGAF-GYATIFGKI 486          
BLAST of Voltage gated potassium channel vs. Planmine SMEST
Match: SMESG000021280.1 (SMESG000021280.1)

HSP 1 Score: 381.719 bits (979), Expect = 1.870e-122
Identity = 240/479 (50.10%), Postives = 326/479 (68.06%), Query Frame = 1
Query:  103 MSGSRRGLVAPQNTLLDTIIRRCNSQHSSFILANAKIVDHPIIYVNEAFSKLTGFARNEVMQKSSQCTFLHGEETNKDLLDQWFSALNNYEQIQLELLVFKKNLSPLWIVLQIHPITNEKLEVXXXXXTFYDITAIKHPSDDEAEIKPGLSKFAKLAKSVARNRSIMIDLTQDFQ-ENNKESSKVETSPINNIFMHS------------KNIPQYKHETPKTPPHIILHYSQFKVIWDWVILLLTYYTAVMVPFNAAFSNKSMDAVLFLIVDSIVDVIFFLDIVLNFHTTFVGSTGEVISDAFIIRINYLKGWFIIDLMSCLPYDVFNAFQPGSQEGISQXXXXXXXXXXXXXXXXXXXXDQYLEYMATXXXXXXXXXXXXAHWFACIWYTVGNTDLRNNKQYGWIPKMLQDCHQTVANWTTFDP-------NKEHKLLNYATSLYFTMSLLTSIGFGNVSANTELEKFACVIFMLFGG 1479
            MSGSRRGLVAPQNT LD IIRRCN+QH SF+LA+AKI+D+P++Y NE F+KLTG+ R E+MQK   CTF+ GE TNK+ +     A+   E  Q+EL+++KKN + L +++++ PI N+K  V L LLTF D++A K P+++E   +  +SKF KLAKSV RN+ I   +++++  EN  +S +  T  +++ FM +            +++P YK ETPKTPPHIILHYS FK +WDW+IL+L  Y A++VP    +   + +   F+IVDSI+D+IFF+DIVLNFHTTFVG  GEV+SD  IIRINY KGWFI+D++SCLPYD+    Q  S    S +   +KV RLLRL R+LR+++ YLEY+ ++L LMIF FL+LAHW ACIWY VG +DL+N   YGWIP+M      T       DP            L+ Y TSLY+T+SL+T+IGFGNVSA+T+ E+   +  ML G 
Sbjct:    1 MSGSRRGLVAPQNTFLDNIIRRCNAQHCSFLLASAKILDYPVVYCNEGFNKLTGYNRVEIMQKGGLCTFMQGENTNKEFVALLEKAMEKGETEQVELILYKKNRTQLSLLVRMSPIYNDKKCVTLFLLTFRDVSAFKMPTEEEQIYQENVSKFVKLAKSVTRNKQI---ISENYPIENGPKSDQNHTISMDD-FMKNEFPKFEEIDNLMEDLPLYKQETPKTPPHIILHYSPFKTMWDWMILVLVGYNAIVVPLYLTYLFTTSELTKFIIVDSIIDIIFFIDIVLNFHTTFVGPNGEVVSDPVIIRINYFKGWFIVDVLSCLPYDLLTTGQ-SSSNQNSSVFKDIKVARLLRLFRILRRMEMYLEYVVSVLALMIFAFLILAHWLACIWYKVGISDLQNGILYGWIPRMFNSSLIT----RNLDPAFISEAVTTNDTLMVYLTSLYYTISLVTTIGFGNVSASTQNEQIMTIFCMLIGA 470          
The following BLAST results are available for this feature:
BLAST of Voltage gated potassium channel vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNH58.796e-13149.79potassium voltage-gated channel subfamily H member... [more]
KCNH12.677e-13049.15potassium voltage-gated channel subfamily H member... [more]
KCNH19.611e-13049.47potassium voltage-gated channel subfamily H member... [more]
KCNH19.611e-13049.47potassium voltage-gated channel subfamily H member... [more]
KCNH19.611e-13049.47potassium voltage-gated channel subfamily H member... [more]
back to top
BLAST of Voltage gated potassium channel vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
egl-27.080e-11545.44pep chromosome:WBcel235:V:1288841:1299208:-1 gene:... [more]
egl-23.100e-11445.40pep chromosome:WBcel235:V:1288841:1299208:-1 gene:... [more]
egl-23.100e-11445.40pep chromosome:WBcel235:V:1289373:1299332:-1 gene:... [more]
unc-1036.367e-4844.00Potassium voltage-gated channel unc-103 [Source:U... [more]
unc-1031.027e-4744.00Potassium voltage-gated channel unc-103 [Source:U... [more]
back to top
BLAST of Voltage gated potassium channel vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eag1.091e-15054.58gene:FBgn0000535 transcript:FBtr0310014[more]
eag7.769e-14954.26gene:FBgn0000535 transcript:FBtr0303285[more]
eag7.819e-14853.46gene:FBgn0000535 transcript:FBtr0310015[more]
eag8.586e-14254.35gene:FBgn0000535 transcript:FBtr0310016[more]
eag2.061e-13952.67gene:FBgn0000535 transcript:FBtr0303286[more]
back to top
BLAST of Voltage gated potassium channel vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnh1a1.724e-12951.81potassium voltage-gated channel, subfamily H (eag-... [more]
kcnh5b3.486e-12949.57potassium voltage-gated channel, subfamily H (eag-... [more]
kcnh1b8.901e-12849.89potassium voltage-gated channel, subfamily H (eag-... [more]
kcnh5b3.510e-12649.89potassium voltage-gated channel, subfamily H (eag-... [more]
kcnh5b5.770e-12649.89potassium voltage-gated channel, subfamily H (eag-... [more]
back to top
BLAST of Voltage gated potassium channel vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tmem50b1.546e-12448.93transmembrane protein 50B [Source:Xenbase;Acc:XB-G... [more]
ENSXETT00000000694.14.434e-12447.63potassium voltage-gated channel subfamily H member... [more]
tmem50b1.059e-12348.50transmembrane protein 50B [Source:Xenbase;Acc:XB-G... [more]
tmem50b1.601e-12348.50transmembrane protein 50B [Source:Xenbase;Acc:XB-G... [more]
tmem50b2.240e-12348.50transmembrane protein 50B [Source:Xenbase;Acc:XB-G... [more]
back to top
BLAST of Voltage gated potassium channel vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kcnh19.877e-13049.15potassium voltage-gated channel, subfamily H (eag-... [more]
Kcnh54.483e-12749.79potassium voltage-gated channel, subfamily H (eag-... [more]
Kcnh14.852e-12647.18potassium voltage-gated channel, subfamily H (eag-... [more]
Kcnh87.059e-8641.23potassium voltage-gated channel, subfamily H (eag-... [more]
Kcnh43.230e-7837.66potassium voltage-gated channel, subfamily H (eag-... [more]
back to top
BLAST of Voltage gated potassium channel vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q02280|KCNAE_DROME7.130e-13752.46Potassium voltage-gated channel protein eag OS=Dro... [more]
sp|Q63472|KCNH1_RAT9.703e-12949.57Potassium voltage-gated channel subfamily H member... [more]
sp|Q920E3|KCNH5_MOUSE3.136e-12649.79Potassium voltage-gated channel subfamily H member... [more]
sp|Q9EPI9|KCNH5_RAT4.263e-12649.79Potassium voltage-gated channel subfamily H member... [more]
sp|Q8NCM2|KCNH5_HUMAN1.141e-12549.79Potassium voltage-gated channel subfamily H member... [more]
back to top
BLAST of Voltage gated potassium channel vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8JDJ19.215e-16658.47Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267DWF63.989e-16459.01Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A4S2M2L17.829e-16255.32Uncharacterized protein OS=Opisthorchis felineus O... [more]
R7V2W74.373e-15556.53Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A1S3JY711.892e-14854.33potassium voltage-gated channel subfamily H member... [more]
back to top
BLAST of Voltage gated potassium channel vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnh5b3.775e-12649.68potassium voltage-gated channel subfamily H member... [more]
kcnh5b5.873e-12649.68potassium voltage-gated channel subfamily H member... [more]
kcnh5a2.204e-12549.14potassium voltage-gated channel subfamily H member... [more]
kcnh1b2.015e-12049.02potassium voltage-gated channel, subfamily H (eag-... [more]
kcnh5a6.231e-11946.37potassium voltage-gated channel subfamily H member... [more]
back to top
BLAST of Voltage gated potassium channel vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnh1b1.732e-11546.32potassium voltage-gated channel, subfamily H (eag-... [more]
kcnh5b5.878e-8944.16potassium voltage-gated channel, subfamily H (eag-... [more]
kcnh5b2.536e-8843.59potassium voltage-gated channel, subfamily H (eag-... [more]
kcnh82.566e-5537.67potassium voltage-gated channel, subfamily H (eag-... [more]
ENSPMAT00000005922.18.032e-4738.66pep scaffold:Pmarinus_7.0:GL476456:333240:381928:-... [more]
back to top
BLAST of Voltage gated potassium channel vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Voltage gated potassium channel vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO367806.551e-10944.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458882.042e-8437.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO301401.323e-7335.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO471233.458e-4543.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO417182.461e-4039.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Voltage gated potassium channel vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnh1a1.695e-12950.74potassium voltage-gated channel subfamily H member... [more]
ENSORLT00000001433.23.350e-12950.43potassium voltage-gated channel subfamily H member... [more]
ENSORLT00000036780.13.632e-12950.43potassium voltage-gated channel subfamily H member... [more]
kcnh1a2.777e-12749.69potassium voltage-gated channel subfamily H member... [more]
kcnh5b1.721e-12549.26potassium voltage-gated channel subfamily H member... [more]
back to top
BLAST of Voltage gated potassium channel vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000017777.10.000e+099.78SMESG000017777.1[more]
SMESG000035416.11.007e-15453.54SMESG000035416.1[more]
SMESG000035416.18.309e-15453.55SMESG000035416.1[more]
SMESG000035416.18.898e-15453.55SMESG000035416.1[more]
SMESG000021280.11.870e-12250.10SMESG000021280.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019065 ID=SMED30019065|Name=Voltage gated potassium channel|organism=Schmidtea mediterranea sexual|type=transcript|length=1554bp
CCGATCTTTTTATTTGCCATGAAAGGAATAAATTTCGTCCTGTGAATATT
CAGTTTTCAAATTCGTTTTGTGTAATTTTCACGGTTTTGGAACTATATTT
CTATGTCGGGTTCCAGAAGAGGTTTAGTGGCCCCTCAAAATACTTTATTA
GATACGATTATTCGTCGATGCAACAGTCAACATAGTAGTTTCATACTTGC
GAATGCCAAAATAGTTGACCATCCAATTATTTATGTTAATGAAGCCTTCT
CCAAACTAACAGGATTCGCTCGAAATGAGGTAATGCAAAAGAGCAGCCAA
TGTACATTTCTCCATGGAGAAGAAACCAATAAGGATTTGCTTGATCAATG
GTTTTCCGCACTAAATAATTACGAACAGATACAACTAGAACTGTTGGTAT
TTAAAAAAAATTTGTCACCTTTATGGATTGTTTTACAAATTCACCCCATA
ACAAATGAAAAATTAGAAGTTTTGTTATTACTATTGACGTTCTATGATAT
AACAGCAATCAAACATCCATCCGATGACGAAGCTGAAATCAAGCCAGGGC
TCAGTAAATTCGCTAAATTAGCTAAATCAGTTGCTAGAAATCGTTCAATA
ATGATTGACTTGACTCAGGATTTCCAAGAAAACAATAAAGAAAGCTCAAA
AGTTGAAACTTCTCCGATTAATAATATATTTATGCATTCAAAAAATATTC
CACAATACAAACATGAAACTCCAAAAACTCCGCCTCACATCATTTTACAT
TATTCGCAATTCAAAGTGATTTGGGATTGGGTTATTTTACTGCTAACGTA
TTATACTGCTGTCATGGTGCCATTCAATGCTGCCTTCAGCAACAAGTCTA
TGGACGCCGTTCTATTTCTTATCGTTGACAGTATTGTAGATGTCATATTT
TTCCTCGACATTGTTTTAAATTTTCACACGACATTTGTTGGCTCAACTGG
AGAAGTTATTTCTGATGCATTTATTATCAGAATAAATTATCTAAAAGGAT
GGTTTATTATAGACCTTATGTCATGTCTTCCATATGATGTTTTTAATGCC
TTCCAACCTGGATCCCAAGAGGGAATCAGCCAACTTCTTGGAGCTTTGAA
GGTTGTTAGGTTACTCAGACTTGGTCGAGTTCTTCGCAAACTGGACCAAT
ACCTCGAATATATGGCTACAATGTTGGTACTTATGATTTTTGTTTTTTTA
CTATTAGCGCACTGGTTTGCATGTATTTGGTACACTGTTGGAAACACGGA
TTTGAGAAATAATAAACAGTACGGATGGATACCAAAAATGTTGCAGGACT
GCCATCAAACAGTTGCGAATTGGACTACATTTGACCCAAACAAAGAGCAT
AAGTTGTTGAATTATGCTACATCTCTTTATTTTACGATGTCTTTATTGAC
GAGTATTGGATTTGGAAATGTGTCGGCCAATACTGAATTGGAAAAATTTG
CTTGCGTCATTTTTATGTTATTTGGAGGTTGGTGAGGATTTTTAATTTTT
TATTACAAAGTTATAAAAAGTTCTTAATATAAAAACAAAATACAGTAAGA
CTAG
back to top

protein sequence of SMED30019065-orf-1

>SMED30019065-orf-1 ID=SMED30019065-orf-1|Name=SMED30019065-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=461bp
MSGSRRGLVAPQNTLLDTIIRRCNSQHSSFILANAKIVDHPIIYVNEAFS
KLTGFARNEVMQKSSQCTFLHGEETNKDLLDQWFSALNNYEQIQLELLVF
KKNLSPLWIVLQIHPITNEKLEVLLLLLTFYDITAIKHPSDDEAEIKPGL
SKFAKLAKSVARNRSIMIDLTQDFQENNKESSKVETSPINNIFMHSKNIP
QYKHETPKTPPHIILHYSQFKVIWDWVILLLTYYTAVMVPFNAAFSNKSM
DAVLFLIVDSIVDVIFFLDIVLNFHTTFVGSTGEVISDAFIIRINYLKGW
FIIDLMSCLPYDVFNAFQPGSQEGISQLLGALKVVRLLRLGRVLRKLDQY
LEYMATMLVLMIFVFLLLAHWFACIWYTVGNTDLRNNKQYGWIPKMLQDC
HQTVANWTTFDPNKEHKLLNYATSLYFTMSLLTSIGFGNVSANTELEKFA
CVIFMLFGGW*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005244voltage-gated ion channel activity
GO:0005267potassium channel activity
GO:0005249voltage-gated potassium channel activity
GO:0005216ion channel activity
GO:0000155phosphorelay sensor kinase activity
Vocabulary: biological process
TermDefinition
GO:0034765regulation of ion transmembrane transport
GO:0006813potassium ion transport
GO:0055085transmembrane transport
GO:0006811ion transport
GO:0000160phosphorelay signal transduction system
GO:0006810transport
GO:0023014signal transduction by protein phosphorylation
GO:0034220ion transmembrane transport
GO:0071805potassium ion transmembrane transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR027359Volt_channel_dom_sf
IPR030171EAG2
IPR035965PAS-like_dom_sf
IPR003938K_chnl_volt-dep_EAG/ELK/ERG
IPR003949K_chnl_volt-dep_EAG
IPR001610PAC
IPR000014PAS
IPR005821Ion_trans_dom
IPR000700PAS-assoc_C
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005622intracellular
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003938Potassium channel, voltage-dependent, EAG/ELK/ERGPRINTSPR01463EAGCHANLFMLYcoord: 270..279
score: 79.06
coord: 216..225
score: 63.75
coord: 259..269
score: 62.78
coord: 367..377
score: 79.83
coord: 447..458
score: 40.62
coord: 234..241
score: 64.45
coord: 421..438
score: 69.79
IPR003949Potassium channel, voltage-dependent, EAGPRINTSPR01464EAGCHANNELcoord: 193..210
score: 53.09
coord: 302..310
score: 80.25
coord: 129..140
score: 65.74
coord: 17..24
score: 51.39
coord: 152..164
score: 47.01
coord: 114..127
score: 50.0
coord: 324..333
score: 60.0
IPR001610PAC motifSMARTSM00086pac_2coord: 94..136
e-value: 0.004
score: 26.4
IPR005821Ion transport domainPFAMPF00520Ion_transcoord: 223..457
e-value: 8.7E-30
score: 103.7
IPR000014PAS domainPFAMPF13426PAS_9coord: 38..135
e-value: 4.8E-12
score: 46.1
IPR000014PAS domainTIGRFAMTIGR00229TIGR00229coord: 42..137
e-value: 6.6E-6
score: 24.3
IPR000014PAS domainPROSITEPS50112PAScoord: 42..74
score: 10.458
IPR000014PAS domainCDDcd00130PAScoord: 42..133
e-value: 3.56786E-8
score: 49.1687
NoneNo IPR availableGENE3DG3DSA:3.30.450.20coord: 3..145
e-value: 1.7E-34
score: 120.6
NoneNo IPR availablePANTHERPTHR10217VOLTAGE AND LIGAND GATED POTASSIUM CHANNELcoord: 2..458
NoneNo IPR availableSUPERFAMILYSSF81324Voltage-gated potassium channelscoord: 216..458
NoneNo IPR availableTMHMMTMhelixcoord: 418..440
NoneNo IPR availableTMHMMTMhelixcoord: 223..245
NoneNo IPR availableTMHMMTMhelixcoord: 358..380
NoneNo IPR availableTMHMMTMhelixcoord: 252..274
IPR027359Voltage-dependent channel domain superfamilyGENE3DG3DSA:1.20.120.350coord: 160..346
e-value: 2.7E-5
score: 25.6
IPR030171Potassium voltage-gated channel subfamily H member 5PANTHERPTHR10217:SF533POTASSIUM VOLTAGE-GATED CHANNEL SUBFAMILY H MEMBER 5coord: 2..458
IPR000700PAS-associated, C-terminalPROSITEPS50113PACcoord: 93..145
score: 9.737
IPR035965PAS domain superfamilySUPERFAMILYSSF55785PYP-like sensor domain (PAS domain)coord: 39..135